Radial spoke head 14-like protein

Overview
NameRadial spoke head 14-like protein
Smed IDSMED30009188
Length (bp)1180
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Radial spoke head 14-like protein (SMED30009188) t-SNE clustered cells

Violin plots show distribution of expression levels for Radial spoke head 14-like protein (SMED30009188) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Radial spoke head 14-like protein (SMED30009188) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Radial spoke head 14-like protein (SMED30009188) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30009188

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 13

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30009188h1SMcG0008317 SmedASXL_005396SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
Smed sexual biotypeSMED30009188h1SMcG0008317 Contig45549newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30009188h1SMcG0008317 Contig45549uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
pharynxSMED30009188h1SMcG0008317 dd_Smed_v4_1917_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30009188h1SMcG0008317 dd_Smed_v4_1917_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30009188h1SMcG0008317 dd_Smed_v4_1917_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30009188h1SMcG0008317 dd_Smed_v4_1917_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30009188h1SMcG0008317 dd_Smed_v4_1917_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30009188h1SMcG0008317 dd_Smed_v4_1917_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
cilated neuronSMED30009188h1SMcG0008317 dd_Smed_v4_1917_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30009188h1SMcG0008317 dd_Smed_v6_1917_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30009188h1SMcG0008317 dd_Smed_v4_1917_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ciliated epithelial cellSMED30009188h1SMcG0008317 dd_Smed_v4_1917_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Radial spoke head 14-like protein vs. Ensembl Human
Match: RSPH14 (radial spoke head 14 homolog [Source:HGNC Symbol;Acc:HGNC:13437])

HSP 1 Score: 177.563 bits (449), Expect = 1.332e-51
Identity = 129/348 (37.07%), Postives = 203/348 (58.33%), Query Frame = 3
Query:   90 MAGVQISFEPPPDIDCTKATLAYGLRAIPRLGRELISPDLLTRQKALKALIDYLHDHEHIASSVNGGIVPSIRNLLEACDVTCRTLAVEVCYVYSMHSVGRMALLENGVIITLGKLFSDKELIIRKLVYKTLEMTSEYWFGAEAIINANLIPDLFIKV--QEEIDELKVYILECLHFCLLLDVKDALQNQGIKILTALLFHEXXXXXXXXXXXXXXXXMSHEGKEMAIKEETVPPLIEMLKQQESTVKXXXXXXXXXXXXXTHGKYAAINFGALPHLLPLINDPNSEVRVNSIKALTCIAETPEGRRLLLDHIDLFKGRMLDTL------DAVAQHAKIAVDVITWKP 1109
            MA  Q S E P +I+ T+ T AYG RA+P+L  EL S DL TRQKAL AL D +HD E I  ++N G + +++ LL+  +   R    EV ++ + HSVGR A LE+ +++ L  L +D   + R  +YK      +   GA+ II+  LI  L  K+  + E +E + +IL+ L  CL  D  +AL +  + +L   L      I++KAA+ ++++++S EGK+     + +P L+ +LK     VK++AAGA+    +IT GKYAA+   A+  LL L++ P +  R+N+ KALT +AE PEGR+ L  H+  F+   ++T       +A+ + A+IA+ VI +KP
Sbjct:    1 MAHSQNSLELPININATQITTAYGHRALPKLKEELQSEDLQTRQKALMALCDLMHDPECIYKAMNIGCMENLKALLKDSNSMVRIKTTEVLHITASHSVGRYAFLEHDIVLALSFLLNDPSPVCRGNLYKAYMQLVQVPRGAQEIISKGLISSLVWKLQVEVEEEEFQEFILDTLVLCLQEDATEALGSNVVLVLKQKLLSANQNIRSKAARALLNVSISREGKKQVCHFDVIPILVHLLKDPVEHVKSNAAGALMFATVITEGKYAALEAQAIGLLLELLHSPMTIARLNATKALTMLAEAPEGRKALQTHVPTFRAMEVETYEKPQVAEALQRAARIAISVIEFKP 348          
BLAST of Radial spoke head 14-like protein vs. Ensembl Human
Match: RSPH14 (radial spoke head 14 homolog [Source:HGNC Symbol;Acc:HGNC:13437])

HSP 1 Score: 83.9593 bits (206), Expect = 3.087e-19
Identity = 46/101 (45.54%), Postives = 63/101 (62.38%), Query Frame = 3
Query:   90 MAGVQISFEPPPDIDCTKATLAYGLRAIPRLGRELISPDLLTRQKALKALIDYLHDHEHIASSVNGGIVPSIRNLLEACDVTCRTLAVEVCYVYSMHSVGR 392
            MA  Q S E P +I+ T+ T AYG RA+P+L  EL S DL TRQKAL AL D +HD E I  ++N G + +++ LL+  +   R    EV ++ + HSVGR
Sbjct:    1 MAHSQNSLELPININATQITTAYGHRALPKLKEELQSEDLQTRQKALMALCDLMHDPECIYKAMNIGCMENLKALLKDSNSMVRIKTTEVLHITASHSVGR 101          
BLAST of Radial spoke head 14-like protein vs. Ensembl Zebrafish
Match: rsph14 (radial spoke head 14 homolog [Source:ZFIN;Acc:ZDB-GENE-081104-375])

HSP 1 Score: 174.866 bits (442), Expect = 6.312e-51
Identity = 122/340 (35.88%), Postives = 187/340 (55.00%), Query Frame = 3
Query:   90 MAGVQISFEPPPDIDCTKATLAYGLRAIPRLGRELISPDLLTRQKALKALIDYLHDHEHIASSVNGGIVPSIRNLLEACDVTCRTLAVEVCYVYSMHSVGRMALLENGVIITLGKLFSDKELIIRKLVYKTLEMTSEYWFGAEAIINANLIPDLFIKVQEEIDELKVYILECLHFCLLLDVKDALQNQGIKILTALLFHEXXXXXXXXXXXXXXXXMSHEGKEMAIKEETVPPLIEMLKQQESTVKXXXXXXXXXXXXXTHGKYAAINFGALPHLLPLINDPNSEVRVNSIKALTCIAETPEGRRLLLDHIDLFKGRMLDTLDAVAQHAKIAVDVITWKP 1109
            MA  Q + +PPP ID T+A +A+G  A+P+L  EL   DL TRQKAL AL D LHD E    ++    +  ++ LL+  D   R    EV YV + HS+GR A L   ++  L  L  D E+  RK V++ L   +E+  GA  ++N  L+P L  K+  E + ++  +L  L  CL ++   AL++  I++L   L H    I+ +AA  ++ I++   GK    +E  +P L+++L   +  V A+AAG I N A+IT GK  A+   AL  LL L+   N+ V  N+++ALT +AE P  R  L  H+ L K R+ D    + + A   ++VI+W+P
Sbjct:    1 MASPQTTEQPPPHIDPTQAPIAFGNLALPKLLVELQDDDLFTRQKALTALCDLLHDPERAYEAIFSECLEILKVLLQDEDSLIRVKTTEVLYVLASHSMGRDAFLNFDIVGPLANLLDDPEIACRKNVHRALNRIAEFPLGAVFMVNKGLVPRLVPKISIEEENIRALVLSTLSCCLSVNALPALESDVIQVLRDQLSHSSPIIRKEAASALMAISVPTVGKIKVCEENLLPILVKLLSDDDQEVVANAAGTIMNTAVITKGKSEALEADALAPLLQLVLSENTAVCANALRALTVLAEVPRARAHLRQHVPLLKTRLTDPNYLIQEAASTTIEVISWQP 340          
BLAST of Radial spoke head 14-like protein vs. Ensembl Zebrafish
Match: rsph14 (radial spoke head 14 homolog [Source:ZFIN;Acc:ZDB-GENE-081104-375])

