Transient-receptor-potential-like protein

Overview
NameTransient-receptor-potential-like protein
Smed IDSMED30009185
Length (bp)735
Neoblast Clusters

Zeng et. al., 2018




 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30009185

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30009185h1SMcG0007553 SmedASXL_003057SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30009185h1SMcG0007553 dd_Smed_v4_97628_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30009185h1SMcG0007553 dd_Smed_v4_97628_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30009185h1SMcG0007553 dd_Smed_v4_97628_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
photoreceptor neuronSMED30009185h1SMcG0007553 SMED30025288smed_20140614PMID:22884275
Lapan et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Transient-receptor-potential-like protein vs. Ensembl Human
Match: TRPC5 (transient receptor potential cation channel subfamily C member 5 [Source:HGNC Symbol;Acc:HGNC:12337])

HSP 1 Score: 169.088 bits (427), Expect = 2.921e-47
Identity = 99/251 (39.44%), Postives = 153/251 (60.96%), Query Frame = 2
Query:   38 IPLNPLKNLKPINTKERELLDAVDHGDRATVERMLFTEPL---VDINCTNVLGRTPLFLAVDNENSELVRLLLRHPNIIIGDSLLQAIKEGVYGIVEQLINH--PTIEQEILSSSWPGSEASKEIDSPEFRPDISPVMLAAICNQFEILQLLLSRGATIEQPHPASCHCHPCQESIQRDTLRHSLRRISTYRALAN--------------AFKLSVELSKLSSCENEFKETYLQLSDQCKGLACDLLEECR 733
            IPL  ++    ++ +E+  L+AV+ GD ATV++ L    +   V+INC + LGR+ L +A++NEN E++ LLL H ++ +GD+LL AI++ V G VE L+++  P+ E+++ +          +    EF PDI+P+MLAA  N +EI++LL+ +  TI +PH   C+C  C  S + D+LRHS  R++ Y+ALA+              AF+L  EL +LS  ENEFK  Y +LS QCK  A DLL++ R
Sbjct:   18 IPLQIVRAETELSAEEKAFLNAVEKGDYATVKQALQEAEIYYNVNINCMDPLGRSALLIAIENENLEIMELLLNH-SVYVGDALLYAIRKEVVGAVELLLSYRRPSGEKQVPT-------LMMDTQFSEFTPDITPIMLAAHTNNYEIIKLLVQKRVTIPRPHQIRCNCVECVSSSEVDSLRHSRSRLNIYKALASPSLIALSSEDPILTAFRLGWELKELSKVENEFKAEYEELSQQCKLFAKDLLDQAR 260          
BLAST of Transient-receptor-potential-like protein vs. Ensembl Human
Match: TRPC3 (transient receptor potential cation channel subfamily C member 3 [Source:HGNC Symbol;Acc:HGNC:12335])

HSP 1 Score: 160.229 bits (404), Expect = 2.079e-44
Identity = 90/247 (36.44%), Postives = 135/247 (54.66%), Query Frame = 2
Query:   71 INTKERELLDAVDHGDRATVERMLFTEPLVDINCTNVLGRTPLFLAVDNENSELVRLLLRHPNII-IGDSLLQAIKEGVYGIVEQLINHPTI-----------EQEILSSSWPGSEASKEIDSPEFRPDISPVMLAAICNQFEILQLLLSRGATIEQPHPASCHCHPCQESIQRDTLRHSLRRISTYRALAN--------------AFKLSVELSKLSSCENEFKETYLQLSDQCKGLACDLLEECR 733
            +  +E   LDA ++G+   V +ML     +++NC + +G+  L LAV NE+ E+  LLL+  N+  IGD+LL AI +G   IVE ++NHP             EQE+    +   +     D   F PDI+P++LAA C ++E++ +LL +GA IE+PH   C C  C E  + D+  HS  RI+ Y+ LA+              A +LS EL+KL++ E EFK  Y +LS QCK     +L+ CR
Sbjct:   36 LTAEEERFLDAAEYGNIPVVRKMLEESKTLNVNCVDYMGQNALQLAVGNEHLEVTELLLKKENLARIGDALLLAISKGYVRIVEAILNHPGFAASKRLTLSPCEQELQDDDFYAYDE----DGTRFSPDITPIILAAHCQKYEVVHMLLMKGARIERPHDYFCKCGDCMEKQRHDSFSHSRSRINAYKGLASPAYLSLSSEDPVLTALELSNELAKLANIEKEFKNDYRKLSMQCKDFVVGVLDLCR 278          
BLAST of Transient-receptor-potential-like protein vs. Ensembl Human
Match: TRPC3 (transient receptor potential cation channel subfamily C member 3 [Source:HGNC Symbol;Acc:HGNC:12335])

HSP 1 Score: 159.844 bits (403), Expect = 3.331e-44
Identity = 90/247 (36.44%), Postives = 135/247 (54.66%), Query Frame = 2
Query:   71 INTKERELLDAVDHGDRATVERMLFTEPLVDINCTNVLGRTPLFLAVDNENSELVRLLLRHPNII-IGDSLLQAIKEGVYGIVEQLINHPTI-----------EQEILSSSWPGSEASKEIDSPEFRPDISPVMLAAICNQFEILQLLLSRGATIEQPHPASCHCHPCQESIQRDTLRHSLRRISTYRALAN--------------AFKLSVELSKLSSCENEFKETYLQLSDQCKGLACDLLEECR 733
            +  +E   LDA ++G+   V +ML     +++NC + +G+  L LAV NE+ E+  LLL+  N+  IGD+LL AI +G   IVE ++NHP             EQE+    +   +     D   F PDI+P++LAA C ++E++ +LL +GA IE+PH   C C  C E  + D+  HS  RI+ Y+ LA+              A +LS EL+KL++ E EFK  Y +LS QCK     +L+ CR
Sbjct:   36 LTAEEERFLDAAEYGNIPVVRKMLEESKTLNVNCVDYMGQNALQLAVGNEHLEVTELLLKKENLARIGDALLLAISKGYVRIVEAILNHPGFAASKRLTLSPCEQELQDDDFYAYDE----DGTRFSPDITPIILAAHCQKYEVVHMLLMKGARIERPHDYFCKCGDCMEKQRHDSFSHSRSRINAYKGLASPAYLSLSSEDPVLTALELSNELAKLANIEKEFKNDYRKLSMQCKDFVVGVLDLCR 278          
BLAST of Transient-receptor-potential-like protein vs. Ensembl Human
Match: TRPC3 (transient receptor potential cation channel subfamily C member 3 [Source:HGNC Symbol;Acc:HGNC:12335])

HSP 1 Score: 159.844 bits (403), Expect = 4.441e-44
Identity = 90/247 (36.44%), Postives = 135/247 (54.66%), Query Frame = 2
Query:   71 INTKERELLDAVDHGDRATVERMLFTEPLVDINCTNVLGRTPLFLAVDNENSELVRLLLRHPNII-IGDSLLQAIKEGVYGIVEQLINHPTI-----------EQEILSSSWPGSEASKEIDSPEFRPDISPVMLAAICNQFEILQLLLSRGATIEQPHPASCHCHPCQESIQRDTLRHSLRRISTYRALAN--------------AFKLSVELSKLSSCENEFKETYLQLSDQCKGLACDLLEECR 733
            +  +E   LDA ++G+   V +ML     +++NC + +G+  L LAV NE+ E+  LLL+  N+  IGD+LL AI +G   IVE ++NHP             EQE+    +   +     D   F PDI+P++LAA C ++E++ +LL +GA IE+PH   C C  C E  + D+  HS  RI+ Y+ LA+              A +LS EL+KL++ E EFK  Y +LS QCK     +L+ CR
Sbjct:  109 LTAEEERFLDAAEYGNIPVVRKMLEESKTLNVNCVDYMGQNALQLAVGNEHLEVTELLLKKENLARIGDALLLAISKGYVRIVEAILNHPGFAASKRLTLSPCEQELQDDDFYAYDE----DGTRFSPDITPIILAAHCQKYEVVHMLLMKGARIERPHDYFCKCGDCMEKQRHDSFSHSRSRINAYKGLASPAYLSLSSEDPVLTALELSNELAKLANIEKEFKNDYRKLSMQCKDFVVGVLDLCR 351          
BLAST of Transient-receptor-potential-like protein vs. Ensembl Human
Match: TRPC4 (transient receptor potential cation channel subfamily C member 4 [Source:HGNC Symbol;Acc:HGNC:12336])

HSP 1 Score: 152.14 bits (383), Expect = 4.945e-44
Identity = 102/251 (40.64%), Postives = 153/251 (60.96%), Query Frame = 2
Query:   38 IPLNPLKNLKPINTKERELLDAVDHGDRATVERMLFTEPL---VDINCTNVLGRTPLFLAVDNENSELVRLLLRHPNIIIGDSLLQAIKEGVYGIVEQLINH--PTIEQEILSSSWPGSEASKEIDSPEFRPDISPVMLAAICNQFEILQLLLSRGATIEQPHPASCHCHPCQESIQRDTLRHSLRRISTYRALAN--------------AFKLSVELSKLSSCENEFKETYLQLSDQCKGLACDLLEECR 733
            IPL  ++    ++  E+  L+AV+ GD A+V++ L    +   ++INC + LGRT L +A++NEN EL+ LLL   N+ +GD+LL AI++ V G VE L+NH  P+ E+++     P     K+    EF PDI+P++LAA  N +EI++LL+ +G ++ +PH   C+C  C  S   D+LRHS  R++ Y+ALA+              AF+LS EL +LS  ENEFK  Y +LS QCK  A DLL++ R
Sbjct:   18 IPLRIVRAESELSPSEKAYLNAVEKGDYASVKKSLEEAEIYFKININCIDPLGRTALLIAIENENLELIELLLSF-NVYVGDALLHAIRKEVVGAVELLLNHKKPSGEKQV-----PPILLDKQFS--EFTPDITPIILAAHTNNYEIIKLLVQKGVSVPRPHEVRCNCVECVSSSDVDSLRHSRSRLNIYKALASPSLIALSSEDPFLTAFQLSWELQELSKVENEFKSEYEELSRQCKQFAKDLLDQTR 260          
BLAST of Transient-receptor-potential-like protein vs. Ensembl Celegans
Match: trp-1 (Transient-receptor-potential-like protein [Source:UniProtKB/Swiss-Prot;Acc:P34586])

HSP 1 Score: 211.846 bits (538), Expect = 8.610e-63
Identity = 113/237 (47.68%), Postives = 160/237 (67.51%), Query Frame = 2
Query:   71 INTKERELLDAVDHGDRATVERMLFTEP--LVDINCTNVLGRTPLFLAVDNENSELVRLLLRHPNIIIGDSLLQAIKEGVYGIVEQLINHPTIEQEILSSSWPGSEASKEIDSPEFRPDISPVMLAAICNQFEILQLLLSRGATIEQPHPASCHCHPCQESIQRDTLRHSLRRISTYRALA--------------NAFKLSVELSKLSSCENEFKETYLQLSDQCKGLACDLLEECR 733
            I+ +ER  L+A + G++ T++  L  +    +++NC + +GRT L +AVDNEN E+V LLL+ P+I IG++LL AI+EGVY +VE L+NHP I +E+L   W  +    E  S E+  DISPV+LAA  NQFEILQ+L+ + A+IE+PH  SC C  C      D+L++SL+RI+T+RALA              +AFKLS +L +L+  E+EFKETYLQLS+QCK  +CDLL +CR
Sbjct:   46 ISPEERRFLEAAELGNKPTLQECLDYDGDRRLNVNCLDSMGRTALEIAVDNENMEVVELLLQQPDIRIGNALLCAIREGVYRLVEVLVNHPNITREMLGDGWSQALDPSEAASAEYSSDISPVILAAQLNQFEILQMLIRKDASIEKPHRHSCICETCDRERLNDSLQYSLKRINTFRALASPAWMSLTSPDPILSAFKLSWDLQRLAFEEHEFKETYLQLSEQCKQYSCDLLSQCR 282          
BLAST of Transient-receptor-potential-like protein vs. Ensembl Celegans
Match: trp-1 (Transient-receptor-potential-like protein [Source:UniProtKB/Swiss-Prot;Acc:P34586])

HSP 1 Score: 207.223 bits (526), Expect = 4.104e-61
Identity = 110/230 (47.83%), Postives = 155/230 (67.39%), Query Frame = 2
Query:   92 LLDAVDHGDRATVERMLFTEP--LVDINCTNVLGRTPLFLAVDNENSELVRLLLRHPNIIIGDSLLQAIKEGVYGIVEQLINHPTIEQEILSSSWPGSEASKEIDSPEFRPDISPVMLAAICNQFEILQLLLSRGATIEQPHPASCHCHPCQESIQRDTLRHSLRRISTYRALA--------------NAFKLSVELSKLSSCENEFKETYLQLSDQCKGLACDLLEECR 733
             L+A + G++ T++  L  +    +++NC + +GRT L +AVDNEN E+V LLL+ P+I IG++LL AI+EGVY +VE L+NHP I +E+L   W  +    E  S E+  DISPV+LAA  NQFEILQ+L+ + A+IE+PH  SC C  C      D+L++SL+RI+T+RALA              +AFKLS +L +L+  E+EFKETYLQLS+QCK  +CDLL +CR
Sbjct:   73 FLEAAELGNKPTLQECLDYDGDRRLNVNCLDSMGRTALEIAVDNENMEVVELLLQQPDIRIGNALLCAIREGVYRLVEVLVNHPNITREMLGDGWSQALDPSEAASAEYSSDISPVILAAQLNQFEILQMLIRKDASIEKPHRHSCICETCDRERLNDSLQYSLKRINTFRALASPAWMSLTSPDPILSAFKLSWDLQRLAFEEHEFKETYLQLSEQCKQYSCDLLSQCR 302          
BLAST of Transient-receptor-potential-like protein vs. Ensembl Celegans
Match: trp-2 (TRP (Transient receptor potential) channel family; TRP homlogous cation channel protein [Source:UniProtKB/TrEMBL;Acc:G5EE02])

HSP 1 Score: 131.339 bits (329), Expect = 1.194e-34
Identity = 81/234 (34.62%), Postives = 128/234 (54.70%), Query Frame = 2
Query:   80 KERELLDAVDHGDRATVERML--FTEPLVDINCTNVLGRTPLFLAVDNENSELVRLLLRHPNIIIGDSLLQAIKEGVYGIVEQLINHPTIEQEILSSSWPGSEASKEIDSPEFRPDISPVMLAAICNQFEILQLLLSRGATIEQPHPASCHCHPCQESIQRDTLRHSLRRISTYRALAN--------------AFKLSVELSKLSSCENEFKETYLQLSDQCKGLACDLLEECR 733
            +E++ L + + GD  +V ++L   +    +INC + LGR  L +A++NEN E++ LLL H NI  GD++L AI E     VE ++ H   + +   S   G E ++      F PDI+P++LAA  + +E ++L L +  T+  PH   C C  C  + + D+LR S  RI+ YRAL +              AF+LS EL +LS  ENEF+  Y +LS +C+     +L++ R
Sbjct:   33 REKQFLLSCERGDIGSVRKLLAGISTETFNINCLDPLGRNALLIAIENENIEMIELLLDH-NIETGDAILYAIGEENVEAVEIIVEHLE-KMDKFDSERQGVEITEH---SAFTPDITPIVLAAHKDNYECIKLFLDKKGTVPHPHDVRCSCPECYVAREEDSLRLSRSRINAYRALTSPSLICLSARDPILYAFELSWELKRLSFIENEFRTDYEELSQKCQKFCVHMLDQVR 261          
BLAST of Transient-receptor-potential-like protein vs. Ensembl Celegans
Match: trp-2 (TRP (Transient receptor potential) channel family; TRP homlogous cation channel protein [Source:UniProtKB/TrEMBL;Acc:G5EE02])

