Glutamate receptor-interacting protein 2

Overview
NameGlutamate receptor-interacting protein 2
Smed IDSMED30009173
Length (bp)3941
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Glutamate receptor-interacting protein 2 (SMED30009173) t-SNE clustered cells

Violin plots show distribution of expression levels for Glutamate receptor-interacting protein 2 (SMED30009173) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Glutamate receptor-interacting protein 2 (SMED30009173) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Glutamate receptor-interacting protein 2 (SMED30009173) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30009173

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30009173SMESG000031603.1 PL08001B1F10ncbi_smed_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
pharynxSMED30009173SMESG000031603.1 dd_Smed_v4_3080_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30009173SMESG000031603.1 dd_Smed_v4_3080_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
gutSMED30009173SMESG000031603.1 dd_Smed_v4_3080_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30009173SMESG000031603.1 dd_Smed_v4_3080_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Glutamate receptor-interacting protein 2 vs. Ensembl Human
Match: MPDZ (multiple PDZ domain crumbs cell polarity complex component [Source:HGNC Symbol;Acc:HGNC:7208])

HSP 1 Score: 103.99 bits (258), Expect = 1.709e-21
Identity = 75/279 (26.88%), Postives = 133/279 (47.67%), Query Frame = 1
Query:  253 AIQENWIRILGIDYEIISMNLCK--RNQSLGVALEGRNEIARNTQEVVQHHFFKVILPSQCVGETGKFMVKDEILEVNGLKVVGLPTKEVLNTLRKVTNYFQIVVARSIIHNYDLASDYGGSEDNINSPISFYDMDDDESSQNGTLRSNVSNYSTTSRDFGSSVSFGGLIDGQHETVNDYLRNMVGWRGPIV-IELRKQNSPFGLALEEIRNPLHNA-MIIVFKYVVPEMTAGKDGRLHAGDRLLQVNGKSVEGVDFRQVCKWIKSSPRGRLVLYICKP 1077
            A+   W RI+GI+YEI+  ++ K   N  LG++LE            V HHF + +LP   VG +GK    DE+LEVNG+ ++G   ++V+N L+++     +V  R  +                 S +   D+ D E ++   +       S+ + D   +++  G      ++  +    +  W   I  IEL K +   G ++ + ++P+  A  +I+ + +VP   A KDGRL  GDRL+ VN  ++E     +  + +K +P G + + + KP
Sbjct:  536 ALLTKWQRIMGINYEIVVAHVSKFSENSGLGISLEA----------TVGHHFIRSVLPEGPVGHSGKLFSGDELLEVNGITLLGENHQDVVNILKELPIEVTMVCCRRTV------------PPTTQSELDSLDLCDIELTEKPHVDLGEFIGSSETEDPVLAMTDAG------QSTEEVQAPLAMWEAGIQHIELEKGSKGLGFSILDYQDPIDPASTVIIIRSLVPGGIAEKDGRLLPGDRLMFVNDVNLENSSLEEAVEALKGAPSGTVRIGVAKP 786          

HSP 2 Score: 88.1965 bits (217), Expect = 1.071e-16
Identity = 182/823 (22.11%), Postives = 324/823 (39.37%), Query Frame = 1
Query:  325 NQSLGVAL-EGRNEIAR-NTQEVVQHHFFKVILPSQCVGETGKFMVKDEILEVNGLKVVGLPTKEVLNTLRKVTN----YFQIVVAR-------SIIHN----YDLASDYGGSED---NINSPISFYDMDDDESSQNGTLRSNVSNYSTTSRDFGSSVSFGGLIDGQHETVNDY-LRNMVGWRGPI-----VIELRKQNSPFGLALEEIRNPLHNAMIIVFKYVVPEMTAGKDGRLHAGDRLLQVNGKSVEGVDFRQVCKWIKSSPRGRLVLYICKPHFETINYDPSSPANDDKYYFNTIRDMDKLPKLSE-----ETDGECLRLPAVPEYME----THITLKRTENKLGIFLDIVDEGKNGARIKKMT-HGIAKNDGRLHEGDFVTKVNE-----------ISLKVDNKSKLDLCLKQISADKRNYNISYITAEDVRLHNGKYGTVSSATNRLPQSSQIYPEFL--SIKVTEPLNEINSDKTRNHKFSFETFDIIIKNDKQTGLGLVLSPSLKDPNRYISITDIHDNSLCGKSGLLKINDEILKVNNVDFENISINELGHFLKRAHKTENELRFQVRRLTCSENVPVDPLIEKLTWFPDIYHRVLKRGPN-GFGFSLLELDSNNGVVVDKVDLNKVCD----LKPGERFVMINKCTVITCSKPNVVQMVKNS--TRNLEL--IIETPKYREFR----------------------------------------------VKISKDSSMSLGLNIAGGRDTRFP-IPV-IESLVPNRTSKFSEELFTLDLITEVDGTNVTKQNHAEIIQIFRSTGRETTFKIL 2475
            ++SLG+++  GR   +R +  EV++  F K +L     G+ G     D I+EV+G+ +     ++ +  +RK  N      Q ++ R       S++HN    Y+ +S    ++    N +   S  + + +++          S ++    D   S +     D   E    Y  +N+    G +     +IEL K +S  GL+L    N   + M +    + P   AGKDGRL   D LL++NG+ + G   +     IK +P    +++I   + + +N     P N           ++ LP  SE     ET+       A  +        H+ L + +  LGI +   D   +G  IK +T HG+A  DGRL  GD +  V++           ISL    K  + L +   + D +    +   A   + +       SS +  +PQS    PE +  + + + P    +   T       ET   I K   +TGLGL +          I I ++++     K G L   D+IL+VN +D    + +E  + L+   +T   +R  + R         D    K     D     L++ P  G G S++   ++ GV V  +    + D    L  G++ +M+N   V   ++  V  ++K S  T  LE+  I   P + E R                                              V++ K  + SLG++IAGG  +    +P+ I  + P   +  +++L   D I  + GT+     H + + + ++       +++
Sbjct: 1159 SKSLGISIVGGRGMGSRLSNGEVMRGIFIKHVLEDSPAGKNGTLKPGDRIVEVDGMDLRDASHEQAVEAIRKAGNPVVFMVQSIINRPRKSPLPSLLHNLYPKYNFSSTNPFADSLQINADKAPSQSESEPEKAPLCSVPPPPPSAFAEMGSDHTQSSASKISQDVDKEDEFGYSWKNIRERYGTLTGELHMIELEKGHSGLGLSLA--GNKDRSRMSVFIVGIDPNGAAGKDGRLQIADELLEINGQILYGRSHQNASSIIKCAPSKVKIIFI--RNKDAVNQMAVCPGN----------AVEPLPSNSENLQNKETEPTVTTSDAAVDLSSFKNVQHLELPKDQGGLGIAISEEDT-LSGVIIKSLTEHGVAATDGRLKVGDQILAVDDEIVVGYPIEKFISLLKTAKMTVKLTIHAENPDSQAVPSAAGAASGEKKN-------SSQSLMVPQSGSPEPESIRNTSRSSTPAIFASDPATCPIIPGCETTIEISKG--RTGLGLSIVGGSDTLLGAIIIHEVYEEGAACKDGRLWAGDQILEVNGIDLRKATHDEAINVLR---QTPQRVRLTLYR---------DEAPYKEEEVCDTLTIELQKKPGKGLGLSIVGKRNDTGVFVSDIVKGGIADADGRLMQGDQILMVNGEDVRNATQEAVAALLKCSLGTVTLEVGRIKAGPFHSERRPSQSSQVSEGSLSSFTFPLSGSSTSESLESSSKKNALASEIQGLRTVEMKKGPTDSLGISIAGGVGSPLGDVPIFIAMMHPTGVAAQTQKLRVGDRIVTICGTSTEGMTHTQAVNLLKNASGSIEMQVV 1945          

HSP 3 Score: 64.6994 bits (156), Expect = 1.387e-9
Identity = 138/660 (20.91%), Postives = 255/660 (38.64%), Query Frame = 1
Query:  349 EGRNEIARNTQEVVQHHFFKVILPSQCVGETGKFMVKDEILEVNGLKVVGLPTKEVLNTLRKVTNYFQIVVARSIIHNYDLASDYGG-SEDNINSPISFYDMDDDESSQNGTLRSNVSNYSTTSRDFGSSVSFGGLIDGQHETVNDYLRNMVGWRGPIVIELRKQNSPFGLALEEIRNPLHNAMIIVFKYVVPEMTAGKDGRLHAGDRLLQVNGKSVEGVDFRQVCKWIKSSP-RGRLVLYICKPHFETINYDPSSPANDDKYYFNTIRDMDKLPKLSEETDGECLRLPAVPEYMETHITLKRTENKLGIFLDIVDEGKNGARIKKMTHGIAKNDGRLHEGDFVTKVNEISLKVDNKSKLDLCLKQISADKRNYNISYITAEDVRLHNGKYGTVSSATNRLPQSSQI---------YPEFLSIKVTEPLNEINSDKTRNHKFSFETFDIIIKNDKQTGLGLVLSPSLKDP--NRYISITDIHDNSLCGKSGLLKINDEILKVNNVDFENISINELGHFLKRAHKTENELRFQVRRLTCSENVPV------DPLIEKLTWF--------------PDIYHRVLKRGPNGFGFSLL-ELDSNNG-------VVVDKVDLNKVCDLKPGERFVMINKCTVITCSKPNVVQMVKNSTRNLELII 2205
            +G   IA + ++ +     K +         G+  V D+IL V+   VVG P ++ ++ L+      ++ +      +  + S  G  S +  NS  S   +    S +  ++R+  ++ S+T   F S  +   +I G   T                IE+ K  +  GL++    + L  A+II    V  E  A KDGRL AGD++L+VNG  +      +    ++ +P R RL LY              +P  +++       ++ K P       G+ L L          I  KR  N  G+F+  + +G           GIA  DGRL +GD +  VN   ++   +  +   LK         ++  +T E  R+  G +     +  R  QSSQ+         +P   S       +    +   +      T +  +K      LG+ ++  +  P  +  I I  +H   +  ++  L++ D I+ +     E ++  +  + LK A  +   +  QV       +V V      +P    L++               P      L+RGP+G GFS++    S +G        V  K   ++   LK G++ + +N  ++   +    V ++K +   + L++
Sbjct: 1490 QGGLGIAISEEDTLSGVIIKSLTEHGVAATDGRLKVGDQILAVDDEIVVGYPIEKFISLLKTAKMTVKLTIHAENPDSQAVPSAAGAASGEKKNSSQSLM-VPQSGSPEPESIRN--TSRSSTPAIFASDPATCPIIPGCETT----------------IEISKGRTGLGLSIVGGSDTLLGAIII--HEVYEEGAACKDGRLWAGDQILEVNGIDLRKATHDEAINVLRQTPQRVRLTLY-----------RDEAPYKEEEVCDTLTIELQKKP-------GKGLGL---------SIVGKR--NDTGVFVSDIVKG-----------GIADADGRLMQGDQILMVNGEDVRNATQEAVAALLK--------CSLGTVTLEVGRIKAGPF----HSERRPSQSSQVSEGSLSSFTFPLSGSSTSESLESSSKKNALASEIQGLRTVE--MKKGPTDSLGISIAGGVGSPLGDVPIFIAMMHPTGVAAQTQKLRVGDRIVTICGTSTEGMTHTQAVNLLKNASGS---IEMQV---VAGGDVSVVTGHQQEPASSSLSFTGLTSSSIFQDDLGPPQCKSITLERGPDGLGFSIVGGYGSPHGDLPIYVKTVFAKGAASEDGRLKRGDQIIAVNGQSLEGVTHEEAVAILKRTKGTVTLMV 2068          

HSP 4 Score: 56.9954 bits (136), Expect = 3.137e-7
Identity = 98/417 (23.50%), Postives = 166/417 (39.81%), Query Frame = 1
Query:  283 GIDYEIISMNLCKRNQSLGVALEGRNEIARNTQEVVQHHFFKVILPSQCVGETGKFMVKDEILEVNGLKVVGLPTKEVLNTLRKVTNYFQI-VVARSIIHNYDLASDYGGSEDNINSPISF------YDMDDD--ESSQN-GTLRSNVSNYSTTSRDFGSSVSFGGLIDGQHET---VNDYLRNMVGWRGPIVIELRK--QNSPFGLALEEIRNPLHNAMIIVFKYVVPEMTAGKDGRLHAGDRLLQVNGKSVEGVDFRQVCKWIKSSPRGRLVLYIC------------------------KPHFETINYDPSSPANDDKYYFNTIRDMDKLPKLSEETDGECLRLPAVPEYMETHITLKRTENKLGI----FLDIVDEGKNGARIKKMT-HGIAKNDGRLHEGDFVTKVNEISLK 1401
            G + E   + L K  Q LG+ + G   I     E     F K I  S  V   G+  + D+I+ V+G  + G   ++ +  LR       + ++ R +    +L S    ++D   SP++       Y+ D+D   S++N   L +    Y   S +         + D Q +    +  + R M      +V  + K  +NS  G++LE      H+      + V+PE   G  G+L +GD LL+VNG ++ G + + V   +K  P   + +  C                        KPH +   +  SS   D       +  M    + +EE         A+ E    HI L++    LG     + D +D       I+ +   GIA+ DGRL  GD +  VN+++L+
Sbjct:  370 GEESETFDVELTKNVQGLGITIAGY--IGDKKLEP-SGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRRGMKQEAELMSREDVTKDADLSPVNASIIKENYEKDEDFLSSTRNTNILPTEEEGYPLLSAEIEE------IEDAQKQEAALLTKWQRIMGINYEIVVAHVSKFSENSGLGISLEATVG--HH----FIRSVLPEGPVGHSGKLFSGDELLEVNGITLLGENHQDVVNILKELPI-EVTMVCCRRTVPPTTQSELDSLDLCDIELTEKPHVDLGEFIGSSETED------PVLAMTDAGQSTEEVQAPL----AMWEAGIQHIELEKGSKGLGFSILDYQDPIDPASTVIIIRSLVPGGIAEKDGRLLPGDRLMFVNDVNLE 760          

HSP 5 Score: 56.225 bits (134), Expect = 5.335e-7
Identity = 120/572 (20.98%), Postives = 210/572 (36.71%), Query Frame = 1
Query:  208 IDKYFRFNITESSSKAIQENWIRILGIDYEIISMNLCKRNQSLGVALEGRNEIARNTQEVVQHHFFKVILPSQCVGETGKFMVKDEILEVNGLKVVGLPTKEVLNTLRKVTNYFQIVVARSIIHNYDLASDYGGSEDNINSPISFYDMDDDESSQNGTLRSNVSNYSTTSRDFGSSVSFGGLIDGQHETVNDYLRNMVGWRGPIVIELRKQNSPFGLALEEIRNPLHNAMIIVFKYVVPEMTAGKDGRLHAGDRLLQVNGKSVEGVDFRQVCKWIKSSPRG-RLVLYICKPHFETINYDPSSPANDDKYYFN-------------TIRDMDK--LPKLSEETDGECLRLPAVPEYMETHITLKRTENKLGIFLDIVDEGKNGARI--KKMTHGIAKNDGRLHEGDFVTKVNEISLKVDNKSKLDLCLKQISADKRNYNISYITAEDVRLHNGKYGTVSSATNRLPQSSQIYPEFLSIKVTEPLNEINSDKTRNHKFSFETFDIIIKNDKQTGLGLVLSPSLKDPNRYISITDIHDNSLCGKSGLLKINDEILKVNNVDFENISINELGHFLK 1869
            +DK   F     S K I+E +  + G   E+  + L K +  LG++L G  + +R +       F   I P+   G+ G+  + DE+LE+NG  + G   +   + ++   +  +I+     I N D  +       N   P+          S +  L++  +  + T+ D  ++V      + QH                  +EL K     G+A+ E  + L     ++ K +     A  DGRL  GD++L V+ + V G    +    +K++    +L ++   P  + +     + + + K                 +IR+  +   P +       C  +P      ET I + +    LG+ +    +   GA I  +    G A  DGRL  GD + +VN I L+   K+  D  +          N+   T + VRL                    +Y +    K  E                 +T  I ++     GLGL +     D   ++S  DI    +    G L   D+IL VN  D  N +   +   LK
Sbjct: 1324 VDKEDEFGY---SWKNIRERYGTLTG---ELHMIELEKGHSGLGLSLAGNKDRSRMSV------FIVGIDPNGAAGKDGRLQIADELLEINGQILYGRSHQNASSIIKCAPSKVKII----FIRNKDAVNQMAVCPGNAVEPL---------PSNSENLQNKETEPTVTTSD--AAVDLSSFKNVQH------------------LELPKDQGGLGIAISE-EDTLSG---VIIKSLTEHGVAATDGRLKVGDQILAVDDEIVVGYPIEKFISLLKTAKMTVKLTIHAENPDSQAVPSAAGAASGEKKNSSQSLMVPQSGSPEPESIRNTSRSSTPAIFASDPATCPIIPGC----ETTIEISKGRTGLGLSIVGGSDTLLGAIIIHEVYEEGAACKDGRLWAGDQILEVNGIDLR---KATHDEAI----------NVLRQTPQRVRL-------------------TLYRDEAPYKEEE---------------VCDTLTIELQKKPGKGLGLSIVGKRNDTGVFVS--DIVKGGIADADGRLMQGDQILMVNGEDVRNATQEAVAALLK 1793          
BLAST of Glutamate receptor-interacting protein 2 vs. Ensembl Human
Match: MPDZ (multiple PDZ domain crumbs cell polarity complex component [Source:HGNC Symbol;Acc:HGNC:7208])

HSP 1 Score: 103.99 bits (258), Expect = 1.771e-21
Identity = 75/279 (26.88%), Postives = 133/279 (47.67%), Query Frame = 1
Query:  253 AIQENWIRILGIDYEIISMNLCK--RNQSLGVALEGRNEIARNTQEVVQHHFFKVILPSQCVGETGKFMVKDEILEVNGLKVVGLPTKEVLNTLRKVTNYFQIVVARSIIHNYDLASDYGGSEDNINSPISFYDMDDDESSQNGTLRSNVSNYSTTSRDFGSSVSFGGLIDGQHETVNDYLRNMVGWRGPIV-IELRKQNSPFGLALEEIRNPLHNA-MIIVFKYVVPEMTAGKDGRLHAGDRLLQVNGKSVEGVDFRQVCKWIKSSPRGRLVLYICKP 1077
            A+   W RI+GI+YEI+  ++ K   N  LG++LE            V HHF + +LP   VG +GK    DE+LEVNG+ ++G   ++V+N L+++     +V  R  +                 S +   D+ D E ++   +       S+ + D   +++  G      ++  +    +  W   I  IEL K +   G ++ + ++P+  A  +I+ + +VP   A KDGRL  GDRL+ VN  ++E     +  + +K +P G + + + KP
Sbjct:  536 ALLTKWQRIMGINYEIVVAHVSKFSENSGLGISLEA----------TVGHHFIRSVLPEGPVGHSGKLFSGDELLEVNGITLLGENHQDVVNILKELPIEVTMVCCRRTV------------PPTTQSELDSLDLCDIELTEKPHVDLGEFIGSSETEDPVLAMTDAG------QSTEEVQAPLAMWEAGIQHIELEKGSKGLGFSILDYQDPIDPASTVIIIRSLVPGGIAEKDGRLLPGDRLMFVNDVNLENSSLEEAVEALKGAPSGTVRIGVAKP 786          

HSP 2 Score: 87.8113 bits (216), Expect = 1.239e-16
Identity = 182/823 (22.11%), Postives = 324/823 (39.37%), Query Frame = 1
Query:  325 NQSLGVAL-EGRNEIAR-NTQEVVQHHFFKVILPSQCVGETGKFMVKDEILEVNGLKVVGLPTKEVLNTLRKVTN----YFQIVVAR-------SIIHN----YDLASDYGGSED---NINSPISFYDMDDDESSQNGTLRSNVSNYSTTSRDFGSSVSFGGLIDGQHETVNDY-LRNMVGWRGPI-----VIELRKQNSPFGLALEEIRNPLHNAMIIVFKYVVPEMTAGKDGRLHAGDRLLQVNGKSVEGVDFRQVCKWIKSSPRGRLVLYICKPHFETINYDPSSPANDDKYYFNTIRDMDKLPKLSE-----ETDGECLRLPAVPEYME----THITLKRTENKLGIFLDIVDEGKNGARIKKMT-HGIAKNDGRLHEGDFVTKVNE-----------ISLKVDNKSKLDLCLKQISADKRNYNISYITAEDVRLHNGKYGTVSSATNRLPQSSQIYPEFL--SIKVTEPLNEINSDKTRNHKFSFETFDIIIKNDKQTGLGLVLSPSLKDPNRYISITDIHDNSLCGKSGLLKINDEILKVNNVDFENISINELGHFLKRAHKTENELRFQVRRLTCSENVPVDPLIEKLTWFPDIYHRVLKRGPN-GFGFSLLELDSNNGVVVDKVDLNKVCD----LKPGERFVMINKCTVITCSKPNVVQMVKNS--TRNLEL--IIETPKYREFR----------------------------------------------VKISKDSSMSLGLNIAGGRDTRFP-IPV-IESLVPNRTSKFSEELFTLDLITEVDGTNVTKQNHAEIIQIFRSTGRETTFKIL 2475
            ++SLG+++  GR   +R +  EV++  F K +L     G+ G     D I+EV+G+ +     ++ +  +RK  N      Q ++ R       S++HN    Y+ +S    ++    N +   S  + + +++          S ++    D   S +     D   E    Y  +N+    G +     +IEL K +S  GL+L    N   + M +    + P   AGKDGRL   D LL++NG+ + G   +     IK +P    +++I   + + +N     P N           ++ LP  SE     ET+       A  +        H+ L + +  LGI +   D   +G  IK +T HG+A  DGRL  GD +  V++           ISL    K  + L +   + D +    +   A   + +       SS +  +PQS    PE +  + + + P    +   T       ET   I K   +TGLGL +          I I ++++     K G L   D+IL+VN +D    + +E  + L+   +T   +R  + R         D    K     D     L++ P  G G S++   ++ GV V  +    + D    L  G++ +M+N   V   ++  V  ++K S  T  LE+  I   P + E R                                              V++ K  + SLG++IAGG  +    +P+ I  + P   +  +++L   D I  + GT+     H + + + ++       +++
Sbjct: 1173 SKSLGISIVGGRGMGSRLSNGEVMRGIFIKHVLEDSPAGKNGTLKPGDRIVEVDGMDLRDASHEQAVEAIRKAGNPVVFMVQSIINRPRKSPLPSLLHNLYPKYNFSSTNPFADSLQINADKAPSQSESEPEKAPLCSVPPPPPSAFAEMGSDHTQSSASKISQDVDKEDEFGYSWKNIRERYGTLTGELHMIELEKGHSGLGLSLA--GNKDRSRMSVFIVGIDPNGAAGKDGRLQIADELLEINGQILYGRSHQNASSIIKCAPSKVKIIFIR--NKDAVNQMAVCPGN----------AVEPLPSNSENLQNKETEPTVTTSDAAVDLSSFKNVQHLELPKDQGGLGIAISEEDT-LSGVIIKSLTEHGVAATDGRLKVGDQILAVDDEIVVGYPIEKFISLLKTAKMTVKLTIHAENPDSQAVPSAAGAASGEKKN-------SSQSLMVPQSGSPEPESIRNTSRSSTPAIFASDPATCPIIPGCETTIEISKG--RTGLGLSIVGGSDTLLGAIIIHEVYEEGAACKDGRLWAGDQILEVNGIDLRKATHDEAINVLR---QTPQRVRLTLYR---------DEAPYKEEEVCDTLTIELQKKPGKGLGLSIVGKRNDTGVFVSDIVKGGIADADGRLMQGDQILMVNGEDVRNATQEAVAALLKCSLGTVTLEVGRIKAGPFHSERRPSQSSQVSEGSLSSFTFPLSGSSTSESLESSSKKNALASEIQGLRTVEMKKGPTDSLGISIAGGVGSPLGDVPIFIAMMHPTGVAAQTQKLRVGDRIVTICGTSTEGMTHTQAVNLLKNASGSIEMQVV 1959          