HSP 1 Score: 124.405 bits (311), Expect = 5.198e-33
Identity = 73/199 (36.68%), Postives = 109/199 (54.77%), Query Frame = 3
Query:   90 MAGVQISFEPPPDIDCTKATLAYGLRAIPRLGRELISPDLLTRQKALKALIDYLHDHEHIASSVNGGIVPSIRNLLEACDVTCRTLAVEVCYVYSMHSVGRMALLENGVIITLGKLFSDKELIIRKLVYKTLEMTSEYWFGAEAIINANLIPDLFIKVQEEIDELKVYILECLHFCLLLDVKDALQNQGIKILTALLFH 686
            MA  Q + +PPP ID T+A +A+G  A+P+L  EL   DL TRQKAL AL D LHD E    ++    +  ++ LL+  D   R    EV YV + HS+GR A L   ++  L  L  D E+  RK V++ L   +E+  GA  ++N  L+P L  K+  E + ++  +L  L  CL ++   AL++  I++L   L H
Sbjct:    1 MASPQTTEQPPPHIDPTQAPIAFGNLALPKLLVELQDDDLFTRQKALTALCDLLHDPERAYEAIFSECLEILKVLLQDEDSLIRVKTTEVLYVLASHSMGRDAFLNFDIVGPLANLLDDPEIACRKNVHRALNRIAEFPLGAVFMVNKGLVPRLVPKISIEEENIRALVLSTLSCCLSVNALPALESDVIQVLRDQLSH 199          
BLAST of Radial spoke head 14-like protein vs. Ensembl Xenopus
Match: RSPH14 (radial spoke head 14 homolog (Chlamydomonas) [Source:NCBI gene;Acc:594888])

HSP 1 Score: 237.269 bits (604), Expect = 7.176e-75
Identity = 152/340 (44.71%), Postives = 223/340 (65.59%), Query Frame = 3
Query:   90 MAGVQISFEPPPDIDCTKATLAYGLRAIPRLGRELISPDLLTRQKALKALIDYLHDHEHIASSVNGGIVPSIRNLLEACDVTCRTLAVEVCYVYSMHSVGRMALLENGVIITLGKLFSDKELIIRKLVYKTLEMTSEYWFGAEAIINANLIPDLFIKVQEEIDELKVYILECLHFCLLLDVKDALQNQGIKILTALLFHEXXXXXXXXXXXXXXXXMSHEGKEMAIKEETVPPLIEMLKQQESTVKXXXXXXXXXXXXXTHGKYAAINFGALPHLLPLINDPNSEVRVNSIKALTCIAETPEGRRLLLDHIDLFKGRMLDTLDAVAQHAKIAVDVITWKP 1109
            MA  +IS   PP+ID TK+ +A+G RA+P+L  EL   +L+TRQ+AL AL D +HD E++  +V+ G + S+++LL   D T R  A EV Y+ + HSVGR  +L++ VI  + KL  D  +I R+ ++KT EM SE   GA A++ ANL+  L  K++ E++++++ ILE LHF L  DV  AL    + IL   L H    I+  AAK ++DI +  EGKE   +EE VP L+ +L+  ++ V+A+AAGA+ NI I T GKYAAIN GA+P LL L++D  S VR+NS+KALT ++E PEGR++LL  +++ +  + D  +AV + A IA+ VI WKP
Sbjct:    1 MAQARISCCLPPNIDPTKSPVAFGERALPKLNEELKDSELITRQRALMALCDLVHDPENVYQAVHLGFLESLKSLLHDQDSTVRQKATEVFYIMAGHSVGRQGILKSDVIPAISKLLDDPVVICRQNMHKTFEMVSELPAGAAALVKANLVVQLVQKLECELEDIQMIILETLHFMLQTDVLQALSAGAVGILKGKLSHPSAGIRRMAAKALMDICVPLEGKETVCQEEVVPLLVHLLQDSDNEVRANAAGALMNITITTQGKYAAINSGAIPKLLALVSDGYSRVRLNSLKALTTLSEAPEGRKVLLADVNIIQSCLDDQSEAVRRAAAIAIQVIQWKP 340          
BLAST of Radial spoke head 14-like protein vs. Ensembl Mouse
Match: Rsph14 (radial spoke head homolog 14 (Chlamydomonas) [Source:MGI Symbol;Acc:MGI:1918486])

HSP 1 Score: 216.853 bits (551), Expect = 4.707e-67
Identity = 134/341 (39.30%), Postives = 215/341 (63.05%), Query Frame = 3
Query:   90 MAGVQISFEPPPDIDCTKATLAYGLRAIPRLGRELISPDLLTRQKALKALIDYLHDHEHIASSVNGGIVPSIRNLLEACDVTCRTLAVEVCYVYSMHSVGRMALLENGVIITLGKLFSDKELIIRKLVYKTLEMTSEYWFGAEAIINANLIPDLFIKVQEEIDELKVYILECLHFCLLLDVKDALQNQGIKILTALLFHEXXXXXXXXXXXXXXXXMSHEGKEMAIKEETVPPLIEMLKQQESTVKXXXXXXXXXXXXXTHGKYAAINFGALPHLLPLIN-DPNSEVRVNSIKALTCIAETPEGRRLLLDHIDLFKGRMLDTLDAVAQHAKIAVDVITWKP 1109
            MA  +IS   PPDID TKA +AYG RA+ +L  EL S DLLTRQKAL AL D +HD E++  ++N G + S++ LL+  D   R    EV Y+ + H VGR+  L++ +I  L  L SD + + R+ +++  +  ++   GA+ I+ + LIP L  K+Q+E D ++  IL+ L  CL  D  +AL++Q +  L   L  + +EI++KAA+ +I I++  +GK    K + +P L+ +L   +  VKA+AAGA+ +  + T GKYAA++  A+  LL L++ +P +++ +N+ KALT +AE PEGR+LLL H+ +F+  +    +A+ + A++A+ VI WKP
Sbjct:    1 MAHARISMYMPPDIDPTKAAIAYGCRALSKLNEELQSRDLLTRQKALVALCDLMHDPEYVYEAINIGCLESLKTLLQDDDNLVRIKTTEVLYIMATHYVGRVGFLKHDIIQALSLLLSDHQTLCRENLHQAYKHLAQLPKGAQGIVQSGLIPSLVRKLQKEEDHIQEIILDTLALCLQEDATEALESQAVPCLKEKLLSQNSEIRSKAARALIAISIPLDGKNQVWKNKVIPILVTLLSDTDEEVKANAAGALMHATVTTEGKYAALDANAIEPLLELLSTNPKTKLCLNATKALTMLAEAPEGRKLLLSHVPIFRYLLAHKNEAIQRAAEVAIKVIEWKP 341          
BLAST of Radial spoke head 14-like protein vs. Ensembl Mouse
Match: Rsph14 (radial spoke head homolog 14 (Chlamydomonas) [Source:MGI Symbol;Acc:MGI:1918486])