HSP 1 Score: 131.339 bits (329), Expect = 1.245e-34
Identity = 81/234 (34.62%), Postives = 128/234 (54.70%), Query Frame = 2
Query:   80 KERELLDAVDHGDRATVERML--FTEPLVDINCTNVLGRTPLFLAVDNENSELVRLLLRHPNIIIGDSLLQAIKEGVYGIVEQLINHPTIEQEILSSSWPGSEASKEIDSPEFRPDISPVMLAAICNQFEILQLLLSRGATIEQPHPASCHCHPCQESIQRDTLRHSLRRISTYRALAN--------------AFKLSVELSKLSSCENEFKETYLQLSDQCKGLACDLLEECR 733
            +E++ L + + GD  +V ++L   +    +INC + LGR  L +A++NEN E++ LLL H NI  GD++L AI E     VE ++ H   + +   S   G E +   +   F PDI+P++LAA  + +E ++L L +  T+  PH   C C  C  + + D+LR S  RI+ YRAL +              AF+LS EL +LS  ENEF+  Y +LS +C+     +L++ R
Sbjct:   33 REKQFLLSCERGDIGSVRKLLAGISTETFNINCLDPLGRNALLIAIENENIEMIELLLDH-NIETGDAILYAIGEENVEAVEIIVEHLE-KMDKFDSERQGVEIT---EHSAFTPDITPIVLAAHKDNYECIKLFLDKKGTVPHPHDVRCSCPECYVAREEDSLRLSRSRINAYRALTSPSLICLSARDPILYAFELSWELKRLSFIENEFRTDYEELSQKCQKFCVHMLDQVR 261          
BLAST of Transient-receptor-potential-like protein vs. Ensembl Celegans
Match: spe-41 (TRP homologous cation channel protein; TRP-3 channel protein [Source:UniProtKB/TrEMBL;Acc:G5EF09])

HSP 1 Score: 65.4698 bits (158), Expect = 5.009e-12
Identity = 48/167 (28.74%), Postives = 79/167 (47.31%), Query Frame = 2
Query:  272 DSLLQAIKEGVYGIVEQLINHPTIEQEILSSSWPGSEASKEIDSPEFRPDISPVMLAAICNQFEILQLLLSRGATIEQPHPASCHCHPCQESIQRDTLRHSLRRISTYRALANAFKL--------------SVELSKLSSCEN-EFKETYLQLSDQCKGLACDLLEE 727
            ++LL +I  G   +VE ++        +L    P  E S   +SP F P ++P+MLA I N F I+Q L++RG  I+ PH  +C C  C+   +  T   S R +   RAL++   L              + +L +L+S +  E+ ETY  L    +   C + ++
Sbjct:  102 EALLLSIAVGSRPLVEFVL--------VLFVDAPYLERSGSANSPHFPPHMTPLMLACILNNFSIVQCLITRGHCIQIPHFITCECKTCKR--ETVTTHSSTRLVDVMRALSSEAYLWLATDDVFAATCAVARDLQQLASDDQLEYVETYRDLEMNVQRFLCRISDQ 258          
BLAST of Transient-receptor-potential-like protein vs. Ensembl Fly
Match: Trpgamma (gene:FBgn0032593 transcript:FBtr0335144)

HSP 1 Score: 160.999 bits (406), Expect = 8.429e-45
Identity = 96/247 (38.87%), Postives = 139/247 (56.28%), Query Frame = 2
Query:   44 LNPLKNLKPINTKERELLDAVDHGDRATVERMLFTEP---LVDINCTNVLGRTPLFLAVDNENSELVRLLLRHPNIIIGDSLLQAIKEGVYGIVEQLINHPTIEQEILSSSWPGSEASKEIDSPEFRPDISPVMLAAICNQFEILQLLLSRGATIEQPHPASCHCHPCQESIQRDTLRHSLRRISTYRALAN--------------AFKLSVELSKLSSCENEFKETYLQLSDQCKGLACDLLEECR 733
            + P + ++ +  +E++ L AV+ GD A   RML        +++NC + LGRT L +A+DNEN E+V LL+ + N+   D+LL +I E     VE L++H   E     S    S  S   D+  F PDI+P++LAA  + +EI+++LL RGA +  PH   C C  C +S Q D+LRHS  RI+ YRALA+              AF+LS EL +LS  E+EFK  Y +L  QC+  A  LL+  R
Sbjct:   69 IRPHQEIRQLTLEEKKFLLAVERGDMAGTRRMLQKAQDTEYINVNCVDPLGRTALLMAIDNENLEMVELLINY-NVDTKDALLHSISEEFVEAVEVLLDH---ENVTFHSEGNHSWESASEDTSTFTPDITPLILAAHRDNYEIIKILLDRGAVLPMPHDVRCGCDECVQSRQEDSLRHSRSRINAYRALASPSLIALSSKDPILTAFELSWELRRLSFLEHEFKNEYQELRKQCQDFATALLDHTR 311          
BLAST of Transient-receptor-potential-like protein vs. Ensembl Fly
Match: Trpgamma (gene:FBgn0032593 transcript:FBtr0080945)

HSP 1 Score: 160.999 bits (406), Expect = 9.102e-45
Identity = 96/247 (38.87%), Postives = 139/247 (56.28%), Query Frame = 2
Query:   44 LNPLKNLKPINTKERELLDAVDHGDRATVERMLFTEP---LVDINCTNVLGRTPLFLAVDNENSELVRLLLRHPNIIIGDSLLQAIKEGVYGIVEQLINHPTIEQEILSSSWPGSEASKEIDSPEFRPDISPVMLAAICNQFEILQLLLSRGATIEQPHPASCHCHPCQESIQRDTLRHSLRRISTYRALAN--------------AFKLSVELSKLSSCENEFKETYLQLSDQCKGLACDLLEECR 733
            + P + ++ +  +E++ L AV+ GD A   RML        +++NC + LGRT L +A+DNEN E+V LL+ + N+   D+LL +I E     VE L++H   E     S    S  S   D+  F PDI+P++LAA  + +EI+++LL RGA +  PH   C C  C +S Q D+LRHS  RI+ YRALA+              AF+LS EL +LS  E+EFK  Y +L  QC+  A  LL+  R
Sbjct:    8 IRPHQEIRQLTLEEKKFLLAVERGDMAGTRRMLQKAQDTEYINVNCVDPLGRTALLMAIDNENLEMVELLINY-NVDTKDALLHSISEEFVEAVEVLLDH---ENVTFHSEGNHSWESASEDTSTFTPDITPLILAAHRDNYEIIKILLDRGAVLPMPHDVRCGCDECVQSRQEDSLRHSRSRINAYRALASPSLIALSSKDPILTAFELSWELRRLSFLEHEFKNEYQELRKQCQDFATALLDHTR 250          
BLAST of Transient-receptor-potential-like protein vs. Ensembl Fly
Match: Trpgamma (gene:FBgn0032593 transcript:FBtr0080946)

HSP 1 Score: 160.999 bits (406), Expect = 9.102e-45
Identity = 96/247 (38.87%), Postives = 139/247 (56.28%), Query Frame = 2
Query:   44 LNPLKNLKPINTKERELLDAVDHGDRATVERMLFTEP---LVDINCTNVLGRTPLFLAVDNENSELVRLLLRHPNIIIGDSLLQAIKEGVYGIVEQLINHPTIEQEILSSSWPGSEASKEIDSPEFRPDISPVMLAAICNQFEILQLLLSRGATIEQPHPASCHCHPCQESIQRDTLRHSLRRISTYRALAN--------------AFKLSVELSKLSSCENEFKETYLQLSDQCKGLACDLLEECR 733
            + P + ++ +  +E++ L AV+ GD A   RML        +++NC + LGRT L +A+DNEN E+V LL+ + N+   D+LL +I E     VE L++H   E     S    S  S   D+  F PDI+P++LAA  + +EI+++LL RGA +  PH   C C  C +S Q D+LRHS  RI+ YRALA+              AF+LS EL +LS  E+EFK  Y +L  QC+  A  LL+  R
Sbjct:    8 IRPHQEIRQLTLEEKKFLLAVERGDMAGTRRMLQKAQDTEYINVNCVDPLGRTALLMAIDNENLEMVELLINY-NVDTKDALLHSISEEFVEAVEVLLDH---ENVTFHSEGNHSWESASEDTSTFTPDITPLILAAHRDNYEIIKILLDRGAVLPMPHDVRCGCDECVQSRQEDSLRHSRSRINAYRALASPSLIALSSKDPILTAFELSWELRRLSFLEHEFKNEYQELRKQCQDFATALLDHTR 250          
BLAST of Transient-receptor-potential-like protein vs. Ensembl Fly
Match: trpl (gene:FBgn0005614 transcript:FBtr0088471)

HSP 1 Score: 138.272 bits (347), Expect = 6.267e-37
Identity = 91/232 (39.22%), Postives = 122/232 (52.59%), Query Frame = 2
Query:  101 AVDHGDRATVERML---FTEPLVDINCTNVLGRTPLFLAVDNENSELVRLLLRHPNIIIG----DSLLQAIKEGVYGIVEQLINHPTIEQEILSSSWPGSEASKEIDSPEFRPDISPVMLAAICNQFEILQLLLSRGATIEQPHPASCHCHPCQESIQRDTLRHSLRRISTYRALAN--------------AFKLSVELSKLSSCENEFKETYLQLSDQCKGLACDLLEECR 733
            AV+ GD   V R+L        ++INC + LGR  L LA+DNEN E+V LL     +++G    D+LL AI       VE +      E+ I     P S    +I++  F PDI+P+MLAA  N FEIL++LL RGA +  PH   C C  C      D+LRHSL R++ YRAL +              AF+LS EL  L+  E E K  Y+ L  QC+  A DLL++ R
Sbjct:   48 AVERGDMPNVRRILQKALRHQHININCMDPLGRRALTLAIDNENLEMVELL-----VVMGVETKDALLHAINAE---FVEAVELLLEHEELIYKEGEPYSWQKVDINTAMFAPDITPLMLAAHKNNFEILRILLDRGAAVPVPHDIRCGCEECVRLTAEDSLRHSLSRVNIYRALCSPSLICLTSNDPIITAFQLSWELRNLALTEQECKSEYMDLRRQCQKFAVDLLDQTR 271          
BLAST of Transient-receptor-potential-like protein vs. Ensembl Fly
Match: trpl (gene:FBgn0005614 transcript:FBtr0301662)

HSP 1 Score: 138.272 bits (347), Expect = 6.267e-37
Identity = 91/232 (39.22%), Postives = 122/232 (52.59%), Query Frame = 2
Query:  101 AVDHGDRATVERML---FTEPLVDINCTNVLGRTPLFLAVDNENSELVRLLLRHPNIIIG----DSLLQAIKEGVYGIVEQLINHPTIEQEILSSSWPGSEASKEIDSPEFRPDISPVMLAAICNQFEILQLLLSRGATIEQPHPASCHCHPCQESIQRDTLRHSLRRISTYRALAN--------------AFKLSVELSKLSSCENEFKETYLQLSDQCKGLACDLLEECR 733
            AV+ GD   V R+L        ++INC + LGR  L LA+DNEN E+V LL     +++G    D+LL AI       VE +      E+ I     P S    +I++  F PDI+P+MLAA  N FEIL++LL RGA +  PH   C C  C      D+LRHSL R++ YRAL +              AF+LS EL  L+  E E K  Y+ L  QC+  A DLL++ R
Sbjct:   48 AVERGDMPNVRRILQKALRHQHININCMDPLGRRALTLAIDNENLEMVELL-----VVMGVETKDALLHAINAE---FVEAVELLLEHEELIYKEGEPYSWQKVDINTAMFAPDITPLMLAAHKNNFEILRILLDRGAAVPVPHDIRCGCEECVRLTAEDSLRHSLSRVNIYRALCSPSLICLTSNDPIITAFQLSWELRNLALTEQECKSEYMDLRRQCQKFAVDLLDQTR 271          
BLAST of Transient-receptor-potential-like protein vs. Ensembl Zebrafish
Match: trpc4b (transient receptor potential cation channel, subfamily C, member 4b [Source:ZFIN;Acc:ZDB-GENE-120329-1])

HSP 1 Score: 173.711 bits (439), Expect = 3.217e-49
Identity = 101/251 (40.24%), Postives = 153/251 (60.96%), Query Frame = 2
Query:   38 IPLNPLKNLKPINTKERELLDAVDHGDRATVERMLFTEPL---VDINCTNVLGRTPLFLAVDNENSELVRLLLRHPNIIIGDSLLQAIKEGVYGIVEQLINH--PTIEQEILSSSWPGSEASKEIDSPEFRPDISPVMLAAICNQFEILQLLLSRGATIEQPHPASCHCHPCQESIQRDTLRHSLRRISTYRALAN--------------AFKLSVELSKLSSCENEFKETYLQLSDQCKGLACDLLEECR 733
            IPL  ++    ++T+E+  L AV+ GD A+V+  L    +   ++INC + LGRT L +A++NEN E++ LLL   N+ +GD+LL AI++ V G VE L+NH  P+ E+++     P     K+    +F PDI+P++LAA  N +EI+++L+ +G ++ QPH   C+C  C  S   D+LRHS  R++ Y+ALA+              AF+LS EL +LS  ENEFK  Y +LS QCK  A DLL++ R
Sbjct:   18 IPLRIVRAESELSTQEKSYLSAVEKGDYASVKLALEEAEIYFKININCIDPLGRTALLIAIENENLEIIELLLSF-NVYVGDALLHAIRKEVVGAVELLLNHKKPSGEKQV-----PPILLDKQFS--DFTPDITPIILAAHTNNYEIIKMLVQKGVSVPQPHEVRCNCVECVSSSDVDSLRHSRSRLNIYKALASPSLIALSSEDPFLTAFQLSWELQELSKVENEFKAEYEELSHQCKHFAKDLLDQTR 260          
BLAST of Transient-receptor-potential-like protein vs. Ensembl Zebrafish
Match: trpc4b (transient receptor potential cation channel, subfamily C, member 4b [Source:ZFIN;Acc:ZDB-GENE-120329-1])