HSP 3 Score: 64.6994 bits (156), Expect = 1.424e-9
Identity = 134/659 (20.33%), Postives = 252/659 (38.24%), Query Frame = 1
Query:  349 EGRNEIARNTQEVVQHHFFKVILPSQCVGETGKFMVKDEILEVNGLKVVGLPTKEVLNTLRKVTNYFQIVVARSIIHNYDLASDYGGSEDNINSPISFYDMDDDESSQNGTLRSNVSNYSTTSRDFGSSVSFGGLIDGQHETVNDYLRNMVGWRGPIVIELRKQNSPFGLALEEIRNPLHNAMIIVFKYVVPEMTAGKDGRLHAGDRLLQVNGKSVEGVDFRQVCKWIKSSP-RGRLVLYICKPHFETINYDPSSPANDDKYYFNTIRDMDKLPKLSEETDGECLRLPAVPEYMETHITLKRTENKLGIFLDIVDEGKNGARIKKMTHGIAKNDGRLHEGDFVTKVNEISLKVDNKSKLDLCLKQISADKRNYNISYITAEDVRLHNGKYGTVSSATNRLPQSSQI---------YPEFLSIKVTEPLNEINSDKTRNHKFSFETFDIIIKNDKQTGLGLVLSPSLKDP--NRYISITDIHDNSLCGKSGLLKINDEILKVNNVDFENISINELGHFLKRAHKTENELRFQVRRLTCSENVPV------DPLIEKLTWF--------------PDIYHRVLKRGPNGFGFSLL-ELDSNNG-------VVVDKVDLNKVCDLKPGERFVMINKCTVITCSKPNVVQMVKNSTRNLELII 2205
            +G   IA + ++ +     K +         G+  V D+IL V+   VVG P ++ ++ L+      ++ +      +  + S  G +     +      +    S +  ++R+  ++ S+T   F S  +   +I G   T                IE+ K  +  GL++    + L  A+II    V  E  A KDGRL AGD++L+VNG  +      +    ++ +P R RL LY              +P  +++       ++ K P       G+ L L          I  KR  N  G+F+  + +G           GIA  DGRL +GD +  VN   ++   +  +   LK         ++  +T E  R+  G +     +  R  QSSQ+         +P   S       +    +   +      T +  +K      LG+ ++  +  P  +  I I  +H   +  ++  L++ D I+ +     E ++  +  + LK A  +   +  QV       +V V      +P    L++               P      L+RGP+G GFS++    S +G        V  K   ++   LK G++ + +N  ++   +    V ++K +   + L++
Sbjct: 1504 QGGLGIAISEEDTLSGVIIKSLTEHGVAATDGRLKVGDQILAVDDEIVVGYPIEKFISLLKTAKMTVKLTIHAENPDSQAVPSAAGAASGEKKNSSQSLMVPQSGSPEPESIRN--TSRSSTPAIFASDPATCPIIPGCETT----------------IEISKGRTGLGLSIVGGSDTLLGAIII--HEVYEEGAACKDGRLWAGDQILEVNGIDLRKATHDEAINVLRQTPQRVRLTLY-----------RDEAPYKEEEVCDTLTIELQKKP-------GKGLGL---------SIVGKR--NDTGVFVSDIVKG-----------GIADADGRLMQGDQILMVNGEDVRNATQEAVAALLK--------CSLGTVTLEVGRIKAGPF----HSERRPSQSSQVSEGSLSSFTFPLSGSSTSESLESSSKKNALASEIQGLRTVE--MKKGPTDSLGISIAGGVGSPLGDVPIFIAMMHPTGVAAQTQKLRVGDRIVTICGTSTEGMTHTQAVNLLKNASGS---IEMQV---VAGGDVSVVTGHQQEPASSSLSFTGLTSSSIFQDDLGPPQCKSITLERGPDGLGFSIVGGYGSPHGDLPIYVKTVFAKGAASEDGRLKRGDQIIAVNGQSLEGVTHEEAVAILKRTKGTVTLMV 2082          

HSP 4 Score: 56.9954 bits (136), Expect = 3.416e-7
Identity = 98/417 (23.50%), Postives = 166/417 (39.81%), Query Frame = 1
Query:  283 GIDYEIISMNLCKRNQSLGVALEGRNEIARNTQEVVQHHFFKVILPSQCVGETGKFMVKDEILEVNGLKVVGLPTKEVLNTLRKVTNYFQI-VVARSIIHNYDLASDYGGSEDNINSPISF------YDMDDD--ESSQN-GTLRSNVSNYSTTSRDFGSSVSFGGLIDGQHET---VNDYLRNMVGWRGPIVIELRK--QNSPFGLALEEIRNPLHNAMIIVFKYVVPEMTAGKDGRLHAGDRLLQVNGKSVEGVDFRQVCKWIKSSPRGRLVLYIC------------------------KPHFETINYDPSSPANDDKYYFNTIRDMDKLPKLSEETDGECLRLPAVPEYMETHITLKRTENKLGI----FLDIVDEGKNGARIKKMT-HGIAKNDGRLHEGDFVTKVNEISLK 1401
            G + E   + L K  Q LG+ + G   I     E     F K I  S  V   G+  + D+I+ V+G  + G   ++ +  LR       + ++ R +    +L S    ++D   SP++       Y+ D+D   S++N   L +    Y   S +         + D Q +    +  + R M      +V  + K  +NS  G++LE      H+      + V+PE   G  G+L +GD LL+VNG ++ G + + V   +K  P   + +  C                        KPH +   +  SS   D       +  M    + +EE         A+ E    HI L++    LG     + D +D       I+ +   GIA+ DGRL  GD +  VN+++L+
Sbjct:  370 GEESETFDVELTKNVQGLGITIAGY--IGDKKLEP-SGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRRGMKQEAELMSREDVTKDADLSPVNASIIKENYEKDEDFLSSTRNTNILPTEEEGYPLLSAEIEE------IEDAQKQEAALLTKWQRIMGINYEIVVAHVSKFSENSGLGISLEATVG--HH----FIRSVLPEGPVGHSGKLFSGDELLEVNGITLLGENHQDVVNILKELPI-EVTMVCCRRTVPPTTQSELDSLDLCDIELTEKPHVDLGEFIGSSETED------PVLAMTDAGQSTEEVQAPL----AMWEAGIQHIELEKGSKGLGFSILDYQDPIDPASTVIIIRSLVPGGIAEKDGRLLPGDRLMFVNDVNLE 760          

HSP 5 Score: 56.225 bits (134), Expect = 5.617e-7
Identity = 120/572 (20.98%), Postives = 210/572 (36.71%), Query Frame = 1
Query:  208 IDKYFRFNITESSSKAIQENWIRILGIDYEIISMNLCKRNQSLGVALEGRNEIARNTQEVVQHHFFKVILPSQCVGETGKFMVKDEILEVNGLKVVGLPTKEVLNTLRKVTNYFQIVVARSIIHNYDLASDYGGSEDNINSPISFYDMDDDESSQNGTLRSNVSNYSTTSRDFGSSVSFGGLIDGQHETVNDYLRNMVGWRGPIVIELRKQNSPFGLALEEIRNPLHNAMIIVFKYVVPEMTAGKDGRLHAGDRLLQVNGKSVEGVDFRQVCKWIKSSPRG-RLVLYICKPHFETINYDPSSPANDDKYYFN-------------TIRDMDK--LPKLSEETDGECLRLPAVPEYMETHITLKRTENKLGIFLDIVDEGKNGARI--KKMTHGIAKNDGRLHEGDFVTKVNEISLKVDNKSKLDLCLKQISADKRNYNISYITAEDVRLHNGKYGTVSSATNRLPQSSQIYPEFLSIKVTEPLNEINSDKTRNHKFSFETFDIIIKNDKQTGLGLVLSPSLKDPNRYISITDIHDNSLCGKSGLLKINDEILKVNNVDFENISINELGHFLK 1869
            +DK   F     S K I+E +  + G   E+  + L K +  LG++L G  + +R +       F   I P+   G+ G+  + DE+LE+NG  + G   +   + ++   +  +I+     I N D  +       N   P+          S +  L++  +  + T+ D  ++V      + QH                  +EL K     G+A+ E  + L     ++ K +     A  DGRL  GD++L V+ + V G    +    +K++    +L ++   P  + +     + + + K                 +IR+  +   P +       C  +P      ET I + +    LG+ +    +   GA I  +    G A  DGRL  GD + +VN I L+   K+  D  +          N+   T + VRL                    +Y +    K  E                 +T  I ++     GLGL +     D   ++S  DI    +    G L   D+IL VN  D  N +   +   LK
Sbjct: 1338 VDKEDEFGY---SWKNIRERYGTLTG---ELHMIELEKGHSGLGLSLAGNKDRSRMSV------FIVGIDPNGAAGKDGRLQIADELLEINGQILYGRSHQNASSIIKCAPSKVKII----FIRNKDAVNQMAVCPGNAVEPL---------PSNSENLQNKETEPTVTTSD--AAVDLSSFKNVQH------------------LELPKDQGGLGIAISE-EDTLSG---VIIKSLTEHGVAATDGRLKVGDQILAVDDEIVVGYPIEKFISLLKTAKMTVKLTIHAENPDSQAVPSAAGAASGEKKNSSQSLMVPQSGSPEPESIRNTSRSSTPAIFASDPATCPIIPGC----ETTIEISKGRTGLGLSIVGGSDTLLGAIIIHEVYEEGAACKDGRLWAGDQILEVNGIDLR---KATHDEAI----------NVLRQTPQRVRL-------------------TLYRDEAPYKEEE---------------VCDTLTIELQKKPGKGLGLSIVGKRNDTGVFVS--DIVKGGIADADGRLMQGDQILMVNGEDVRNATQEAVAALLK 1807          
BLAST of Glutamate receptor-interacting protein 2 vs. Ensembl Human
Match: MPDZ (multiple PDZ domain crumbs cell polarity complex component [Source:HGNC Symbol;Acc:HGNC:7208])

HSP 1 Score: 103.605 bits (257), Expect = 1.836e-21
Identity = 75/279 (26.88%), Postives = 133/279 (47.67%), Query Frame = 1
Query:  253 AIQENWIRILGIDYEIISMNLCK--RNQSLGVALEGRNEIARNTQEVVQHHFFKVILPSQCVGETGKFMVKDEILEVNGLKVVGLPTKEVLNTLRKVTNYFQIVVARSIIHNYDLASDYGGSEDNINSPISFYDMDDDESSQNGTLRSNVSNYSTTSRDFGSSVSFGGLIDGQHETVNDYLRNMVGWRGPIV-IELRKQNSPFGLALEEIRNPLHNA-MIIVFKYVVPEMTAGKDGRLHAGDRLLQVNGKSVEGVDFRQVCKWIKSSPRGRLVLYICKP 1077
            A+   W RI+GI+YEI+  ++ K   N  LG++LE            V HHF + +LP   VG +GK    DE+LEVNG+ ++G   ++V+N L+++     +V  R  +                 S +   D+ D E ++   +       S+ + D   +++  G      ++  +    +  W   I  IEL K +   G ++ + ++P+  A  +I+ + +VP   A KDGRL  GDRL+ VN  ++E     +  + +K +P G + + + KP
Sbjct:  536 ALLTKWQRIMGINYEIVVAHVSKFSENSGLGISLEA----------TVGHHFIRSVLPEGPVGHSGKLFSGDELLEVNGITLLGENHQDVVNILKELPIEVTMVCCRRTV------------PPTTQSELDSLDLCDIELTEKPHVDLGEFIGSSETEDPVLAMTDAG------QSTEEVQAPLAMWEAGIQHIELEKGSKGLGFSILDYQDPIDPASTVIIIRSLVPGGIAEKDGRLLPGDRLMFVNDVNLENSSLEEAVEALKGAPSGTVRIGVAKP 786          

HSP 2 Score: 94.3597 bits (233), Expect = 1.346e-18
Identity = 179/796 (22.49%), Postives = 320/796 (40.20%), Query Frame = 1
Query:  325 NQSLGVAL-EGRNEIAR-NTQEVVQHHFFKVILPSQCVGETGKFMVKDEILEVNGLKVVGLPTKEVLNTLRKVTN----YFQIVVAR-------SIIHN----YDLASDYGGSED---NINSPISFYDMDDDESSQNGTLRSNVSNYSTTSRDFGSSVSFGGLIDGQHETVNDY-LRNMVGWRGPI-----VIELRKQNSPFGLALEEIRNPLHNAMIIVFKYVVPEMTAGKDGRLHAGDRLLQVNGKSVEGVDFRQVCKWIKSSPRGRLVLYICKPHFETINYDPSSPANDDKYYFNTIRDMDKLPKLSE-----ETDGECLRLPAVPEYME----THITLKRTENKLGIFLDIVDEGKNGARIKKMT-HGIAKNDGRLHEGDFVTKVNE-----------ISLKVDNKSKLDLCLKQISADKRNYNISYITAEDVRLHNGKYGTVSSATNRLPQSSQIYPEFL--SIKVTEPLNEINSDKTRNHKFSFETFDIIIKNDKQTGLGLVLSPSLKDPNRYISITDIHDNSLCGKSGLLKINDEILKVNNVDFENISINELGHFLKRAHKTENELRFQVRRLTCSENVPVDPLIEKLTWFPDIYHRVLKRGPN-GFGFSLLELDSNNGVVVDKVDLNKVCD----LKPGERFVMINKCTVITCSKPNVVQMVKNSTRNLE-----------------------LIIETPKYREFRVKISKDSSMSLGLNIAGGRDTRFP-IPV-IESLVPNRTSKFSEELFTLDLITEVDGTNVTKQNHAEIIQIFRSTGRETTFKIL 2475
            ++SLG+++  GR   +R +  EV++  F K +L     G+ G     D I+EV+G+ +     ++ +  +RK  N      Q ++ R       S++HN    Y+ +S    ++    N +   S  + + +++          S ++    D   S +     D   E    Y  +N+    G +     +IEL K +S  GL+L    N   + M +    + P   AGKDGRL   D LL++NG+ + G   +     IK +P    +++I   + + +N     P N           ++ LP  SE     ET+       A  +        H+ L + +  LGI +   D   +G  IK +T HG+A  DGRL  GD +  V++           ISL    K  + L +   + D +    +   A   + +       SS +  +PQS    PE +  + + + P    +   T       ET   I K   +TGLGL +          I I ++++     K G L   D+IL+VN +D    + +E  + L+   +T   +R  + R         D    K     D     L++ P  G G S++   ++ GV V  +    + D    L  G++ +M+N   V   ++  V  ++K S  +L                        L  E    R   V++ K  + SLG++IAGG  +    +P+ I  + P   +  +++L   D I  + GT+     H + + + ++       +++
Sbjct: 1159 SKSLGISIVGGRGMGSRLSNGEVMRGIFIKHVLEDSPAGKNGTLKPGDRIVEVDGMDLRDASHEQAVEAIRKAGNPVVFMVQSIINRPRKSPLPSLLHNLYPKYNFSSTNPFADSLQINADKAPSQSESEPEKAPLCSVPPPPPSAFAEMGSDHTQSSASKISQDVDKEDEFGYSWKNIRERYGTLTGELHMIELEKGHSGLGLSLA--GNKDRSRMSVFIVGIDPNGAAGKDGRLQIADELLEINGQILYGRSHQNASSIIKCAPSKVKIIFIR--NKDAVNQMAVCPGN----------AVEPLPSNSENLQNKETEPTVTTSDAAVDLSSFKNVQHLELPKDQGGLGIAISEEDT-LSGVIIKSLTEHGVAATDGRLKVGDQILAVDDEIVVGYPIEKFISLLKTAKMTVKLTIHAENPDSQAVPSAAGAASGEKKN-------SSQSLMVPQSGSPEPESIRNTSRSSTPAIFASDPATCPIIPGCETTIEISKG--RTGLGLSIVGGSDTLLGAIIIHEVYEEGAACKDGRLWAGDQILEVNGIDLRKATHDEAINVLR---QTPQRVRLTLYR---------DEAPYKEEEVCDTLTIELQKKPGKGLGLSIVGKRNDTGVFVSDIVKGGIADADGRLMQGDQILMVNGEDVRNATQEAVAALLKVSEGSLSSFTFPLSGSSTSESLESSSKKNALASEIQGLR--TVEMKKGPTDSLGISIAGGVGSPLGDVPIFIAMMHPTGVAAQTQKLRVGDRIVTICGTSTEGMTHTQAVNLLKNASGSIEMQVV 1916          

HSP 3 Score: 56.9954 bits (136), Expect = 3.294e-7
Identity = 98/417 (23.50%), Postives = 166/417 (39.81%), Query Frame = 1
Query:  283 GIDYEIISMNLCKRNQSLGVALEGRNEIARNTQEVVQHHFFKVILPSQCVGETGKFMVKDEILEVNGLKVVGLPTKEVLNTLRKVTNYFQI-VVARSIIHNYDLASDYGGSEDNINSPISF------YDMDDD--ESSQN-GTLRSNVSNYSTTSRDFGSSVSFGGLIDGQHET---VNDYLRNMVGWRGPIVIELRK--QNSPFGLALEEIRNPLHNAMIIVFKYVVPEMTAGKDGRLHAGDRLLQVNGKSVEGVDFRQVCKWIKSSPRGRLVLYIC------------------------KPHFETINYDPSSPANDDKYYFNTIRDMDKLPKLSEETDGECLRLPAVPEYMETHITLKRTENKLGI----FLDIVDEGKNGARIKKMT-HGIAKNDGRLHEGDFVTKVNEISLK 1401
            G + E   + L K  Q LG+ + G   I     E     F K I  S  V   G+  + D+I+ V+G  + G   ++ +  LR       + ++ R +    +L S    ++D   SP++       Y+ D+D   S++N   L +    Y   S +         + D Q +    +  + R M      +V  + K  +NS  G++LE      H+      + V+PE   G  G+L +GD LL+VNG ++ G + + V   +K  P   + +  C                        KPH +   +  SS   D       +  M    + +EE         A+ E    HI L++    LG     + D +D       I+ +   GIA+ DGRL  GD +  VN+++L+
Sbjct:  370 GEESETFDVELTKNVQGLGITIAGY--IGDKKLEP-SGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRRGMKQEAELMSREDVTKDADLSPVNASIIKENYEKDEDFLSSTRNTNILPTEEEGYPLLSAEIEE------IEDAQKQEAALLTKWQRIMGINYEIVVAHVSKFSENSGLGISLEATVG--HH----FIRSVLPEGPVGHSGKLFSGDELLEVNGITLLGENHQDVVNILKELPI-EVTMVCCRRTVPPTTQSELDSLDLCDIELTEKPHVDLGEFIGSSETED------PVLAMTDAGQSTEEVQAPL----AMWEAGIQHIELEKGSKGLGFSILDYQDPIDPASTVIIIRSLVPGGIAEKDGRLLPGDRLMFVNDVNLE 760          

HSP 4 Score: 56.6102 bits (135), Expect = 3.932e-7
Identity = 121/583 (20.75%), Postives = 214/583 (36.71%), Query Frame = 1
Query:  208 IDKYFRFNITESSSKAIQENWIRILGIDYEIISMNLCKRNQSLGVALEGRNEIARNTQEVVQHHFFKVILPSQCVGETGKFMVKDEILEVNGLKVVGLPTKEVLNTLRKVTNYFQIVVARSIIHNYDLASDYGGSEDNINSPISFYDMDDDESSQNGTLRSNVSNYSTTSRDFGSSVSFGGLIDGQHETVNDYLRNMVGWRGPIVIELRKQNSPFGLALEEIRNPLHNAMIIVFKYVVPEMTAGKDGRLHAGDRLLQVNGKSVEGVDFRQVCKWIKSSPRG-RLVLYICKPHFETINYDPSSPANDDKYYFN-------------TIRDMDK--LPKLSEETDGECLRLPAVPEYMETHITLKRTENKLGIFLDIVDEGKNGARI--KKMTHGIAKNDGRLHEGDFVTKVNEISLKVDNKSKLDLCLKQISADKRNYNISYITAEDVRLHNGKYGTVSSATNRLPQSSQIYPEFLSIKVTEPLNEINSDKTRNHKFSFETFDIIIKNDKQTGLGLVLSPSLKDPNRYISITDIHDNSLCGKSGLLKINDEILKVNNVDFENISINELGHFLKRAHKTENELRF 1902
            +DK   F     S K I+E +  + G   E+  + L K +  LG++L G  + +R +       F   I P+   G+ G+  + DE+LE+NG  + G   +   + ++   +  +I+     I N D  +       N   P+          S +  L++  +  + T+ D  ++V      + QH                  +EL K     G+A+ E  + L     ++ K +     A  DGRL  GD++L V+ + V G    +    +K++    +L ++   P  + +     + + + K                 +IR+  +   P +       C  +P      ET I + +    LG+ +    +   GA I  +    G A  DGRL  GD + +VN I L+   K+  D  +          N+   T + VRL                    +Y +    K  E                 +T  I ++     GLGL +     D   ++S  DI    +    G L   D+IL VN  D  N +   +   LK +  + +   F
Sbjct: 1324 VDKEDEFGY---SWKNIRERYGTLTG---ELHMIELEKGHSGLGLSLAGNKDRSRMSV------FIVGIDPNGAAGKDGRLQIADELLEINGQILYGRSHQNASSIIKCAPSKVKII----FIRNKDAVNQMAVCPGNAVEPL---------PSNSENLQNKETEPTVTTSD--AAVDLSSFKNVQH------------------LELPKDQGGLGIAISE-EDTLSG---VIIKSLTEHGVAATDGRLKVGDQILAVDDEIVVGYPIEKFISLLKTAKMTVKLTIHAENPDSQAVPSAAGAASGEKKNSSQSLMVPQSGSPEPESIRNTSRSSTPAIFASDPATCPIIPGC----ETTIEISKGRTGLGLSIVGGSDTLLGAIIIHEVYEEGAACKDGRLWAGDQILEVNGIDLR---KATHDEAI----------NVLRQTPQRVRL-------------------TLYRDEAPYKEEE---------------VCDTLTIELQKKPGKGLGLSIVGKRNDTGVFVS--DIVKGGIADADGRLMQGDQILMVNGEDVRNATQEAVAALLKVSEGSLSSFTF 1804          
BLAST of Glutamate receptor-interacting protein 2 vs. Ensembl Human
Match: MPDZ (multiple PDZ domain crumbs cell polarity complex component [Source:HGNC Symbol;Acc:HGNC:7208])