HSP 1 Score: 216.853 bits (551), Expect = 4.707e-67
Identity = 134/341 (39.30%), Postives = 215/341 (63.05%), Query Frame = 3
Query:   90 MAGVQISFEPPPDIDCTKATLAYGLRAIPRLGRELISPDLLTRQKALKALIDYLHDHEHIASSVNGGIVPSIRNLLEACDVTCRTLAVEVCYVYSMHSVGRMALLENGVIITLGKLFSDKELIIRKLVYKTLEMTSEYWFGAEAIINANLIPDLFIKVQEEIDELKVYILECLHFCLLLDVKDALQNQGIKILTALLFHEXXXXXXXXXXXXXXXXMSHEGKEMAIKEETVPPLIEMLKQQESTVKXXXXXXXXXXXXXTHGKYAAINFGALPHLLPLIN-DPNSEVRVNSIKALTCIAETPEGRRLLLDHIDLFKGRMLDTLDAVAQHAKIAVDVITWKP 1109
            MA  +IS   PPDID TKA +AYG RA+ +L  EL S DLLTRQKAL AL D +HD E++  ++N G + S++ LL+  D   R    EV Y+ + H VGR+  L++ +I  L  L SD + + R+ +++  +  ++   GA+ I+ + LIP L  K+Q+E D ++  IL+ L  CL  D  +AL++Q +  L   L  + +EI++KAA+ +I I++  +GK    K + +P L+ +L   +  VKA+AAGA+ +  + T GKYAA++  A+  LL L++ +P +++ +N+ KALT +AE PEGR+LLL H+ +F+  +    +A+ + A++A+ VI WKP
Sbjct:    1 MAHARISMYMPPDIDPTKAAIAYGCRALSKLNEELQSRDLLTRQKALVALCDLMHDPEYVYEAINIGCLESLKTLLQDDDNLVRIKTTEVLYIMATHYVGRVGFLKHDIIQALSLLLSDHQTLCRENLHQAYKHLAQLPKGAQGIVQSGLIPSLVRKLQKEEDHIQEIILDTLALCLQEDATEALESQAVPCLKEKLLSQNSEIRSKAARALIAISIPLDGKNQVWKNKVIPILVTLLSDTDEEVKANAAGALMHATVTTEGKYAALDANAIEPLLELLSTNPKTKLCLNATKALTMLAEAPEGRKLLLSHVPIFRYLLAHKNEAIQRAAEVAIKVIEWKP 341          
BLAST of Radial spoke head 14-like protein vs. Ensembl Mouse
Match: Rsph14 (radial spoke head homolog 14 (Chlamydomonas) [Source:MGI Symbol;Acc:MGI:1918486])

HSP 1 Score: 216.853 bits (551), Expect = 1.501e-66
Identity = 134/341 (39.30%), Postives = 215/341 (63.05%), Query Frame = 3
Query:   90 MAGVQISFEPPPDIDCTKATLAYGLRAIPRLGRELISPDLLTRQKALKALIDYLHDHEHIASSVNGGIVPSIRNLLEACDVTCRTLAVEVCYVYSMHSVGRMALLENGVIITLGKLFSDKELIIRKLVYKTLEMTSEYWFGAEAIINANLIPDLFIKVQEEIDELKVYILECLHFCLLLDVKDALQNQGIKILTALLFHEXXXXXXXXXXXXXXXXMSHEGKEMAIKEETVPPLIEMLKQQESTVKXXXXXXXXXXXXXTHGKYAAINFGALPHLLPLIN-DPNSEVRVNSIKALTCIAETPEGRRLLLDHIDLFKGRMLDTLDAVAQHAKIAVDVITWKP 1109
            MA  +IS   PPDID TKA +AYG RA+ +L  EL S DLLTRQKAL AL D +HD E++  ++N G + S++ LL+  D   R    EV Y+ + H VGR+  L++ +I  L  L SD + + R+ +++  +  ++   GA+ I+ + LIP L  K+Q+E D ++  IL+ L  CL  D  +AL++Q +  L   L  + +EI++KAA+ +I I++  +GK    K + +P L+ +L   +  VKA+AAGA+ +  + T GKYAA++  A+  LL L++ +P +++ +N+ KALT +AE PEGR+LLL H+ +F+  +    +A+ + A++A+ VI WKP
Sbjct:   34 MAHARISMYMPPDIDPTKAAIAYGCRALSKLNEELQSRDLLTRQKALVALCDLMHDPEYVYEAINIGCLESLKTLLQDDDNLVRIKTTEVLYIMATHYVGRVGFLKHDIIQALSLLLSDHQTLCRENLHQAYKHLAQLPKGAQGIVQSGLIPSLVRKLQKEEDHIQEIILDTLALCLQEDATEALESQAVPCLKEKLLSQNSEIRSKAARALIAISIPLDGKNQVWKNKVIPILVTLLSDTDEEVKANAAGALMHATVTTEGKYAALDANAIEPLLELLSTNPKTKLCLNATKALTMLAEAPEGRKLLLSHVPIFRYLLAHKNEAIQRAAEVAIKVIEWKP 374          
BLAST of Radial spoke head 14-like protein vs. Ensembl Mouse
Match: Rsph14 (radial spoke head homolog 14 (Chlamydomonas) [Source:MGI Symbol;Acc:MGI:1918486])

HSP 1 Score: 144.05 bits (362), Expect = 1.729e-40
Identity = 79/200 (39.50%), Postives = 120/200 (60.00%), Query Frame = 3
Query:   90 MAGVQISFEPPPDIDCTKATLAYGLRAIPRLGRELISPDLLTRQKALKALIDYLHDHEHIASSVNGGIVPSIRNLLEACDVTCRTLAVEVCYVYSMHSVGRMALLENGVIITLGKLFSDKELIIRKLVYKTLEMTSEYWFGAEAIINANLIPDLFIKVQEEIDELKVYILECLHFCLLLDVKDALQNQGIKILTALLFHE 689
            MA  +IS   PPDID TKA +AYG RA+ +L  EL S DLLTRQKAL AL D +HD E++  ++N G + S++ LL+  D   R    EV Y+ + H VGR+  L++ +I  L  L SD + + R+ +++  +  ++   GA+ I+ + LIP L  K+Q+E D ++  IL+ L  CL  D  +AL++Q +  L   L  +
Sbjct:    1 MAHARISMYMPPDIDPTKAAIAYGCRALSKLNEELQSRDLLTRQKALVALCDLMHDPEYVYEAINIGCLESLKTLLQDDDNLVRIKTTEVLYIMATHYVGRVGFLKHDIIQALSLLLSDHQTLCRENLHQAYKHLAQLPKGAQGIVQSGLIPSLVRKLQKEEDHIQEIILDTLALCLQEDATEALESQAVPCLKEKLLSQ 200          
BLAST of Radial spoke head 14-like protein vs. Ensembl Mouse
Match: Rsph14 (radial spoke head homolog 14 (Chlamydomonas) [Source:MGI Symbol;Acc:MGI:1918486])

HSP 1 Score: 126.331 bits (316), Expect = 1.446e-34
Identity = 67/161 (41.61%), Postives = 100/161 (62.11%), Query Frame = 3
Query:   90 MAGVQISFEPPPDIDCTKATLAYGLRAIPRLGRELISPDLLTRQKALKALIDYLHDHEHIASSVNGGIVPSIRNLLEACDVTCRTLAVEVCYVYSMHSVGRMALLENGVIITLGKLFSDKELIIRKLVYKTLEMTSEYWFGAEAIINANLIPDLFIKVQEE 572
            MA  +IS   PPDID TKA +AYG RA+ +L  EL S DLLTRQKAL AL D +HD E++  ++N G + S++ LL+  D   R    EV Y+ + H VGR+  L++ +I  L  L SD + + R+ +++  +  ++   GA+ I+ + LIP L  K+Q+E
Sbjct:    1 MAHARISMYMPPDIDPTKAAIAYGCRALSKLNEELQSRDLLTRQKALVALCDLMHDPEYVYEAINIGCLESLKTLLQDDDNLVRIKTTEVLYIMATHYVGRVGFLKHDIIQALSLLLSDHQTLCRENLHQAYKHLAQLPKGAQGIVQSGLIPSLVRKLQKE 161          
BLAST of Radial spoke head 14-like protein vs. UniProt/SwissProt
Match: sp|Q9D3W1|RSP14_MOUSE (Radial spoke head 14 homolog OS=Mus musculus OX=10090 GN=Rsph14 PE=2 SV=1)