HSP 1 Score: 173.711 bits (439), Expect = 3.217e-49
Identity = 101/251 (40.24%), Postives = 153/251 (60.96%), Query Frame = 2
Query:   38 IPLNPLKNLKPINTKERELLDAVDHGDRATVERMLFTEPL---VDINCTNVLGRTPLFLAVDNENSELVRLLLRHPNIIIGDSLLQAIKEGVYGIVEQLINH--PTIEQEILSSSWPGSEASKEIDSPEFRPDISPVMLAAICNQFEILQLLLSRGATIEQPHPASCHCHPCQESIQRDTLRHSLRRISTYRALAN--------------AFKLSVELSKLSSCENEFKETYLQLSDQCKGLACDLLEECR 733
            IPL  ++    ++T+E+  L AV+ GD A+V+  L    +   ++INC + LGRT L +A++NEN E++ LLL   N+ +GD+LL AI++ V G VE L+NH  P+ E+++     P     K+    +F PDI+P++LAA  N +EI+++L+ +G ++ QPH   C+C  C  S   D+LRHS  R++ Y+ALA+              AF+LS EL +LS  ENEFK  Y +LS QCK  A DLL++ R
Sbjct:   18 IPLRIVRAESELSTQEKSYLSAVEKGDYASVKLALEEAEIYFKININCIDPLGRTALLIAIENENLEIIELLLSF-NVYVGDALLHAIRKEVVGAVELLLNHKKPSGEKQV-----PPILLDKQFS--DFTPDITPIILAAHTNNYEIIKMLVQKGVSVPQPHEVRCNCVECVSSSDVDSLRHSRSRLNIYKALASPSLIALSSEDPFLTAFQLSWELQELSKVENEFKAEYEELSHQCKHFAKDLLDQTR 260          
BLAST of Transient-receptor-potential-like protein vs. Ensembl Zebrafish
Match: trpc4a (transient receptor potential cation channel, subfamily C, member 4a [Source:ZFIN;Acc:ZDB-GENE-131217-1])

HSP 1 Score: 168.703 bits (426), Expect = 1.871e-47
Identity = 99/251 (39.44%), Postives = 150/251 (59.76%), Query Frame = 2
Query:   38 IPLNPLKNLKPINTKERELLDAVDHGDRATVERMLFTEPL---VDINCTNVLGRTPLFLAVDNENSELVRLLLRHPNIIIGDSLLQAIKEGVYGIVEQLINH--PTIEQEILSSSWPGSEASKEIDSPEFRPDISPVMLAAICNQFEILQLLLSRGATIEQPHPASCHCHPCQESIQRDTLRHSLRRISTYRALAN--------------AFKLSVELSKLSSCENEFKETYLQLSDQCKGLACDLLEECR 733
            IPL  +++   ++  E+  L AV+ GD  +V++ L    +   ++INC + LGRT L +A++NEN E++ LLL   N+ +GD+LL AI++ V G VE L+NH  P+   ++     P     K+    +F PDI+P++LAA  N +EI+++L+ +G ++ QPH   C+C  C  S   D+LRHS  R++ YRALA+              AF+LS EL +LS  ENEFK  Y +LS QCK  A DLL++ R
Sbjct:   18 IPLRIVRSESELSPLEKAYLWAVEKGDYGSVKQALIEAEIYFKININCIDPLGRTALLIAIENENLEIIELLLSF-NVYVGDALLHAIRKEVVGAVELLLNHKKPSGGMQV-----PPILLDKQFS--DFTPDITPIILAAHTNNYEIIKMLVQKGVSMPQPHQVRCNCMECVSSSDVDSLRHSRSRLNIYRALASPSLVALSSEDPFLTAFQLSWELQELSKVENEFKSEYEELSQQCKQFAKDLLDQTR 260          
BLAST of Transient-receptor-potential-like protein vs. Ensembl Zebrafish
Match: trpc4a (transient receptor potential cation channel, subfamily C, member 4a [Source:ZFIN;Acc:ZDB-GENE-131217-1])

HSP 1 Score: 168.703 bits (426), Expect = 1.871e-47
Identity = 99/251 (39.44%), Postives = 150/251 (59.76%), Query Frame = 2
Query:   38 IPLNPLKNLKPINTKERELLDAVDHGDRATVERMLFTEPL---VDINCTNVLGRTPLFLAVDNENSELVRLLLRHPNIIIGDSLLQAIKEGVYGIVEQLINH--PTIEQEILSSSWPGSEASKEIDSPEFRPDISPVMLAAICNQFEILQLLLSRGATIEQPHPASCHCHPCQESIQRDTLRHSLRRISTYRALAN--------------AFKLSVELSKLSSCENEFKETYLQLSDQCKGLACDLLEECR 733
            IPL  +++   ++  E+  L AV+ GD  +V++ L    +   ++INC + LGRT L +A++NEN E++ LLL   N+ +GD+LL AI++ V G VE L+NH  P+   ++     P     K+    +F PDI+P++LAA  N +EI+++L+ +G ++ QPH   C+C  C  S   D+LRHS  R++ YRALA+              AF+LS EL +LS  ENEFK  Y +LS QCK  A DLL++ R
Sbjct:   18 IPLRIVRSESELSPLEKAYLWAVEKGDYGSVKQALIEAEIYFKININCIDPLGRTALLIAIENENLEIIELLLSF-NVYVGDALLHAIRKEVVGAVELLLNHKKPSGGMQV-----PPILLDKQFS--DFTPDITPIILAAHTNNYEIIKMLVQKGVSMPQPHQVRCNCMECVSSSDVDSLRHSRSRLNIYRALASPSLVALSSEDPFLTAFQLSWELQELSKVENEFKSEYEELSQQCKQFAKDLLDQTR 260          
BLAST of Transient-receptor-potential-like protein vs. Ensembl Zebrafish
Match: trpc5b (transient receptor potential cation channel, subfamily C, member 5b [Source:ZFIN;Acc:ZDB-GENE-091112-24])

HSP 1 Score: 162.54 bits (410), Expect = 3.742e-47
Identity = 99/251 (39.44%), Postives = 148/251 (58.96%), Query Frame = 2
Query:   38 IPLNPLKNLKPINTKERELLDAVDHGDRATVERMLFTEPL---VDINCTNVLGRTPLFLAVDNENSELVRLLLRHPNIIIGDSLLQAIKEGVYGIVEQLINH--PTIEQEILSSSWPGSEASKEIDSPEFRPDISPVMLAAICNQFEILQLLLSRGATIEQPHPASCHCHPCQESIQRDTLRHSLRRISTYRALAN--------------AFKLSVELSKLSSCENEFKETYLQLSDQCKGLACDLLEECR 733
            IPL  ++    ++ KER  L AV+ GD A V++ L    +   +++NC + LGR+ L +A++NEN E++ LLL H  +  GD+LL AI++ V G VE L+++  P  E+++ S          +    EF PDI+P+MLAA  N +EI++LL+ R  TI +PH   C C  C  S + D+LRHS  R++ Y+ALA+              AF+L  EL +LS  ENEF++ Y +LS QCK  A DLL++ R
Sbjct:   33 IPLQIVRAEVELSAKERAYLTAVEKGDYAGVKQALEEADIYYNINVNCLDPLGRSALLIAIENENLEVMELLLSH-GVHTGDALLYAIRKEVVGAVELLLSYRKPCGEKQVPS-------LMMDTQFSEFTPDITPIMLAAHTNNYEIIKLLVQRKVTIPRPHQIRCDCVECVSSSEVDSLRHSRSRLNIYKALASPSLIALSSEDPILTAFRLGWELKELSKVENEFRQEYDELSQQCKLFAKDLLDQAR 275          
BLAST of Transient-receptor-potential-like protein vs. Ensembl Xenopus
Match: TRPC5 (transient receptor potential cation channel, subfamily C, member 5 [Source:NCBI gene;Acc:100493720])

HSP 1 Score: 171.014 bits (432), Expect = 5.369e-48
Identity = 101/251 (40.24%), Postives = 151/251 (60.16%), Query Frame = 2
Query:   38 IPLNPLKNLKPINTKERELLDAVDHGDRATVERMLFTEPL---VDINCTNVLGRTPLFLAVDNENSELVRLLLRHPNIIIGDSLLQAIKEGVYGIVEQLINH--PTIEQEILSSSWPGSEASKEIDSPEFRPDISPVMLAAICNQFEILQLLLSRGATIEQPHPASCHCHPCQESIQRDTLRHSLRRISTYRALAN--------------AFKLSVELSKLSSCENEFKETYLQLSDQCKGLACDLLEECR 733
            IPL  ++    ++ +E+  L AV+ GD A+V+  L    +   ++INC + LGR+ L +A++NEN E++ LLL H NI +GD+LL AI++ V G VE L++H  P+ E+++ +          +    EF PDI+P+MLAA  N +EI++LL+ R  TI +PH   C+C  C  S + D+LRHS  R++ Y+ALA+              AF+L  EL +LS  ENEFK  Y +LS QCK  A DLL++ R
Sbjct:   18 IPLQIVRAEAELSQEEKAYLIAVEKGDYASVKHALEEAEIYYNININCMDPLGRSALLIAIENENLEIMELLLSH-NIYVGDALLYAIRKEVVGAVELLLSHRKPSGEKQVPT-------LMMDTQFSEFTPDITPIMLAAHTNNYEIIKLLVQRRVTIPRPHQIRCNCVECVSSSEVDSLRHSRSRLNIYKALASPSLIALSSEDPILTAFRLGWELKELSKVENEFKAEYEELSQQCKKFAKDLLDQAR 260          
BLAST of Transient-receptor-potential-like protein vs. Ensembl Xenopus
Match: TRPC3 (transient receptor potential cation channel, subfamily C, member 3 [Source:NCBI gene;Acc:100490905])

HSP 1 Score: 161.384 bits (407), Expect = 9.988e-45
Identity = 99/271 (36.53%), Postives = 145/271 (53.51%), Query Frame = 2
Query:    8 MRRSRSRHKWI--PLNPLKNLKPINTKERE-LLDAVDHGDRATVERMLFTEPLVDINCTNVLGRTPLFLAVDNENSELVRLLLRHPNII-IGDSLLQAIKEGVYGIVEQLINHPTI-----------EQEILSSSWPGSEASKEIDSPEFRPDISPVMLAAICNQFEILQLLLSRGATIEQPHPASCHCHPCQESIQRDTLRHSLRRISTYRALAN--------------AFKLSVELSKLSSCENEFKETYLQLSDQCKGLACDLLEECR 733
            M R + R + +  P     N  P  T E E  LDA ++G+   V +ML     +++NC + +G+  L LAV NE+ E+  LLL+  N+  IGD+LL AI +G   IVE ++NHP             EQE+    +     S + D   F PDI+P++LAA C ++E++ +LL +GA IE+PH   C C  C E  + D+  HS  RI+ Y+ LA+              A +LS EL+KL++ E EFK  Y +LS QCK     +L+ CR
Sbjct:   18 MIREKGRRQAVRGPAFMFNNRGPNLTAEEERFLDAAEYGNIPVVRKMLEESKTLNVNCVDYMGQNALQLAVGNEHLEVSELLLKKDNLARIGDALLLAISKGYVRIVEAILNHPAFAASKRLTLSPCEQELQDDDF----YSYDEDGTRFSPDITPIILAAHCQKYEVVHMLLVKGAKIERPHDYFCKCSDCTEKQKHDSFSHSRSRINAYKGLASPAYLSLSSEDPVHTALELSNELAKLANIEKEFKNDYRKLSMQCKDFVVGVLDLCR 284          
BLAST of Transient-receptor-potential-like protein vs. Ensembl Xenopus
Match: nup188 (nucleoporin 188kDa [Source:Xenbase;Acc:XB-GENE-5933085])

HSP 1 Score: 152.14 bits (383), Expect = 1.802e-41
Identity = 90/243 (37.04%), Postives = 137/243 (56.38%), Query Frame = 2
Query:   71 INTKERELLDAVDHGDRATVERMLFTEPLVDINCTNVLGRTPLFLAVDNENSELVRLLLRHPNII-IGDSLLQAIKEGVYGIVEQLINHPTI-EQEILSSSWPGSE------ASKEIDSPEFRPDISPVMLAAICNQFEILQLLLSRGATIEQPHPASCHCHPCQESIQRDTLRHSLRRISTYRALAN--------------AFKLSVELSKLSSCENEFKETYLQLSDQCKGLACDLLEECR 733
            ++  E   LDA ++G+   V RM+     +++NC + +G+  L LAV NE+ E+  LLL+  N+  +GD+LL AI +G   IVE +++HP+  E + L++S   SE       + + D   F  DI+P++LAA C ++EI+  LL +GA IE+PH   C C  C E  + D+  HS  RI+ Y+ LA+              A +LS EL+ L++ E EFK  Y +LS QCK     LL+ CR
Sbjct:   38 LSADEERFLDAAEYGNIPVVRRMMEECRSLNVNCVDYMGQNALQLAVANEHLEITELLLKKENLARVGDALLLAISKGYVRIVEAILSHPSFSEGKRLTTSPSQSEFQHDDFYAYDEDGTRFSQDITPIILAAHCQEYEIVHTLLRKGARIERPHDYFCKCTECSEKQKHDSFSHSRSRINAYKGLASPAYLSLSSEDPVMTALELSNELAVLANIEKEFKNDYKKLSMQCKDFVVGLLDLCR 280          
BLAST of Transient-receptor-potential-like protein vs. Ensembl Xenopus
Match: nup188 (nucleoporin 188kDa [Source:Xenbase;Acc:XB-GENE-5933085])

HSP 1 Score: 152.14 bits (383), Expect = 2.065e-41
Identity = 90/243 (37.04%), Postives = 137/243 (56.38%), Query Frame = 2
Query:   71 INTKERELLDAVDHGDRATVERMLFTEPLVDINCTNVLGRTPLFLAVDNENSELVRLLLRHPNII-IGDSLLQAIKEGVYGIVEQLINHPTI-EQEILSSSWPGSE------ASKEIDSPEFRPDISPVMLAAICNQFEILQLLLSRGATIEQPHPASCHCHPCQESIQRDTLRHSLRRISTYRALAN--------------AFKLSVELSKLSSCENEFKETYLQLSDQCKGLACDLLEECR 733
            ++  E   LDA ++G+   V RM+     +++NC + +G+  L LAV NE+ E+  LLL+  N+  +GD+LL AI +G   IVE +++HP+  E + L++S   SE       + + D   F  DI+P++LAA C ++EI+  LL +GA IE+PH   C C  C E  + D+  HS  RI+ Y+ LA+              A +LS EL+ L++ E EFK  Y +LS QCK     LL+ CR
Sbjct:   50 LSADEERFLDAAEYGNIPVVRRMMEECRSLNVNCVDYMGQNALQLAVANEHLEITELLLKKENLARVGDALLLAISKGYVRIVEAILSHPSFSEGKRLTTSPSQSEFQHDDFYAYDEDGTRFSQDITPIILAAHCQEYEIVHTLLRKGARIERPHDYFCKCTECSEKQKHDSFSHSRSRINAYKGLASPAYLSLSSEDPVMTALELSNELAVLANIEKEFKNDYKKLSMQCKDFVVGLLDLCR 292          
BLAST of Transient-receptor-potential-like protein vs. Ensembl Xenopus
Match: nup188 (nucleoporin 188kDa [Source:Xenbase;Acc:XB-GENE-5933085])

HSP 1 Score: 151.754 bits (382), Expect = 2.082e-41
Identity = 90/243 (37.04%), Postives = 137/243 (56.38%), Query Frame = 2
Query:   71 INTKERELLDAVDHGDRATVERMLFTEPLVDINCTNVLGRTPLFLAVDNENSELVRLLLRHPNII-IGDSLLQAIKEGVYGIVEQLINHPTI-EQEILSSSWPGSE------ASKEIDSPEFRPDISPVMLAAICNQFEILQLLLSRGATIEQPHPASCHCHPCQESIQRDTLRHSLRRISTYRALAN--------------AFKLSVELSKLSSCENEFKETYLQLSDQCKGLACDLLEECR 733
            ++  E   LDA ++G+   V RM+     +++NC + +G+  L LAV NE+ E+  LLL+  N+  +GD+LL AI +G   IVE +++HP+  E + L++S   SE       + + D   F  DI+P++LAA C ++EI+  LL +GA IE+PH   C C  C E  + D+  HS  RI+ Y+ LA+              A +LS EL+ L++ E EFK  Y +LS QCK     LL+ CR
Sbjct:   42 LSADEERFLDAAEYGNIPVVRRMMEECRSLNVNCVDYMGQNALQLAVANEHLEITELLLKKENLARVGDALLLAISKGYVRIVEAILSHPSFSEGKRLTTSPSQSEFQHDDFYAYDEDGTRFSQDITPIILAAHCQEYEIVHTLLRKGARIERPHDYFCKCTECSEKQKHDSFSHSRSRINAYKGLASPAYLSLSSEDPVMTALELSNELAVLANIEKEFKNDYKKLSMQCKDFVVGLLDLCR 284          
BLAST of Transient-receptor-potential-like protein vs. Ensembl Mouse
Match: Trpc5 (transient receptor potential cation channel, subfamily C, member 5 [Source:MGI Symbol;Acc:MGI:109524])