HSP 1 Score: 103.605 bits (257), Expect = 1.939e-21
Identity = 75/279 (26.88%), Postives = 133/279 (47.67%), Query Frame = 1
Query:  253 AIQENWIRILGIDYEIISMNLCK--RNQSLGVALEGRNEIARNTQEVVQHHFFKVILPSQCVGETGKFMVKDEILEVNGLKVVGLPTKEVLNTLRKVTNYFQIVVARSIIHNYDLASDYGGSEDNINSPISFYDMDDDESSQNGTLRSNVSNYSTTSRDFGSSVSFGGLIDGQHETVNDYLRNMVGWRGPIV-IELRKQNSPFGLALEEIRNPLHNA-MIIVFKYVVPEMTAGKDGRLHAGDRLLQVNGKSVEGVDFRQVCKWIKSSPRGRLVLYICKP 1077
            A+   W RI+GI+YEI+  ++ K   N  LG++LE            V HHF + +LP   VG +GK    DE+LEVNG+ ++G   ++V+N L+++     +V  R  +                 S +   D+ D E ++   +       S+ + D   +++  G      ++  +    +  W   I  IEL K +   G ++ + ++P+  A  +I+ + +VP   A KDGRL  GDRL+ VN  ++E     +  + +K +P G + + + KP
Sbjct:  536 ALLTKWQRIMGINYEIVVAHVSKFSENSGLGISLEA----------TVGHHFIRSVLPEGPVGHSGKLFSGDELLEVNGITLLGENHQDVVNILKELPIEVTMVCCRRTV------------PPTTQSELDSLDLCDIELTEKPHVDLGEFIGSSETEDPVLAMTDAG------QSTEEVQAPLAMWEAGIQHIELEKGSKGLGFSILDYQDPIDPASTVIIIRSLVPGGIAEKDGRLLPGDRLMFVNDVNLENSSLEEAVEALKGAPSGTVRIGVAKP 786          

HSP 2 Score: 101.293 bits (251), Expect = 1.096e-20
Identity = 181/781 (23.18%), Postives = 316/781 (40.46%), Query Frame = 1
Query:  325 NQSLGVAL-EGRNEIAR-NTQEVVQHHFFKVILPSQCVGETGKFMVKDEILEVNGLKVVGLPTKEVLNTLRKVTNYFQIVVARSIIHNYDLASDYGGSEDNINSPI---------SFYDMDDDESSQNGTLRSNVSNYSTTSRDFGSSVSFGGLIDGQHETVNDYLRNMVGWRGPIVIELRKQNSPFGLALEEIRNPLHNAMIIVFKYVVPEMTAGKDGRLHAGDRLLQVNGKSVEGVDFRQVCKWIKSSPRGRLVLYICKPHFETINYDPSSPANDDKYYFNTIRDMDKLPKLSE-----ETDGECLRLPAVPEYME----THITLKRTENKLGIFLDIVDEGKNGARIKKMT-HGIAKNDGRLHEGDFVTKVNE-----------ISLKVDNKSKLDLCLKQISADKRNYNISYITAEDVRLHNGKYGTVSSATNRLPQSSQIYPEFL--SIKVTEPLNEINSDKTRNHKFSFETFDIIIKNDKQTGLGLVLSPSLKDPNRYISITDIHDNSLCGKSGLLKINDEILKVNNVDFENISINELGHFLKRAHKTENELRFQVRRLTCSENVPVDPLIEKLTWFPDIYHRVLKRGPN-GFGFSLLELDSNNGVVVDKVDLNKVCD----LKPGERFVMINKCTVITCSKPNVVQMVKNSTRNLE-----------------------LIIETPKYREFRVKISKDSSMSLGLNIAGGRDTRFP-IPV-IESLVPNRTSKFSEELFTLDLITEVDGTNVTKQNHAEIIQIFRSTGRETTFKIL 2475
            ++SLG+++  GR   +R +  EV++  F K +L     G+ G     D I+EV+G+ +     ++ +  +RK  N   + + +SII N   A     SE    +P+         +F +M  D +  +    S +S       +FG S      I  ++ T+   L          +IEL K +S  GL+L    N   + M +    + P   AGKDGRL   D LL++NG+ + G   +     IK +P    +++I   + + +N     P N           ++ LP  SE     ET+       A  +        H+ L + +  LGI +   D   +G  IK +T HG+A  DGRL  GD +  V++           ISL    K  + L +   + D +    +   A   + +       SS +  +PQS    PE +  + + + P    +   T       ET   I K   +TGLGL +          I I ++++     K G L   D+IL+VN +D    + +E  + L+   +T   +R  + R         D    K     D     L++ P  G G S++   ++ GV V  +    + D    L  G++ +M+N   V   ++  V  ++K S  +L                        L  E    R   V++ K  + SLG++IAGG  +    +P+ I  + P   +  +++L   D I  + GT+     H + + + ++       +++
Sbjct: 1159 SKSLGISIVGGRGMGSRLSNGEVMRGIFIKHVLEDSPAGKNGTLKPGDRIVEVDGMDLRDASHEQAVEAIRKAGNPV-VFMVQSII-NRPRAPSQSESEPE-KAPLCSVPPPPPSAFAEMGSDHTQSSA---SKISQDVDKEDEFGYSWKN---IRERYGTLTGELH---------MIELEKGHSGLGLSLA--GNKDRSRMSVFIVGIDPNGAAGKDGRLQIADELLEINGQILYGRSHQNASSIIKCAPSKVKIIFI--RNKDAVNQMAVCPGN----------AVEPLPSNSENLQNKETEPTVTTSDAAVDLSSFKNVQHLELPKDQGGLGIAISEEDT-LSGVIIKSLTEHGVAATDGRLKVGDQILAVDDEIVVGYPIEKFISLLKTAKMTVKLTIHAENPDSQAVPSAAGAASGEKKN-------SSQSLMVPQSGSPEPESIRNTSRSSTPAIFASDPATCPIIPGCETTIEISKG--RTGLGLSIVGGSDTLLGAIIIHEVYEEGAACKDGRLWAGDQILEVNGIDLRKATHDEAINVLR---QTPQRVRLTLYR---------DEAPYKEEEVCDTLTIELQKKPGKGLGLSIVGKRNDTGVFVSDIVKGGIADADGRLMQGDQILMVNGEDVRNATQEAVAALLKVSEGSLSSFTFPLSGSSTSESLESSSKKNALASEIQGLR--TVEMKKGPTDSLGISIAGGVGSPLGDVPIFIAMMHPTGVAAQTQKLRVGDRIVTICGTSTEGMTHTQAVNLLKNASGSIEMQVV 1883          

HSP 3 Score: 56.6102 bits (135), Expect = 4.162e-7
Identity = 98/417 (23.50%), Postives = 166/417 (39.81%), Query Frame = 1
Query:  283 GIDYEIISMNLCKRNQSLGVALEGRNEIARNTQEVVQHHFFKVILPSQCVGETGKFMVKDEILEVNGLKVVGLPTKEVLNTLRKVTNYFQI-VVARSIIHNYDLASDYGGSEDNINSPISF------YDMDDD--ESSQN-GTLRSNVSNYSTTSRDFGSSVSFGGLIDGQHET---VNDYLRNMVGWRGPIVIELRK--QNSPFGLALEEIRNPLHNAMIIVFKYVVPEMTAGKDGRLHAGDRLLQVNGKSVEGVDFRQVCKWIKSSPRGRLVLYIC------------------------KPHFETINYDPSSPANDDKYYFNTIRDMDKLPKLSEETDGECLRLPAVPEYMETHITLKRTENKLGI----FLDIVDEGKNGARIKKMT-HGIAKNDGRLHEGDFVTKVNEISLK 1401
            G + E   + L K  Q LG+ + G   I     E     F K I  S  V   G+  + D+I+ V+G  + G   ++ +  LR       + ++ R +    +L S    ++D   SP++       Y+ D+D   S++N   L +    Y   S +         + D Q +    +  + R M      +V  + K  +NS  G++LE      H+      + V+PE   G  G+L +GD LL+VNG ++ G + + V   +K  P   + +  C                        KPH +   +  SS   D       +  M    + +EE         A+ E    HI L++    LG     + D +D       I+ +   GIA+ DGRL  GD +  VN+++L+
Sbjct:  370 GEESETFDVELTKNVQGLGITIAGY--IGDKKLEP-SGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRRGMKQEAELMSREDVTKDADLSPVNASIIKENYEKDEDFLSSTRNTNILPTEEEGYPLLSAEIEE------IEDAQKQEAALLTKWQRIMGINYEIVVAHVSKFSENSGLGISLEATVG--HH----FIRSVLPEGPVGHSGKLFSGDELLEVNGITLLGENHQDVVNILKELPI-EVTMVCCRRTVPPTTQSELDSLDLCDIELTEKPHVDLGEFIGSSETED------PVLAMTDAGQSTEEVQAPL----AMWEAGIQHIELEKGSKGLGFSILDYQDPIDPASTVIIIRSLVPGGIAEKDGRLLPGDRLMFVNDVNLE 760          
BLAST of Glutamate receptor-interacting protein 2 vs. Ensembl Human
Match: MPDZ (multiple PDZ domain crumbs cell polarity complex component [Source:HGNC Symbol;Acc:HGNC:7208])

HSP 1 Score: 103.605 bits (257), Expect = 2.101e-21
Identity = 75/279 (26.88%), Postives = 133/279 (47.67%), Query Frame = 1
Query:  253 AIQENWIRILGIDYEIISMNLCK--RNQSLGVALEGRNEIARNTQEVVQHHFFKVILPSQCVGETGKFMVKDEILEVNGLKVVGLPTKEVLNTLRKVTNYFQIVVARSIIHNYDLASDYGGSEDNINSPISFYDMDDDESSQNGTLRSNVSNYSTTSRDFGSSVSFGGLIDGQHETVNDYLRNMVGWRGPIV-IELRKQNSPFGLALEEIRNPLHNA-MIIVFKYVVPEMTAGKDGRLHAGDRLLQVNGKSVEGVDFRQVCKWIKSSPRGRLVLYICKP 1077
            A+   W RI+GI+YEI+  ++ K   N  LG++LE            V HHF + +LP   VG +GK    DE+LEVNG+ ++G   ++V+N L+++     +V  R  +                 S +   D+ D E ++   +       S+ + D   +++  G      ++  +    +  W   I  IEL K +   G ++ + ++P+  A  +I+ + +VP   A KDGRL  GDRL+ VN  ++E     +  + +K +P G + + + KP
Sbjct:  536 ALLTKWQRIMGINYEIVVAHVSKFSENSGLGISLEA----------TVGHHFIRSVLPEGPVGHSGKLFSGDELLEVNGITLLGENHQDVVNILKELPIEVTMVCCRRTV------------PPTTQSELDSLDLCDIELTEKPHVDLGEFIGSSETEDPVLAMTDAG------QSTEEVQAPLAMWEAGIQHIELEKGSKGLGFSILDYQDPIDPASTVIIIRSLVPGGIAEKDGRLLPGDRLMFVNDVNLENSSLEEAVEALKGAPSGTVRIGVAKP 786          

HSP 2 Score: 94.7449 bits (234), Expect = 9.680e-19
Identity = 184/808 (22.77%), Postives = 320/808 (39.60%), Query Frame = 1
Query:  325 NQSLGVAL-EGRNEIAR-NTQEVVQHHFFKVILPSQCVGETGKFMVKDEILEVNGLKVVGLPTKEVLNTLRKVTNYFQIVVARSIIHNYDLASDYGGSEDNINSPI---------SFYDMDDDESSQNGTLRSNVSNYSTTSRDFGSSVSFGGLIDGQHETVNDYLRNMVGWRGPIVIELRKQNSPFGLALEEIRNPLHNAMIIVFKYVVPEMTAGKDGRLHAGDRLLQVNGKSVEGVDFRQVCKWIKSSPRGRLVLYICKPHFETINYDPSSPANDDKYYFNTIRDMDKLPKLSE-----ETDGECLRLPAVPEYME----THITLKRTENKLGIFLDIVDEGKNGARIKKMT-HGIAKNDGRLHEGDFVTKVNE-----------ISLKVDNKSKLDLCLKQISADKRNYNISYITAEDVRLHNGKYGTVSSATNRLPQSSQIYPEFL--SIKVTEPLNEINSDKTRNHKFSFETFDIIIKNDKQTGLGLVLSPSLKDPNRYISITDIHDNSLCGKSGLLKINDEILKVNNVDFENISINELGHFLKRAHKTENELRFQVRRLTCSENVPVDPLIEKLTWFPDIYHRVLKRGPN-GFGFSLLELDSNNGVVVDKVDLNKVCD----LKPGERFVMINKCTVITCSKPNVVQMVKNS--TRNLEL--IIETPKYREFR----------------------------------------------VKISKDSSMSLGLNIAGGRDTRFP-IPV-IESLVPNRTSKFSEELFTLDLITEVDGTNVTKQNHAEIIQIFRSTGRETTFKIL 2475
            ++SLG+++  GR   +R +  EV++  F K +L     G+ G     D I+EV+G+ +     ++ +  +RK  N   + + +SII N   A     SE    +P+         +F +M  D +  +    S +S       +FG S      I  ++ T+   L          +IEL K +S  GL+L    N   + M +    + P   AGKDGRL   D LL++NG+ + G   +     IK +P    +++I   + + +N     P N           ++ LP  SE     ET+       A  +        H+ L + +  LGI +   D   +G  IK +T HG+A  DGRL  GD +  V++           ISL    K  + L +   + D +    +   A   + +       SS +  +PQS    PE +  + + + P    +   T       ET   I K   +TGLGL +          I I ++++     K G L   D+IL+VN +D    + +E  + L+   +T   +R  + R         D    K     D     L++ P  G G S++   ++ GV V  +    + D    L  G++ +M+N   V   ++  V  ++K S  T  LE+  I   P + E R                                              V++ K  + SLG++IAGG  +    +P+ I  + P   +  +++L   D I  + GT+     H + + + ++       +++
Sbjct: 1159 SKSLGISIVGGRGMGSRLSNGEVMRGIFIKHVLEDSPAGKNGTLKPGDRIVEVDGMDLRDASHEQAVEAIRKAGNPV-VFMVQSII-NRPRAPSQSESEPE-KAPLCSVPPPPPSAFAEMGSDHTQSSA---SKISQDVDKEDEFGYSWKN---IRERYGTLTGELH---------MIELEKGHSGLGLSLA--GNKDRSRMSVFIVGIDPNGAAGKDGRLQIADELLEINGQILYGRSHQNASSIIKCAPSKVKIIFI--RNKDAVNQMAVCPGN----------AVEPLPSNSENLQNKETEPTVTTSDAAVDLSSFKNVQHLELPKDQGGLGIAISEEDT-LSGVIIKSLTEHGVAATDGRLKVGDQILAVDDEIVVGYPIEKFISLLKTAKMTVKLTIHAENPDSQAVPSAAGAASGEKKN-------SSQSLMVPQSGSPEPESIRNTSRSSTPAIFASDPATCPIIPGCETTIEISKG--RTGLGLSIVGGSDTLLGAIIIHEVYEEGAACKDGRLWAGDQILEVNGIDLRKATHDEAINVLR---QTPQRVRLTLYR---------DEAPYKEEEVCDTLTIELQKKPGKGLGLSIVGKRNDTGVFVSDIVKGGIADADGRLMQGDQILMVNGEDVRNATQEAVAALLKCSLGTVTLEVGRIKAGPFHSERRPSQSSQVSEGSLSSFTFPLSGSSTSESLESSSKKNALASEIQGLRTVEMKKGPTDSLGISIAGGVGSPLGDVPIFIAMMHPTGVAAQTQKLRVGDRIVTICGTSTEGMTHTQAVNLLKNASGSIEMQVV 1912          

HSP 3 Score: 56.6102 bits (135), Expect = 4.032e-7
Identity = 98/417 (23.50%), Postives = 166/417 (39.81%), Query Frame = 1
Query:  283 GIDYEIISMNLCKRNQSLGVALEGRNEIARNTQEVVQHHFFKVILPSQCVGETGKFMVKDEILEVNGLKVVGLPTKEVLNTLRKVTNYFQI-VVARSIIHNYDLASDYGGSEDNINSPISF------YDMDDD--ESSQN-GTLRSNVSNYSTTSRDFGSSVSFGGLIDGQHET---VNDYLRNMVGWRGPIVIELRK--QNSPFGLALEEIRNPLHNAMIIVFKYVVPEMTAGKDGRLHAGDRLLQVNGKSVEGVDFRQVCKWIKSSPRGRLVLYIC------------------------KPHFETINYDPSSPANDDKYYFNTIRDMDKLPKLSEETDGECLRLPAVPEYMETHITLKRTENKLGI----FLDIVDEGKNGARIKKMT-HGIAKNDGRLHEGDFVTKVNEISLK 1401
            G + E   + L K  Q LG+ + G   I     E     F K I  S  V   G+  + D+I+ V+G  + G   ++ +  LR       + ++ R +    +L S    ++D   SP++       Y+ D+D   S++N   L +    Y   S +         + D Q +    +  + R M      +V  + K  +NS  G++LE      H+      + V+PE   G  G+L +GD LL+VNG ++ G + + V   +K  P   + +  C                        KPH +   +  SS   D       +  M    + +EE         A+ E    HI L++    LG     + D +D       I+ +   GIA+ DGRL  GD +  VN+++L+
Sbjct:  370 GEESETFDVELTKNVQGLGITIAGY--IGDKKLEP-SGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRRGMKQEAELMSREDVTKDADLSPVNASIIKENYEKDEDFLSSTRNTNILPTEEEGYPLLSAEIEE------IEDAQKQEAALLTKWQRIMGINYEIVVAHVSKFSENSGLGISLEATVG--HH----FIRSVLPEGPVGHSGKLFSGDELLEVNGITLLGENHQDVVNILKELPI-EVTMVCCRRTVPPTTQSELDSLDLCDIELTEKPHVDLGEFIGSSETED------PVLAMTDAGQSTEEVQAPL----AMWEAGIQHIELEKGSKGLGFSILDYQDPIDPASTVIIIRSLVPGGIAEKDGRLLPGDRLMFVNDVNLE 760          
BLAST of Glutamate receptor-interacting protein 2 vs. Ensembl Celegans
Match: mpz-1 (Multiple PDZ domain protein [Source:UniProtKB/TrEMBL;Acc:G1K0W2])

HSP 1 Score: 53.1434 bits (126), Expect = 1.578e-6
Identity = 39/127 (30.71%), Postives = 67/127 (52.76%), Query Frame = 1
Query: 1213 VPEYMETHITLKRTENKLGIFLDI-VDEGKNGARIKKMTHGIAKN-DGRLHEGDFVTKVNEISLKVDNKSKLDLCLKQISADKRNYNISYITAEDVRLHNGKYGTVSSAT----NRLPQSSQIYPEF 1575
            +P ++E  + L++    LG  LD   D+G NG  +K +    A   DGR+  GDF+TK+N  SL+    S+    LK+ +      N++YIT+ D +    ++   S ++    NRL  S +++P+F
Sbjct: 1114 LPTHLERTVKLQKGALPLGAVLDGDKDKGVNGCVVKSICGKKAVALDGRIQVGDFITKINTESLRNVTNSQARAILKRTNLVGTFCNVTYITSADAKTWKERFQRPSESSSPIINRL--SPKVFPKF 1238          
BLAST of Glutamate receptor-interacting protein 2 vs. Ensembl Celegans
Match: mpz-1 (Multiple PDZ domain protein [Source:UniProtKB/TrEMBL;Acc:G1K0W2])

HSP 1 Score: 53.1434 bits (126), Expect = 1.829e-6
Identity = 39/127 (30.71%), Postives = 67/127 (52.76%), Query Frame = 1
Query: 1213 VPEYMETHITLKRTENKLGIFLDI-VDEGKNGARIKKMTHGIAKN-DGRLHEGDFVTKVNEISLKVDNKSKLDLCLKQISADKRNYNISYITAEDVRLHNGKYGTVSSAT----NRLPQSSQIYPEF 1575
            +P ++E  + L++    LG  LD   D+G NG  +K +    A   DGR+  GDF+TK+N  SL+    S+    LK+ +      N++YIT+ D +    ++   S ++    NRL  S +++P+F
Sbjct:  807 LPTHLERTVKLQKGALPLGAVLDGDKDKGVNGCVVKSICGKKAVALDGRIQVGDFITKINTESLRNVTNSQARAILKRTNLVGTFCNVTYITSADAKTWKERFQRPSESSSPIINRL--SPKVFPKF 931          
BLAST of Glutamate receptor-interacting protein 2 vs. Ensembl Celegans
Match: mpz-1 (Multiple PDZ domain protein [Source:UniProtKB/TrEMBL;Acc:G1K0W2])