HSP 1 Score: 216.853 bits (551), Expect = 3.293e-66
Identity = 134/341 (39.30%), Postives = 215/341 (63.05%), Query Frame = 3
Query:   90 MAGVQISFEPPPDIDCTKATLAYGLRAIPRLGRELISPDLLTRQKALKALIDYLHDHEHIASSVNGGIVPSIRNLLEACDVTCRTLAVEVCYVYSMHSVGRMALLENGVIITLGKLFSDKELIIRKLVYKTLEMTSEYWFGAEAIINANLIPDLFIKVQEEIDELKVYILECLHFCLLLDVKDALQNQGIKILTALLFHEXXXXXXXXXXXXXXXXMSHEGKEMAIKEETVPPLIEMLKQQESTVKXXXXXXXXXXXXXTHGKYAAINFGALPHLLPLIN-DPNSEVRVNSIKALTCIAETPEGRRLLLDHIDLFKGRMLDTLDAVAQHAKIAVDVITWKP 1109
            MA  +IS   PPDID TKA +AYG RA+ +L  EL S DLLTRQKAL AL D +HD E++  ++N G + S++ LL+  D   R    EV Y+ + H VGR+  L++ +I  L  L SD + + R+ +++  +  ++   GA+ I+ + LIP L  K+Q+E D ++  IL+ L  CL  D  +AL++Q +  L   L  + +EI++KAA+ +I I++  +GK    K + +P L+ +L   +  VKA+AAGA+ +  + T GKYAA++  A+  LL L++ +P +++ +N+ KALT +AE PEGR+LLL H+ +F+  +    +A+ + A++A+ VI WKP
Sbjct:    1 MAHARISMYMPPDIDPTKAAIAYGCRALSKLNEELQSRDLLTRQKALVALCDLMHDPEYVYEAINIGCLESLKTLLQDDDNLVRIKTTEVLYIMATHYVGRVGFLKHDIIQALSLLLSDHQTLCRENLHQAYKHLAQLPKGAQGIVQSGLIPSLVRKLQKEEDHIQEIILDTLALCLQEDATEALESQAVPCLKEKLLSQNSEIRSKAARALIAISIPLDGKNQVWKNKVIPILVTLLSDTDEEVKANAAGALMHATVTTEGKYAALDANAIEPLLELLSTNPKTKLCLNATKALTMLAEAPEGRKLLLSHVPIFRYLLAHKNEAIQRAAEVAIKVIEWKP 341          
BLAST of Radial spoke head 14-like protein vs. UniProt/SwissProt
Match: sp|Q9UHP6|RSP14_HUMAN (Radial spoke head 14 homolog OS=Homo sapiens OX=9606 GN=RSPH14 PE=1 SV=1)

HSP 1 Score: 177.563 bits (449), Expect = 6.397e-51
Identity = 129/348 (37.07%), Postives = 203/348 (58.33%), Query Frame = 3
Query:   90 MAGVQISFEPPPDIDCTKATLAYGLRAIPRLGRELISPDLLTRQKALKALIDYLHDHEHIASSVNGGIVPSIRNLLEACDVTCRTLAVEVCYVYSMHSVGRMALLENGVIITLGKLFSDKELIIRKLVYKTLEMTSEYWFGAEAIINANLIPDLFIKV--QEEIDELKVYILECLHFCLLLDVKDALQNQGIKILTALLFHEXXXXXXXXXXXXXXXXMSHEGKEMAIKEETVPPLIEMLKQQESTVKXXXXXXXXXXXXXTHGKYAAINFGALPHLLPLINDPNSEVRVNSIKALTCIAETPEGRRLLLDHIDLFKGRMLDTL------DAVAQHAKIAVDVITWKP 1109
            MA  Q S E P +I+ T+ T AYG RA+P+L  EL S DL TRQKAL AL D +HD E I  ++N G + +++ LL+  +   R    EV ++ + HSVGR A LE+ +++ L  L +D   + R  +YK      +   GA+ II+  LI  L  K+  + E +E + +IL+ L  CL  D  +AL +  + +L   L      I++KAA+ ++++++S EGK+     + +P L+ +LK     VK++AAGA+    +IT GKYAA+   A+  LL L++ P +  R+N+ KALT +AE PEGR+ L  H+  F+   ++T       +A+ + A+IA+ VI +KP
Sbjct:    1 MAHSQNSLELPININATQITTAYGHRALPKLKEELQSEDLQTRQKALMALCDLMHDPECIYKAMNIGCMENLKALLKDSNSMVRIKTTEVLHITASHSVGRYAFLEHDIVLALSFLLNDPSPVCRGNLYKAYMQLVQVPRGAQEIISKGLISSLVWKLQVEVEEEEFQEFILDTLVLCLQEDATEALGSNVVLVLKQKLLSANQNIRSKAARALLNVSISREGKKQVCHFDVIPILVHLLKDPVEHVKSNAAGALMFATVITEGKYAALEAQAIGLLLELLHSPMTIARLNATKALTMLAEAPEGRKALQTHVPTFRAMEVETYEKPQVAEALQRAARIAISVIEFKP 348          
BLAST of Radial spoke head 14-like protein vs. TrEMBL
Match: A0A1I8J1N9 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 300.056 bits (767), Expect = 4.978e-96
Identity = 171/341 (50.15%), Postives = 239/341 (70.09%), Query Frame = 3
Query:   90 MAGVQISFEPPPDIDCTKATLAYGLRAIPRLGRELI-SPDLLTRQKALKALIDYLHDHEHIASSVNGGIVPSIRNLLEACDVTCRTLAVEVCYVYSMHSVGRMALLENGVIITLGKLFSDKELIIRKLVYKTLEMTSEYWFGAEAIINANLIPDLFIKVQEEIDELKVYILECLHFCLLLDVKDALQNQGIKILTALLFHEXXXXXXXXXXXXXXXXMSHEGKEMAIKEETVPPLIEMLKQQESTVKXXXXXXXXXXXXXTHGKYAAINFGALPHLLPLINDPNSEVRVNSIKALTCIAETPEGRRLLLDHIDLFKGRMLDTLDAVAQHAKIAVDVITWKP 1109
            MA   IS   PP+ID TKAT+AYG  A+ RL REL  + ++LTRQKA+KAL DYLHDHEH+A++++ GIV S+++LL   DVTCR L+    YV S HSVGR A+L+ G I  L  LF D E I R+  +  +EM SE  FGA+ I+ A L+P L  KV+ E DE+K YIL+ LHFCL+++ +DAL+  G+++ T+LL      I+AKAA+ I+D+++  +GK+ A++  TVP LI +L    S V+A+AAGA++ IA+ T GKY A+N   +  LLPL+NDPNSEVRVN++K +TC+AE PEGR++L  H++  +    D +  V +HA+IAV VITW+P
Sbjct:    1 MATSVISANLPPNIDPTKATMAYGNGALRRLNRELQDTENMLTRQKAVKALCDYLHDHEHVAAAIHEGIVVSLKSLLRDTDVTCRQLSTMCFYVISQHSVGREAILDTGTIEPLSALFEDAEDICRRNAHMAIEMLSEVPFGADGIVQAALVPKLIEKVKSEHDEIKEYILDTLHFCLIVNTQDALKAHGMEVFTSLLASNLATIRAKAARDIMDLSVPLDGKDKAVEVGTVPALIGLLGDNASAVRANAAGALSFIAVTTQGKYTALNADCVNPLLPLVNDPNSEVRVNALKVVTCLAEAPEGRKILTGHVEQIRQLESDEITNVRKHAEIAVRVITWRP 341          
BLAST of Radial spoke head 14-like protein vs. TrEMBL
Match: A0A267ETD1 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig006473g1 PE=4 SV=1)