HSP 1 Score: 168.318 bits (425), Expect = 3.199e-47
Identity = 99/251 (39.44%), Postives = 152/251 (60.56%), Query Frame = 2
Query:   38 IPLNPLKNLKPINTKERELLDAVDHGDRATVERMLFTEPL---VDINCTNVLGRTPLFLAVDNENSELVRLLLRHPNIIIGDSLLQAIKEGVYGIVEQLINH--PTIEQEILSSSWPGSEASKEIDSPEFRPDISPVMLAAICNQFEILQLLLSRGATIEQPHPASCHCHPCQESIQRDTLRHSLRRISTYRALAN--------------AFKLSVELSKLSSCENEFKETYLQLSDQCKGLACDLLEECR 733
            IPL  ++    ++ +E+  L AV+ GD ATV++ L    +   V+INC + LGR+ L +A++NEN E++ LLL H ++ +GD+LL AI++ V G VE L+++  P+ E+++ +          +    EF PDI+P+MLAA  N +EI++LL+ +  TI +PH   C+C  C  S + D+LRHS  R++ Y+ALA+              AF+L  EL +LS  ENEFK  Y +LS QCK  A DLL++ R
Sbjct:   18 IPLQIVRAETELSAEEKAFLSAVEKGDYATVKQALQEAEIYYNVNINCMDPLGRSALLIAIENENLEIMELLLNH-SVYVGDALLYAIRKEVVGAVELLLSYRKPSGEKQVPT-------LMMDTQFSEFTPDITPIMLAAHTNNYEIIKLLVQKRVTIPRPHQIRCNCVECVSSSEVDSLRHSRSRLNIYKALASPSLIALSSEDPILTAFRLGWELKELSKVENEFKAEYEELSQQCKLFAKDLLDQAR 260          
BLAST of Transient-receptor-potential-like protein vs. Ensembl Mouse
Match: Trpc4 (transient receptor potential cation channel, subfamily C, member 4 [Source:MGI Symbol;Acc:MGI:109525])

HSP 1 Score: 151.754 bits (382), Expect = 2.936e-43
Identity = 102/251 (40.64%), Postives = 153/251 (60.96%), Query Frame = 2
Query:   38 IPLNPLKNLKPINTKERELLDAVDHGDRATVERMLFTEPL---VDINCTNVLGRTPLFLAVDNENSELVRLLLRHPNIIIGDSLLQAIKEGVYGIVEQLINH--PTIEQEILSSSWPGSEASKEIDSPEFRPDISPVMLAAICNQFEILQLLLSRGATIEQPHPASCHCHPCQESIQRDTLRHSLRRISTYRALAN--------------AFKLSVELSKLSSCENEFKETYLQLSDQCKGLACDLLEECR 733
            IPL  ++    ++  E+  L+AV+ GD A+V++ L    +   ++INC + LGRT L +A++NEN EL+ LLL   N+ +GD+LL AI++ V G VE L+NH  P+ E+++     P     K+    EF PDI+P++LAA  N +EI++LL+ +G ++ +PH   C+C  C  S   D+LRHS  R++ Y+ALA+              AF+LS EL +LS  ENEFK  Y +LS QCK  A DLL++ R
Sbjct:   18 IPLRIVRAESELSPSEKAYLNAVEKGDYASVKKSLEEAEIYFKININCIDPLGRTALLIAIENENLELIELLLSF-NVYVGDALLHAIRKEVVGAVELLLNHKKPSGEKQV-----PPILLDKQFS--EFTPDITPIILAAHTNNYEIIKLLVQKGVSVPRPHEVRCNCVECVSSSDVDSLRHSRSRLNIYKALASPSLIALSSEDPFLTAFQLSWELQELSKVENEFKSEYEELSRQCKQFAKDLLDQTR 260          
BLAST of Transient-receptor-potential-like protein vs. Ensembl Mouse
Match: Trpc7 (transient receptor potential cation channel, subfamily C, member 7 [Source:MGI Symbol;Acc:MGI:1349470])

HSP 1 Score: 150.599 bits (379), Expect = 4.808e-43
Identity = 85/244 (34.84%), Postives = 135/244 (55.33%), Query Frame = 2
Query:   80 KERELLDAVDHGDRATVERMLFTEPLVDINCTNVLGRTPLFLAVDNENSELVRLLLRHPNII-IGDSLLQAIKEGVYGIVEQLINHPT-----------IEQEILSSSWPGSEASKEIDSPEFRPDISPVMLAAICNQFEILQLLLSRGATIEQPHPASCHCHPCQESIQRDTLRHSLRRISTYRALAN--------------AFKLSVELSKLSSCENEFKETYLQLSDQCKGLACDLLEECR 733
            +E   LD+ ++G+   V +ML     ++ NC + +G+  L LAV NE+ E+  LLL+  N+  +GD+LL AI +G   IVE +++HP            +EQE+    +   +     D   F  DI+P++LAA C ++EI+ +LL +GA IE+PH   C C+ C E  ++D+  HS  R++ Y+ LA+              A +LS EL++L++ E EFK  Y +LS QCK     +L+ CR
Sbjct:   43 EEERFLDSAEYGNIPVVRKMLEESKTLNFNCVDYMGQNALQLAVGNEHLEVTELLLKKENLARVGDALLLAISKGYVRIVEAILSHPAFAQGQRLTLSPLEQELRDDDFYAYDE----DGTRFSHDITPIILAAHCQEYEIVHILLLKGARIERPHDYFCKCNECTEKQRKDSFSHSRSRMNAYKGLASAAYLSLSSEDPVLTALELSNELARLANIETEFKNDYRKLSMQCKDFVVGVLDLCR 282          
BLAST of Transient-receptor-potential-like protein vs. Ensembl Mouse
Match: Trpc3 (transient receptor potential cation channel, subfamily C, member 3 [Source:MGI Symbol;Acc:MGI:109526])

HSP 1 Score: 155.992 bits (393), Expect = 6.242e-43
Identity = 90/247 (36.44%), Postives = 134/247 (54.25%), Query Frame = 2
Query:   71 INTKERELLDAVDHGDRATVERMLFTEPLVDINCTNVLGRTPLFLAVDNENSELVRLLLRHPNII-IGDSLLQAIKEGVYGIVEQLINHPTI-----------EQEILSSSWPGSEASKEIDSPEFRPDISPVMLAAICNQFEILQLLLSRGATIEQPHPASCHCHPCQESIQRDTLRHSLRRISTYRALAN--------------AFKLSVELSKLSSCENEFKETYLQLSDQCKGLACDLLEECR 733
            +  +E   LDA ++G+   V +ML     +++NC + +G+  L LAV NE+ E+  LLL+  N+  IGD+LL AI +G   IVE ++ HP             EQE+    +   +     D   F PDI+P++LAA C+++E++ LLL +GA IE+PH   C C  C E  + D   HS  RI+ Y+ LA+              A +LS EL+KL++ E EFK  Y +LS QCK     +L+ CR
Sbjct:   98 LTAEEERFLDAAEYGNIPVVRKMLEESRTLNVNCVDYMGQNALQLAVGNEHLEVTELLLKKENLARIGDALLLAISKGYVRIVEAILGHPGFAASRRLTLSPCEQELRDDDFYAYDE----DGTRFSPDITPIILAAHCHKYEVVHLLLLKGARIERPHDYFCRCSDCAEKQRLDAFSHSRSRINAYKGLASPAYLSLSSEDPVLTALELSNELAKLANIEKEFKNDYRKLSMQCKDFVVGVLDLCR 340          
BLAST of Transient-receptor-potential-like protein vs. Ensembl Mouse
Match: Trpc6 (transient receptor potential cation channel, subfamily C, member 6 [Source:MGI Symbol;Acc:MGI:109523])

HSP 1 Score: 149.828 bits (377), Expect = 1.474e-42
Identity = 89/243 (36.63%), Postives = 137/243 (56.38%), Query Frame = 2
Query:   71 INTKERELLDAVDHGDRATVERMLFTEPLVDINCTNVLGRTPLFLAVDNENSELVRLLLRHPNII-IGDSLLQAIKEGVYGIVEQLINHPTI-EQEILSSSWPGSEASKEI------DSPEFRPDISPVMLAAICNQFEILQLLLSRGATIEQPHPASCHCHPCQESIQRDTLRHSLRRISTYRALAN--------------AFKLSVELSKLSSCENEFKETYLQLSDQCKGLACDLLEECR 733
            ++ +E   LDA ++G+   V +ML     +++NC + +G+  L LAV NE+ E+  LLL+  N+  +GD+LL AI +G   IVE ++NHP   E + L++S   SE  ++       D   F  D++P++LAA C ++EI+  LL +GA IE+PH   C C  C +  + D+  HS  RI+ Y+ LA+              A +LS EL+ L++ E EFK  Y +LS QCK     LL+ CR
Sbjct:   94 LSIEEERFLDAAEYGNIPVVRKMLEECHSLNVNCVDYMGQNALQLAVANEHLEITELLLKKENLSRVGDALLLAISKGYVRIVEAILNHPAFAEGKRLATSPSQSELQQDDFYAYDEDGTRFSHDVTPIILAAHCQEYEIVHTLLRKGARIERPHDYFCKCTECSQKQKHDSFSHSRSRINAYKGLASPAYLSLSSEDPVMTALELSNELAVLANIEKEFKNDYRKLSMQCKDFVVGLLDLCR 336          
BLAST of Transient-receptor-potential-like protein vs. UniProt/SwissProt
Match: sp|P34586|TRPL_CAEEL (Transient-receptor-potential-like protein OS=Caenorhabditis elegans OX=6239 GN=trp-1 PE=2 SV=3)

HSP 1 Score: 211.846 bits (538), Expect = 1.095e-61
Identity = 113/237 (47.68%), Postives = 160/237 (67.51%), Query Frame = 2
Query:   71 INTKERELLDAVDHGDRATVERMLFTEP--LVDINCTNVLGRTPLFLAVDNENSELVRLLLRHPNIIIGDSLLQAIKEGVYGIVEQLINHPTIEQEILSSSWPGSEASKEIDSPEFRPDISPVMLAAICNQFEILQLLLSRGATIEQPHPASCHCHPCQESIQRDTLRHSLRRISTYRALA--------------NAFKLSVELSKLSSCENEFKETYLQLSDQCKGLACDLLEECR 733
            I+ +ER  L+A + G++ T++  L  +    +++NC + +GRT L +AVDNEN E+V LLL+ P+I IG++LL AI+EGVY +VE L+NHP I +E+L   W  +    E  S E+  DISPV+LAA  NQFEILQ+L+ + A+IE+PH  SC C  C      D+L++SL+RI+T+RALA              +AFKLS +L +L+  E+EFKETYLQLS+QCK  +CDLL +CR
Sbjct:   46 ISPEERRFLEAAELGNKPTLQECLDYDGDRRLNVNCLDSMGRTALEIAVDNENMEVVELLLQQPDIRIGNALLCAIREGVYRLVEVLVNHPNITREMLGDGWSQALDPSEAASAEYSSDISPVILAAQLNQFEILQMLIRKDASIEKPHRHSCICETCDRERLNDSLQYSLKRINTFRALASPAWMSLTSPDPILSAFKLSWDLQRLAFEEHEFKETYLQLSEQCKQYSCDLLSQCR 282          
BLAST of Transient-receptor-potential-like protein vs. UniProt/SwissProt
Match: sp|O62852|TRPC5_RABIT (Short transient receptor potential channel 5 OS=Oryctolagus cuniculus OX=9986 GN=TRPC5 PE=2 SV=1)

HSP 1 Score: 169.088 bits (427), Expect = 1.377e-46
Identity = 99/251 (39.44%), Postives = 153/251 (60.96%), Query Frame = 2
Query:   38 IPLNPLKNLKPINTKERELLDAVDHGDRATVERMLFTEPL---VDINCTNVLGRTPLFLAVDNENSELVRLLLRHPNIIIGDSLLQAIKEGVYGIVEQLINH--PTIEQEILSSSWPGSEASKEIDSPEFRPDISPVMLAAICNQFEILQLLLSRGATIEQPHPASCHCHPCQESIQRDTLRHSLRRISTYRALAN--------------AFKLSVELSKLSSCENEFKETYLQLSDQCKGLACDLLEECR 733
            IPL  ++    ++ +E+  L+AV+ GD ATV++ L    +   V+INC + LGR+ L +A++NEN E++ LLL H ++ +GD+LL AI++ V G VE L+++  P+ E+++ +          +    EF PDI+P+MLAA  N +EI++LL+ +  TI +PH   C+C  C  S + D+LRHS  R++ Y+ALA+              AF+L  EL +LS  ENEFK  Y +LS QCK  A DLL++ R
Sbjct:   18 IPLQIVRAETELSAEEKAFLNAVEKGDYATVKQALQEAEIYYNVNINCMDPLGRSALLIAIENENLEIMELLLNH-SVYVGDALLYAIRKEVVGAVELLLSYRKPSGEKQVPT-------LMMDTQFSEFTPDITPIMLAAHTNNYEIIKLLVQKRVTIPRPHQIRCNCVECVSSSEVDSLRHSRSRLNIYKALASPSLIALSSEDPILTAFRLGWELKELSKVENEFKAEYEELSQQCKLFAKDLLDQAR 260          
BLAST of Transient-receptor-potential-like protein vs. UniProt/SwissProt
Match: sp|Q9UL62|TRPC5_HUMAN (Short transient receptor potential channel 5 OS=Homo sapiens OX=9606 GN=TRPC5 PE=1 SV=1)

HSP 1 Score: 169.088 bits (427), Expect = 1.403e-46
Identity = 99/251 (39.44%), Postives = 153/251 (60.96%), Query Frame = 2
Query:   38 IPLNPLKNLKPINTKERELLDAVDHGDRATVERMLFTEPL---VDINCTNVLGRTPLFLAVDNENSELVRLLLRHPNIIIGDSLLQAIKEGVYGIVEQLINH--PTIEQEILSSSWPGSEASKEIDSPEFRPDISPVMLAAICNQFEILQLLLSRGATIEQPHPASCHCHPCQESIQRDTLRHSLRRISTYRALAN--------------AFKLSVELSKLSSCENEFKETYLQLSDQCKGLACDLLEECR 733
            IPL  ++    ++ +E+  L+AV+ GD ATV++ L    +   V+INC + LGR+ L +A++NEN E++ LLL H ++ +GD+LL AI++ V G VE L+++  P+ E+++ +          +    EF PDI+P+MLAA  N +EI++LL+ +  TI +PH   C+C  C  S + D+LRHS  R++ Y+ALA+              AF+L  EL +LS  ENEFK  Y +LS QCK  A DLL++ R
Sbjct:   18 IPLQIVRAETELSAEEKAFLNAVEKGDYATVKQALQEAEIYYNVNINCMDPLGRSALLIAIENENLEIMELLLNH-SVYVGDALLYAIRKEVVGAVELLLSYRRPSGEKQVPT-------LMMDTQFSEFTPDITPIMLAAHTNNYEIIKLLVQKRVTIPRPHQIRCNCVECVSSSEVDSLRHSRSRLNIYKALASPSLIALSSEDPILTAFRLGWELKELSKVENEFKAEYEELSQQCKLFAKDLLDQAR 260          
BLAST of Transient-receptor-potential-like protein vs. UniProt/SwissProt
Match: sp|Q9QX29|TRPC5_MOUSE (Short transient receptor potential channel 5 OS=Mus musculus OX=10090 GN=Trpc5 PE=1 SV=2)