HSP 1 Score: 53.1434 bits (126), Expect = 1.830e-6
Identity = 39/127 (30.71%), Postives = 67/127 (52.76%), Query Frame = 1
Query: 1213 VPEYMETHITLKRTENKLGIFLDI-VDEGKNGARIKKMTHGIAKN-DGRLHEGDFVTKVNEISLKVDNKSKLDLCLKQISADKRNYNISYITAEDVRLHNGKYGTVSSAT----NRLPQSSQIYPEF 1575
            +P ++E  + L++    LG  LD   D+G NG  +K +    A   DGR+  GDF+TK+N  SL+    S+    LK+ +      N++YIT+ D +    ++   S ++    NRL  S +++P+F
Sbjct:  825 LPTHLERTVKLQKGALPLGAVLDGDKDKGVNGCVVKSICGKKAVALDGRIQVGDFITKINTESLRNVTNSQARAILKRTNLVGTFCNVTYITSADAKTWKERFQRPSESSSPIINRL--SPKVFPKF 949          
BLAST of Glutamate receptor-interacting protein 2 vs. Ensembl Celegans
Match: mpz-1 (Multiple PDZ domain protein [Source:UniProtKB/TrEMBL;Acc:G1K0W2])

HSP 1 Score: 53.1434 bits (126), Expect = 1.844e-6
Identity = 39/127 (30.71%), Postives = 67/127 (52.76%), Query Frame = 1
Query: 1213 VPEYMETHITLKRTENKLGIFLDI-VDEGKNGARIKKMTHGIAKN-DGRLHEGDFVTKVNEISLKVDNKSKLDLCLKQISADKRNYNISYITAEDVRLHNGKYGTVSSAT----NRLPQSSQIYPEF 1575
            +P ++E  + L++    LG  LD   D+G NG  +K +    A   DGR+  GDF+TK+N  SL+    S+    LK+ +      N++YIT+ D +    ++   S ++    NRL  S +++P+F
Sbjct:  807 LPTHLERTVKLQKGALPLGAVLDGDKDKGVNGCVVKSICGKKAVALDGRIQVGDFITKINTESLRNVTNSQARAILKRTNLVGTFCNVTYITSADAKTWKERFQRPSESSSPIINRL--SPKVFPKF 931          
BLAST of Glutamate receptor-interacting protein 2 vs. Ensembl Celegans
Match: mpz-1 (Multiple PDZ domain protein [Source:UniProtKB/TrEMBL;Acc:G1K0W2])

HSP 1 Score: 52.7582 bits (125), Expect = 1.972e-6
Identity = 39/127 (30.71%), Postives = 67/127 (52.76%), Query Frame = 1
Query: 1213 VPEYMETHITLKRTENKLGIFLDI-VDEGKNGARIKKMTHGIAKN-DGRLHEGDFVTKVNEISLKVDNKSKLDLCLKQISADKRNYNISYITAEDVRLHNGKYGTVSSAT----NRLPQSSQIYPEF 1575
            +P ++E  + L++    LG  LD   D+G NG  +K +    A   DGR+  GDF+TK+N  SL+    S+    LK+ +      N++YIT+ D +    ++   S ++    NRL  S +++P+F
Sbjct:   32 LPTHLERTVKLQKGALPLGAVLDGDKDKGVNGCVVKSICGKKAVALDGRIQVGDFITKINTESLRNVTNSQARAILKRTNLVGTFCNVTYITSADAKTWKERFQRPSESSSPIINRL--SPKVFPKF 156          
BLAST of Glutamate receptor-interacting protein 2 vs. Ensembl Fly
Match: Patj (gene:FBgn0067864 transcript:FBtr0072781)

HSP 1 Score: 96.6709 bits (239), Expect = 8.943e-20
Identity = 90/341 (26.39%), Postives = 146/341 (42.82%), Query Frame = 1
Query:  217 YFRFNITESSSKAIQENWIRILGIDYEIISMNLCK-RNQSLGVALEGRNEIARNTQEVVQHHFFKVILPSQCVGETGKFMVKDEILEVNGLKVVGLPTKEVLNTLRKVTNYFQIVVARSIIHNYDLASDYGGSEDNINSPISFYDMDDDESSQNGTLRSNVSNYS---------TTSRDFGSSVSFGGLIDGQHETVN------------DYLRNMVGWRG-PIVIELRKQNSPFGLALEEIRNPLH-NAMIIVFKYVVPEMTAGKDGRLHAGDRLLQVNGKSVEGVDFRQVCKWIKSSPRGRLVLYICKP-----------------HFETINYDPSSPA 1116
            Y    +++ +   I   W +I+G D E+I   + K     LG++LEG  ++    +EV  HH+ + ILP   VG  G     DE+LEVNG +++G+   EV+  L+++    ++V  R                 N NS  S     DD      TL+   +N+            ++  GS  + G + DG                  + L  +  W   P +IEL K +   G ++ + ++PL  N  +IV + +VP   A  DGRL  GDRLL VN  ++E     Q  + +K + +G + + + KP                   ET++  PS PA
Sbjct:  530 YTDPELSDDAETEIIRKWQKIVGSDVEVIVAQIKKFAVGGLGISLEGTVDV-EGGREVRPHHYIRSILPDGPVGVNGVLRSGDELLEVNGERLLGMNHLEVVAILKELPLDVRMVCGR-----------------NRNS--SLLPFSDD------TLKKLSNNFENLLPATDRLVKAKSDGSLATAGSVADGDSVAAAAASFSKLKSRSLEPLTGLAMWSSQPQIIELVKGDRGLGFSILDYQDPLDPNDTLIVIRSLVPGGVAQLDGRLIPGDRLLFVNSINLENASLDQAVQALKGASKGVVRIGVAKPLPMTDNSLKACSNASTTSEETLDAQPSPPA 844          
BLAST of Glutamate receptor-interacting protein 2 vs. Ensembl Fly
Match: Patj (gene:FBgn0067864 transcript:FBtr0301625)

HSP 1 Score: 96.6709 bits (239), Expect = 8.943e-20
Identity = 90/341 (26.39%), Postives = 146/341 (42.82%), Query Frame = 1
Query:  217 YFRFNITESSSKAIQENWIRILGIDYEIISMNLCK-RNQSLGVALEGRNEIARNTQEVVQHHFFKVILPSQCVGETGKFMVKDEILEVNGLKVVGLPTKEVLNTLRKVTNYFQIVVARSIIHNYDLASDYGGSEDNINSPISFYDMDDDESSQNGTLRSNVSNYS---------TTSRDFGSSVSFGGLIDGQHETVN------------DYLRNMVGWRG-PIVIELRKQNSPFGLALEEIRNPLH-NAMIIVFKYVVPEMTAGKDGRLHAGDRLLQVNGKSVEGVDFRQVCKWIKSSPRGRLVLYICKP-----------------HFETINYDPSSPA 1116
            Y    +++ +   I   W +I+G D E+I   + K     LG++LEG  ++    +EV  HH+ + ILP   VG  G     DE+LEVNG +++G+   EV+  L+++    ++V  R                 N NS  S     DD      TL+   +N+            ++  GS  + G + DG                  + L  +  W   P +IEL K +   G ++ + ++PL  N  +IV + +VP   A  DGRL  GDRLL VN  ++E     Q  + +K + +G + + + KP                   ET++  PS PA
Sbjct:  530 YTDPELSDDAETEIIRKWQKIVGSDVEVIVAQIKKFAVGGLGISLEGTVDV-EGGREVRPHHYIRSILPDGPVGVNGVLRSGDELLEVNGERLLGMNHLEVVAILKELPLDVRMVCGR-----------------NRNS--SLLPFSDD------TLKKLSNNFENLLPATDRLVKAKSDGSLATAGSVADGDSVAAAAASFSKLKSRSLEPLTGLAMWSSQPQIIELVKGDRGLGFSILDYQDPLDPNDTLIVIRSLVPGGVAQLDGRLIPGDRLLFVNSINLENASLDQAVQALKGASKGVVRIGVAKPLPMTDNSLKACSNASTTSEETLDAQPSPPA 844          
BLAST of Glutamate receptor-interacting protein 2 vs. Ensembl Fly
Match: Patj (gene:FBgn0067864 transcript:FBtr0072779)

HSP 1 Score: 96.6709 bits (239), Expect = 8.943e-20
Identity = 90/341 (26.39%), Postives = 146/341 (42.82%), Query Frame = 1
Query:  217 YFRFNITESSSKAIQENWIRILGIDYEIISMNLCK-RNQSLGVALEGRNEIARNTQEVVQHHFFKVILPSQCVGETGKFMVKDEILEVNGLKVVGLPTKEVLNTLRKVTNYFQIVVARSIIHNYDLASDYGGSEDNINSPISFYDMDDDESSQNGTLRSNVSNYS---------TTSRDFGSSVSFGGLIDGQHETVN------------DYLRNMVGWRG-PIVIELRKQNSPFGLALEEIRNPLH-NAMIIVFKYVVPEMTAGKDGRLHAGDRLLQVNGKSVEGVDFRQVCKWIKSSPRGRLVLYICKP-----------------HFETINYDPSSPA 1116
            Y    +++ +   I   W +I+G D E+I   + K     LG++LEG  ++    +EV  HH+ + ILP   VG  G     DE+LEVNG +++G+   EV+  L+++    ++V  R                 N NS  S     DD      TL+   +N+            ++  GS  + G + DG                  + L  +  W   P +IEL K +   G ++ + ++PL  N  +IV + +VP   A  DGRL  GDRLL VN  ++E     Q  + +K + +G + + + KP                   ET++  PS PA
Sbjct:  530 YTDPELSDDAETEIIRKWQKIVGSDVEVIVAQIKKFAVGGLGISLEGTVDV-EGGREVRPHHYIRSILPDGPVGVNGVLRSGDELLEVNGERLLGMNHLEVVAILKELPLDVRMVCGR-----------------NRNS--SLLPFSDD------TLKKLSNNFENLLPATDRLVKAKSDGSLATAGSVADGDSVAAAAASFSKLKSRSLEPLTGLAMWSSQPQIIELVKGDRGLGFSILDYQDPLDPNDTLIVIRSLVPGGVAQLDGRLIPGDRLLFVNSINLENASLDQAVQALKGASKGVVRIGVAKPLPMTDNSLKACSNASTTSEETLDAQPSPPA 844          
BLAST of Glutamate receptor-interacting protein 2 vs. Ensembl Fly
Match: CG15803 (gene:FBgn0038606 transcript:FBtr0345256)

HSP 1 Score: 62.003 bits (149), Expect = 3.989e-9
Identity = 62/266 (23.31%), Postives = 120/266 (45.11%), Query Frame = 1
Query:  328 QSLGVALEGRNEIARNTQEVVQHHFFKVILPSQCVGETGKFMVKDEILEVNGLKVVGLPTKEVLNTLRKVTNYFQIVVAR-----SIIHN------YDLASDYGGSEDNINSPISFYDMDDDESSQNGTLRSNVSNYSTTSRDFGSSVSFGGLIDGQHETVNDYLRNMVG---WRGPI-VIELRKQNSPFGLALEEIRNPLHN-AMIIVFKYVVPEMTAGKDGRLHAGDRLLQVNGKSVEGVDFRQVCKWIKSSPRGRLVLYICKP 1077
            +SLG++LEG  ++     E   HH+ + IL    VG  G     DE+L+VN  K+ GL   EV+  L+++    ++V AR     S+I+       ++  S   G   ++ + +S    +           S++   ST +     + + G          +  L N+ G   W   +  +++ K    FG ++ + ++PL +   +IV + ++    A     ++ GDRL+ V  + ++G++  +    +K+ P G   L IC+P
Sbjct:  605 KSLGISLEGTVDVECGI-EKRPHHYIRSILADGPVGRQGILRPGDELLQVNEHKLQGLRHIEVVKILKELPARVKLVCARGTHVPSVINTSQNPEAFETRSLLPGGHQSLQNLLSKAQSE-----------SSLYTSSTATLTDAGAAAGGSGGTAGGGARSKSLENVSGLALWSCEVTAVDIEKTEQGFGFSILDYQDPLDSEGSVIVIRGLIRGGAAEATNEIYPGDRLMSVGDRLLQGLELDEAVSILKAMPPGLTRLGICRP 858          
BLAST of Glutamate receptor-interacting protein 2 vs. Ensembl Fly
Match: CG15803 (gene:FBgn0038606 transcript:FBtr0302308)

HSP 1 Score: 56.6102 bits (135), Expect = 1.849e-7
Identity = 55/244 (22.54%), Postives = 108/244 (44.26%), Query Frame = 1
Query:  394 HHFFKVILPSQCVGETGKFMVKDEILEVNGLKVVGLPTKEVLNTLRKVTNYFQIVVAR-----SIIHN------YDLASDYGGSEDNINSPISFYDMDDDESSQNGTLRSNVSNYSTTSRDFGSSVSFGGLIDGQHETVNDYLRNMVG---WRGPI-VIELRKQNSPFGLALEEIRNPLHN-AMIIVFKYVVPEMTAGKDGRLHAGDRLLQVNGKSVEGVDFRQVCKWIKSSPRGRLVLYICKP 1077
            HH+ + IL    VG  G     DE+L+VN  K+ GL   EV+  L+++    ++V AR     S+I+       ++  S   G   ++ + +S    +           S++   ST +     + + G          +  L N+ G   W   +  +++ K    FG ++ + ++PL +   +IV + ++    A     ++ GDRL+ V  + ++G++  +    +K+ P G   L IC+P
Sbjct:  624 HHYIRSILADGPVGRQGILRPGDELLQVNEHKLQGLRHIEVVKILKELPARVKLVCARGTHVPSVINTSQNPEAFETRSLLPGGHQSLQNLLSKAQSE-----------SSLYTSSTATLTDAGAAAGGSGGTAGGGARSKSLENVSGLALWSCEVTAVDIEKTEQGFGFSILDYQDPLDSEGSVIVIRGLIRGGAAEATNEIYPGDRLMSVGDRLLQGLELDEAVSILKAMPPGLTRLGICRP 856          
BLAST of Glutamate receptor-interacting protein 2 vs. Ensembl Zebrafish
Match: si:dkey-92j12.5 (si:dkey-92j12.5 [Source:ZFIN;Acc:ZDB-GENE-090313-354])

HSP 1 Score: 108.997 bits (271), Expect = 2.572e-23
Identity = 119/470 (25.32%), Postives = 209/470 (44.47%), Query Frame = 1
Query:  154 WKSYFTGIILSNFTSFNKIDKYFRFNITESSSKAIQENWIRILGIDYEIISMNLCK--RNQSLGVALEGRNEIARNTQEVVQHHFFKVILPSQCVGETGKFMVKDEILEVNGLKVVGLPTKEVLNTLRKVTNYFQIVVARSIIHNYDLASDYGGSEDNINSPISFYDMDDDESSQNGTLRSNVSNYSTTSRD--FGSSVSFGGLIDGQHETVNDYLRNMVGWRGPI-VIELRKQNSPFGLALEEIRNPLHNA-MIIVFKYVVPEMTAGKDGRLHAGDRLLQVNGKSVEGVDFRQVCKWIKSSPRGRLVLYICKPHFET--------INYDPSSPANDDKYYFNTIRDMDKLPKLSEETDGECLRLPAVPEYMETHITLKRTENKLGIFLDIVDEGKNGARIKKMTHG--IAKNDGRLHEGDFVTKVNEISLKVDNKSKLDLCLKQISADKRNYNISYITAEDVRLHNGKY 1515
            ++S  T  +LS   S N   K     +++   K+++E W   LG  YE++   + K   +  LGV+LE +            HH+   ILP   +G+TG     DE++EVNG  ++G   KEV++ L+++     +V +R I                   P    + +DD+     TL+  ++ ++  +    FGS  +   L +   ++    L +   W   I V EL+K +S  G ++ + ++P++    +IV + +VP   A +DGRL  GDRL+ VN   +      Q    +KS+  G + + + KP  E         I  +  S  N     F T     K      + + E + +P+     E  IT+ R  + LG+ +  + +G +G  I+ + HG  I+K DGRL  GD +  +N  S      ++    L++ S    + ++ Y+ A  + LH   Y
Sbjct:  453 FRSSQTCCLLSKTESRNH--KSSCCKLSDDEEKSLKEKWQSKLGPQYEVLVTQVEKFIESSGLGVSLEAKE----------GHHYICSILPEGPLGQTGIIHPGDELIEVNGFSLIGETHKEVVSLLKELPMNVCVVCSRLI-------------------PPRVSEEEDDDVQL--TLKELLAEFNEKAEQNIFGSVFA---LREEDLKSEAPVLSHQAMWENEIEVYELQKGDSGLGFSILDYQDPVNPGRTVIVIRSLVPGGLADRDGRLLPGDRLMFVNQTDLSHASLAQAVHVLKSTALGTVRIGVTKPLPENDIQDTGAEITGNCHSEHNHQHSTFQTNSHSQK-----SKMEAEPVSIPS--SGYERTITVVRGNSSLGMTVSALRDG-SGIIIRSVVHGGSISK-DGRLAVGDGIVALNGESTTNLTNAQARAMLRRHSLIGPDLSVMYVPAAFLDLHRASY 877          
BLAST of Glutamate receptor-interacting protein 2 vs. Ensembl Zebrafish
Match: si:dkey-92j12.5 (si:dkey-92j12.5 [Source:ZFIN;Acc:ZDB-GENE-090313-354])

HSP 1 Score: 108.997 bits (271), Expect = 2.646e-23
Identity = 119/470 (25.32%), Postives = 209/470 (44.47%), Query Frame = 1
Query:  154 WKSYFTGIILSNFTSFNKIDKYFRFNITESSSKAIQENWIRILGIDYEIISMNLCK--RNQSLGVALEGRNEIARNTQEVVQHHFFKVILPSQCVGETGKFMVKDEILEVNGLKVVGLPTKEVLNTLRKVTNYFQIVVARSIIHNYDLASDYGGSEDNINSPISFYDMDDDESSQNGTLRSNVSNYSTTSRD--FGSSVSFGGLIDGQHETVNDYLRNMVGWRGPI-VIELRKQNSPFGLALEEIRNPLHNA-MIIVFKYVVPEMTAGKDGRLHAGDRLLQVNGKSVEGVDFRQVCKWIKSSPRGRLVLYICKPHFET--------INYDPSSPANDDKYYFNTIRDMDKLPKLSEETDGECLRLPAVPEYMETHITLKRTENKLGIFLDIVDEGKNGARIKKMTHG--IAKNDGRLHEGDFVTKVNEISLKVDNKSKLDLCLKQISADKRNYNISYITAEDVRLHNGKY 1515
            ++S  T  +LS   S N   K     +++   K+++E W   LG  YE++   + K   +  LGV+LE +            HH+   ILP   +G+TG     DE++EVNG  ++G   KEV++ L+++     +V +R I                   P    + +DD+     TL+  ++ ++  +    FGS  +   L +   ++    L +   W   I V EL+K +S  G ++ + ++P++    +IV + +VP   A +DGRL  GDRL+ VN   +      Q    +KS+  G + + + KP  E         I  +  S  N     F T     K      + + E + +P+     E  IT+ R  + LG+ +  + +G +G  I+ + HG  I+K DGRL  GD +  +N  S      ++    L++ S    + ++ Y+ A  + LH   Y
Sbjct:  487 FRSSQTCCLLSKTESRNH--KSSCCKLSDDEEKSLKEKWQSKLGPQYEVLVTQVEKFIESSGLGVSLEAKE----------GHHYICSILPEGPLGQTGIIHPGDELIEVNGFSLIGETHKEVVSLLKELPMNVCVVCSRLI-------------------PPRVSEEEDDDVQL--TLKELLAEFNEKAEQNIFGSVFA---LREEDLKSEAPVLSHQAMWENEIEVYELQKGDSGLGFSILDYQDPVNPGRTVIVIRSLVPGGLADRDGRLLPGDRLMFVNQTDLSHASLAQAVHVLKSTALGTVRIGVTKPLPENDIQDTGAEITGNCHSEHNHQHSTFQTNSHSQK-----SKMEAEPVSIPS--SGYERTITVVRGNSSLGMTVSALRDG-SGIIIRSVVHGGSISK-DGRLAVGDGIVALNGESTTNLTNAQARAMLRRHSLIGPDLSVMYVPAAFLDLHRASY 911          
BLAST of Glutamate receptor-interacting protein 2 vs. Ensembl Zebrafish
Match: ptpn13 (protein tyrosine phosphatase non-receptor type 13 [Source:ZFIN;Acc:ZDB-GENE-070410-72])

HSP 1 Score: 59.6918 bits (143), Expect = 2.859e-8
Identity = 56/208 (26.92%), Postives = 91/208 (43.75%), Query Frame = 1
Query:  823 IELRKQNSPFGLALEEIRNPLHNAMIIVFKYVVPEMTAGKDGRLHAGDRLLQVNGKSVEGVDFRQVCKWIKSSPRGRLVLYICKPHFETINYDPSSPANDDKYYFNTIRDMDKLPKLSEETDGECLRLPAVPEYMETHITLKRT------ENKLGIFLDIVDE--------GKNGARIKKMTHG-IAKNDGRLHEGDFVTKVNEISLK 1401
            IEL K +S  G+++    N       I  K V+P+  A +DGR+  GDR++ VNGKS+EG   +Q  + ++ +  G++V  +          +   P  D  +   T       P+ + E   + +  P+ PE     IT   T      +N  G+      E        G +  R+KK+  G  A   GR+  GD + +VN+  LK
Sbjct: 1323 IELSKIDSSLGISVTGGSNTSLKHGGIYVKGVIPKGAAEQDGRIKKGDRVVAVNGKSLEGATHKQAVEMLRDT--GQVVHLL---------MERGQPPKDSIHAPLT-------PQGTSEPQNKTVEEPSAPEKEYNFITADNTFDVALLKNTSGLGFSFSREEIIPGEPLGSSMVRVKKLFPGQPAAESGRIKVGDVILRVNQTPLK 1512          
BLAST of Glutamate receptor-interacting protein 2 vs. Ensembl Zebrafish
Match: pdzd2 (PDZ domain containing 2 [Source:ZFIN;Acc:ZDB-GENE-060526-297])