HSP 1 Score: 299.671 bits (766), Expect = 5.606e-96
Identity = 171/341 (50.15%), Postives = 239/341 (70.09%), Query Frame = 3
Query:   90 MAGVQISFEPPPDIDCTKATLAYGLRAIPRLGRELI-SPDLLTRQKALKALIDYLHDHEHIASSVNGGIVPSIRNLLEACDVTCRTLAVEVCYVYSMHSVGRMALLENGVIITLGKLFSDKELIIRKLVYKTLEMTSEYWFGAEAIINANLIPDLFIKVQEEIDELKVYILECLHFCLLLDVKDALQNQGIKILTALLFHEXXXXXXXXXXXXXXXXMSHEGKEMAIKEETVPPLIEMLKQQESTVKXXXXXXXXXXXXXTHGKYAAINFGALPHLLPLINDPNSEVRVNSIKALTCIAETPEGRRLLLDHIDLFKGRMLDTLDAVAQHAKIAVDVITWKP 1109
            MA   IS   PP+ID TKAT+AYG  A+ RL REL  + ++LTRQKA+KAL DYLHDHEH+A++++ GIV S+++LL   DVTCR L+    YV S HSVGR A+L+ G I  L  LF D E I R+  +  +EM SE  FGA+ I+ A L+P L  KV+ E DE+K YIL+ LHFCL+++ +DAL+  G+++ T+LL      I+AKAA+ I+D+++  +GK+ A++  TVP LI +L    S V+A+AAGA++ IA+ T GKY A+N   +  LLPL+NDPNSEVRVN++K +TC+AE PEGR++L  H++  +    D +  V +HA+IAV VITW+P
Sbjct:    3 MATSVISANLPPNIDPTKATMAYGNGALRRLNRELQDTENMLTRQKAVKALCDYLHDHEHVAAAIHEGIVVSLKSLLRDTDVTCRQLSTMCFYVISQHSVGREAILDTGTIEPLSALFEDAEDICRRNAHMAIEMLSEVPFGADGIVQAALVPKLIEKVKSEHDEIKEYILDTLHFCLIVNTQDALKAHGMEVFTSLLASNLATIRAKAARDIMDLSVPLDGKDKAVEVGTVPALIGLLGDNASAVRANAAGALSFIAVTTQGKYTALNADCVNPLLPLVNDPNSEVRVNALKVVTCLAEAPEGRKILTGHVEQIRQLESDEITNVRKHAEIAVRVITWRP 343          
BLAST of Radial spoke head 14-like protein vs. TrEMBL
Match: A0A1S3HML5 (radial spoke head 14 homolog OS=Lingula unguis OX=7574 GN=LOC106156564 PE=4 SV=1)

HSP 1 Score: 294.278 bits (752), Expect = 6.431e-94
Identity = 170/340 (50.00%), Postives = 235/340 (69.12%), Query Frame = 3
Query:   90 MAGVQISFEPPPDIDCTKATLAYGLRAIPRLGRELISPDLLTRQKALKALIDYLHDHEHIASSVNGGIVPSIRNLLEACDVTCRTLAVEVCYVYSMHSVGRMALLENGVIITLGKLFSDKELIIRKLVYKTLEMTSEYWFGAEAIINANLIPDLFIKVQEEIDELKVYILECLHFCLLLDVKDALQNQGIKILTALLFHEXXXXXXXXXXXXXXXXMSHEGKEMAIKEETVPPLIEMLKQQESTVKXXXXXXXXXXXXXTHGKYAAINFGALPHLLPLINDPNSEVRVNSIKALTCIAETPEGRRLLLDHIDLFKGRMLDTLDAVAQHAKIAVDVITWKP 1109
            MA   IS + PP ID T+A LAYG RA+PRL RELI  +LLTRQ+A+++L DYLHD EHIA ++  GI  S++ LL+  DVT R  A E  Y+ + ++VGR A L+  +II L KLF+DKE I+RK  +K +EM SE   GAE I+ ANL+P L  K++ E DE+K  IL+ LHFC+ +D   AL+ + +++ T  L H    I+AKAA+ I+D+++  +GK  A++  +V  L+E+LK  ++ V+ASAAGAI  I I T GKY A+N  A+  L+ L++D NSEVR N++KA+TC+AE PEGR+ LL+HID  + R  D + AV +HA IAV VITWKP
Sbjct:    1 MAETVISAKMPPHIDVTRAPLAYGDRALPRLNRELIDLNLLTRQRAVRSLCDYLHDPEHIAEALRQGIPESLKGLLDDKDVTVRQKATECLYIIAGYAVGREAFLDQNIIIPLSKLFADKEDIVRKNAHKAMEMVSETMTGAEGIVEANLVPVLVEKLKTEHDEIKELILDTLHFCMRVDTAHALRAEAMQVFTNHLQHGTPVIRAKAARDIMDLSVPLDGKNKAVEVGSVASLVELLKDSDADVRASAAGAIMTITITTKGKYTALNCNAIEPLVKLVDDENSEVRANALKAITCLAEAPEGRQELLNHIDQIRKRTNDAIPAVVKHANIAVKVITWKP 340          
BLAST of Radial spoke head 14-like protein vs. TrEMBL
Match: C3YDA5 (Uncharacterized protein OS=Branchiostoma floridae OX=7739 GN=BRAFLDRAFT_279978 PE=4 SV=1)

HSP 1 Score: 282.337 bits (721), Expect = 3.661e-89
Identity = 165/340 (48.53%), Postives = 229/340 (67.35%), Query Frame = 3
Query:   90 MAGVQISFEPPPDIDCTKATLAYGLRAIPRLGRELISPDLLTRQKALKALIDYLHDHEHIASSVNGGIVPSIRNLLEACDVTCRTLAVEVCYVYSMHSVGRMALLENGVIITLGKLFSDKELIIRKLVYKTLEMTSEYWFGAEAIINANLIPDLFIKVQEEIDELKVYILECLHFCLLLDVKDALQNQGIKILTALLFHEXXXXXXXXXXXXXXXXMSHEGKEMAIKEETVPPLIEMLKQQESTVKXXXXXXXXXXXXXTHGKYAAINFGALPHLLPLINDPNSEVRVNSIKALTCIAETPEGRRLLLDHIDLFKGRMLDTLDAVAQHAKIAVDVITWKP 1109
            MA   IS + PPDID TKA LAYG RA+PRL REL   +L+TRQ+AL  L DYLHD EHIA ++  G+  S++ LL   D T R    EV YV + H+ GR A L+ G+I+ L KLF D   + RK  +  +EM SE  +GA  ++ A L+P L  K+++E++E+K  IL+ LHFCL ++   AL    +++ T LL H +  I+AKAA+ I+D+++  +GK  A + + +PPL+ +LK  ++ V++ AAGAIA I I T GKY A+  GA+PHL+ L+ D NSEVR+NS+KALT ++E PEGR+ LL+H+DL K RM D  +AV + A IAV VITWKP
Sbjct:    1 MAKTVISQKLPPDIDPTKAPLAYGDRALPRLNRELNDKELITRQRALMTLCDYLHDPEHIAEALRVGVAESLKKLLSDKDPTVRHKTTEVLYVIATHNKGRDAFLDYGIIVPLSKLFDDSVDLARKNAHMAMEMMSEIPYGAAGVVEAQLVPKLVGKLRDELNEIKELILDTLHFCLRVETMHALVAGAMEVFTELLGHNQAIIRAKAARDIMDLSVPLDGKNKACEVKALPPLVGLLKDGDTYVRSMAAGAIATITITTQGKYLALEAGAIPHLVELVEDKNSEVRLNSLKALTTLSEAPEGRKELLNHVDLIKKRMEDESEAVVKAATIAVRVITWKP 340          
BLAST of Radial spoke head 14-like protein vs. TrEMBL
Match: A0A4S2KYH1 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_010469 PE=4 SV=1)