HSP 1 Score: 168.318 bits (425), Expect = 2.238e-46
Identity = 99/251 (39.44%), Postives = 152/251 (60.56%), Query Frame = 2
Query:   38 IPLNPLKNLKPINTKERELLDAVDHGDRATVERMLFTEPL---VDINCTNVLGRTPLFLAVDNENSELVRLLLRHPNIIIGDSLLQAIKEGVYGIVEQLINH--PTIEQEILSSSWPGSEASKEIDSPEFRPDISPVMLAAICNQFEILQLLLSRGATIEQPHPASCHCHPCQESIQRDTLRHSLRRISTYRALAN--------------AFKLSVELSKLSSCENEFKETYLQLSDQCKGLACDLLEECR 733
            IPL  ++    ++ +E+  L AV+ GD ATV++ L    +   V+INC + LGR+ L +A++NEN E++ LLL H ++ +GD+LL AI++ V G VE L+++  P+ E+++ +          +    EF PDI+P+MLAA  N +EI++LL+ +  TI +PH   C+C  C  S + D+LRHS  R++ Y+ALA+              AF+L  EL +LS  ENEFK  Y +LS QCK  A DLL++ R
Sbjct:   18 IPLQIVRAETELSAEEKAFLSAVEKGDYATVKQALQEAEIYYNVNINCMDPLGRSALLIAIENENLEIMELLLNH-SVYVGDALLYAIRKEVVGAVELLLSYRKPSGEKQVPT-------LMMDTQFSEFTPDITPIMLAAHTNNYEIIKLLVQKRVTIPRPHQIRCNCVECVSSSEVDSLRHSRSRLNIYKALASPSLIALSSEDPILTAFRLGWELKELSKVENEFKAEYEELSQQCKLFAKDLLDQAR 260          
BLAST of Transient-receptor-potential-like protein vs. UniProt/SwissProt
Match: sp|Q9VJJ7|TRPG_DROME (Transient receptor potential-gamma protein OS=Drosophila melanogaster OX=7227 GN=Trpgamma PE=1 SV=2)

HSP 1 Score: 160.999 bits (406), Expect = 9.124e-44
Identity = 96/247 (38.87%), Postives = 139/247 (56.28%), Query Frame = 2
Query:   44 LNPLKNLKPINTKERELLDAVDHGDRATVERMLFTEP---LVDINCTNVLGRTPLFLAVDNENSELVRLLLRHPNIIIGDSLLQAIKEGVYGIVEQLINHPTIEQEILSSSWPGSEASKEIDSPEFRPDISPVMLAAICNQFEILQLLLSRGATIEQPHPASCHCHPCQESIQRDTLRHSLRRISTYRALAN--------------AFKLSVELSKLSSCENEFKETYLQLSDQCKGLACDLLEECR 733
            + P + ++ +  +E++ L AV+ GD A   RML        +++NC + LGRT L +A+DNEN E+V LL+ + N+   D+LL +I E     VE L++H   E     S    S  S   D+  F PDI+P++LAA  + +EI+++LL RGA +  PH   C C  C +S Q D+LRHS  RI+ YRALA+              AF+LS EL +LS  E+EFK  Y +L  QC+  A  LL+  R
Sbjct:    8 IRPHQEIRQLTLEEKKFLLAVERGDMAGTRRMLQKAQDTEYINVNCVDPLGRTALLMAIDNENLEMVELLINY-NVDTKDALLHSISEEFVEAVEVLLDH---ENVTFHSEGNHSWESASEDTSTFTPDITPLILAAHRDNYEIIKILLDRGAVLPMPHDVRCGCDECVQSRQEDSLRHSRSRINAYRALASPSLIALSSKDPILTAFELSWELRRLSFLEHEFKNEYQELRKQCQDFATALLDHTR 250          
BLAST of Transient-receptor-potential-like protein vs. TrEMBL
Match: A0A4Y2EQQ3 (Transient-receptor-potential-like protein OS=Araneus ventricosus OX=182803 GN=trp-1_5 PE=3 SV=1)

HSP 1 Score: 262.692 bits (670), Expect = 8.758e-79
Identity = 136/258 (52.71%), Postives = 181/258 (70.16%), Query Frame = 2
Query:   11 RRSRSRHKW---IPLNPLKNLKPINTKERELLDAVDHGDRATVERMLFTEPLVDINCTNVLGRTPLFLAVDNENSELVRLLLRHPNIIIGDSLLQAIKEGVYGIVEQLINHPTIEQEILSSSWPGSEASKEIDSPEFRPDISPVMLAAICNQFEILQLLLSRGATIEQPHPASCHCHPCQESIQRDTLRHSLRRISTYRALAN--------------AFKLSVELSKLSSCENEFKETYLQLSDQCKGLACDLLEECR 733
            R ++S +++   IPL PLK+   ++ KE+  L+A + GDR T+ R L     V++NCTN+LGR+ + +AVDNEN E+V LLL+  ++ IGD+LL AI+EGVY IVE LINHP+I  E+L++ W  +    E +S ++ PDISP++LAA CNQFEILQLLLSRGA IE+PHP SC C  CQE +  D+LR+SLRRI TYRALA+              AFKLS EL  L+  ENEFKE Y++LS+QCK  +CDLL+ CR
Sbjct:    8 RSTKSTNQYRIRIPLEPLKDGHSMDPKEKTFLEAAERGDRPTMVRCLQKPNPVNVNCTNILGRSAIQIAVDNENVEIVELLLQQESVKIGDALLYAIREGVYKIVEMLINHPSITSEMLANDWAKTRQPGE-ESSDYSPDISPIILAAHCNQFEILQLLLSRGAVIEKPHPLSCSCQKCQEGMHTDSLRYSLRRIHTYRALASPAWMSLTSEDPILTAFKLSWELEHLAMQENEFKEIYVELSNQCKKYSCDLLDLCR 264          
BLAST of Transient-receptor-potential-like protein vs. TrEMBL
Match: A0A0F7VHL6 (Csa-Trp2 (Fragment) OS=Cupiennius salei OX=6928 GN=Csa-Trp2 PE=2 SV=1)

HSP 1 Score: 254.988 bits (650), Expect = 3.502e-78
Identity = 134/246 (54.47%), Postives = 171/246 (69.51%), Query Frame = 2
Query:   38 IPLNPLKNLKPINTKERELLDAVDHGDRATVERMLFTEPLVDINCTNVLGRTPLFLAVDNENSELVRLLLRHPNIIIGDSLLQAIKEGVYGIVEQLINHPTIEQEILSSSWPGSEASKEIDSPEFRPDISPVMLAAICNQFEILQLLLSRGATIEQPHPASCHCHPCQESIQRDTLRHSLRRISTYRALAN--------------AFKLSVELSKLSSCENEFKETYLQLSDQCKGLACDLLEECR 733
            IPL PLK+   ++ KER  L+A + GD+AT+ R L     V++NCTN+LGR+ + +A DNEN E+V LLL+  N+ IGD+LL AI EGVY IVE LINHP+I  E+L++ W  S    E +S ++ PDISPV+LAA CNQFEILQLLL+ GA I++PHP SC C  C+E I  D+LR+SLRRI TYRALA+              AF+LS EL  L+  ENEFKE YL LS+QCK  +CDLL+ CR
Sbjct:   39 IPLEPLKDGPSMDPKERIFLEAAERGDKATMARCLQMPNPVNVNCTNILGRSAIQIAADNENVEIVELLLQQENVKIGDALLYAISEGVYKIVEMLINHPSITSEMLANGWAKSRLPGE-ESSDYSPDISPVILAAHCNQFEILQLLLTHGAIIDKPHPLSCTCTLCREGIHTDSLRYSLRRIHTYRALASPAWISLTSEDPILTAFQLSWELEHLAHRENEFKEIYLVLSNQCKKYSCDLLDLCR 283          
BLAST of Transient-receptor-potential-like protein vs. TrEMBL
Match: A0A0R3SMV3 (Uncharacterized protein OS=Hymenolepis diminuta OX=6216 GN=HDID_LOCUS6266 PE=4 SV=1)

HSP 1 Score: 254.603 bits (649), Expect = 4.986e-78
Identity = 139/255 (54.51%), Postives = 179/255 (70.20%), Query Frame = 2
Query:   17 SRSRHKW--IPLNPLKNLKPINTKERELLDAVDHGDRATVERMLFTEPLVDINCTNVLGRTPLFLAVDNENSELVRLLLRHPNIIIGDSLLQAIKEGVYGIVEQLINHPTIEQEILSSSWPGSEASKEIDSPEFRPDISPVMLAAICNQFEILQLLLSRGATIEQPHPASCHCHPCQESIQRDTLRHSLRRISTYRALAN--------------AFKLSVELSKLSSCENEFKETYLQLSDQCKGLACDLLEECR 733
            S S +K+   P N LK     +   R  LDAV+ GD++TV R L   P V++NCTN++GRT + +AVDNEN E+V LLL+ PNI IGD+LL A++EGVY IVE LI+H +I +E+LS+SW    +  E +S +F  DISPV+LAAICNQFEILQLLLSRGA IE+PH ++C C  C    + D+L++SL RI+TYRALA+              AFKLS EL+ L+S ENEFKE +LQLSDQCK  ACDLL++CR
Sbjct:  143 STSSYKFGRFPPNFLKESGQSDPLSRIFLDAVERGDKSTVARCLKCSPPVNVNCTNMIGRTAIQIAVDNENFEIVELLLKEPNIRIGDALLYAVQEGVYRIVEMLIDHHSITKEMLSTSWSKRISLSE-ESHDFSADISPVILAAICNQFEILQLLLSRGARIERPHRSNCSCSDCSAMYREDSLKYSLWRINTYRALASPAWISLTSPDPILAAFKLSWELNHLASRENEFKEVFLQLSDQCKKYACDLLDQCR 396          
BLAST of Transient-receptor-potential-like protein vs. TrEMBL
Match: A0A0L8HBD3 (Uncharacterized protein OS=Octopus bimaculoides OX=37653 GN=OCBIM_22018761mg PE=4 SV=1)

HSP 1 Score: 246.899 bits (629), Expect = 5.690e-78
Identity = 132/265 (49.81%), Postives = 176/265 (66.42%), Query Frame = 2
Query:    2 FLMRRSRSR-------HKWIPLNPLKNLKPINTKERELLDAVDHGDRATVERMLFTEPLVDINCTNVLGRTPLFLAVDNENSELVRLLLRHPNIIIGDSLLQAIKEGVYGIVEQLINHPTIEQEILSSSWPGSEASKEIDSPEFRPDISPVMLAAICNQFEILQLLLSRGATIEQPHPASCHCHPCQESIQRDTLRHSLRRISTYRALA--------------NAFKLSVELSKLSSCENEFKETYLQLSDQCKGLACDLLEECR 733
            +L +RS +R          IPL PLK    I+ +ER  L+A + GD+ T+ R L     V++NCTN+LGR+ + +AVDNEN+E+V LLL+   + IGD++L AI+EGVY IVE LI+HP++ + +L S W  ++   E +S ++ PDISPV+LAA CNQFEILQLLL RGATIE+PH  SC C  CQE +  D+LRHSL RI TY+ALA              +AFKLS +L+K    ENEFK+ Y  L+ QCK  ACDLL++CR
Sbjct:    3 YLNKRSSTRCGPTGRGGVLIPLEPLKEGHRIDPQERFFLEAAEKGDKHTMIRCLQGPNPVNVNCTNMLGRSAIQIAVDNENTEIVELLLKQEGVKIGDAVLYAIREGVYKIVEMLIDHPSVTRGMLGSDWSKTKHGNE-ESSDYSPDISPVILAAHCNQFEILQLLLLRGATIERPHELSCSCKKCQEQVHEDSLRHSLLRIHTYKALASPAWISLTSLDPILSAFKLSWDLAKKGLKENEFKDLYFDLAMQCKRFACDLLDQCR 266          
BLAST of Transient-receptor-potential-like protein vs. TrEMBL
Match: A0A1I8I4R7 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 258.07 bits (658), Expect = 1.277e-76
Identity = 130/246 (52.85%), Postives = 171/246 (69.51%), Query Frame = 2
Query:   38 IPLNPLKNLKPINTKERELLDAVDHGDRATVERMLFTEPLVDINCTNVLGRTPLFLAVDNENSELVRLLLRHPNIIIGDSLLQAIKEGVYGIVEQLINHPTIEQEILSSSWPGSEASKEIDSPEFRPDISPVMLAAICNQFEILQLLLSRGATIEQPHPASCHCHPCQESIQRDTLRHSLRRISTYRALAN--------------AFKLSVELSKLSSCENEFKETYLQLSDQCKGLACDLLEECR 733
            IPL P+K    ++T ER  L+AV  GD++TV R L     V++NCT+++GRT + +AVDNEN E+V LLL  P I+IGD++L AI+EGVY I E L++HP+  +E+L   W         +S EF PDISPV+LAA CNQFEILQLLLSRGATIE+PH  SC C  C++ ++ D+LRHSL RI+TYRALA+              AF+LS EL +L+S ENEFKE ++ LS QC+  ACDLL++CR
Sbjct:   14 IPLRPMKQANKMDTLERLFLEAVQRGDQSTVARCLRGPAPVNVNCTDMVGRTAIQIAVDNENIEIVELLLTVPGIVIGDAILYAIQEGVYTIAEMLVDHPSTTKEMLGVDWSRHCGRHSGESAEFSPDISPVILAATCNQFEILQLLLSRGATIERPHQLSCRCDRCKQLVRDDSLRHSLLRINTYRALASPAWICLTSSDPILTAFRLSWELQRLASRENEFKEAFVALSQQCRKYACDLLDQCR 259          
BLAST of Transient-receptor-potential-like protein vs. Ensembl Cavefish
Match: trpc4a (short transient receptor potential channel 4-like [Source:NCBI gene;Acc:103035222])