HSP 1 Score: 56.6102 bits (135), Expect = 2.454e-7
Identity = 45/199 (22.61%), Postives = 87/199 (43.72%), Query Frame = 1
Query:  820 VIELRKQNSPFGLALEEIRNPLHNAMIIVFKYVVPEMTAGKDGRLHAGDRLLQVNGKSVEGVDFRQVCKWIKSSPRGRLVLYICKPHFETINYDPS-SPANDDKYYFNTIRDMDKLPKLSEETDGECLRLPAVPEYMETHITLKRTEN---KLGIFLDIVDEGKNGARIKKMTHG-IAKNDGRLHEGDFVTKVNEISLK 1401
            ++ ++ Q    G ++   ++     M I  K + P   A  DGRL  GD +L+VNG+S++G+  +Q  +  K   +G + L + +    + +  P  +P    +            P      +G+  + P   + +   +TL +       +G     ++    G  I  +  G +AK DGRL  GD + +V+ +SL+
Sbjct:  663 IVLMKGQGKGLGFSIVGGQDSARGRMGIFVKTIFPNGAAAADGRLKEGDEILEVNGESLQGLTHQQAIQTFKQLKKGVVTLTV-RTRLRSPSLTPCPTPTLLSRSSSPNSNASGGTPVPQSFDEGDSRKGPGPKDRIIMEVTLNKEPGVGLGIGACCLTLENSAPGIYIHSLAPGSVAKMDGRLSRGDQLLEVDSVSLR 860          
BLAST of Glutamate receptor-interacting protein 2 vs. Ensembl Zebrafish
Match: pdzd2 (PDZ domain containing 2 [Source:ZFIN;Acc:ZDB-GENE-060526-297])

HSP 1 Score: 56.6102 bits (135), Expect = 2.816e-7
Identity = 45/199 (22.61%), Postives = 87/199 (43.72%), Query Frame = 1
Query:  820 VIELRKQNSPFGLALEEIRNPLHNAMIIVFKYVVPEMTAGKDGRLHAGDRLLQVNGKSVEGVDFRQVCKWIKSSPRGRLVLYICKPHFETINYDPS-SPANDDKYYFNTIRDMDKLPKLSEETDGECLRLPAVPEYMETHITLKRTEN---KLGIFLDIVDEGKNGARIKKMTHG-IAKNDGRLHEGDFVTKVNEISLK 1401
            ++ ++ Q    G ++   ++     M I  K + P   A  DGRL  GD +L+VNG+S++G+  +Q  +  K   +G + L + +    + +  P  +P    +            P      +G+  + P   + +   +TL +       +G     ++    G  I  +  G +AK DGRL  GD + +V+ +SL+
Sbjct:  597 IVLMKGQGKGLGFSIVGGQDSARGRMGIFVKTIFPNGAAAADGRLKEGDEILEVNGESLQGLTHQQAIQTFKQLKKGVVTLTV-RTRLRSPSLTPCPTPTLLSRSSSPNSNASGGTPVPQSFDEGDSRKGPGPKDRIIMEVTLNKEPGVGLGIGACCLTLENSAPGIYIHSLAPGSVAKMDGRLSRGDQLLEVDSVSLR 794          
BLAST of Glutamate receptor-interacting protein 2 vs. Ensembl Xenopus
Match: iffo2 (intermediate filament family orphan 2 [Source:Xenbase;Acc:XB-GENE-963325])

HSP 1 Score: 105.916 bits (263), Expect = 3.638e-22
Identity = 163/696 (23.42%), Postives = 281/696 (40.37%), Query Frame = 1
Query:  325 NQSLGVAL-EGRNEIAR-NTQEVVQHHFFKVILPSQCVGETGKFMVKDEILEVNGLKVVGLPTKEVLNTLRKVTNYFQIVV------ARSIIHNYDLASDYGGSEDNINSPISFYDMDDDESSQNGTLRSN-VSNYSTTSRDFGSSVSFGGLIDGQHETVNDYLRNMVGWR-----GPI-VIELRKQNSPFGLALEEIRNPLHNAMIIVFKYVVPEMTAGKDGRLHAGDRLLQVNGKSVEGVDFRQVCKWIKSSPRGRLVLYICKPHFETINYDPSSPANDDKYYFNTIRDMDKLPKLSEETDGECLRLPAVPEYMET-----HITLKRTENKLGIFLDIVDEGKNGARIKKMT-HGIAKNDGRLHEGDFVTKVNEISLKVDNKSKLDLCLKQISADKRNYNISYITAEDVRLHNGKYGTVSSATNRLPQSSQIYPEFLSIKVTEPLNEINSDKTRNHKFSFETFDIIIK--------NDKQTGLGLVLSPSLKDPNRYISITDIHDNSLCGKSGLLKINDEILKVNNVDFENISINELGHFLKRAHKTENELRFQVRRLTCSENVPVDPLIEKLTWFPDIYHRVLKRGPN-GFGFSLLELDSNNGVVVDKVDLNKVCD----LKPGERFVMINKCTVITCSKPNVVQMVKNSTRNLELIIETPKYREFRVKISKDSSMSLGLNIAGGRDTRFPIP 2310
             +SLG+++  GR   +R +  EV++  F K IL     G+ G     D I+EV+G  +     ++ +  +RK  N    +V       R  ++   +A  +  S  N  +P  F      +S    T  SN ++  ST S      +      D + E    Y    +  R     G + +IEL K  +  GL+L    N   + M +    + P   AGKDGRL   D LL++NG+ + G   +     IK +P    +++I   + + +N     P    +  F        L     E + E +  P +P  + +     H+ L + +  LGI +   D   NG  IK +T HG A  DGR+  GD +  V++  +  D   K+ +CL + +       IS    +  +L      T++S+T  +    Q  P   +    EP+   +   T     S      II         +  +TGLGL +          I I ++++     K G L   D+IL+VN +D  N + +E  + L+   +T  ++R  V R         D    K     D+    L++ P  G G S++   ++ GV V  +    + +    L  G++ +M+N   V   ++  V  ++K S   ++L +   K   F  +     S  +    +      FP+P
Sbjct: 1205 GKSLGISIVGGRGMGSRLSNGEVMRGIFIKHILEDSPAGKNGTLKTGDRIVEVDGTDLRDASHEQAVEAIRKAGNPVVFLVQSIINRPRGTMNPVRIA--FRCSPTNPFAPTPFKASSSSDSETEKTSSSNYLTGPSTLSSVNSEKLQMTSSTDPEKEDEFGYSWKKISQRYGNLPGELHMIELEKGKTGLGLSL--AGNKDRSRMSVFIVGIDPNGAAGKDGRLQIADELLEINGQILYGRSHQNASSIIKCAPSKVKIIFIR--NKDAVNQMAVCPVKATEPSFPNSSAFSNL-----EVEEESVPSPVLPLNVGSFKNVLHVELPKDQGGLGIAISEEDT-VNGVVIKSLTDHGAAAKDGRIKVGDCILAVDDEPVVGDPIEKV-ICLLKKAKTTVKLTISSDEKDMPQLLPLPSITLTSSTGEIKNGQQCLP-LSNFSEPEPVRSSSRSSTPATFPSDPATCPIIPGCETTIDISKGRTGLGLSIVGGADTLLGAIIIHEVYEEGAASKDGRLWAGDQILEVNGIDLRNATHDEAINVLR---QTPQKVRLTVYR---------DEAQYKEEDMYDVLDLELQKKPGKGLGLSIVGKRNDTGVFVSDIVKGGIAEIDGRLMQGDQLLMVNGEDVRNATQEAVAALLKCSLGTVKLEVGRIKTGPFHSERRTSQSSQVSEGTSSLTSFSFPMP 1874          

HSP 2 Score: 96.2857 bits (238), Expect = 3.157e-19
Identity = 81/299 (27.09%), Postives = 139/299 (46.49%), Query Frame = 1
Query:  256 IQENWIRILGIDYEIISMNLCKRNQS--LGVALEGRNEIARNTQEVVQHHFFKVILPSQCVGETGKFMVKDEILEVNGLKVVGLPTKEVLNTLRKVTNYFQIVVARSI-----------IHNYDLASDYGGSEDNINSPI-SFYDMDDDESSQNGTLRSNVSNYSTTSRDFGSSVS--------FGGLIDGQHETVNDYLRN-MVGWRGPIV-IELRKQNSPFGLALEEIRNPLHNA-MIIVFKYVVPEMTAGKDGRLHAGDRLLQVNGKSVEGVDFRQVCKWIKSSPRGRLVLYICKP 1077
            I+  W RI+G+ YEI+   + K ++S  LG++LE              HHF + ILP   VG +G     DE+LEVNG+ ++G    +V+N L+++     +V  R +            H  +  +D  G E +   P+ + + M +D       +  ++   S    DFG +V              DGQ  ++ D   + +  W   I  I L K +   G ++ + ++P+  A  +IV + +VP   A +DGRL  GDRL+ VN  ++E     +  + +K +P G + + + KP
Sbjct:  537 IKSKWQRIMGVGYEIVVAKVNKFSESSGLGISLEASG----------GHHFLRSILPEGPVGRSGSLYSGDELLEVNGISLLGQNHIDVVNILKELPICVTVVCCRQVKPPNSSLDEKEQHISEQEND--GPEGDFPVPLPALWKMQED-------IPQSLDTDSKLHIDFGGTVGSSETDDLNTASTEDGQ--SIEDAQGSPLAMWETDIQDILLEKGSLGLGFSILDYQDPIDPASTVIVIRSLVPGGVAEQDGRLLPGDRLMFVNEINLEHASLEEAVQALKGAPTGNVSIGVAKP 814          
BLAST of Glutamate receptor-interacting protein 2 vs. Ensembl Xenopus
Match: iffo2 (intermediate filament family orphan 2 [Source:Xenbase;Acc:XB-GENE-963325])

HSP 1 Score: 103.219 bits (256), Expect = 2.201e-21
Identity = 165/699 (23.61%), Postives = 284/699 (40.63%), Query Frame = 1
Query:  325 NQSLGVAL-EGRNEIAR-NTQEVVQHHFFKVILPSQCVGETGKFMVKDEILEVNGLKVVGLPTKEVLNTLRKVTNYFQIVVARSIIHN------YDLASDYGGSEDNINSPISFYDMDDDESSQNGTLRSNVSNY----STTSRDFGSSVSFGGLIDGQHETVNDYLRNMVGWR-----GPI-VIELRKQNSPFGLALEEIRNPLHNAMIIVFKYVVPEMTAGKDGRLHAGDRLLQVNGKSVEGVDFRQVCKWIKSSPRGRLVLYICKPHFETINYDPSSPANDDKYYFNTIRDMDKLPKLSEETDGECLRLPAVPEYMET-----HITLKRTENKLGIFLDIVDEGKNGARIKKMT-HGIAKNDGRLHEGDFVTKVNEISLKVDNKSKLDLCLKQISADKRNYNISYITAEDVRLHNGKYGTVSSATNRLPQSSQIYPEFLSIKVTEPLNEINSDKTRNHKFSFETFDIIIK--------NDKQTGLGLVLSPSLKDPNRYISITDIHDNSLCGKSGLLKINDEILKVNNVDFENISINELGHFLKRAHKTENELRFQVRRLTCSENVPVDPLIEKLTWFPDIYHRVLKRGPN-GFGFSLLELDSNNGVVVDKVDLNKVCD----LKPGERFVMINKCTVITCSKPNVVQMVKNSTRNLELIIETPKYREFRVKISKDSSMSLGLNIAGGRDTRFPIP 2310
             +SLG+++  GR   +R +  EV++  F K IL     G+ G     D I+EV+G  +     ++ +  +RK  N   + + +SII+       Y   S     +    +P S        SS + T +++ SNY    ST S      +      D + E    Y    +  R     G + +IEL K  +  GL+L    N   + M +    + P   AGKDGRL   D LL++NG+ + G   +     IK +P    +++I   + + +N     P    +  F        L     E + E +  P +P  + +     H+ L + +  LGI +   D   NG  IK +T HG A  DGR+  GD +  V++  +  D   K+ +CL + +       IS    +  +L      T++S+T  +    Q  P   +    EP+   +   T     S      II         +  +TGLGL +          I I ++++     K G L   D+IL+VN +D  N + +E  + L+   +T  ++R  V R         D    K     D+    L++ P  G G S++   ++ GV V  +    + +    L  G++ +M+N   V   ++  V  ++K S   ++L +   K   F  +     S  +    +      FP+P
Sbjct: 1205 GKSLGISIVGGRGMGSRLSNGEVMRGIFIKHILEDSPAGKNGTLKTGDRIVEVDGTDLRDASHEQAVEAIRKAGNPV-VFLVQSIINRPRPESVYCSPSSSALRQHPTTNPFSHPSPKASSSSDSETEKTSSSNYLTGPSTLSSVNSEKLQMTSSTDPEKEDEFGYSWKKISQRYGNLPGELHMIELEKGKTGLGLSL--AGNKDRSRMSVFIVGIDPNGAAGKDGRLQIADELLEINGQILYGRSHQNASSIIKCAPSKVKIIFIR--NKDAVNQMAVCPVKATEPSFPNSSAFSNL-----EVEEESVPSPVLPLNVGSFKNVLHVELPKDQGGLGIAISEEDT-VNGVVIKSLTDHGAAAKDGRIKVGDCILAVDDEPVVGDPIEKV-ICLLKKAKTTVKLTISSDEKDMPQLLPLPSITLTSSTGEIKNGQQCLP-LSNFSEPEPVRSSSRSSTPATFPSDPATCPIIPGCETTIDISKGRTGLGLSIVGGADTLLGAIIIHEVYEEGAASKDGRLWAGDQILEVNGIDLRNATHDEAINVLR---QTPQKVRLTVYR---------DEAQYKEEDMYDVLDLELQKKPGKGLGLSIVGKRNDTGVFVSDIVKGGIAEIDGRLMQGDQLLMVNGEDVRNATQEAVAALLKCSLGTVKLEVGRIKTGPFHSERRTSQSSQVSEGTSSLTSFSFPMP 1878          

HSP 2 Score: 96.2857 bits (238), Expect = 2.878e-19
Identity = 81/299 (27.09%), Postives = 139/299 (46.49%), Query Frame = 1
Query:  256 IQENWIRILGIDYEIISMNLCKRNQS--LGVALEGRNEIARNTQEVVQHHFFKVILPSQCVGETGKFMVKDEILEVNGLKVVGLPTKEVLNTLRKVTNYFQIVVARSI-----------IHNYDLASDYGGSEDNINSPI-SFYDMDDDESSQNGTLRSNVSNYSTTSRDFGSSVS--------FGGLIDGQHETVNDYLRN-MVGWRGPIV-IELRKQNSPFGLALEEIRNPLHNA-MIIVFKYVVPEMTAGKDGRLHAGDRLLQVNGKSVEGVDFRQVCKWIKSSPRGRLVLYICKP 1077
            I+  W RI+G+ YEI+   + K ++S  LG++LE              HHF + ILP   VG +G     DE+LEVNG+ ++G    +V+N L+++     +V  R +            H  +  +D  G E +   P+ + + M +D       +  ++   S    DFG +V              DGQ  ++ D   + +  W   I  I L K +   G ++ + ++P+  A  +IV + +VP   A +DGRL  GDRL+ VN  ++E     +  + +K +P G + + + KP
Sbjct:  537 IKSKWQRIMGVGYEIVVAKVNKFSESSGLGISLEASG----------GHHFLRSILPEGPVGRSGSLYSGDELLEVNGISLLGQNHIDVVNILKELPICVTVVCCRQVKPPNSSLDEKEQHISEQEND--GPEGDFPVPLPALWKMQED-------IPQSLDTDSKLHIDFGGTVGSSETDDLNTASTEDGQ--SIEDAQGSPLAMWETDIQDILLEKGSLGLGFSILDYQDPIDPASTVIVIRSLVPGGVAEQDGRLLPGDRLMFVNEINLEHASLEEAVQALKGAPTGNVSIGVAKP 814          
BLAST of Glutamate receptor-interacting protein 2 vs. Ensembl Xenopus
Match: iffo2 (intermediate filament family orphan 2 [Source:Xenbase;Acc:XB-GENE-963325])

HSP 1 Score: 102.449 bits (254), Expect = 4.413e-21
Identity = 178/749 (23.77%), Postives = 310/749 (41.39%), Query Frame = 1
Query:  325 NQSLGVAL-EGRNEIAR-NTQEVVQHHFFKVILPSQCVGETGKFMVKDEILEVNGLKVVGLPTKEVLNTLRKVTNYFQIVVARSIIHNYDLASDYGGSEDNINSPISFYDM-DDDESSQNGTLRSNVSNY----STTSRDFGSSVSFGGLIDGQHETVNDYLRNMVGWR-----GPI-VIELRKQNSPFGLALEEIRNPLHNAMIIVFKYVVPEMTAGKDGRLHAGDRLLQVNGKSVEGVDFRQVCKWIKSSPRGRLVLYICKPHFETINYDPSSPANDDKYYFNTIRDMDKLPKLSEETDGECLRLPAVPEYMETHITL---KRTENKLGIFLDIVDEGKNGARIKKMT-HGIAKNDGRLHEGDFVTKVNEISLKVDNKSKLDLCLKQISADKRNYNISYITAEDVRLHNGKYGTVSSATNRLPQSSQIYPEFLSIKVTEPLNEINSDKTRNHKFSF--------------ETFDIIIKNDKQTGLGLVLSPSLKDPNRYISITDIHDNSLCGKSGLLKINDEILKVNNVDFENISINELGHFLKRAHKTENELRFQVRRLTCSENVPVDPLIEKLTWFPDIYHRVLKRGPN-GFGFSLLELDSNNGVVVDKVDLNKVCD----LKPGERFVMINKCTVITCSKPNVVQMVKNSTRNLE----LIIETPKYREFR-VKISKDSSMSLGLNIAGGRDTRFP-IPV-IESLVPNRTSKFSEELFTLDLITEVDGTNVTKQNHAEIIQIFR 2442
             +SLG+++  GR   +R +  EV++  F K IL     G+ G     D I+EV+G  +     ++ +  +RK  N   + + +SII N    S +G     +++ I  + +     SS + T +++ SNY    ST S      +      D + E    Y    +  R     G + +IEL K  +  GL+L    N   + M +    + P   AGKDGRL   D LL++NG+ + G   +     IK +P    +++I   + + +N     P    +  F        L                  E    HI +    + +  LGI +   D   NG  IK +T HG A  DGR+  GD +  V++  +  D   K+ +CL + +       IS    +  +L      T++S+T  +    Q  P  LS   +EP   + S    +   +F               T DI   +  +TGLGL +          I I ++++     K G L   D+IL+VN +D  N + +E  + L+   +T  ++R  V R         D    K     D+    L++ P  G G S++   ++ GV V  +    + +    L  G++ +M+N   V   ++  V  ++K +   L     L +   + +  R V+I K  + SLG++IAGG  +    +P+ I  +  N  +  + +L   D I  + G       H++ + + +
Sbjct: 1004 GKSLGISIVGGRGMGSRLSNGEVMRGIFIKHILEDSPAGKNGTLKTGDRIVEVDGTDLRDASHEQAVEAIRKAGNPV-VFLVQSII-NRPRVSAWGSFL--LSTFIWKHSIFQASSSSDSETEKTSSSNYLTGPSTLSSVNSEKLQMTSSTDPEKEDEFGYSWKKISQRYGNLPGELHMIELEKGKTGLGLSLA--GNKDRSRMSVFIVGIDPNGAAGKDGRLQIADELLEINGQILYGRSHQNASSIIKCAPSKVKIIFI--RNKDAVNQMAVCPVKATEPSFPNSSAFSNL------------------EVQNNHIVIFLPNKDQGGLGIAISEEDT-VNGVVIKSLTDHGAAAKDGRIKVGDCILAVDDEPVVGDPIEKV-ICLLKKAKTTVKLTISSDEKDMPQLLPLPSITLTSSTGEIKNGQQCLP--LS-NFSEP-EPVRSSSRSSTPATFPSDPATCPIIPGCETTIDI---SKGRTGLGLSIVGGADTLLGAIIIHEVYEEGAASKDGRLWAGDQILEVNGIDLRNATHDEAINVLR---QTPQKVRLTVYR---------DEAQYKEEDMYDVLDLELQKKPGKGLGLSIVGKRNDTGVFVSDIVKGGIAEIDGRLMQGDQLLMVNGEDVRNATQEAVAALLKVNIVLLRSVFFLSLAASEIQGLRTVEIKKGPTDSLGISIAGGVGSPLGDVPIFIAMMHANGVAAQTHKLRVGDRIVSICGQPTEGMTHSQAVTLLK 1705          

HSP 2 Score: 95.1301 bits (235), Expect = 7.213e-19
Identity = 80/282 (28.37%), Postives = 131/282 (46.45%), Query Frame = 1
Query:  256 IQENWIRILGIDYEIISMNLCKRNQS--LGVALEGRNEIARNTQEVVQHHFFKVILPSQCVGETGKFMVKDEILEVNGLKVVGLPTKEVLNTLRKVTNYFQIVVARSIIHNYDLASDYGGSEDNINSPISFYDMDDDESSQ---NGTLRSN-VSNYSTTSRDFGSSVSFGGLIDGQHETVNDYLRNMVGWRGPIV-IELRKQNSPFGLALEEIRNPLHNA-MIIVFKYVVPEMTAGKDGRLHAGDRLLQVNGKSVEGVDFRQVCKWIKSSPRGRLVLYICKP 1077
            I+  W RI+G+ YEI+   + K ++S  LG++LE              HHF + ILP   VG +G     DE+LEVNG+ ++G    +V+N L+++     +V  R +            S D     IS  + D  E       GT+ S+   + +T S + G S+      D Q          +  W   I  I L K +   G ++ + ++P+  A  +IV + +VP   A +DGRL  GDRL+ VN  ++E     +  + +K +P G + + + KP
Sbjct:  504 IKSKWQRIMGVGYEIVVAKVNKFSESSGLGISLEASG----------GHHFLRSILPEGPVGRSGSLYSGDELLEVNGISLLGQNHIDVVNILKELPICVTVVCCRQV-------KPPNSSLDEKEQHISEQENDGPEGLHIDFGGTVGSSETDDLNTASTEDGQSIE-----DAQGSP-------LAMWETDIQDILLEKGSLGLGFSILDYQDPIDPASTVIVIRSLVPGGVAEQDGRLLPGDRLMFVNEINLEHASLEEAVQALKGAPTGNVSIGVAKP 756          
BLAST of Glutamate receptor-interacting protein 2 vs. Ensembl Xenopus
Match: iffo2 (intermediate filament family orphan 2 [Source:Xenbase;Acc:XB-GENE-963325])