HSP 1 Score: 281.567 bits (719), Expect = 6.639e-89
Identity = 161/341 (47.21%), Postives = 225/341 (65.98%), Query Frame = 3
Query:   90 MAGVQISFEPPPDIDCTKATLAYGLRAIPRLGRELISPDLLTRQKALKALIDYLHDHEHIASSVNGGIVPSIRNLLEACDVTCRTLAVEVCYVYSMHSVGRMALLENGVIITLGKLFSDKEL-IIRKLVYKTLEMTSEYWFGAEAIINANLIPDLFIKVQEEIDELKVYILECLHFCLLLDVKDALQNQGIKILTALLFHEXXXXXXXXXXXXXXXXMSHEGKEMAIKEETVPPLIEMLKQQESTVKXXXXXXXXXXXXXTHGKYAAINFGALPHLLPLINDPNSEVRVNSIKALTCIAETPEGRRLLLDHIDLFKGRMLDTLDAVAQHAKIAVDVITWKP 1109
            MA  +IS EPPP ID TKATLAYG  AI RL REL    LLT+Q+A+KAL DYLHDHEHIA ++N G+V S+  LLE  DV CR  A E   V   H +GR+A L++ ++ +   L    E+ I+R    K +E+ +    GA A++    IP L    ++E+DE++V +L+ L+ CL  D    L++ G+ + T LL HE  E++A+AA+ I+ ++++  GK+ A+  ET+P L+E+LK    TV+ASAAGA+A I    HG+Y  +N GA+PHLL L++D  S VRVN++K +TC++ETPEGRR+LLDH++       D   AVA+HAKIA  VITWKP
Sbjct:    1 MALARISLEPPPHIDPTKATLAYGRLAIKRLNRELHDAVLLTKQRAVKALCDYLHDHEHIAEAINEGVVTSLNVLLEDSDVPCRAYATECFVVLCQHELGRVAFLDHNILQSFLNLIKLSEVDIVRLNAQKAIELLTTSPAGALAVVENGYIPLLINCARDEVDEIRVVVLDTLNHCLSFDTAKGLESGGMPLFTQLLSHESPEVRARAAQNILRLSVNPTGKQEALDNETIPALVELLKDNSETVRASAAGALAFICTTNHGRYTTLNAGAIPHLLRLVDDETSRVRVNALKVITCLSETPEGRRILLDHLNTITSHEKDVNAAVAKHAKIAASVITWKP 341          
BLAST of Radial spoke head 14-like protein vs. Ensembl Cavefish
Match: rsph14 (radial spoke head 14 homolog [Source:NCBI gene;Acc:103021394])

HSP 1 Score: 167.162 bits (422), Expect = 4.506e-48
Identity = 119/343 (34.69%), Postives = 194/343 (56.56%), Query Frame = 3
Query:   90 MAGVQISFEPPPDIDCTKATLAYGLRAIPRLGRELISPDLLTRQKALKALIDYLHDHEHIASSVNGGIVPSIRNLLEACDVTCRTLAVEVCYVYSMHSVGRMALLENGVIITLGKLFSDKELIIRKLVYKTLEMTSEYWFGAEAIINANLIPDLFIKVQEEIDELKVYILECLHFCLLLDV---KDALQNQGIKILTALLFHEXXXXXXXXXXXXXXXXMSHEGKEMAIKEETVPPLIEMLKQQESTVKXXXXXXXXXXXXXTHGKYAAINFGALPHLLPLINDPNSEVRVNSIKALTCIAETPEGRRLLLDHIDLFKGRMLDTLDAVAQHAKIAVDVITWKP 1109
            MAG +IS + PP ID  ++ LA+G RA+PRL  EL +P+L  RQ AL AL D +HD E    ++  G +  ++ LL+  D + RT   EV Y+ + HSVGR A+L   V+  L +L  +     R+  +  L+M S +  G   +++  L+P L +KV  E ++++  +L  L  C+ +D    + AL +  + +L   L H    I+ +A   +I I++  +GK    +EE +P L+++L  ++  +KA+AAG I N A+IT GK+ ++  GAL  LL L+   +  V  N+++ALTC+AE P  R  LL H+ L + R+      + + +  A+ VI+W P
Sbjct:    1 MAGSRISEQLPPLIDRNQSPLAFGQRALPRLAAELQNPELTVRQGALAALRDLIHDPERAYETIYHGCLERLKVLLKDEDSSIRTATTEVLYLLTAHSVGREAILREDVVGCLSELLDEPVDACRRNTHLVLKMMSGFPAGVACMVSLGLVPRLVMKVAAETEDIRELVLSTLGSCMRVDTQAAQAALASDVVTVLREQLTHSSTNIRREATAAMIAISVPPQGKVKVCEEEVLPVLVQLLSDEDLEIKANAAGTIMNTAVITKGKFQSLQAGALAPLLHLVECEHRAVCANALRALTCLAEVPRAREQLLQHLPLLQTRLNHPEPIIQRASATAIQVISWTP 343          
BLAST of Radial spoke head 14-like protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005642.1 (pep scaffold:Pmarinus_7.0:GL476474:164372:179435:1 gene:ENSPMAG00000005107.1 transcript:ENSPMAT00000005642.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 227.254 bits (578), Expect = 8.154e-72
Identity = 147/334 (44.01%), Postives = 201/334 (60.18%), Query Frame = 3
Query:  108 SFEPPPDIDCTKATLAYGLRAIPRLGRELISPDLLTRQKALKALIDYLHDHEHIASSVNGGIVPSIRNLLEACDVTCRTLAVEVCYVYSMHSVGRMALLENGVIITLGKLFSDKELIIRKLVYKTLEMTSEYWFGAEAIINANLIPDLFIKVQEEIDELKVYILECLHFCLLLDVKDALQNQGIKILTALLFHEXXXXXXXXXXXXXXXXMSHEGKEMAIKEETVPPLIEMLKQQESTVKXXXXXXXXXXXXXTHGKYAAINFGALPHLLPLINDPNSEVRVNSIKALTCIAETPEGRRLLLDHIDLFKGRMLDTLDAVAQHAKIAVDVITWKP 1109
            S + PPD+D TKATLA+G RA+PRL REL  P+LLTRQ+AL AL D +H+ E    +V  G +  +R+LL   D T R    E   +   HS+ R   L   +I+ L  LF D   I R   +KTLEM SE   GA  I+ A L+P L  K++ E++E+   IL+ L+FCL +D   AL+   + +L  LL HE   I+AKAA+  ++I +S EGK  A  ++ VP L+ +L    + V+ +AAGAI  IA+ T GKYAA+   A+  L+ L+ D  SEVR+N+IKA+T +AE PEGR  LL  + L  G   D   AVA    IA+ VITW+P
Sbjct:   12 SVQLPPDVDPTKATLAFGDRALPRLCRELQGPELLTRQRALMALCDLVHEPEMAYEAVRVGCLECLRSLLVDEDATVRCKTTEALSIMVSHSIVRTMFLSMDLILPLSHLFDDDVDICRLNTHKTLEMLSEIPHGALGIVEAGLVPCLVKKLRSELNEICELILDTLNFCLAVDTMQALEVGAVDVLLTLLLHESERIRAKAARATMNITVSLEGKNQACDKQLVPVLVGLLSDSSTDVRGNAAGAIMTIAVTTQGKYAALGAEAVHPLVELVTDGRSEVRLNAIKAITALAEAPEGREALLPSVSLLGGCRSDASAAVANAVHIALQVITWRP 345          
BLAST of Radial spoke head 14-like protein vs. Ensembl Nematostella
Match: EDO46598 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RPM5])