HSP 1 Score: 165.622 bits (418), Expect = 2.374e-46
Identity = 98/249 (39.36%), Postives = 150/249 (60.24%), Query Frame = 2
Query:   38 IPLNPLKNLKPINTKERELLDAVDHGDRATVERMLFTEPL---VDINCTNVLGRTPLFLAVDNENSELVRLLLRHPNIIIGDSLLQAIKEGVYGIVEQLINHPTIEQEILSSSWPGSEASKEIDSPEFRPDISPVMLAAICNQFEILQLLLSRGATIEQPHPASCHCHPCQESIQRDTLRHSLRRISTYRALAN--------------AFKLSVELSKLSSCENEFKETYLQLSDQCKGLACDLLEECR 733
            IPL  ++    ++  E+  L+AV+ GD A+V++ L    +   ++INC + LGRT L +A++NEN E++ LLL   N+ +GD+LL AI++ V G VE L+NH   +++      P     K+    +F PDI+P++LAA  N +EI++LL+ +G ++ QPH   C+C  C  S   D+LRHS  R++ YRAL++              AF+LS EL +LS  ENEFK  Y +LS QCK  A +LL++ R
Sbjct:   18 IPLRIVRAESELSPLEKAYLNAVEKGDYASVKQSLEEAEIYFKININCIDPLGRTALLIAIENENLEIIELLLSF-NVYVGDALLHAIRKEVVGAVELLLNH---KKQRGGMQVPPILLDKQFS--DFTPDITPIILAAHTNNYEIIKLLVQKGVSMPQPHEVRCNCVECVSSSDVDSLRHSRSRLNIYRALSSPSLIALSSEDPFLTAFRLSWELEELSKVENEFKYEYEELSQQCKQFAKNLLDQTR 260          
BLAST of Transient-receptor-potential-like protein vs. Ensembl Cavefish
Match: trpc5b (transient receptor potential cation channel, subfamily C, member 5b [Source:ZFIN;Acc:ZDB-GENE-091112-24])

HSP 1 Score: 164.466 bits (415), Expect = 4.916e-46
Identity = 99/251 (39.44%), Postives = 148/251 (58.96%), Query Frame = 2
Query:   38 IPLNPLKNLKPINTKERELLDAVDHGDRATVERMLFTEPL---VDINCTNVLGRTPLFLAVDNENSELVRLLLRHPNIIIGDSLLQAIKEGVYGIVEQLINH--PTIEQEILSSSWPGSEASKEIDSPEFRPDISPVMLAAICNQFEILQLLLSRGATIEQPHPASCHCHPCQESIQRDTLRHSLRRISTYRALAN--------------AFKLSVELSKLSSCENEFKETYLQLSDQCKGLACDLLEECR 733
            IPL  ++    ++ +ER  L AV+ GD A V+  L    +   ++INC + LGR+ L +A++NEN E++ LLL H  + +GD+LL AI++ V G VE L++H  P+ E+++     P      +    EF PDI+P+MLAA  N +EI++LL+ R  TI +PH   C C  C  S + D+LRHS  R++ Y+ LA+              AF+L  EL +LS  ENEF++ Y +LS QCK  A DLL++ R
Sbjct:   18 IPLQIVRAEAELSAEERAYLTAVEKGDYAGVKMALQEAEIYYNININCLDPLGRSALLIAIENENLEVMELLLSH-GVQVGDALLYAIRKEVVGAVELLLSHRKPSGEKQV-----PALMMDSQFS--EFTPDITPIMLAAHTNNYEIIKLLVQRKVTIPRPHQIRCDCVECVSSSEVDSLRHSRSRLNIYKTLASPSLIALSSEDPILTAFRLGWELKELSKVENEFRQEYEELSQQCKLFAKDLLDQAR 260          
BLAST of Transient-receptor-potential-like protein vs. Ensembl Cavefish
Match: trpc5a (short transient receptor potential channel 5-like [Source:NCBI gene;Acc:103044006])

HSP 1 Score: 163.696 bits (413), Expect = 1.119e-45
Identity = 99/251 (39.44%), Postives = 148/251 (58.96%), Query Frame = 2
Query:   38 IPLNPLKNLKPINTKERELLDAVDHGDRATVERMLFTEPL---VDINCTNVLGRTPLFLAVDNENSELVRLLLRHPNIIIGDSLLQAIKEGVYGIVEQLINH--PTIEQEILSSSWPGSEASKEIDSPEFRPDISPVMLAAICNQFEILQLLLSRGATIEQPHPASCHCHPCQESIQRDTLRHSLRRISTYRALAN--------------AFKLSVELSKLSSCENEFKETYLQLSDQCKGLACDLLEECR 733
            IPL+ ++    ++ +ER  L AV+ GD A V+  L    +   +D+NC + LGR+ L +A++NEN E++ LLL H  +  GD+LL AI++ V G VE L++H  P+ E+++ S          +    EF PDI+P+MLAA  N +EI++LL+    TI +PH   C C  C  S + D+LRHS  R++ Y+ALA+              AF+L  EL +LS  ENEF++ Y +LS QCK  A DLL++ R
Sbjct:   21 IPLHIVRAEVELSQEERAFLLAVEKGDYAGVKHALQEAEVYYNIDVNCVDPLGRSALLIAIENENLEVMELLLDH-GVNTGDALLYAIRKEVVGAVELLLSHRRPSGEKQVPS-------LMMDAQFSEFTPDITPIMLAAHTNNYEIIKLLVQHKVTIPRPHQIRCDCVECVSSSEVDSLRHSRSRLNIYKALASPSLIALSSEDPILTAFRLGWELKELSKVENEFRQEYEELSQQCKRFAKDLLDQAR 263          
BLAST of Transient-receptor-potential-like protein vs. Ensembl Cavefish
Match: trpc3 (transient receptor potential cation channel subfamily C member 3 [Source:NCBI gene;Acc:103037748])

HSP 1 Score: 160.614 bits (405), Expect = 1.343e-44
Identity = 92/241 (38.17%), Postives = 137/241 (56.85%), Query Frame = 2
Query:   71 INTKERELLDAVDHGDRATVERMLFTEPLVDINCTNVLGRTPLFLAVDNENSELVRLLLRHPNII-IGDSLLQAIKEGVYGIVEQLINHPTIEQ-EILSSS----WPGSEASKEIDSPEFRPDISPVMLAAICNQFEILQLLLSRGATIEQPHPASCHCHPCQESIQRDTLRHSLRRISTYRALAN--------------AFKLSVELSKLSSCENEFKETYLQLSDQCKGLACDLLEECR 733
            +  +E   LDA ++G+   V +ML     +++NC + +G+  L LAV NE+ E+  LLLR  N+  +GD+LL AI +G   IVE L+ HP++   E L+ S          S + D   F PDI+P++LAA C ++E++ +LL +GA IE+PH   C C  C E  ++D+  HS  RI+ YR LA+              A +LS EL+KL++ E EFK  Y +LS QCK     +L+ CR
Sbjct:   91 LTAEEERFLDAAEYGNIPVVRKMLEESATLNVNCVDYMGQNGLQLAVGNEHLEVTELLLRRENLARVGDALLLAISKGYIRIVEALLGHPSLAGGERLTRSPCELQDDDFYSYDEDGTRFSPDITPIILAAHCQKYEVVHMLLLKGARIERPHDYFCKCADCTEKQRKDSFSHSRSRINAYRGLASPAYLSLSSEDPVLTALELSNELAKLANIEKEFKNDYRKLSMQCKDFVVGVLDLCR 331          
BLAST of Transient-receptor-potential-like protein vs. Ensembl Cavefish
Match: trpc4b (short transient receptor potential channel 4-like [Source:NCBI gene;Acc:103045092])

HSP 1 Score: 155.606 bits (392), Expect = 7.768e-43
Identity = 102/251 (40.64%), Postives = 154/251 (61.35%), Query Frame = 2
Query:   38 IPLNPLKNLKPINTKERELLDAVDHGDRATVERMLFTEPL---VDINCTNVLGRTPLFLAVDNENSELVRLLLRHPNIIIGDSLLQAIKEGVYGIVEQLINH--PTIEQEILSSSWPGSEASKEIDSPEFRPDISPVMLAAICNQFEILQLLLSRGATIEQPHPASCHCHPCQESIQRDTLRHSLRRISTYRALAN--------------AFKLSVELSKLSSCENEFKETYLQLSDQCKGLACDLLEECR 733
            IPL  +++   ++ +E+  L AV+ GD  +V+R L    +   ++INC + LGRT L +A++NEN EL+ LLL + N+ +GD+LL AI++ V G VE L+NH  P+ E+++     P     K+    +F PDI+P++LAA  N +EI++LL+ +G ++ QPH   C+C  C  S   D+LRHS  R++ YRAL++              AF+LS EL +LS  ENEFK  Y +LS QCK  A DLL++ R
Sbjct:   18 IPLRVVRSEAELSCQEKAYLSAVERGDYGSVKRALDEAEIYFKININCVDPLGRTALLIAIENENLELIELLLSY-NVHVGDALLHAIRKEVVGAVELLLNHKKPSGEKQV-----PPILLDKQFS--DFTPDITPIILAAHTNNYEIIKLLVQKGVSVPQPHEVRCNCMECVSSSDVDSLRHSRSRLNIYRALSSPSLIALSSEDPFLTAFQLSWELQELSKVENEFKTEYEELSHQCKRFAKDLLDQTR 260          
BLAST of Transient-receptor-potential-like protein vs. Ensembl Sea Lamprey
Match: trpc3 (transient receptor potential cation channel, subfamily C, member 3 [Source:ZFIN;Acc:ZDB-GENE-140129-1])

HSP 1 Score: 149.828 bits (377), Expect = 1.144e-41
Identity = 90/246 (36.59%), Postives = 133/246 (54.07%), Query Frame = 2
Query:   71 INTKERELLDAVDHGDRATVERML---FTEPLVDINCTNVLGRTPLFLAVDNENSELVRLLLRHPNII-IGDSLLQAIKEGVYGIVEQLINHPTIEQE---ILSSSWPGSE----ASKEIDSPEFRPDISPVMLAAICNQFEILQLLLSRGATIEQPHPASCHCHPCQESIQRDTLRHSLRRISTYRALAN--------------AFKLSVELSKLSSCENEFKETYLQLSDQCKGLACDLLEECR 733
            +  +E   LDA ++G+   V RML        +++NC + +G+  + LAV NE+ E+  LLL+   +  +GD+L+ AI +G   IVE ++ HP    E   ILS     ++     + + D   F PDI+P++LAA C ++EI+ +LL RGA IE+PH   C C  C E  + D   HS  RI+ YR LA+              A +LS EL+ L++ E EFK  Y +LS QCK     LL+ CR
Sbjct:   37 LTAEEERFLDAAEYGNIPVVRRMLEDGGAGRSLNVNCVDYMGQNAMQLAVGNEHLEVAELLLKRDKLSRVGDALMLAISKGYVRIVEAILAHPAFAGEKRLILSPREQETQDDDFYAYDEDGTRFSPDITPIILAAHCQEYEIVHILLRRGARIERPHDYFCKCGECTEKQRHDAFSHSRSRINAYRGLASPAYLSLSSEDPVLTALELSNELAMLANIEKEFKNDYKKLSVQCKDFVVGLLDLCR 282          
BLAST of Transient-receptor-potential-like protein vs. Ensembl Sea Lamprey
Match: trpc4b (transient receptor potential cation channel, subfamily C, member 4b [Source:ZFIN;Acc:ZDB-GENE-120329-1])

HSP 1 Score: 103.99 bits (258), Expect = 9.328e-26
Identity = 56/128 (43.75%), Postives = 77/128 (60.16%), Query Frame = 2
Query:  392 EIDSPEFRPDISPVMLAAICNQFEILQLLLSRGATIEQPHPASCHCHPCQESIQRDTLRHSLRRISTYRALAN--------------AFKLSVELSKLSSCENEFKETYLQLSDQCKGLACDLLEECR 733
            E  S EF PD++P++LAA  N +E+++LLL+RG ++ +PH   C C  C    + D LRHS  R++ YRALA+              AF LS EL +LS  ENEFK  Y +LS QCK  A +LL++ R
Sbjct:    8 EGHSSEFTPDMTPIILAAHTNNYELIKLLLTRGVSVPRPHAVRCACLQCAAGSEADGLRHSRSRLAVYRALASPCLVALASEDPFLTAFTLSCELCELSRVENEFKAEYEELSQQCKQFAKELLDQTR 135          
BLAST of Transient-receptor-potential-like protein vs. Ensembl Sea Lamprey
Match: trpc4b (transient receptor potential cation channel, subfamily C, member 4b [Source:ZFIN;Acc:ZDB-GENE-120329-1])

HSP 1 Score: 99.3673 bits (246), Expect = 3.321e-24
Identity = 52/120 (43.33%), Postives = 73/120 (60.83%), Query Frame = 2
Query:  416 PDISPVMLAAICNQFEILQLLLSRGATIEQPHPASCHCHPCQESIQRDTLRHSLRRISTYRALAN--------------AFKLSVELSKLSSCENEFKETYLQLSDQCKGLACDLLEECR 733
            PD++P++LAA  N +E+++LLL+RG ++ +PH   C C  C    + D LRHS  R++ YRALA+              AF LS EL +LS  ENEFK  Y +LS QCK  A +LL++ R
Sbjct:    2 PDMTPIILAAHTNNYELIKLLLTRGVSVPRPHAVRCACLQCAAGSEADGLRHSRSRLAVYRALASPCLVALASEDPFLTAFTLSCELCELSRVENEFKAEYEELSQQCKQFAKELLDQTR 121          
BLAST of Transient-receptor-potential-like protein vs. Ensembl Nematostella
Match: EDO48346 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RJX1])

HSP 1 Score: 87.8113 bits (216), Expect = 5.666e-20
Identity = 66/187 (35.29%), Postives = 102/187 (54.55%), Query Frame = 2
Query:  227 ELVRLLLRHPNIIIGDSLLQAIKEGVYGIVEQLINHPTIEQEILSSSWPGSEASKEI-DSPEFRPDISPVMLAAICNQFEILQLLLSRGATIEQPHPASCHCHPCQESIQRDTLRHSLRRISTYRALAN-----------------AFKLSVELSKLSSCENEFKETYLQLSDQCKGLACDLLEECR 733
            E++RLLL++    +G +LLQA+ +     V+ L+ +          S      SK   DS  +   ++P++LA+  N ++I++LLLS+G TI++ H   C C  CQ S+ R  +  SL R+ TYRALA+                 AF+L+ EL +L+  E EF+  YLQLS QC+  A  LL++CR
Sbjct:    2 EMIRLLLKN-GADVGAALLQAVSKDNVLYVKALLAYENNNDRFSRRSSSCVNLSKNTNDSNRY---MTPLILASHNNSYDIVKLLLSKGHTIDRVHDRGCLCPWCQ-SLGR--IGTSLHRLYTYRALASPVYMSLTFLSCKDPVRQAFELNKELVELADIEYEFRSDYLQLSQQCEEFAVALLDQCR 181          
BLAST of Transient-receptor-potential-like protein vs. Ensembl Nematostella
Match: EDO45311 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RSZ7])

HSP 1 Score: 82.0333 bits (201), Expect = 5.831e-18
Identity = 44/116 (37.93%), Postives = 63/116 (54.31%), Query Frame = 2
Query:  428 PVMLAAICNQFEILQLLLSRGATIEQPHPASCHCHPCQESIQRDTLRHSLRRISTYRALAN--------------AFKLSVELSKLSSCENEFKETYLQLSDQCKGLACDLLEECR 733
            P+++AA    +E+L +L+S+G  + +PH   C C  CQ     D  R S RR+  YR LAN              AF+LS EL  ++  E+E+++ YLQLS QC      LL+ECR
Sbjct:    1 PLVVAAQLGNYEVLNMLVSKGFQLVKPHNVLCRCEECQA----DNFRESQRRLDIYRGLANPVFISMTSNDPFLTAFELSSELEVIARREDEYEKDYLQLSQQCSQFTIGLLDECR 112          
BLAST of Transient-receptor-potential-like protein vs. Ensembl Nematostella
Match: EDO49302 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RH68])