HSP 1 Score: 101.679 bits (252), Expect = 6.793e-21
Identity = 169/727 (23.25%), Postives = 290/727 (39.89%), Query Frame = 1
Query:  325 NQSLGVAL-EGRNEIAR-NTQEVVQHHFFKVILPSQCVGETGKFMVKDEILEVNGLKVVGLPTKEVLNTLRKVTNYFQIVVARSIIHNYD------LASDYG------------GSEDNIN----------------SPISFYDMDDDESSQNGTLRSNVSNY----STTSRDFGSSVSFGGLIDGQHETVNDYLRNMVGWR-----GPI-VIELRKQNSPFGLALEEIRNPLHNAMIIVFKYVVPEMTAGKDGRLHAGDRLLQVNGKSVEGVDFRQVCKWIKSSPRGRLVLYICKPHFETINYDPSSPANDDKYYFNTIRDMDKLPKLSEETDGECLRLPAVPEYMET-----HITLKRTENKLGIFLDIVDEGKNGARIKKMT-HGIAKNDGRLHEGDFVTKVNEISLKVDNKSKLDLCLKQISADKRNYNISYITAEDVRLHNGKYGTVSSATNRLPQSSQIYPEFLSIKVTEPLNEINSDKTRNHKFSFETFDIIIK--------NDKQTGLGLVLSPSLKDPNRYISITDIHDNSLCGKSGLLKINDEILKVNNVDFENISINELGHFLKRAHKTENELRFQVRRLTCSENVPVDPLIEKLTWFPDIYHRVLKRGPN-GFGFSLLELDSNNGVVVDKVDLNKVCD----LKPGERFVMINKCTVITCSKPNVVQMVKNSTRNLELIIETPKYREFRVKISKDSSMSLGLNIAGGRDTRFPIP 2310
             +SLG+++  GR   +R +  EV++  F K IL     G+ G     D I+EV+G  +     ++ +  +RK  N   + + +SII+         L S +G             S+ NIN                +P +        SS + T +++ SNY    ST S      +      D + E    Y    +  R     G + +IEL K  +  GL+L    N   + M +    + P   AGKDGRL   D LL++NG+ + G   +     IK +P    +++I   + + +N     P    +  F        L     E + E +  P +P  + +     H+ L + +  LGI +   D   NG  IK +T HG A  DGR+  GD +  V++  +  D   K+ +CL + +       IS    +  +L      T++S+T  +    Q  P   +    EP+   +   T     S      II         +  +TGLGL +          I I ++++     K G L   D+IL+VN +D  N + +E  + L+   +T  ++R  V R         D    K     D+    L++ P  G G S++   ++ GV V  +    + +    L  G++ +M+N   V   ++  V  ++K S   ++L +   K   F  +     S  +    +      FP+P
Sbjct: 1205 GKSLGISIVGGRGMGSRLSNGEVMRGIFIKHILEDSPAGKNGTLKTGDRIVEVDGTDLRDASHEQAVEAIRKAGNPV-VFLVQSIINRPRKPALPLLQSTFGTKPLFRCTNPFDSSQLNINKGTMNPVRIAFRCSPTNPFAPTPFKASSSSDSETEKTSSSNYLTGPSTLSSVNSEKLQMTSSTDPEKEDEFGYSWKKISQRYGNLPGELHMIELEKGKTGLGLSL--AGNKDRSRMSVFIVGIDPNGAAGKDGRLQIADELLEINGQILYGRSHQNASSIIKCAPSKVKIIFIR--NKDAVNQMAVCPVKATEPSFPNSSAFSNL-----EVEEESVPSPVLPLNVGSFKNVLHVELPKDQGGLGIAISEEDT-VNGVVIKSLTDHGAAAKDGRIKVGDCILAVDDEPVVGDPIEKV-ICLLKKAKTTVKLTISSDEKDMPQLLPLPSITLTSSTGEIKNGQQCLP-LSNFSEPEPVRSSSRSSTPATFPSDPATCPIIPGCETTIDISKGRTGLGLSIVGGADTLLGAIIIHEVYEEGAASKDGRLWAGDQILEVNGIDLRNATHDEAINVLR---QTPQKVRLTVYR---------DEAQYKEEDMYDVLDLELQKKPGKGLGLSIVGKRNDTGVFVSDIVKGGIAEIDGRLMQGDQLLMVNGEDVRNATQEAVAALLKCSLGTVKLEVGRIKTGPFHSERRTSQSSQVSEGTSSLTSFSFPMP 1906          

HSP 2 Score: 96.6709 bits (239), Expect = 2.338e-19
Identity = 81/299 (27.09%), Postives = 139/299 (46.49%), Query Frame = 1
Query:  256 IQENWIRILGIDYEIISMNLCKRNQS--LGVALEGRNEIARNTQEVVQHHFFKVILPSQCVGETGKFMVKDEILEVNGLKVVGLPTKEVLNTLRKVTNYFQIVVARSI-----------IHNYDLASDYGGSEDNINSPI-SFYDMDDDESSQNGTLRSNVSNYSTTSRDFGSSVS--------FGGLIDGQHETVNDYLRN-MVGWRGPIV-IELRKQNSPFGLALEEIRNPLHNA-MIIVFKYVVPEMTAGKDGRLHAGDRLLQVNGKSVEGVDFRQVCKWIKSSPRGRLVLYICKP 1077
            I+  W RI+G+ YEI+   + K ++S  LG++LE              HHF + ILP   VG +G     DE+LEVNG+ ++G    +V+N L+++     +V  R +            H  +  +D  G E +   P+ + + M +D       +  ++   S    DFG +V              DGQ  ++ D   + +  W   I  I L K +   G ++ + ++P+  A  +IV + +VP   A +DGRL  GDRL+ VN  ++E     +  + +K +P G + + + KP
Sbjct:  537 IKSKWQRIMGVGYEIVVAKVNKFSESSGLGISLEASG----------GHHFLRSILPEGPVGRSGSLYSGDELLEVNGISLLGQNHIDVVNILKELPICVTVVCCRQVKPPNSSLDEKEQHISEQEND--GPEGDFPVPLPALWKMQED-------IPQSLDTDSKLHIDFGGTVGSSETDDLNTASTEDGQ--SIEDAQGSPLAMWETDIQDILLEKGSLGLGFSILDYQDPIDPASTVIVIRSLVPGGVAEQDGRLLPGDRLMFVNEINLEHASLEEAVQALKGAPTGNVSIGVAKP 814          
BLAST of Glutamate receptor-interacting protein 2 vs. Ensembl Xenopus
Match: iffo2 (intermediate filament family orphan 2 [Source:Xenbase;Acc:XB-GENE-963325])

HSP 1 Score: 97.8265 bits (242), Expect = 1.168e-19
Identity = 85/311 (27.33%), Postives = 145/311 (46.62%), Query Frame = 1
Query:  256 IQENWIRILGIDYEIISMNLCKRNQS--LGVALEGRNEIARNTQEVVQHHFFKVILPSQCVGETGKFMVKDEILEVNGLKVVGLPTKEVLNTLRKVTNYFQIVVARSI-----------IHNYDLASDYGGSEDNINSPI-SFYDMDDDESSQNGTLRSNVSNYSTTSRDFGSSVS--------FGGLIDGQHETVNDYLRN-MVGWRGPIV-IELRKQNSPFGLALEEIRNPLHNA-MIIVFKYVVPEMTAGKDGRLHAGDRLLQVNGKSVEGVDFRQVCKWIKSSPRGRLVLYICKP-HFETINYDPSS 1110
            I+  W RI+G+ YEI+   + K ++S  LG++LE              HHF + ILP   VG +G     DE+LEVNG+ ++G    +V+N L+++     +V  R +            H  +  +D  G E +   P+ + + M +D       +  ++   S    DFG +V              DGQ  ++ D   + +  W   I  I L K +   G ++ + ++P+  A  +IV + +VP   A +DGRL  GDRL+ VN  ++E     +  + +K +P G + + + KP   ET+  D +S
Sbjct:  537 IKSKWQRIMGVGYEIVVAKVNKFSESSGLGISLEASG----------GHHFLRSILPEGPVGRSGSLYSGDELLEVNGISLLGQNHIDVVNILKELPICVTVVCCRQVKPPNSSLDEKEQHISEQEND--GPEGDFPVPLPALWKMQED-------IPQSLDTDSKLHIDFGGTVGSSETDDLNTASTEDGQ--SIEDAQGSPLAMWETDIQDILLEKGSLGLGFSILDYQDPIDPASTVIVIRSLVPGGVAEQDGRLLPGDRLMFVNEINLEHASLEEAVQALKGAPTGNVSIGVAKPLPVETLEVDLTS 826          

HSP 2 Score: 92.4337 bits (228), Expect = 4.638e-18
Identity = 122/516 (23.64%), Postives = 211/516 (40.89%), Query Frame = 1
Query:  820 VIELRKQNSPFGLALEEIRNPLHNAMIIVFKYVVPEMTAGKDGRLHAGDRLLQVNGKSVEGVDFRQVCKWIKSSPRGRLVLYICKPHFETINYDPSSPANDDKYYFNTIRDMDKLPKLSEETDGECLRLPAVPEYMET-----HITLKRTENKLGIFLDIVDEGKNGARIKKMT-HGIAKNDGRLHEGDFVTKVNEISLKVDNKSKLDLCLKQISADKRNYNISYITAEDVRLHNGKYGTVSSATNRLPQSSQIYPEFLSIKVTEPLNEINSDKTRNHKFSFETFDIIIK--------NDKQTGLGLVLSPSLKDPNRYISITDIHDNSLCGKSGLLKINDEILKVNNVDFENISINELGHFLKRAHKTENELRFQVRRLTCSENVPVDPLIEKLTWFPDIYHRVLKRGPN-GFGFSLLELDSNNGVVVDKVDLNKVCD----LKPGERFVMINKCTVITCSKPNVVQMVKNSTRNLELIIETPKYREFRVKISKDSSMSLGLNIAGGRDTRFPIP 2310
            +IEL K  +  GL+L    N   + M +    + P   AGKDGRL   D LL++NG+ + G   +     IK +P    +++I   + + +N     P    +  F        L     E + E +  P +P  + +     H+ L + +  LGI +   D   NG  IK +T HG A  DGR+  GD +  V++  +  D   K+ +CL + +       IS    +  +L      T++S+T  +    Q  P   +    EP+   +   T     S      II         +  +TGLGL +          I I ++++     K G L   D+IL+VN +D  N + +E  + L+   +T  ++R  V R         D    K     D+    L++ P  G G S++   ++ GV V  +    + +    L  G++ +M+N   V   ++  V  ++K S   ++L +   K   F  +     S  +    +      FP+P
Sbjct: 1404 MIELEKGKTGLGLSL--AGNKDRSRMSVFIVGIDPNGAAGKDGRLQIADELLEINGQILYGRSHQNASSIIKCAPSKVKIIFIR--NKDAVNQMAVCPVKATEPSFPNSSAFSNL-----EVEEESVPSPVLPLNVGSFKNVLHVELPKDQGGLGIAISEEDT-VNGVVIKSLTDHGAAAKDGRIKVGDCILAVDDEPVVGDPIEKV-ICLLKKAKTTVKLTISSDEKDMPQLLPLPSITLTSSTGEIKNGQQCLP-LSNFSEPEPVRSSSRSSTPATFPSDPATCPIIPGCETTIDISKGRTGLGLSIVGGADTLLGAIIIHEVYEEGAASKDGRLWAGDQILEVNGIDLRNATHDEAINVLR---QTPQKVRLTVYR---------DEAQYKEEDMYDVLDLELQKKPGKGLGLSIVGKRNDTGVFVSDIVKGGIAEIDGRLMQGDQLLMVNGEDVRNATQEAVAALLKCSLGTVKLEVGRIKTGPFHSERRTSQSSQVSEGTSSLTSFSFPMP 1895          
BLAST of Glutamate receptor-interacting protein 2 vs. Ensembl Mouse
Match: Mpdz (multiple PDZ domain protein [Source:MGI Symbol;Acc:MGI:1343489])

HSP 1 Score: 103.605 bits (257), Expect = 1.301e-21
Identity = 80/279 (28.67%), Postives = 135/279 (48.39%), Query Frame = 1
Query:  253 AIQENWIRILGIDYEIISMNLCK--RNQSLGVALEGRNEIARNTQEVVQHHFFKVILPSQCVGETGKFMVKDEILEVNGLKVVGLPTKEVLNTLRKVTNYFQIVVARSIIHNYDLASDYGGSEDNINSPISFYDMDDDESSQNGTLRSNVSNYSTTSRDFGSSVSFGGLIDGQHETVNDYLRNMVGWR-GPIVIELRKQNSPFGLALEEIRNPLHNA-MIIVFKYVVPEMTAGKDGRLHAGDRLLQVNGKSVEGVDFRQVCKWIKSSPRGRLVLYICKP 1077
            A+   W RI+GI+YEI+  ++ K   N  LG++LE            V HHF + +LP   VG +GK    DE+LEVNG+ ++G   ++V+N L+++     +V  R  +    L            S +   D++D E ++   +       S+ + D   ++S    +D   E +   L     W  G   IEL K +   G ++ + ++P+  A  +IV + +VP   A KDGRL  GDRL+ VN  ++E     +  + +K +P G + + + KP
Sbjct:  529 ALLTKWQRIMGINYEIVVAHVSKFSENSGLGISLEA----------TVGHHFIRSVLPEGPVGHSGKLFSGDELLEVNGINLLGENHQDVVNILKELPIDVTMVCCRRTVPPIAL------------SEMDSLDINDLELTEKPHIDLGEFIGSSETEDPMLAMSD---VDQNAEEIQTPLAM---WEAGGQSIELEKGSRGLGFSILDYQDPIDPANTVIVIRSLVPGGIAEKDGRLFPGDRLMFVNDINLENSTLEEAVEALKGAPSGMVRIGVAKP 779          

HSP 2 Score: 95.9005 bits (237), Expect = 3.024e-19
Identity = 183/794 (23.05%), Postives = 315/794 (39.67%), Query Frame = 1
Query:  325 NQSLGVAL-EGRNEIAR-NTQEVVQHHFFKVILPSQCVGETGKFMVKDEILEVNGLKVVGLPTKEVLNTLRKVTNYFQIVVARSIIHNYDLASDYGGSED------NI--NSPISFYDMDDDESSQNGTLRSNVSNYSTTSRDFGSSVS-----FGGLIDGQHETVNDYLRNMVGWRGPIVIELRKQNSPFGLALEEIRNPLHNAMIIVFKYVVPEMTAGKDGRLHAGDRLLQVNGKSVEGVDFRQVCKWIKSSPRGRLVLYICKPHFETINYDPSSPA-NDDKYYFNTIRDMDKLPKLSEETDGECLRLPAVPEYMETHITLKRTENKLGIFLDIVDEGKNGARIKKMT-HGIAKNDGRLHEGDFVTKVNE-----------ISLKVDNKSKLDLCLKQISADKRNYNISYITAEDVRLHNGKYGTVSSA-TNRLPQSSQIYPE--FLSIKVTEPLNEINSDKTRNHKFSFETFDIIIKNDKQTGLGLVLSPSLKDPNRYISITDIHDNSLCGKSGLLKINDEILKVNNVDFENISINELGHFLKRAHKTENELRFQVRRLTCSENVPVDPLIEKLTWFPDIYHRVLKRGPN-GFGFSLLELDSNNGVVVDKVDLNKVCD----LKPGERFVMINKCTVITCSKPNVVQMVKNSTRNLEL----IIETPKYREFR----------------------------------------------VKISKDSSMSLGLNIAGGRDTRFP-IPV-IESLVPNRTSKFSEELFTLDLITEVDGTNVTKQNHAEIIQIFR 2442
            ++SLG+++  GR   +R +  EV++  F K +L     G+ G     D I+EV+G+ +     ++ +  +RK  N    +V +SII N   A     SE       N+  +SP  F +M  D +  + T    VS       +FG S       +G L    H                 VIEL K  S  GL+L   ++    ++ IV   + P   AG+DGRL   D LL++NG+ + G   +     IK +P    +++I   + + +N     P    D     +    +K  +    T      L ++ +  +  + L + +  LGI +   ++  NG  I+ +T HG A  DGRL  GD +  V++           ISL    K+ + L ++  +        S +T    R  N +   V +     +P +S+      F S   T P+  I   +T        T +I   +  QTGLGL +          I I ++++     K G L   D+IL+VN +D    + +E  + L+   +T   +R  + R         D    K     D +   L++ P  G G S++   ++ GV V  +    + D    L  G++ +M+N   V   ++  V  ++K S   + L    +   P + E R                                              V+I K  + SLGL+IAGG  +    +P+ I  + PN  +  +++L   D I  + GT+     H + + + +
Sbjct: 1147 SKSLGISIVGGRGMGSRLSNGEVMRGIFIKHVLEDSPAGKNGTLKPGDRIIEVDGMDLRDASHEQAVEAIRKAGNPVVFMV-QSII-NRPRAPSQSESETEKPALCNVPPSSPSVFSEMGSDCAQPSATA---VSEDEDKEDEFGYSWKNIQERYGSLTGQLH-----------------VIELEKGQSGLGLSLAGNKDRTRMSVFIV--GIDPTGAAGRDGRLQIADELLEINGQILYGRSHQNASSIIKCAPSKVKIIFI--RNADAVNQMAVCPGIAADSPSSTSDSPQNKEVEPCSTTSASAADLSSLTDVYQ--LELPKDQGGLGIAI-CEEDTINGVMIESLTEHGGAAKDGRLKPGDHILAVDDEVVAGCPVEKFISLLKTAKATVKLTVRAENPACPAVPSSAVTVSGERKDNSQTPAVPAPDLEPIPSTSRSSTPAVFASDPATCPI--IPGCET--------TIEI---SKGQTGLGLSIVGGSDTLLGAIIIHEVYEEGAACKDGRLWAGDQILEVNGIDLRKATHDEAINVLR---QTPQRVRLTLYR---------DEAPYKEEDVCDTFTIELQKRPGKGLGLSIVGKRNDTGVFVSDIVKGGIADADGRLMQGDQILMVNGEDVRHATQEAVAALLKCSLGAVTLEVGRVKAAPFHSERRPSQSSQVSESSLSSFTPPLSGINTSESLESNSKKNALASEIQGLRTVEIKKGPADSLGLSIAGGVGSPLGDVPIFIAMMHPNGVAAQTQKLRVGDRIVTICGTSTDGMTHTQAVNLMK 1886          

HSP 3 Score: 61.6178 bits (148), Expect = 7.682e-9
Identity = 114/494 (23.08%), Postives = 198/494 (40.08%), Query Frame = 1
Query:  823 IELRKQNSPFGLALEEIRNPLHNAMIIVFKYVVPEMTAGKDGRLHAGDRLLQVNGKSVEGVDFRQVCKWIKSSP-RGRLVLYICKPHFETINYDPSSPANDDKYYFNTIRDMDKLPKLSEETDGECLRLPAVPEYMETHITLKRTENKLGIFLDIVDEGKNGARIKKMTHGIAKNDGRLHEGDFVTKVNEISLKVDNKSKLDLCLKQISADKRNYNISYITAEDVRLHNGKYGTVSSATNRLPQSSQIYPEFLSIKVTEPLNEINSDKT--RNHKFSFETFDII------IKNDKQTGLGLVLSPSLKDP--NRYISITDIHDNSLCGKSGLLKINDEILKVNNVDFENISINELGHFLKRAH---KTENELRFQVRRLTCSENVPVDPLIE-----KLTWFPDIYHR------VLKRGPNGFGFSLL-ELDSNNG-------VVVDKVDLNKVCDLKPGERFVMINKCTVITCSKPNVVQMVKNSTRNLELII 2205
            IE+ K  +  GL++    + L  A+II    V  E  A KDGRL AGD++L+VNG  +      +    ++ +P R RL LY           D +    +D     TI ++ K P       G+ L L          I  KR  N  G+F+  + +G           GIA  DGRL +GD +  VN   ++   +  +   LK         ++  +T E  R+    +      + R P  S    E      T PL+ IN+ ++   N K +    +I       IK      LGL ++  +  P  +  I I  +H N +  ++  L++ D I+ +     + ++  +  + +K A    + +      V  +T  +    +P +        + FPD           L RGP+G GFS++    S +G        V  K    +   LK G++ + +N  ++   +    V ++K +   + L++
Sbjct: 1582 IEISKGQTGLGLSIVGGSDTLLGAIII--HEVYEEGAACKDGRLWAGDQILEVNGIDLRKATHDEAINVLRQTPQRVRLTLY----------RDEAPYKEEDVCDTFTI-ELQKRP-------GKGLGL---------SIVGKR--NDTGVFVSDIVKG-----------GIADADGRLMQGDQILMVNGEDVRHATQEAVAALLK--------CSLGAVTLEVGRVKAAPF-----HSERRPSQSSQVSESSLSSFTPPLSGINTSESLESNSKKNALASEIQGLRTVEIKKGPADSLGLSIAGGVGSPLGDVPIFIAMMHPNGVAAQTQKLRVGDRIVTICGTSTDGMTHTQAVNLMKNASGSIEVQVVAGGDVSVVTGHQQELANPCLAFTGLTSSSIFPDDLGPPQSKTITLDRGPDGLGFSIVGGYGSPHGDLPIYVKTVFAKGAAAEDGRLKRGDQIIAVNGQSLEGVTHEEAVAILKRTKGTVTLMV 2020          

HSP 4 Score: 61.2326 bits (147), Expect = 1.113e-8
Identity = 91/401 (22.69%), Postives = 163/401 (40.65%), Query Frame = 1
Query:  289 DYEIISMNLCKRNQSLGVALEGRNEIARNTQEVVQHHFFKVILPSQCVGETGKFMVKDEILEVNGLKVVGLPTKEVLNTLRKVTNYFQIVVARSIIHNYDLASDYGGSEDNINSPISFYDMDDDESSQNGTLRSNVSNYSTTSRDFGSSVSFGGLIDGQHETVNDYLRN---MVGWR-------GPIVIELRK--QNSPFGLALEEIRNPLHNAMIIVFKYVVPEMTAGKDGRLHAGDRLLQVNGKSVEGVDFRQVCKWIKSSPRG-------RLVLYICKPHFETINYD----PSSPANDDKYYFNTIRDMDKLPKLSE-ETDGECLRLP-AVPEYMETHITLKRTENKLGI----FLDIVDEGKNGARIKKMT-HGIAKNDGRLHEGDFVTKVNEISLK 1401
            + E   + L K  Q LG+ + G   I     E     F K I  S  V   G+  + D+I+ V+G  + G   ++ +  LR      ++ + R         +  G +  +++ P    + D++  S    L+ N S        F        L+  + E   D  +    +  W+         +V  + K  +NS  G++LE      H+      + V+PE   G  G+L +GD LL+VNG ++ G + + V   +K  P         R V  I     ++++ +       P  D   +  +    D +  +S+ + + E ++ P A+ E     I L++    LG     + D +D       I+ +   GIA+ DGRL  GD +  VN+I+L+
Sbjct:  373 ESETFDVELTKNVQGLGITIAGY--IGDKKLEP-SGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVRLTLMRKGASQEAELTSRGDTAKDVDLPAENCEKDEESLS----LKRNTSILPIEEEGFP-------LLSAELEEAEDVQQEAALLTKWQRIMGINYEIVVAHVSKFSENSGLGISLEATVG--HH----FIRSVLPEGPVGHSGKLFSGDELLEVNGINLLGENHQDVVNILKELPIDVTMVCCRRTVPPIALSEMDSLDINDLELTEKPHIDLGEFIGSSETEDPMLAMSDVDQNAEEIQTPLAMWEAGGQSIELEKGSRGLGFSILDYQDPIDPANTVIVIRSLVPGGIAEKDGRLFPGDRLMFVNDINLE 753          
BLAST of Glutamate receptor-interacting protein 2 vs. Ensembl Mouse
Match: Mpdz (multiple PDZ domain protein [Source:MGI Symbol;Acc:MGI:1343489])