HSP 1 Score: 241.121 bits (614), Expect = 5.058e-77
Identity = 148/341 (43.40%), Postives = 216/341 (63.34%), Query Frame = 3
Query:   90 MAGVQISFEPPPDIDCTKATLAYGLRAIPRLGRELISPDLLTRQKALKALIDYLHDHEHIASSVNGGIVPSIRNLLEACDVTCRTLAVEVCYVYSMHSVGRMALLENGVIITLGKLFSDKELIIRKLVYKTLEMTSEYWFGAEAIINANLIPDLFIKVQEEIDELKVYILECLHFCLLLDVKDALQNQGIKILTALLFHEXXXXXXXXXXXXXXXXMSHEGKEMAIKEETVPPLIEMLKQQESTVKXXXXXXXXXXXXXTHGKYAAINFGALPHLLPLINDPNSEVRVNSIKALTCIAETPEGRRLLLDHIDLFKGRMLD-TLDAVAQHAKIAVDVITWKP 1109
            MA   IS + PPDID TKA LAYG RA+P+L REL S DLLTRQKAL +L D +H+ E+I   +  GI  S+++LL+  D T R    EV ++ + H+VGR A LE+ +I+ L +LF+D+    R+  ++ +EM S    G + ++ ANL+P L  K+ EE DE+K  IL+ LH+C+ ++ K  L + G++  T LL H     + KAA+ I+D++   EGK+ A+    VPPL+ +L+   + V+A AAGAI    I+   KYAAI   A+P+L+  ++DP S+VR+NS+KA+T +AE P GR  LL  +   +  + D    AV + A+IAV VITWKP
Sbjct:    1 MATTLISVKLPPDIDPTKARLAYGDRALPKLNRELNSDDLLTRQKALMSLCDAMHNPEYICEGIRVGIAASLKSLLKDADATVRHKTTEVLFIIAGHAVGRDAFLEHSIILPLSELFNDQVYQARRNAHQAIEMCSHTSPGTDGVVEANLLPILVGKLLEEQDEIKELILDTLHYCMRVETKQVLDSNGMEAFTKLLDHMDPSTRCKAARDIMDLSFPLEGKDRAVDVGAVPPLVSLLRDNSAEVRAQAAGAIMTQTIVPSSKYAAIEAEAIPNLVSQLSDPVSDVRLNSLKAITTLAEAPIGRTTLLKSVKEVEKLVHDHDSPAVRKAAQIAVKVITWKP 341          
BLAST of Radial spoke head 14-like protein vs. Ensembl Medaka
Match: ENSORLT00000034911.1 (radial spoke head 14 homolog [Source:NCBI gene;Acc:111947860])

HSP 1 Score: 99.7525 bits (247), Expect = 4.358e-23
Identity = 100/342 (29.24%), Postives = 166/342 (48.54%), Query Frame = 3
Query:  126 DIDCTKATLAYGLRAIPRLGRELISPDLLTRQKALKALIDYLHDHEHIASSVNGGIVPSIRNLLEACDVTCRTLAVEVCYVYSMHSVGRMALLENGVIITLGKLFSDKELIIRKLVYKTLEMTSEYWFGAEAIINANLIPDLFIKVQ----EEIDELKVYILECLHFCLLLDVKDALQNQGIKILTALLFHEXXXXXXXXXXXXXXXXMSHEGKEMAIKEETVPPLIEMLKQQESTVKXXXXXXXXXXXXXTHGKYAAINFGALPHLLPLIND--PNSEVR-------VNSIKALTCIAETPEGRRLLLDHIDLFKGRMLDTLDAVAQHA-KIAVDVITWKP 1109
            D D   A +A+G  A+P L  +L  P    R +AL ALID L        ++  G +  ++ LLE  D   R    ++ +V + H+ GR ALL    +  L +L  D     R+ V+  L   S +  G  +++   L+P L  K+Q    EE DE++V  L  L  C   D + AL++  + +L   L +    I   AA  ++ +++   GK     ++ +P +  +L++++   + +A G I   A+ T GK   ++   LP LL L  D   + ++R       +NS++ LT +AETPEGRRLL D + L +    +  D   Q   + A+ V+T+ P
Sbjct:    4 DSDAPPAPVAFGRWAVPLLAEQLRLPGRDVRLRALAALIDVLRQPLRGPEALTEGFLQQLKVLLEDEDPCVRAKVCQLLHVLAAHTCGRQALLAASFLPPLSQLLEDPP--CRRTVFLLLSRLSLHSSGRVSLL--TLLPKLMKKLQEEEEEEEDEVQVLFLSLLRCCFQADPEAALRSDAVALLAPKLSNGALNICKAAAAAMMALSVPMGGKVEVCDQKVLPAVAALLQEEDEEAQLNATGVIMFAAVTTAGKLQCLHLNVLPVLLKLACDRHEDEDMRRRRKPLVMNSVRGLTMLAETPEGRRLLQDQLPLLRRTSEEEEDVDIQRVFETAIQVVTFTP 341          
BLAST of Radial spoke head 14-like protein vs. Planmine SMEST
Match: SMESG000077061.1 (SMESG000077061.1)