HSP 1 Score: 56.6102 bits (135), Expect = 2.341e-9
Identity = 61/247 (24.70%), Postives = 105/247 (42.51%), Query Frame = 2
Query:   74 NTKERELLDAVDHGDRATVERMLFTEPLVDINCTNVLGRTPLFLAVDNENSELVRLLLRHPNIIIGDSLLQAIKEGVYGIVEQLINHPTIEQEILSSSWPGSEASKEIDSPEFRPDISPVMLAAICNQFEILQLLLSRGATIEQPHPASCHCHPCQESIQRDTLRHSLR-------RISTYRALANAFKLS----------------VELSKLSSCEN----EFKETYLQLSDQCKGLACDLLEECR 733
            +  E+ L D V + D   V       P       + + R  L   +D    +++++ L      IG +L  A+++G    V+ ++  P I      SS  G    +++    F   +SP+MLA    +F+I++L LS+G  + +PH         ++ + R  +   L        R++ YRALA+   +S                +EL+K    +     EF   Y Q+S  C+  A DLLE+CR
Sbjct:   18 SADEQLLFDLVLNEDVEGVRSFFDLRPDFLFRTRDFVTRALLSDTIDLNRGDILKIFLDE-QARIGGALFNAVRKGSKDCVQTML--PYI------SSKRGDIGPEDVKPGAF---VSPLMLAVHLEKFDIIELFLSKGYRVLEPHDDDDEDDDDEQ-LNRTNVGLELSSELSFNLRVNAYRALASPLYISYFFIMNPDALHPIFHVLELNKKLKNQMYRDFEFNNDYKQISKDCQRFAVDLLEQCR 251          
BLAST of Transient-receptor-potential-like protein vs. Ensembl Medaka
Match: trpc4b (short transient receptor potential channel 4 [Source:NCBI gene;Acc:101154885])

HSP 1 Score: 171.4 bits (433), Expect = 1.931e-48
Identity = 101/251 (40.24%), Postives = 149/251 (59.36%), Query Frame = 2
Query:   38 IPLNPLKNLKPINTKERELLDAVDHGDRATVERMLFTEPL---VDINCTNVLGRTPLFLAVDNENSELVRLLLRHPNIIIGDSLLQAIKEGVYGIVEQLINH--PTIEQEILSSSWPGSEASKEIDSPEFRPDISPVMLAAICNQFEILQLLLSRGATIEQPHPASCHCHPCQESIQRDTLRHSLRRISTYRALAN--------------AFKLSVELSKLSSCENEFKETYLQLSDQCKGLACDLLEECR 733
            IPL  ++    ++  E+  L AV+ GD  +V++ L    +   ++INC + LGRT L +A++NEN E++ LLL + N+ +GD+LL AI++ V G VE L+NH  P  E+++     PG    K+    +F PDI+P++LAA  N +E+++LLL RG +I QPH   C C  C  S   D LR+S  R++ Y+ALA+              AF+LS EL +LS  ENEFK  Y +LS  CK  A DLL++ R
Sbjct:   18 IPLRIVRAEAELSPMEKAYLGAVEKGDYGSVKQALEEAEIYFRININCIDSLGRTALLIAIENENLEIIELLLSY-NVHVGDALLHAIRKEVVGAVELLLNHKKPRGEKQV-----PGILLDKQFS--DFTPDITPIILAAHTNNYEVIKLLLQRGVSIPQPHAVRCSCVECMSSTDVDCLRYSRSRLNIYKALASPSLIALSSEDPFLTAFQLSWELKELSRVENEFKSEYEELSHTCKQFAKDLLDQTR 260          
BLAST of Transient-receptor-potential-like protein vs. Ensembl Medaka
Match: trpc4b (short transient receptor potential channel 4 [Source:NCBI gene;Acc:101154885])

HSP 1 Score: 171.014 bits (432), Expect = 2.458e-48
Identity = 101/251 (40.24%), Postives = 149/251 (59.36%), Query Frame = 2
Query:   38 IPLNPLKNLKPINTKERELLDAVDHGDRATVERMLFTEPL---VDINCTNVLGRTPLFLAVDNENSELVRLLLRHPNIIIGDSLLQAIKEGVYGIVEQLINH--PTIEQEILSSSWPGSEASKEIDSPEFRPDISPVMLAAICNQFEILQLLLSRGATIEQPHPASCHCHPCQESIQRDTLRHSLRRISTYRALAN--------------AFKLSVELSKLSSCENEFKETYLQLSDQCKGLACDLLEECR 733
            IPL  ++    ++  E+  L AV+ GD  +V++ L    +   ++INC + LGRT L +A++NEN E++ LLL + N+ +GD+LL AI++ V G VE L+NH  P  E+++     PG    K+    +F PDI+P++LAA  N +E+++LLL RG +I QPH   C C  C  S   D LR+S  R++ Y+ALA+              AF+LS EL +LS  ENEFK  Y +LS  CK  A DLL++ R
Sbjct:   18 IPLRIVRAEAELSPMEKAYLGAVEKGDYGSVKQALEEAEIYFRININCIDSLGRTALLIAIENENLEIIELLLSY-NVHVGDALLHAIRKEVVGAVELLLNHKKPRGEKQV-----PGILLDKQFS--DFTPDITPIILAAHTNNYEVIKLLLQRGVSIPQPHAVRCSCVECMSSTDVDCLRYSRSRLNIYKALASPSLIALSSEDPFLTAFQLSWELKELSRVENEFKSEYEELSHTCKQFAKDLLDQTR 260          
BLAST of Transient-receptor-potential-like protein vs. Ensembl Medaka
Match: trpc4b (short transient receptor potential channel 4 [Source:NCBI gene;Acc:101154885])

HSP 1 Score: 171.014 bits (432), Expect = 2.644e-48
Identity = 101/251 (40.24%), Postives = 149/251 (59.36%), Query Frame = 2
Query:   38 IPLNPLKNLKPINTKERELLDAVDHGDRATVERMLFTEPL---VDINCTNVLGRTPLFLAVDNENSELVRLLLRHPNIIIGDSLLQAIKEGVYGIVEQLINH--PTIEQEILSSSWPGSEASKEIDSPEFRPDISPVMLAAICNQFEILQLLLSRGATIEQPHPASCHCHPCQESIQRDTLRHSLRRISTYRALAN--------------AFKLSVELSKLSSCENEFKETYLQLSDQCKGLACDLLEECR 733
            IPL  ++    ++  E+  L AV+ GD  +V++ L    +   ++INC + LGRT L +A++NEN E++ LLL + N+ +GD+LL AI++ V G VE L+NH  P  E+++     PG    K+    +F PDI+P++LAA  N +E+++LLL RG +I QPH   C C  C  S   D LR+S  R++ Y+ALA+              AF+LS EL +LS  ENEFK  Y +LS  CK  A DLL++ R
Sbjct:   18 IPLRIVRAEAELSPMEKAYLGAVEKGDYGSVKQALEEAEIYFRININCIDSLGRTALLIAIENENLEIIELLLSY-NVHVGDALLHAIRKEVVGAVELLLNHKKPRGEKQV-----PGILLDKQFS--DFTPDITPIILAAHTNNYEVIKLLLQRGVSIPQPHAVRCSCVECMSSTDVDCLRYSRSRLNIYKALASPSLIALSSEDPFLTAFQLSWELKELSRVENEFKSEYEELSHTCKQFAKDLLDQTR 260          
BLAST of Transient-receptor-potential-like protein vs. Ensembl Medaka
Match: trpc4a (transient receptor potential cation channel subfamily C member 4 [Source:NCBI gene;Acc:101170611])

HSP 1 Score: 167.548 bits (423), Expect = 4.383e-47
Identity = 99/251 (39.44%), Postives = 150/251 (59.76%), Query Frame = 2
Query:   38 IPLNPLKNLKPINTKERELLDAVDHGDRATVERMLFTEPL---VDINCTNVLGRTPLFLAVDNENSELVRLLLRHPNIIIGDSLLQAIKEGVYGIVEQLINH--PTIEQEILSSSWPGSEASKEIDSPEFRPDISPVMLAAICNQFEILQLLLSRGATIEQPHPASCHCHPCQESIQRDTLRHSLRRISTYRALAN--------------AFKLSVELSKLSSCENEFKETYLQLSDQCKGLACDLLEECR 733
            IPL  ++    ++  E+  L AV+ GD A+V++ L    +   ++INC + LGRT L +A++NEN E++ LLL   N+ +GD+LL AI++ V G VE L+NH  P+   ++     P     K+    +F PDI+P++LAA  N +EI++LL+ +G ++ QPH   C+C  C  S   D+LRHS  R++ Y+AL++              AF+LS EL +LS  ENEFK  Y +LS QCK  A DLL++ R
Sbjct:   18 IPLRIVRAESELSNLEKAYLGAVEKGDYASVKQALEEAEIYFKININCIDPLGRTALLIAIENENLEIIELLLSF-NVYVGDALLHAIRKEVVGAVELLLNHKKPSGGMQV-----PPILLDKQYS--DFTPDITPIILAAHTNNYEIIKLLVQKGVSMPQPHEVRCNCVECVSSSDVDSLRHSRSRLNIYKALSSPSLIALSSEDPFLTAFRLSWELQELSKVENEFKSEYEELSQQCKQFAKDLLDQTR 260          
BLAST of Transient-receptor-potential-like protein vs. Ensembl Medaka
Match: trpc5a (short transient receptor potential channel 5 [Source:NCBI gene;Acc:101169488])

HSP 1 Score: 166.777 bits (421), Expect = 9.799e-47
Identity = 103/253 (40.71%), Postives = 150/253 (59.29%), Query Frame = 2
Query:   38 IPLNPLKNLKPINTKERELLDAVDHGDRATVERMLFTEPL---VDINCTNVLGRTPLFLAVDNENSELVRLLLRHPNIIIGDSLLQAIKEGVYGIVEQLINH--PTIEQEILSSSWPGSEASKEIDS--PEFRPDISPVMLAAICNQFEILQLLLSRGATIEQPHPASCHCHPCQESIQRDTLRHSLRRISTYRALAN--------------AFKLSVELSKLSSCENEFKETYLQLSDQCKGLACDLLEECR 733
            IPL  ++    ++ +ER  L AV+ GD A V+  L    +   +D+NC + LGR+ L +A++NEN E++ LLL H  I  GD+LL AI++ V G VE L++H  P+ E+++          S  +DS   EF PDI+P+MLAA  N +EI++LL+ R  TI +PH   C C  C  S + D+LRHS  R++ Y+ALA+              AF+L  EL +LS  ENEF++ Y +LS QCK  A DLL++ R
Sbjct:   21 IPLQIVRAEVELSAEERAYLTAVEKGDYAGVKHALREAEVYYNMDVNCLDPLGRSGLLIAIENENLEIMELLLDH-GIHTGDALLYAIRKEVVGAVELLLSHRRPSGEKQV---------PSLMMDSQFSEFTPDITPIMLAAHTNNYEIIKLLVQRKVTIPRPHQIRCDCVECVSSSEVDSLRHSRSRLNIYKALASPSLIALSSEDPILTAFRLGWELKELSKVENEFRQEYEELSQQCKRFAKDLLDQAR 263          
BLAST of Transient-receptor-potential-like protein vs. Planmine SMEST
Match: SMESG000024108.1 (SMESG000024108.1)

HSP 1 Score: 486.108 bits (1250), Expect = 1.036e-172
Identity = 241/256 (94.14%), Postives = 242/256 (94.53%), Query Frame = 2
Query:    8 MRRSRSRHKWIPLNPLKNLKPINTKERELLDAVDHGDRATVERMLFTEPLVDINCTNVLGRTPLFLAVDNENSELVRLLLRHPNIIIGDSLLQAIKEGVYGIVEQLINHPTIEQEILSSSWPGSEASKEIDSPEFRPDISPVMLAAICNQFEILQLLLSRGATIEQPHPASCHCHPCQESIQRDTLRHSLRRISTYRALA--------------NAFKLSVELSKLSSCENEFKETYLQLSDQCKGLACDLLEECR 733
            MRRSRSRHKWIPLNPLKNLKPINTKERELLDAVDHGDRATVERMLFTEPLVDINCTNVLGRTPLFLAVDNENSELVRLLLRHPNIIIGDSLLQAIKEGVYGIVEQLINHPTIEQEILSSSWPGSEASKEIDSPEFRPDISPVMLAAICNQFEILQLLLSRGATIEQPHPASCHCHPCQESIQRDTLRHSLRRISTYRALA              +AFKLSVELSKLSSCENEFKETYLQLSDQCKGLACDLLEECR
Sbjct:    1 MRRSRSRHKWIPLNPLKNLKPINTKERELLDAVDHGDRATVERMLFTEPLVDINCTNVLGRTPLFLAVDNENSELVRLLLRHPNIIIGDSLLQAIKEGVYGIVEQLINHPTIEQEILSSSWPGSEASKEIDSPEFRPDISPVMLAAICNQFEILQLLLSRGATIEQPHPASCHCHPCQESIQRDTLRHSLRRISTYRALASPAWICLTSQDPILDAFKLSVELSKLSSCENEFKETYLQLSDQCKGLACDLLEECR 256          
BLAST of Transient-receptor-potential-like protein vs. Planmine SMEST
Match: SMESG000078533.1 (SMESG000078533.1)

HSP 1 Score: 142.124 bits (357), Expect = 2.453e-38
Identity = 92/236 (38.98%), Postives = 137/236 (58.05%), Query Frame = 2
Query:   83 ERELLDAVDHGDRATVERML--FTEPLVDINCTNVLGRTPLFLAVDNENSELVRLLLRHPNIIIGDSLLQAIKEGVYGIVEQLINHPTI---EQEILSSSWPGSEASKEIDSPEFRPDISPVMLAAICNQFEILQLLLSRGATIEQPHPASCHCHPCQESIQRDTLRHSLRRISTYRALAN--------------AFKLSVELSKLSSCENEFKETYLQLSDQCKGLACDLLEECR 733
            ER+ L +V+ GD   V+ +L    + +++INC + LGRT L +A++NE++E++ LLL + N+ I DSLL AI E     VE L+        ++++L      S A        F  DI+P++LAA  + + I+++LL RG TI +PH   C CH C +S + D+LRHS  RI+ YRALA+              AF+LS EL++L   ENEFK  Y  L++QC+  A DLL + R
Sbjct:   62 ERKYLLSVERGDAPYVKSILDNKNKYVLNINCADSLGRTALHIAIENEHNEMLELLLSY-NLEIADSLLHAISEENIEAVEILLTAMATRPKKKDLLDLLGNSSNA--------FTSDITPLILAAHRDNYPIIKILLDRGDTIPKPHDLRCACHECVKSQKEDSLRHSRSRINAYRALASPSLICLSSKDPILTAFELSWELNRLGILENEFKTDYEMLAEQCQKFATDLLAQTR 288          
BLAST of Transient-receptor-potential-like protein vs. Planmine SMEST
Match: SMESG000062875.1 (SMESG000062875.1)