HSP 1 Score: 103.605 bits (257), Expect = 1.386e-21
Identity = 80/279 (28.67%), Postives = 135/279 (48.39%), Query Frame = 1
Query:  253 AIQENWIRILGIDYEIISMNLCK--RNQSLGVALEGRNEIARNTQEVVQHHFFKVILPSQCVGETGKFMVKDEILEVNGLKVVGLPTKEVLNTLRKVTNYFQIVVARSIIHNYDLASDYGGSEDNINSPISFYDMDDDESSQNGTLRSNVSNYSTTSRDFGSSVSFGGLIDGQHETVNDYLRNMVGWR-GPIVIELRKQNSPFGLALEEIRNPLHNA-MIIVFKYVVPEMTAGKDGRLHAGDRLLQVNGKSVEGVDFRQVCKWIKSSPRGRLVLYICKP 1077
            A+   W RI+GI+YEI+  ++ K   N  LG++LE            V HHF + +LP   VG +GK    DE+LEVNG+ ++G   ++V+N L+++     +V  R  +    L            S +   D++D E ++   +       S+ + D   ++S    +D   E +   L     W  G   IEL K +   G ++ + ++P+  A  +IV + +VP   A KDGRL  GDRL+ VN  ++E     +  + +K +P G + + + KP
Sbjct:  529 ALLTKWQRIMGINYEIVVAHVSKFSENSGLGISLEA----------TVGHHFIRSVLPEGPVGHSGKLFSGDELLEVNGINLLGENHQDVVNILKELPIDVTMVCCRRTVPPIAL------------SEMDSLDINDLELTEKPHIDLGEFIGSSETEDPMLAMSD---VDQNAEEIQTPLAM---WEAGGQSIELEKGSRGLGFSILDYQDPIDPANTVIVIRSLVPGGIAEKDGRLFPGDRLMFVNDINLENSTLEEAVEALKGAPSGMVRIGVAKP 779          

HSP 2 Score: 86.2705 bits (212), Expect = 2.741e-16
Identity = 182/825 (22.06%), Postives = 318/825 (38.55%), Query Frame = 1
Query:  325 NQSLGVAL-EGRNEIAR-NTQEVVQHHFFKVILPSQCVGETGKFMVKDEILEVNGLKVVGLPTKEVLNTLRKVTN----YFQIVVAR-------SIIHNY----------------DLASDYGGSED----------NI--NSPISFYDMDDDESSQNGTLRSNVSNYSTTSRDFGSSVS-----FGGLIDGQHETVNDYLRNMVGWRGPIVIELRKQNSPFGLALEEIRNPLHNAMIIVFKYVVPEMTAGKDGRLHAGDRLLQVNGKSVEGVDFRQVCKWIKSSPRGRLVLYICKPHFETINYDPSSPA-NDDKYYFNTIRDMDKLPKLSEETDGECLRLPAVPEYMETHITLKRTENKLGIFLDIVDEGKNGARIKKMT-HGIAKNDGRLHEGDFVTKVNE-----------ISLKVDNKSKLDLCLKQISADKRNYNISYITAEDVRLHNGKYGTVSSA-TNRLPQSSQIYPE--FLSIKVTEPLNEINSDKTRNHKFSFETFDIIIKNDKQTGLGLVLSPSLKDPNRYISITDIHDNSLCGKSGLLKINDEILKVNNVDFENISINELGHFLKRAHKTENELRFQVRRLTCSENVPVDPLIEKLTWFPDIYHRVLKRGPN-GFGFSLLELDSNNGVVVDKVDLNKVCD----LKPGERFVMINKCTVITCSKPNVVQMVKNSTRNLEL----IIETPKYREFR----------------------------------------------VKISKDSSMSLGLNIAGGRDTRFP-IPV-IESLVPNRTSKFSEELFTLDLITEVDGTNVTKQNHAEIIQIFR 2442
            ++SLG+++  GR   +R +  EV++  F K +L     G+ G     D I+EV+G+ +     ++ +  +RK  N      Q ++ R       S+ H+                  L +D   S+           N+  +SP  F +M  D +  + T    VS       +FG S       +G L    H                 VIEL K  S  GL+L   ++    ++ IV   + P   AG+DGRL   D LL++NG+ + G   +     IK +P    +++I   + + +N     P    D     +    +K  +    T      L ++ +  +  + L + +  LGI +   ++  NG  I+ +T HG A  DGRL  GD +  V++           ISL    K+ + L ++  +        S +T    R  N +   V +     +P +S+      F S   T P+  I   +T        T +I   +  QTGLGL +          I I ++++     K G L   D+IL+VN +D    + +E  + L+   +T   +R  + R         D    K     D +   L++ P  G G S++   ++ GV V  +    + D    L  G++ +M+N   V   ++  V  ++K S   + L    +   P + E R                                              V+I K  + SLGL+IAGG  +    +P+ I  + PN  +  +++L   D I  + GT+     H + + + +
Sbjct: 1147 SKSLGISIVGGRGMGSRLSNGEVMRGIFIKHVLEDSPAGKNGTLKPGDRIIEVDGMDLRDASHEQAVEAIRKAGNPVVFMVQSIINRPRKSPLPSLPHSLYPKYSFSSTNPFADSLQLTTDQAPSQSESETEKPALCNVPPSSPSVFSEMGSDCAQPSATA---VSEDEDKEDEFGYSWKNIQERYGSLTGQLH-----------------VIELEKGQSGLGLSLAGNKDRTRMSVFIV--GIDPTGAAGRDGRLQIADELLEINGQILYGRSHQNASSIIKCAPSKVKIIFI--RNADAVNQMAVCPGIAADSPSSTSDSPQNKEVEPCSTTSASAADLSSLTDVYQ--LELPKDQGGLGIAI-CEEDTINGVMIESLTEHGGAAKDGRLKPGDHILAVDDEVVAGCPVEKFISLLKTAKATVKLTVRAENPACPAVPSSAVTVSGERKDNSQTPAVPAPDLEPIPSTSRSSTPAVFASDPATCPI--IPGCET--------TIEI---SKGQTGLGLSIVGGSDTLLGAIIIHEVYEEGAACKDGRLWAGDQILEVNGIDLRKATHDEAINVLR---QTPQRVRLTLYR---------DEAPYKEEDVCDTFTIELQKRPGKGLGLSIVGKRNDTGVFVSDIVKGGIADADGRLMQGDQILMVNGEDVRHATQEAVAALLKCSLGAVTLEVGRVKAAPFHSERRPSQSSQVSESSLSSFTPPLSGINTSESLESNSKKNALASEIQGLRTVEIKKGPADSLGLSIAGGVGSPLGDVPIFIAMMHPNGVAAQTQKLRVGDRIVTICGTSTDGMTHTQAVNLMK 1919          

HSP 3 Score: 61.2326 bits (147), Expect = 9.832e-9
Identity = 114/494 (23.08%), Postives = 198/494 (40.08%), Query Frame = 1
Query:  823 IELRKQNSPFGLALEEIRNPLHNAMIIVFKYVVPEMTAGKDGRLHAGDRLLQVNGKSVEGVDFRQVCKWIKSSP-RGRLVLYICKPHFETINYDPSSPANDDKYYFNTIRDMDKLPKLSEETDGECLRLPAVPEYMETHITLKRTENKLGIFLDIVDEGKNGARIKKMTHGIAKNDGRLHEGDFVTKVNEISLKVDNKSKLDLCLKQISADKRNYNISYITAEDVRLHNGKYGTVSSATNRLPQSSQIYPEFLSIKVTEPLNEINSDKT--RNHKFSFETFDII------IKNDKQTGLGLVLSPSLKDP--NRYISITDIHDNSLCGKSGLLKINDEILKVNNVDFENISINELGHFLKRAH---KTENELRFQVRRLTCSENVPVDPLIE-----KLTWFPDIYHR------VLKRGPNGFGFSLL-ELDSNNG-------VVVDKVDLNKVCDLKPGERFVMINKCTVITCSKPNVVQMVKNSTRNLELII 2205
            IE+ K  +  GL++    + L  A+II    V  E  A KDGRL AGD++L+VNG  +      +    ++ +P R RL LY           D +    +D     TI ++ K P       G+ L L          I  KR  N  G+F+  + +G           GIA  DGRL +GD +  VN   ++   +  +   LK         ++  +T E  R+    +      + R P  S    E      T PL+ IN+ ++   N K +    +I       IK      LGL ++  +  P  +  I I  +H N +  ++  L++ D I+ +     + ++  +  + +K A    + +      V  +T  +    +P +        + FPD           L RGP+G GFS++    S +G        V  K    +   LK G++ + +N  ++   +    V ++K +   + L++
Sbjct: 1615 IEISKGQTGLGLSIVGGSDTLLGAIII--HEVYEEGAACKDGRLWAGDQILEVNGIDLRKATHDEAINVLRQTPQRVRLTLY----------RDEAPYKEEDVCDTFTI-ELQKRP-------GKGLGL---------SIVGKR--NDTGVFVSDIVKG-----------GIADADGRLMQGDQILMVNGEDVRHATQEAVAALLK--------CSLGAVTLEVGRVKAAPF-----HSERRPSQSSQVSESSLSSFTPPLSGINTSESLESNSKKNALASEIQGLRTVEIKKGPADSLGLSIAGGVGSPLGDVPIFIAMMHPNGVAAQTQKLRVGDRIVTICGTSTDGMTHTQAVNLMKNASGSIEVQVVAGGDVSVVTGHQQELANPCLAFTGLTSSSIFPDDLGPPQSKTITLDRGPDGLGFSIVGGYGSPHGDLPIYVKTVFAKGAAAEDGRLKRGDQIIAVNGQSLEGVTHEEAVAILKRTKGTVTLMV 2053          

HSP 4 Score: 61.2326 bits (147), Expect = 1.144e-8
Identity = 91/401 (22.69%), Postives = 163/401 (40.65%), Query Frame = 1
Query:  289 DYEIISMNLCKRNQSLGVALEGRNEIARNTQEVVQHHFFKVILPSQCVGETGKFMVKDEILEVNGLKVVGLPTKEVLNTLRKVTNYFQIVVARSIIHNYDLASDYGGSEDNINSPISFYDMDDDESSQNGTLRSNVSNYSTTSRDFGSSVSFGGLIDGQHETVNDYLRN---MVGWR-------GPIVIELRK--QNSPFGLALEEIRNPLHNAMIIVFKYVVPEMTAGKDGRLHAGDRLLQVNGKSVEGVDFRQVCKWIKSSPRG-------RLVLYICKPHFETINYD----PSSPANDDKYYFNTIRDMDKLPKLSE-ETDGECLRLP-AVPEYMETHITLKRTENKLGI----FLDIVDEGKNGARIKKMT-HGIAKNDGRLHEGDFVTKVNEISLK 1401
            + E   + L K  Q LG+ + G   I     E     F K I  S  V   G+  + D+I+ V+G  + G   ++ +  LR      ++ + R         +  G +  +++ P    + D++  S    L+ N S        F        L+  + E   D  +    +  W+         +V  + K  +NS  G++LE      H+      + V+PE   G  G+L +GD LL+VNG ++ G + + V   +K  P         R V  I     ++++ +       P  D   +  +    D +  +S+ + + E ++ P A+ E     I L++    LG     + D +D       I+ +   GIA+ DGRL  GD +  VN+I+L+
Sbjct:  373 ESETFDVELTKNVQGLGITIAGY--IGDKKLEP-SGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVRLTLMRKGASQEAELTSRGDTAKDVDLPAENCEKDEESLS----LKRNTSILPIEEEGFP-------LLSAELEEAEDVQQEAALLTKWQRIMGINYEIVVAHVSKFSENSGLGISLEATVG--HH----FIRSVLPEGPVGHSGKLFSGDELLEVNGINLLGENHQDVVNILKELPIDVTMVCCRRTVPPIALSEMDSLDINDLELTEKPHIDLGEFIGSSETEDPMLAMSDVDQNAEEIQTPLAMWEAGGQSIELEKGSRGLGFSILDYQDPIDPANTVIVIRSLVPGGIAEKDGRLFPGDRLMFVNDINLE 753          
BLAST of Glutamate receptor-interacting protein 2 vs. Ensembl Mouse
Match: Mpdz (multiple PDZ domain protein [Source:MGI Symbol;Acc:MGI:1343489])

HSP 1 Score: 103.605 bits (257), Expect = 1.446e-21
Identity = 80/279 (28.67%), Postives = 135/279 (48.39%), Query Frame = 1
Query:  253 AIQENWIRILGIDYEIISMNLCK--RNQSLGVALEGRNEIARNTQEVVQHHFFKVILPSQCVGETGKFMVKDEILEVNGLKVVGLPTKEVLNTLRKVTNYFQIVVARSIIHNYDLASDYGGSEDNINSPISFYDMDDDESSQNGTLRSNVSNYSTTSRDFGSSVSFGGLIDGQHETVNDYLRNMVGWR-GPIVIELRKQNSPFGLALEEIRNPLHNA-MIIVFKYVVPEMTAGKDGRLHAGDRLLQVNGKSVEGVDFRQVCKWIKSSPRGRLVLYICKP 1077
            A+   W RI+GI+YEI+  ++ K   N  LG++LE            V HHF + +LP   VG +GK    DE+LEVNG+ ++G   ++V+N L+++     +V  R  +    L            S +   D++D E ++   +       S+ + D   ++S    +D   E +   L     W  G   IEL K +   G ++ + ++P+  A  +IV + +VP   A KDGRL  GDRL+ VN  ++E     +  + +K +P G + + + KP
Sbjct:  529 ALLTKWQRIMGINYEIVVAHVSKFSENSGLGISLEA----------TVGHHFIRSVLPEGPVGHSGKLFSGDELLEVNGINLLGENHQDVVNILKELPIDVTMVCCRRTVPPIAL------------SEMDSLDINDLELTEKPHIDLGEFIGSSETEDPMLAMSD---VDQNAEEIQTPLAM---WEAGGQSIELEKGSRGLGFSILDYQDPIDPANTVIVIRSLVPGGIAEKDGRLFPGDRLMFVNDINLENSTLEEAVEALKGAPSGMVRIGVAKP 779          

HSP 2 Score: 86.2705 bits (212), Expect = 2.788e-16
Identity = 182/825 (22.06%), Postives = 318/825 (38.55%), Query Frame = 1
Query:  325 NQSLGVAL-EGRNEIAR-NTQEVVQHHFFKVILPSQCVGETGKFMVKDEILEVNGLKVVGLPTKEVLNTLRKVTN----YFQIVVAR-------SIIHNY----------------DLASDYGGSED----------NI--NSPISFYDMDDDESSQNGTLRSNVSNYSTTSRDFGSSVS-----FGGLIDGQHETVNDYLRNMVGWRGPIVIELRKQNSPFGLALEEIRNPLHNAMIIVFKYVVPEMTAGKDGRLHAGDRLLQVNGKSVEGVDFRQVCKWIKSSPRGRLVLYICKPHFETINYDPSSPA-NDDKYYFNTIRDMDKLPKLSEETDGECLRLPAVPEYMETHITLKRTENKLGIFLDIVDEGKNGARIKKMT-HGIAKNDGRLHEGDFVTKVNE-----------ISLKVDNKSKLDLCLKQISADKRNYNISYITAEDVRLHNGKYGTVSSA-TNRLPQSSQIYPE--FLSIKVTEPLNEINSDKTRNHKFSFETFDIIIKNDKQTGLGLVLSPSLKDPNRYISITDIHDNSLCGKSGLLKINDEILKVNNVDFENISINELGHFLKRAHKTENELRFQVRRLTCSENVPVDPLIEKLTWFPDIYHRVLKRGPN-GFGFSLLELDSNNGVVVDKVDLNKVCD----LKPGERFVMINKCTVITCSKPNVVQMVKNSTRNLEL----IIETPKYREFR----------------------------------------------VKISKDSSMSLGLNIAGGRDTRFP-IPV-IESLVPNRTSKFSEELFTLDLITEVDGTNVTKQNHAEIIQIFR 2442
            ++SLG+++  GR   +R +  EV++  F K +L     G+ G     D I+EV+G+ +     ++ +  +RK  N      Q ++ R       S+ H+                  L +D   S+           N+  +SP  F +M  D +  + T    VS       +FG S       +G L    H                 VIEL K  S  GL+L   ++    ++ IV   + P   AG+DGRL   D LL++NG+ + G   +     IK +P    +++I   + + +N     P    D     +    +K  +    T      L ++ +  +  + L + +  LGI +   ++  NG  I+ +T HG A  DGRL  GD +  V++           ISL    K+ + L ++  +        S +T    R  N +   V +     +P +S+      F S   T P+  I   +T        T +I   +  QTGLGL +          I I ++++     K G L   D+IL+VN +D    + +E  + L+   +T   +R  + R         D    K     D +   L++ P  G G S++   ++ GV V  +    + D    L  G++ +M+N   V   ++  V  ++K S   + L    +   P + E R                                              V+I K  + SLGL+IAGG  +    +P+ I  + PN  +  +++L   D I  + GT+     H + + + +
Sbjct: 1148 SKSLGISIVGGRGMGSRLSNGEVMRGIFIKHVLEDSPAGKNGTLKPGDRIIEVDGMDLRDASHEQAVEAIRKAGNPVVFMVQSIINRPRKSPLPSLPHSLYPKYSFSSTNPFADSLQLTTDQAPSQSESETEKPALCNVPPSSPSVFSEMGSDCAQPSATA---VSEDEDKEDEFGYSWKNIQERYGSLTGQLH-----------------VIELEKGQSGLGLSLAGNKDRTRMSVFIV--GIDPTGAAGRDGRLQIADELLEINGQILYGRSHQNASSIIKCAPSKVKIIFI--RNADAVNQMAVCPGIAADSPSSTSDSPQNKEVEPCSTTSASAADLSSLTDVYQ--LELPKDQGGLGIAI-CEEDTINGVMIESLTEHGGAAKDGRLKPGDHILAVDDEVVAGCPVEKFISLLKTAKATVKLTVRAENPACPAVPSSAVTVSGERKDNSQTPAVPAPDLEPIPSTSRSSTPAVFASDPATCPI--IPGCET--------TIEI---SKGQTGLGLSIVGGSDTLLGAIIIHEVYEEGAACKDGRLWAGDQILEVNGIDLRKATHDEAINVLR---QTPQRVRLTLYR---------DEAPYKEEDVCDTFTIELQKRPGKGLGLSIVGKRNDTGVFVSDIVKGGIADADGRLMQGDQILMVNGEDVRHATQEAVAALLKCSLGAVTLEVGRVKAAPFHSERRPSQSSQVSESSLSSFTPPLSGINTSESLESNSKKNALASEIQGLRTVEIKKGPADSLGLSIAGGVGSPLGDVPIFIAMMHPNGVAAQTQKLRVGDRIVTICGTSTDGMTHTQAVNLMK 1920          

HSP 3 Score: 61.2326 bits (147), Expect = 9.750e-9
Identity = 114/494 (23.08%), Postives = 198/494 (40.08%), Query Frame = 1
Query:  823 IELRKQNSPFGLALEEIRNPLHNAMIIVFKYVVPEMTAGKDGRLHAGDRLLQVNGKSVEGVDFRQVCKWIKSSP-RGRLVLYICKPHFETINYDPSSPANDDKYYFNTIRDMDKLPKLSEETDGECLRLPAVPEYMETHITLKRTENKLGIFLDIVDEGKNGARIKKMTHGIAKNDGRLHEGDFVTKVNEISLKVDNKSKLDLCLKQISADKRNYNISYITAEDVRLHNGKYGTVSSATNRLPQSSQIYPEFLSIKVTEPLNEINSDKT--RNHKFSFETFDII------IKNDKQTGLGLVLSPSLKDP--NRYISITDIHDNSLCGKSGLLKINDEILKVNNVDFENISINELGHFLKRAH---KTENELRFQVRRLTCSENVPVDPLIE-----KLTWFPDIYHR------VLKRGPNGFGFSLL-ELDSNNG-------VVVDKVDLNKVCDLKPGERFVMINKCTVITCSKPNVVQMVKNSTRNLELII 2205
            IE+ K  +  GL++    + L  A+II    V  E  A KDGRL AGD++L+VNG  +      +    ++ +P R RL LY           D +    +D     TI ++ K P       G+ L L          I  KR  N  G+F+  + +G           GIA  DGRL +GD +  VN   ++   +  +   LK         ++  +T E  R+    +      + R P  S    E      T PL+ IN+ ++   N K +    +I       IK      LGL ++  +  P  +  I I  +H N +  ++  L++ D I+ +     + ++  +  + +K A    + +      V  +T  +    +P +        + FPD           L RGP+G GFS++    S +G        V  K    +   LK G++ + +N  ++   +    V ++K +   + L++
Sbjct: 1616 IEISKGQTGLGLSIVGGSDTLLGAIII--HEVYEEGAACKDGRLWAGDQILEVNGIDLRKATHDEAINVLRQTPQRVRLTLY----------RDEAPYKEEDVCDTFTI-ELQKRP-------GKGLGL---------SIVGKR--NDTGVFVSDIVKG-----------GIADADGRLMQGDQILMVNGEDVRHATQEAVAALLK--------CSLGAVTLEVGRVKAAPF-----HSERRPSQSSQVSESSLSSFTPPLSGINTSESLESNSKKNALASEIQGLRTVEIKKGPADSLGLSIAGGVGSPLGDVPIFIAMMHPNGVAAQTQKLRVGDRIVTICGTSTDGMTHTQAVNLMKNASGSIEVQVVAGGDVSVVTGHQQELANPCLAFTGLTSSSIFPDDLGPPQSKTITLDRGPDGLGFSIVGGYGSPHGDLPIYVKTVFAKGAAAEDGRLKRGDQIIAVNGQSLEGVTHEEAVAILKRTKGTVTLMV 2054          