HSP 1 Score: 623.624 bits (1607), Expect = 0.000e+0
Identity = 338/340 (99.41%), Postives = 340/340 (100.00%), Query Frame = 3
Query:   90 MAGVQISFEPPPDIDCTKATLAYGLRAIPRLGRELISPDLLTRQKALKALIDYLHDHEHIASSVNGGIVPSIRNLLEACDVTCRTLAVEVCYVYSMHSVGRMALLENGVIITLGKLFSDKELIIRKLVYKTLEMTSEYWFGAEAIINANLIPDLFIKVQEEIDELKVYILECLHFCLLLDVKDALQNQGIKILTALLFHEXXXXXXXXXXXXXXXXMSHEGKEMAIKEETVPPLIEMLKQQESTVKXXXXXXXXXXXXXTHGKYAAINFGALPHLLPLINDPNSEVRVNSIKALTCIAETPEGRRLLLDHIDLFKGRMLDTLDAVAQHAKIAVDVITWKP 1109
            MAGVQISFEPPPDIDCTKATLAYGLRAIPRLGRELISPDLLTRQKALKALIDYLHDHEHIASSVNGGIVPSIRNLLEACDVTCRTLAVEVCYVYSMHSVGRMALLENGVIITLGKLFSDKELIIRKLVYKTLEMTSEYWFGAE+IINANLIPDLFIKVQEEIDELKVYILECLHFCLLLDVKDALQNQGIKILTALLFHEKNEIKAKAAKCIIDIAMSHEGKEMAIKEETVPPLIEMLKQ+ESTVKASAAGAIANIAIITHGKYAAINFGALPHLLPLINDPNSEVRVNSIKALTCIAETPEGRRLLLDHIDLFKGRMLDTLDAVAQHAKIAVDVITWKP
Sbjct:    1 MAGVQISFEPPPDIDCTKATLAYGLRAIPRLGRELISPDLLTRQKALKALIDYLHDHEHIASSVNGGIVPSIRNLLEACDVTCRTLAVEVCYVYSMHSVGRMALLENGVIITLGKLFSDKELIIRKLVYKTLEMTSEYWFGAESIINANLIPDLFIKVQEEIDELKVYILECLHFCLLLDVKDALQNQGIKILTALLFHEKNEIKAKAAKCIIDIAMSHEGKEMAIKEETVPPLIEMLKQKESTVKASAAGAIANIAIITHGKYAAINFGALPHLLPLINDPNSEVRVNSIKALTCIAETPEGRRLLLDHIDLFKGRMLDTLDAVAQHAKIAVDVITWKP 340          
The following BLAST results are available for this feature:
BLAST of Radial spoke head 14-like protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 2
Match NameE-valueIdentityDescription
RSPH141.332e-5137.07radial spoke head 14 homolog [Source:HGNC Symbol;A... [more]
RSPH143.087e-1945.54radial spoke head 14 homolog [Source:HGNC Symbol;A... [more]
back to top
BLAST of Radial spoke head 14-like protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Radial spoke head 14-like protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Radial spoke head 14-like protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
rsph146.312e-5135.88radial spoke head 14 homolog [Source:ZFIN;Acc:ZDB-... [more]
rsph145.198e-3336.68radial spoke head 14 homolog [Source:ZFIN;Acc:ZDB-... [more]
back to top
BLAST of Radial spoke head 14-like protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
RSPH147.176e-7544.71radial spoke head 14 homolog (Chlamydomonas) [Sour... [more]
back to top
BLAST of Radial spoke head 14-like protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Rsph144.707e-6739.30radial spoke head homolog 14 (Chlamydomonas) [Sour... [more]
Rsph144.707e-6739.30radial spoke head homolog 14 (Chlamydomonas) [Sour... [more]
Rsph141.501e-6639.30radial spoke head homolog 14 (Chlamydomonas) [Sour... [more]
Rsph141.729e-4039.50radial spoke head homolog 14 (Chlamydomonas) [Sour... [more]
Rsph141.446e-3441.61radial spoke head homolog 14 (Chlamydomonas) [Sour... [more]
back to top
BLAST of Radial spoke head 14-like protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 2
Match NameE-valueIdentityDescription
sp|Q9D3W1|RSP14_MOUSE3.293e-6639.30Radial spoke head 14 homolog OS=Mus musculus OX=10... [more]
sp|Q9UHP6|RSP14_HUMAN6.397e-5137.07Radial spoke head 14 homolog OS=Homo sapiens OX=96... [more]
back to top
BLAST of Radial spoke head 14-like protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1I8J1N94.978e-9650.15Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267ETD15.606e-9650.15Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
A0A1S3HML56.431e-9450.00radial spoke head 14 homolog OS=Lingula unguis OX=... [more]
C3YDA53.661e-8948.53Uncharacterized protein OS=Branchiostoma floridae ... [more]
A0A4S2KYH16.639e-8947.21Uncharacterized protein OS=Opisthorchis felineus O... [more]
back to top
BLAST of Radial spoke head 14-like protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
rsph144.506e-4834.69radial spoke head 14 homolog [Source:NCBI gene;Acc... [more]
back to top
BLAST of Radial spoke head 14-like protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000005642.18.154e-7244.01pep scaffold:Pmarinus_7.0:GL476474:164372:179435:1... [more]
back to top
BLAST of Radial spoke head 14-like protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Radial spoke head 14-like protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO465985.058e-7743.40Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Radial spoke head 14-like protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSORLT00000034911.14.358e-2329.24radial spoke head 14 homolog [Source:NCBI gene;Acc... [more]
back to top
BLAST of Radial spoke head 14-like protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000077061.10.000e+099.41SMESG000077061.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30009188 ID=SMED30009188|Name=Radial spoke head 14-like protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1180bp
ATGAAAACACTTTTATATTAAAATTATTAGGTCTTACCATTTTCAGATTA
ATTTAATTTTCTAAACTTTTAAGATTTTACCAATTTTTAATGGCTGGTGT
ACAAATATCATTTGAACCTCCACCAGATATTGATTGTACCAAAGCAACAT
TAGCTTATGGTTTAAGAGCCATTCCAAGACTAGGTAGAGAATTGATCAGT
CCAGATTTATTAACTAGACAAAAAGCCCTTAAAGCTCTTATTGATTATTT
ACATGATCATGAGCATATTGCATCTTCTGTTAATGGAGGTATTGTTCCAT
CAATTAGAAATCTACTTGAAGCGTGTGATGTTACTTGTAGAACCTTGGCA
GTTGAAGTTTGTTATGTATACAGCATGCATTCAGTTGGAAGAATGGCACT
GTTAGAAAATGGTGTCATAATTACACTTGGAAAATTGTTTTCTGATAAAG
AATTGATTATACGAAAATTGGTTTATAAAACTTTAGAAATGACCTCGGAA
TATTGGTTCGGCGCCGAGGCTATTATCAATGCCAATTTGATACCAGATTT
ATTTATTAAAGTTCAAGAAGAAATTGATGAATTAAAAGTATACATTTTGG
AATGTCTACATTTCTGTCTGTTACTCGATGTCAAGGATGCTCTACAAAAT
CAGGGCATCAAAATTTTAACTGCGCTTCTTTTTCATGAAAAAAATGAAAT
CAAAGCTAAAGCAGCAAAATGTATCATCGATATAGCGATGAGTCACGAAG
GAAAAGAAATGGCCATCAAAGAAGAAACGGTTCCTCCGTTGATTGAAATG
CTAAAACAACAGGAAAGCACCGTAAAGGCATCCGCTGCTGGTGCCATAGC
AAATATTGCTATAATTACCCATGGAAAGTATGCCGCTATCAATTTTGGTG
CTCTGCCTCATTTGTTGCCTTTGATAAATGATCCGAACAGCGAAGTGAGA
GTCAATTCCATCAAAGCGTTGACATGTATTGCTGAGACACCGGAAGGACG
CAGACTACTCTTAGATCACATAGATCTATTTAAGGGCCGAATGCTGGATA
CCCTGGATGCAGTGGCACAGCATGCTAAAATAGCAGTCGATGTCATCACA
TGGAAGCCTTAATGATGTAATAATATATTAATAGTTCATTTCTGTTTTTG
AGTAAAATAAGGTTCTTTATTGATTTGGAA
back to top

protein sequence of SMED30009188-orf-1

>SMED30009188-orf-1 ID=SMED30009188-orf-1|Name=SMED30009188-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=341bp
MAGVQISFEPPPDIDCTKATLAYGLRAIPRLGRELISPDLLTRQKALKAL
IDYLHDHEHIASSVNGGIVPSIRNLLEACDVTCRTLAVEVCYVYSMHSVG
RMALLENGVIITLGKLFSDKELIIRKLVYKTLEMTSEYWFGAEAIINANL
IPDLFIKVQEEIDELKVYILECLHFCLLLDVKDALQNQGIKILTALLFHE
KNEIKAKAAKCIIDIAMSHEGKEMAIKEETVPPLIEMLKQQESTVKASAA
GAIANIAIITHGKYAAINFGALPHLLPLINDPNSEVRVNSIKALTCIAET
PEGRRLLLDHIDLFKGRMLDTLDAVAQHAKIAVDVITWKP*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000106ciliated epithelial cell
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR032682Cnd1_C
IPR042856RSP14
IPR000225Armadillo
IPR000357HEAT
IPR011989ARM-like
IPR021133HEAT_type_2
IPR016024ARM-type_fold
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0005488binding
GO:0003674molecular_function
Vocabulary: cellular component
TermDefinition
GO:0005575cellular_component
Vocabulary: biological process
TermDefinition
GO:0008150biological_process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000225ArmadilloSMARTSM00185arm_5coord: 218..258
e-value: 0.062
score: 22.4
coord: 259..299
e-value: 45.0
score: 8.2
IPR000225ArmadilloPROSITEPS50176ARM_REPEATcoord: 229..271
score: 8.522
IPR011989Armadillo-like helicalGENE3DG3DSA:1.25.10.10coord: 15..334
e-value: 7.8E-32
score: 112.4
IPR032682Condensin complex subunit 1, C-terminalPFAMPF12717Cnd1coord: 224..304
e-value: 3.9E-6
score: 27.0
NoneNo IPR availablePANTHERPTHR15599:SF1RADIAL SPOKE HEAD 14 HOMOLOGcoord: 6..327
IPR042856Radial spoke protein 14PANTHERPTHR15599RTDR1coord: 6..327
IPR021133HEAT, type 2PROSITEPS50077HEAT_REPEATcoord: 271..306
score: 9.196
IPR016024Armadillo-type foldSUPERFAMILYSSF48371ARM repeatcoord: 26..312