HSP 1 Score: 138.658 bits (348), Expect = 1.484e-37
Identity = 90/240 (37.50%), Postives = 130/240 (54.17%), Query Frame = 2
Query:   80 KERELLDAVDHGDRATVERMLF----TEPLVDINCTNVLGRTPLFLAVDNENSELVRLLLRHPNI-IIGDSLLQAIKEGVYGIVEQLINHPTI---EQEILSSSWPGSEASKEIDSPEFRPDISPVMLAAICNQFEILQLLLSRGATIEQPHPASCHCHPCQESIQRDTLRHSLRRISTYRALAN--------------AFKLSVELSKLSSCENEFKETYLQLSDQCKGLACDLLEECR 733
            +ER  L+A   GD A V RM      +E L ++NC + +GR  L LAVD+EN+E++ LLL   N   I ++LL AI +G   I   +I HP     E +I    +  +   +  +  +F PDI+P++LAA  N  E++Q+ LSR   IE+PH  SC C  CQ     D+L+ S  R++ YRALA+               F+L  E+ KL+  E EFK  YL L +QC   AC +++ CR
Sbjct:  209 EERVYLNAAALGD-AGVLRMFLDSSDSEKL-NVNCVDYMGRNSLHLAVDSENAEIIELLLDKLNFECIEEALLHAISKGHTKIERLIIEHPNFMAKEDQIRRIDF-NNAFFRTTEKSQFSPDITPLILAAHYNNHEMIQMFLSRQHIIERPHSISCQCSDCQVKQDYDSLKRSRSRLNAYRALASPAFMALSSPDPIMTTFELRQEMMKLAEVEKEFKIEYLMLVEQCMNFACQMMDLCR 445          
BLAST of Transient-receptor-potential-like protein vs. Planmine SMEST
Match: SMESG000018612.1 (SMESG000018612.1)

HSP 1 Score: 137.502 bits (345), Expect = 1.002e-36
Identity = 82/241 (34.02%), Postives = 131/241 (54.36%), Query Frame = 2
Query:   71 INTKERELLDAVDHGDRATVERML--FTEPLVDINCTNVLGRTPLFLAVDNENSELVRLLLRHPNI-IIGDSLLQAIKEGVYGIVEQLINHPTI---EQEILSSSWPGSEASKEIDSPEFRPDISPVMLAAICNQFEILQLLLSRGATIEQPHPASCHCHPCQESIQRDTLRHSLRRISTYRALAN--------------AFKLSVELSKLSSCENEFKETYLQLSDQCKGLACDLLEECR 733
            ++ +ER  L+A   GD   +   L    E  +++NC + +GR  L LAVD+EN + + +LL       I ++LL AI +G   +V  +I HP     E +I    +  +   +  +  +F PDI+P++L+A  N  E++Q+ +SR  +IE+PH  SCHC  CQ     D+L+ S  R++ YRALA+               F+L  E+ KL+  E EFK  YL+L +QC   AC++++ CR
Sbjct:   72 LSDEERVYLNAAALGDIGVIRMSLEAAEEDKMNVNCVDYMGRNALHLAVDSENMDAIEMLLDKVAFECIEEALLHAISKGSTKLVRLIIEHPNYMAGEDKIKRMDY-NNAFFRTTEKSQFSPDITPLILSAHYNNHEMIQMFISRSHSIEKPHSISCHCTDCQIKQDYDSLKRSRSRLNAYRALASPAYMALSSQDPIMTTFELRQEMMKLAEVEKEFKREYLELVEQCMEFACEMMDLCR 311          
BLAST of Transient-receptor-potential-like protein vs. Planmine SMEST
Match: SMESG000018612.1 (SMESG000018612.1)

HSP 1 Score: 137.502 bits (345), Expect = 1.033e-36
Identity = 82/241 (34.02%), Postives = 131/241 (54.36%), Query Frame = 2
Query:   71 INTKERELLDAVDHGDRATVERML--FTEPLVDINCTNVLGRTPLFLAVDNENSELVRLLLRHPNI-IIGDSLLQAIKEGVYGIVEQLINHPTI---EQEILSSSWPGSEASKEIDSPEFRPDISPVMLAAICNQFEILQLLLSRGATIEQPHPASCHCHPCQESIQRDTLRHSLRRISTYRALAN--------------AFKLSVELSKLSSCENEFKETYLQLSDQCKGLACDLLEECR 733
            ++ +ER  L+A   GD   +   L    E  +++NC + +GR  L LAVD+EN + + +LL       I ++LL AI +G   +V  +I HP     E +I    +  +   +  +  +F PDI+P++L+A  N  E++Q+ +SR  +IE+PH  SCHC  CQ     D+L+ S  R++ YRALA+               F+L  E+ KL+  E EFK  YL+L +QC   AC++++ CR
Sbjct:   72 LSDEERVYLNAAALGDIGVIRMSLEAAEEDKMNVNCVDYMGRNALHLAVDSENMDAIEMLLDKVAFECIEEALLHAISKGSTKLVRLIIEHPNYMAGEDKIKRMDY-NNAFFRTTEKSQFSPDITPLILSAHYNNHEMIQMFISRSHSIEKPHSISCHCTDCQIKQDYDSLKRSRSRLNAYRALASPAYMALSSQDPIMTTFELRQEMMKLAEVEKEFKREYLELVEQCMEFACEMMDLCR 311          
The following BLAST results are available for this feature:
BLAST of Transient-receptor-potential-like protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TRPC52.921e-4739.44transient receptor potential cation channel subfam... [more]
TRPC32.079e-4436.44transient receptor potential cation channel subfam... [more]
TRPC33.331e-4436.44transient receptor potential cation channel subfam... [more]
TRPC34.441e-4436.44transient receptor potential cation channel subfam... [more]
TRPC44.945e-4440.64transient receptor potential cation channel subfam... [more]
back to top
BLAST of Transient-receptor-potential-like protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
trp-18.610e-6347.68Transient-receptor-potential-like protein [Source... [more]
trp-14.104e-6147.83Transient-receptor-potential-like protein [Source... [more]
trp-21.194e-3434.62TRP (Transient receptor potential) channel family;... [more]
trp-21.245e-3434.62TRP (Transient receptor potential) channel family;... [more]
spe-415.009e-1228.74TRP homologous cation channel protein; TRP-3 chann... [more]
back to top
BLAST of Transient-receptor-potential-like protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Trpgamma8.429e-4538.87gene:FBgn0032593 transcript:FBtr0335144[more]
Trpgamma9.102e-4538.87gene:FBgn0032593 transcript:FBtr0080945[more]
Trpgamma9.102e-4538.87gene:FBgn0032593 transcript:FBtr0080946[more]
trpl6.267e-3739.22gene:FBgn0005614 transcript:FBtr0088471[more]
trpl6.267e-3739.22gene:FBgn0005614 transcript:FBtr0301662[more]
back to top
BLAST of Transient-receptor-potential-like protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
trpc4b3.217e-4940.24transient receptor potential cation channel, subfa... [more]
trpc4b3.217e-4940.24transient receptor potential cation channel, subfa... [more]
trpc4a1.871e-4739.44transient receptor potential cation channel, subfa... [more]
trpc4a1.871e-4739.44transient receptor potential cation channel, subfa... [more]
trpc5b3.742e-4739.44transient receptor potential cation channel, subfa... [more]
back to top
BLAST of Transient-receptor-potential-like protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TRPC55.369e-4840.24transient receptor potential cation channel, subfa... [more]
TRPC39.988e-4536.53transient receptor potential cation channel, subfa... [more]
nup1881.802e-4137.04nucleoporin 188kDa [Source:Xenbase;Acc:XB-GENE-593... [more]
nup1882.065e-4137.04nucleoporin 188kDa [Source:Xenbase;Acc:XB-GENE-593... [more]
nup1882.082e-4137.04nucleoporin 188kDa [Source:Xenbase;Acc:XB-GENE-593... [more]
back to top
BLAST of Transient-receptor-potential-like protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Trpc53.199e-4739.44transient receptor potential cation channel, subfa... [more]
Trpc42.936e-4340.64transient receptor potential cation channel, subfa... [more]
Trpc74.808e-4334.84transient receptor potential cation channel, subfa... [more]
Trpc36.242e-4336.44transient receptor potential cation channel, subfa... [more]
Trpc61.474e-4236.63transient receptor potential cation channel, subfa... [more]
back to top
BLAST of Transient-receptor-potential-like protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P34586|TRPL_CAEEL1.095e-6147.68Transient-receptor-potential-like protein OS=Caeno... [more]
sp|O62852|TRPC5_RABIT1.377e-4639.44Short transient receptor potential channel 5 OS=Or... [more]
sp|Q9UL62|TRPC5_HUMAN1.403e-4639.44Short transient receptor potential channel 5 OS=Ho... [more]
sp|Q9QX29|TRPC5_MOUSE2.238e-4639.44Short transient receptor potential channel 5 OS=Mu... [more]
sp|Q9VJJ7|TRPG_DROME9.124e-4438.87Transient receptor potential-gamma protein OS=Dros... [more]
back to top
BLAST of Transient-receptor-potential-like protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4Y2EQQ38.758e-7952.71Transient-receptor-potential-like protein OS=Arane... [more]
A0A0F7VHL63.502e-7854.47Csa-Trp2 (Fragment) OS=Cupiennius salei OX=6928 GN... [more]
A0A0R3SMV34.986e-7854.51Uncharacterized protein OS=Hymenolepis diminuta OX... [more]
A0A0L8HBD35.690e-7849.81Uncharacterized protein OS=Octopus bimaculoides OX... [more]
A0A1I8I4R71.277e-7652.85Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of Transient-receptor-potential-like protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
trpc4a2.374e-4639.36short transient receptor potential channel 4-like ... [more]
trpc5b4.916e-4639.44transient receptor potential cation channel, subfa... [more]
trpc5a1.119e-4539.44short transient receptor potential channel 5-like ... [more]
trpc31.343e-4438.17transient receptor potential cation channel subfam... [more]
trpc4b7.768e-4340.64short transient receptor potential channel 4-like ... [more]
back to top
BLAST of Transient-receptor-potential-like protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
trpc31.144e-4136.59transient receptor potential cation channel, subfa... [more]
trpc4b9.328e-2643.75transient receptor potential cation channel, subfa... [more]
trpc4b3.321e-2443.33transient receptor potential cation channel, subfa... [more]
back to top
BLAST of Transient-receptor-potential-like protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Transient-receptor-potential-like protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO483465.666e-2035.29Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO453115.831e-1837.93Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO493022.341e-924.70Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Transient-receptor-potential-like protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
trpc4b1.931e-4840.24short transient receptor potential channel 4 [Sour... [more]
trpc4b2.458e-4840.24short transient receptor potential channel 4 [Sour... [more]
trpc4b2.644e-4840.24short transient receptor potential channel 4 [Sour... [more]
trpc4a4.383e-4739.44transient receptor potential cation channel subfam... [more]
trpc5a9.799e-4740.71short transient receptor potential channel 5 [Sour... [more]
back to top
BLAST of Transient-receptor-potential-like protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000024108.11.036e-17294.14SMESG000024108.1[more]
SMESG000078533.12.453e-3838.98SMESG000078533.1[more]
SMESG000062875.11.484e-3737.50SMESG000062875.1[more]
SMESG000018612.11.002e-3634.02SMESG000018612.1[more]
SMESG000018612.11.033e-3634.02SMESG000018612.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30009185 ID=SMED30009185|Name=Transient-receptor-potential-like protein|organism=Schmidtea mediterranea sexual|type=transcript|length=735bp
GTTTCTCATGAGAAGAAGTCGCAGTCGACACAAATGGATTCCTCTGAATC
CACTGAAGAATTTGAAACCGATTAATACAAAGGAAAGAGAATTATTAGAT
GCCGTTGACCACGGAGATAGGGCAACCGTTGAAAGAATGTTATTTACTGA
GCCATTAGTCGACATTAATTGCACAAACGTTCTCGGAAGAACTCCACTCT
TTCTGGCTGTTGATAATGAAAACTCGGAATTAGTCAGACTTTTATTGAGA
CATCCCAATATCATTATAGGCGACTCTCTATTGCAAGCAATAAAAGAAGG
CGTATATGGAATTGTTGAGCAGTTGATAAATCATCCAACTATTGAACAAG
AGATTCTCAGCTCTTCCTGGCCTGGTTCAGAAGCATCTAAAGAAATCGAT
AGTCCAGAATTCCGACCAGATATTTCACCAGTTATGTTAGCAGCCATTTG
CAATCAATTCGAAATACTACAACTTCTTTTAAGTAGAGGAGCTACAATAG
AACAACCTCATCCAGCTTCATGCCATTGCCATCCATGCCAAGAGAGCATC
CAAAGAGACACATTACGACATTCATTAAGAAGAATTAGCACATATCGAGC
CTTAGCAAATGCGTTCAAGCTATCAGTTGAATTAAGCAAGCTGTCGAGTT
GCGAAAACGAATTTAAGGAGACTTATTTACAACTGTCAGACCAATGCAAA
GGGTTAGCCTGTGATTTACTGGAAGAATGCCGATC
back to top

protein sequence of SMED30009185-orf-1

>SMED30009185-orf-1 ID=SMED30009185-orf-1|Name=SMED30009185-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=244bp
FLMRRSRSRHKWIPLNPLKNLKPINTKERELLDAVDHGDRATVERMLFTE
PLVDINCTNVLGRTPLFLAVDNENSELVRLLLRHPNIIIGDSLLQAIKEG
VYGIVEQLINHPTIEQEILSSSWPGSEASKEIDSPEFRPDISPVMLAAIC
NQFEILQLLLSRGATIEQPHPASCHCHPCQESIQRDTLRHSLRRISTYRA
LANAFKLSVELSKLSSCENEFKETYLQLSDQCKGLACDLLEECR
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000017photoreceptor neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR036770Ankyrin_rpt-contain_sf
IPR002153TRPC_channel
IPR002110Ankyrin_rpt
IPR020683Ankyrin_rpt-contain_dom
IPR013555TRP_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0005216ion channel activity
GO:0005262calcium channel activity
GO:0015279store-operated calcium channel activity
Vocabulary: biological process
TermDefinition
GO:0055085transmembrane transport
GO:0070588calcium ion transmembrane transport
GO:0006810transport
GO:0006811ion transport
GO:0006816calcium ion transport
GO:0006828manganese ion transport
GO:0051480regulation of cytosolic calcium ion concentration
GO:0051924regulation of calcium ion transport
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0005886plasma membrane
GO:0005887integral component of plasma membrane
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002110Ankyrin repeatSMARTSM00248ANK_2acoord: 61..89
e-value: 0.9
score: 18.6
coord: 139..168
e-value: 0.67
score: 19.0
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 61..84
score: 8.71
IPR013555Transient receptor ion channel domainPFAMPF08344TRP_2coord: 174..203
e-value: 3.7E-8
score: 33.4
IPR020683Ankyrin repeat-containing domainPFAMPF12796Ank_2coord: 33..111
e-value: 8.9E-7
score: 29.4
IPR020683Ankyrin repeat-containing domainPROSITEPS50297ANK_REP_REGIONcoord: 53..84
score: 8.879
IPR036770Ankyrin repeat-containing domain superfamilyGENE3DG3DSA:1.25.40.20coord: 26..238
e-value: 6.1E-17
score: 63.8
IPR036770Ankyrin repeat-containing domain superfamilySUPERFAMILYSSF48403Ankyrin repeatcoord: 31..167
IPR002153Transient receptor potential channel, canonicalPANTHERPTHR10117TRANSIENT RECEPTOR POTENTIAL CHANNELcoord: 24..244
NoneNo IPR availablePANTHERPTHR10117:SF46TRANSIENT-RECEPTOR-POTENTIAL-LIKE PROTEINcoord: 24..244