HSP 4 Score: 61.2326 bits (147), Expect = 1.224e-8
Identity = 91/401 (22.69%), Postives = 163/401 (40.65%), Query Frame = 1
Query:  289 DYEIISMNLCKRNQSLGVALEGRNEIARNTQEVVQHHFFKVILPSQCVGETGKFMVKDEILEVNGLKVVGLPTKEVLNTLRKVTNYFQIVVARSIIHNYDLASDYGGSEDNINSPISFYDMDDDESSQNGTLRSNVSNYSTTSRDFGSSVSFGGLIDGQHETVNDYLRN---MVGWR-------GPIVIELRK--QNSPFGLALEEIRNPLHNAMIIVFKYVVPEMTAGKDGRLHAGDRLLQVNGKSVEGVDFRQVCKWIKSSPRG-------RLVLYICKPHFETINYD----PSSPANDDKYYFNTIRDMDKLPKLSE-ETDGECLRLP-AVPEYMETHITLKRTENKLGI----FLDIVDEGKNGARIKKMT-HGIAKNDGRLHEGDFVTKVNEISLK 1401
            + E   + L K  Q LG+ + G   I     E     F K I  S  V   G+  + D+I+ V+G  + G   ++ +  LR      ++ + R         +  G +  +++ P    + D++  S    L+ N S        F        L+  + E   D  +    +  W+         +V  + K  +NS  G++LE      H+      + V+PE   G  G+L +GD LL+VNG ++ G + + V   +K  P         R V  I     ++++ +       P  D   +  +    D +  +S+ + + E ++ P A+ E     I L++    LG     + D +D       I+ +   GIA+ DGRL  GD +  VN+I+L+
Sbjct:  373 ESETFDVELTKNVQGLGITIAGY--IGDKKLEP-SGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVRLTLMRKGASQEAELTSRGDTAKDVDLPAENCEKDEESLS----LKRNTSILPIEEEGFP-------LLSAELEEAEDVQQEAALLTKWQRIMGINYEIVVAHVSKFSENSGLGISLEATVG--HH----FIRSVLPEGPVGHSGKLFSGDELLEVNGINLLGENHQDVVNILKELPIDVTMVCCRRTVPPIALSEMDSLDINDLELTEKPHIDLGEFIGSSETEDPMLAMSDVDQNAEEIQTPLAMWEAGGQSIELEKGSRGLGFSILDYQDPIDPANTVIVIRSLVPGGIAEKDGRLFPGDRLMFVNDINLE 753          
BLAST of Glutamate receptor-interacting protein 2 vs. Ensembl Mouse
Match: Mpdz (multiple PDZ domain protein [Source:MGI Symbol;Acc:MGI:1343489])

HSP 1 Score: 103.605 bits (257), Expect = 1.461e-21
Identity = 80/279 (28.67%), Postives = 135/279 (48.39%), Query Frame = 1
Query:  253 AIQENWIRILGIDYEIISMNLCK--RNQSLGVALEGRNEIARNTQEVVQHHFFKVILPSQCVGETGKFMVKDEILEVNGLKVVGLPTKEVLNTLRKVTNYFQIVVARSIIHNYDLASDYGGSEDNINSPISFYDMDDDESSQNGTLRSNVSNYSTTSRDFGSSVSFGGLIDGQHETVNDYLRNMVGWR-GPIVIELRKQNSPFGLALEEIRNPLHNA-MIIVFKYVVPEMTAGKDGRLHAGDRLLQVNGKSVEGVDFRQVCKWIKSSPRGRLVLYICKP 1077
            A+   W RI+GI+YEI+  ++ K   N  LG++LE            V HHF + +LP   VG +GK    DE+LEVNG+ ++G   ++V+N L+++     +V  R  +    L            S +   D++D E ++   +       S+ + D   ++S    +D   E +   L     W  G   IEL K +   G ++ + ++P+  A  +IV + +VP   A KDGRL  GDRL+ VN  ++E     +  + +K +P G + + + KP
Sbjct:  529 ALLTKWQRIMGINYEIVVAHVSKFSENSGLGISLEA----------TVGHHFIRSVLPEGPVGHSGKLFSGDELLEVNGINLLGENHQDVVNILKELPIDVTMVCCRRTVPPIAL------------SEMDSLDINDLELTEKPHIDLGEFIGSSETEDPMLAMSD---VDQNAEEIQTPLAM---WEAGGQSIELEKGSRGLGFSILDYQDPIDPANTVIVIRSLVPGGIAEKDGRLFPGDRLMFVNDINLENSTLEEAVEALKGAPSGMVRIGVAKP 779          

HSP 2 Score: 86.2705 bits (212), Expect = 2.912e-16
Identity = 182/825 (22.06%), Postives = 318/825 (38.55%), Query Frame = 1
Query:  325 NQSLGVAL-EGRNEIAR-NTQEVVQHHFFKVILPSQCVGETGKFMVKDEILEVNGLKVVGLPTKEVLNTLRKVTN----YFQIVVAR-------SIIHNY----------------DLASDYGGSED----------NI--NSPISFYDMDDDESSQNGTLRSNVSNYSTTSRDFGSSVS-----FGGLIDGQHETVNDYLRNMVGWRGPIVIELRKQNSPFGLALEEIRNPLHNAMIIVFKYVVPEMTAGKDGRLHAGDRLLQVNGKSVEGVDFRQVCKWIKSSPRGRLVLYICKPHFETINYDPSSPA-NDDKYYFNTIRDMDKLPKLSEETDGECLRLPAVPEYMETHITLKRTENKLGIFLDIVDEGKNGARIKKMT-HGIAKNDGRLHEGDFVTKVNE-----------ISLKVDNKSKLDLCLKQISADKRNYNISYITAEDVRLHNGKYGTVSSA-TNRLPQSSQIYPE--FLSIKVTEPLNEINSDKTRNHKFSFETFDIIIKNDKQTGLGLVLSPSLKDPNRYISITDIHDNSLCGKSGLLKINDEILKVNNVDFENISINELGHFLKRAHKTENELRFQVRRLTCSENVPVDPLIEKLTWFPDIYHRVLKRGPN-GFGFSLLELDSNNGVVVDKVDLNKVCD----LKPGERFVMINKCTVITCSKPNVVQMVKNSTRNLEL----IIETPKYREFR----------------------------------------------VKISKDSSMSLGLNIAGGRDTRFP-IPV-IESLVPNRTSKFSEELFTLDLITEVDGTNVTKQNHAEIIQIFR 2442
            ++SLG+++  GR   +R +  EV++  F K +L     G+ G     D I+EV+G+ +     ++ +  +RK  N      Q ++ R       S+ H+                  L +D   S+           N+  +SP  F +M  D +  + T    VS       +FG S       +G L    H                 VIEL K  S  GL+L   ++    ++ IV   + P   AG+DGRL   D LL++NG+ + G   +     IK +P    +++I   + + +N     P    D     +    +K  +    T      L ++ +  +  + L + +  LGI +   ++  NG  I+ +T HG A  DGRL  GD +  V++           ISL    K+ + L ++  +        S +T    R  N +   V +     +P +S+      F S   T P+  I   +T        T +I   +  QTGLGL +          I I ++++     K G L   D+IL+VN +D    + +E  + L+   +T   +R  + R         D    K     D +   L++ P  G G S++   ++ GV V  +    + D    L  G++ +M+N   V   ++  V  ++K S   + L    +   P + E R                                              V+I K  + SLGL+IAGG  +    +P+ I  + PN  +  +++L   D I  + GT+     H + + + +
Sbjct: 1161 SKSLGISIVGGRGMGSRLSNGEVMRGIFIKHVLEDSPAGKNGTLKPGDRIIEVDGMDLRDASHEQAVEAIRKAGNPVVFMVQSIINRPRKSPLPSLPHSLYPKYSFSSTNPFADSLQLTTDQAPSQSESETEKPALCNVPPSSPSVFSEMGSDCAQPSATA---VSEDEDKEDEFGYSWKNIQERYGSLTGQLH-----------------VIELEKGQSGLGLSLAGNKDRTRMSVFIV--GIDPTGAAGRDGRLQIADELLEINGQILYGRSHQNASSIIKCAPSKVKIIFI--RNADAVNQMAVCPGIAADSPSSTSDSPQNKEVEPCSTTSASAADLSSLTDVYQ--LELPKDQGGLGIAI-CEEDTINGVMIESLTEHGGAAKDGRLKPGDHILAVDDEVVAGCPVEKFISLLKTAKATVKLTVRAENPACPAVPSSAVTVSGERKDNSQTPAVPAPDLEPIPSTSRSSTPAVFASDPATCPI--IPGCET--------TIEI---SKGQTGLGLSIVGGSDTLLGAIIIHEVYEEGAACKDGRLWAGDQILEVNGIDLRKATHDEAINVLR---QTPQRVRLTLYR---------DEAPYKEEDVCDTFTIELQKRPGKGLGLSIVGKRNDTGVFVSDIVKGGIADADGRLMQGDQILMVNGEDVRHATQEAVAALLKCSLGAVTLEVGRVKAAPFHSERRPSQSSQVSESSLSSFTPPLSGINTSESLESNSKKNALASEIQGLRTVEIKKGPADSLGLSIAGGVGSPLGDVPIFIAMMHPNGVAAQTQKLRVGDRIVTICGTSTDGMTHTQAVNLMK 1933          

HSP 3 Score: 61.2326 bits (147), Expect = 1.098e-8
Identity = 114/494 (23.08%), Postives = 198/494 (40.08%), Query Frame = 1
Query:  823 IELRKQNSPFGLALEEIRNPLHNAMIIVFKYVVPEMTAGKDGRLHAGDRLLQVNGKSVEGVDFRQVCKWIKSSP-RGRLVLYICKPHFETINYDPSSPANDDKYYFNTIRDMDKLPKLSEETDGECLRLPAVPEYMETHITLKRTENKLGIFLDIVDEGKNGARIKKMTHGIAKNDGRLHEGDFVTKVNEISLKVDNKSKLDLCLKQISADKRNYNISYITAEDVRLHNGKYGTVSSATNRLPQSSQIYPEFLSIKVTEPLNEINSDKT--RNHKFSFETFDII------IKNDKQTGLGLVLSPSLKDP--NRYISITDIHDNSLCGKSGLLKINDEILKVNNVDFENISINELGHFLKRAH---KTENELRFQVRRLTCSENVPVDPLIE-----KLTWFPDIYHR------VLKRGPNGFGFSLL-ELDSNNG-------VVVDKVDLNKVCDLKPGERFVMINKCTVITCSKPNVVQMVKNSTRNLELII 2205
            IE+ K  +  GL++    + L  A+II    V  E  A KDGRL AGD++L+VNG  +      +    ++ +P R RL LY           D +    +D     TI ++ K P       G+ L L          I  KR  N  G+F+  + +G           GIA  DGRL +GD +  VN   ++   +  +   LK         ++  +T E  R+    +      + R P  S    E      T PL+ IN+ ++   N K +    +I       IK      LGL ++  +  P  +  I I  +H N +  ++  L++ D I+ +     + ++  +  + +K A    + +      V  +T  +    +P +        + FPD           L RGP+G GFS++    S +G        V  K    +   LK G++ + +N  ++   +    V ++K +   + L++
Sbjct: 1629 IEISKGQTGLGLSIVGGSDTLLGAIII--HEVYEEGAACKDGRLWAGDQILEVNGIDLRKATHDEAINVLRQTPQRVRLTLY----------RDEAPYKEEDVCDTFTI-ELQKRP-------GKGLGL---------SIVGKR--NDTGVFVSDIVKG-----------GIADADGRLMQGDQILMVNGEDVRHATQEAVAALLK--------CSLGAVTLEVGRVKAAPF-----HSERRPSQSSQVSESSLSSFTPPLSGINTSESLESNSKKNALASEIQGLRTVEIKKGPADSLGLSIAGGVGSPLGDVPIFIAMMHPNGVAAQTQKLRVGDRIVTICGTSTDGMTHTQAVNLMKNASGSIEVQVVAGGDVSVVTGHQQELANPCLAFTGLTSSSIFPDDLGPPQSKTITLDRGPDGLGFSIVGGYGSPHGDLPIYVKTVFAKGAAAEDGRLKRGDQIIAVNGQSLEGVTHEEAVAILKRTKGTVTLMV 2067          

HSP 4 Score: 61.2326 bits (147), Expect = 1.225e-8
Identity = 91/401 (22.69%), Postives = 163/401 (40.65%), Query Frame = 1
Query:  289 DYEIISMNLCKRNQSLGVALEGRNEIARNTQEVVQHHFFKVILPSQCVGETGKFMVKDEILEVNGLKVVGLPTKEVLNTLRKVTNYFQIVVARSIIHNYDLASDYGGSEDNINSPISFYDMDDDESSQNGTLRSNVSNYSTTSRDFGSSVSFGGLIDGQHETVNDYLRN---MVGWR-------GPIVIELRK--QNSPFGLALEEIRNPLHNAMIIVFKYVVPEMTAGKDGRLHAGDRLLQVNGKSVEGVDFRQVCKWIKSSPRG-------RLVLYICKPHFETINYD----PSSPANDDKYYFNTIRDMDKLPKLSE-ETDGECLRLP-AVPEYMETHITLKRTENKLGI----FLDIVDEGKNGARIKKMT-HGIAKNDGRLHEGDFVTKVNEISLK 1401
            + E   + L K  Q LG+ + G   I     E     F K I  S  V   G+  + D+I+ V+G  + G   ++ +  LR      ++ + R         +  G +  +++ P    + D++  S    L+ N S        F        L+  + E   D  +    +  W+         +V  + K  +NS  G++LE      H+      + V+PE   G  G+L +GD LL+VNG ++ G + + V   +K  P         R V  I     ++++ +       P  D   +  +    D +  +S+ + + E ++ P A+ E     I L++    LG     + D +D       I+ +   GIA+ DGRL  GD +  VN+I+L+
Sbjct:  373 ESETFDVELTKNVQGLGITIAGY--IGDKKLEP-SGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVRLTLMRKGASQEAELTSRGDTAKDVDLPAENCEKDEESLS----LKRNTSILPIEEEGFP-------LLSAELEEAEDVQQEAALLTKWQRIMGINYEIVVAHVSKFSENSGLGISLEATVG--HH----FIRSVLPEGPVGHSGKLFSGDELLEVNGINLLGENHQDVVNILKELPIDVTMVCCRRTVPPIALSEMDSLDINDLELTEKPHIDLGEFIGSSETEDPMLAMSDVDQNAEEIQTPLAMWEAGGQSIELEKGSRGLGFSILDYQDPIDPANTVIVIRSLVPGGIAEKDGRLFPGDRLMFVNDINLE 753          
BLAST of Glutamate receptor-interacting protein 2 vs. Ensembl Mouse
Match: Sntb2 (syntrophin, basic 2 [Source:MGI Symbol;Acc:MGI:101771])

HSP 1 Score: 56.9954 bits (136), Expect = 1.197e-7
Identity = 31/93 (33.33%), Postives = 52/93 (55.91%), Query Frame = 1
Query: 2230 RVKISKDSSMSLGLNIAGGRDTRFPIPVIESLVPNRTSKFSEELFTLDLITEVDGTNVTKQNHAEIIQIFRSTGRETTF--KILRKI-PYIKR 2499
            RV++ K  +  LG++I GGR+ R PI +I  + P   +  S  L   D I  V+GT++ +  H + +Q  +  G+E     K +R++ PYIK+
Sbjct:   95 RVRVVKQEAGGLGISIKGGRENRMPI-LISKIFPGLAADQSRALRLGDAILSVNGTDLRQATHDQAVQALKRAGKEVLLEVKFIREVTPYIKK 186          
BLAST of Glutamate receptor-interacting protein 2 vs. UniProt/SwissProt
Match: sp|O55164|MPDZ_RAT (Multiple PDZ domain protein OS=Rattus norvegicus OX=10116 GN=Mpdz PE=1 SV=1)

HSP 1 Score: 104.375 bits (259), Expect = 6.092e-21
Identity = 80/279 (28.67%), Postives = 134/279 (48.03%), Query Frame = 1
Query:  253 AIQENWIRILGIDYEIISMNLCK--RNQSLGVALEGRNEIARNTQEVVQHHFFKVILPSQCVGETGKFMVKDEILEVNGLKVVGLPTKEVLNTLRKVTNYFQIVVARSIIHNYDLASDYGGSEDNINSPISFYDMDDDESSQNGTLRSNVSNYSTTSRDFGSSVSFGGLIDGQHETVNDYLRNMVGWRGPI-VIELRKQNSPFGLALEEIRNPLHNA-MIIVFKYVVPEMTAGKDGRLHAGDRLLQVNGKSVEGVDFRQVCKWIKSSPRGRLVLYICKP 1077
            A+   W RI+GI+YEI+  ++ K   N  LG++LE            V HHF + +LP   VG +GK    DE+LEVNG+ ++G   ++V+N L+++     +V  R  +    L            S +   D+ D E ++   +       S+ + D   ++S    +D   E +   L     W   I  IEL K +   G ++ + ++P+  A  +IV + +VP   A KDGRL  GDRL+ VN  ++E     +  + +K +P G + + + KP
Sbjct:  528 ALLTKWQRIMGINYEIVVAHVSKFSENSGLGISLEA----------TVGHHFIRSVLPEGPVGHSGKLFSGDELLEVNGINLLGENHQDVVNILKELPIDVTMVCCRRTVPPTAL------------SEVDSLDIHDLELTEKPHIDLGEFIGSSETEDPMLAMSD---VDQNAEEIQTPLAM---WEAGIQAIELEKGSRGLGFSILDYQDPIDPANTVIVIRSLVPGGIAEKDGRLFPGDRLMFVNDINLENSTLEEAVEALKGAPSGMVRIGVAKP 778          

HSP 2 Score: 64.3142 bits (155), Expect = 7.942e-9
Identity = 95/403 (23.57%), Postives = 161/403 (39.95%), Query Frame = 1
Query:  244 SSKAIQENWIRILGIDYEIISMNLCKRNQSLGVALEGRNEIARNTQEVVQHHFFKVILPSQCVGETGKFMVKDEILEVNGLKVVGLPTKEVLNTLRKVTNYFQIVVARSIIHNYDLASDYGGSEDNINSPISFYDMDDDESSQNGTLRSNVSNYSTTSRDFGSSVSFGGLIDGQHETVNDYLRNMVGWRGPIVIELRKQNSPFGLALEEIRNPLHNAMIIVFKYVVPEMTAGKDGRLHAGDRLLQVNGKSVEGVDFRQVCKWIKSSPRG-RLVLYICKPHFETI--------------NYDPSSPANDDKYYFNTIRDMDKLPKLSEETDGECLRLPAVPEYMETHITLKRTENKLGIFLDIVDEGKNGARI--KKMTHGIAKNDGRLHEGDFVTKVNEISLK 1401
            S K IQE +  + G   ++  + L K +  LG++L G  +  R +       F   I P+   G  G+  + DE+LE+NG  + G   +   + ++   +  +I+  R+      +A   G + D + S          ES QN  +  ++    TTS    S+V    L +  H                  +EL K     G+A+ E  + L+    +  K +     A KDGRL  GDR+L V+ + V G    +    +K++    +L +    P  + +              +  P+ PA D +   +T R     P +       C  +P      ET I + + +  LG+ +    +   GA I  +    G A  DGRL  GD + +VN I L+
Sbjct: 1320 SWKNIQERYGTLTG---QLHMIELEKGHSGLGLSLAGNKDRTRMSV------FIVGIDPTGAAGRDGRLQIADELLEINGQILYGRSHQNASSIIKCAPSKVKIIFIRNADAVNQMAVCPGSAADPLPS--------TSESPQNKEVEPSI----TTS---ASAVDLSSLTNVYH------------------LELPKDQGGLGIAICE-EDTLNG---VTIKSLTERGGAAKDGRLKPGDRILAVDDELVAGCPIEKFISLLKTAKTTVKLTVGAENPGCQAVPSAAVTASGERKDSSQTPAVPAPDLEPIPSTSR--SSTPAIFASDPATCPIIPGC----ETTIEISKGQTGLGLSIVGGSDTLLGAIIIHEVYEEGAACKDGRLWAGDQILEVNGIDLR 1670          
BLAST of Glutamate receptor-interacting protein 2 vs. UniProt/SwissProt
Match: sp|O75970|MPDZ_HUMAN (Multiple PDZ domain protein OS=Homo sapiens OX=9606 GN=MPDZ PE=1 SV=2)

HSP 1 Score: 103.99 bits (258), Expect = 8.206e-21
Identity = 75/279 (26.88%), Postives = 133/279 (47.67%), Query Frame = 1
Query:  253 AIQENWIRILGIDYEIISMNLCK--RNQSLGVALEGRNEIARNTQEVVQHHFFKVILPSQCVGETGKFMVKDEILEVNGLKVVGLPTKEVLNTLRKVTNYFQIVVARSIIHNYDLASDYGGSEDNINSPISFYDMDDDESSQNGTLRSNVSNYSTTSRDFGSSVSFGGLIDGQHETVNDYLRNMVGWRGPIV-IELRKQNSPFGLALEEIRNPLHNA-MIIVFKYVVPEMTAGKDGRLHAGDRLLQVNGKSVEGVDFRQVCKWIKSSPRGRLVLYICKP 1077
            A+   W RI+GI+YEI+  ++ K   N  LG++LE            V HHF + +LP   VG +GK    DE+LEVNG+ ++G   ++V+N L+++     +V  R  +                 S +   D+ D E ++   +       S+ + D   +++  G      ++  +    +  W   I  IEL K +   G ++ + ++P+  A  +I+ + +VP   A KDGRL  GDRL+ VN  ++E     +  + +K +P G + + + KP
Sbjct:  536 ALLTKWQRIMGINYEIVVAHVSKFSENSGLGISLEA----------TVGHHFIRSVLPEGPVGHSGKLFSGDELLEVNGITLLGENHQDVVNILKELPIEVTMVCCRRTV------------PPTTQSELDSLDLCDIELTEKPHVDLGEFIGSSETEDPVLAMTDAG------QSTEEVQAPLAMWEAGIQHIELEKGSKGLGFSILDYQDPIDPASTVIIIRSLVPGGIAEKDGRLLPGDRLMFVNDVNLENSSLEEAVEALKGAPSGTVRIGVAKP 786          

HSP 2 Score: 88.1965 bits (217), Expect = 5.145e-16
Identity = 182/823 (22.11%), Postives = 324/823 (39.37%), Query Frame = 1
Query:  325 NQSLGVAL-EGRNEIAR-NTQEVVQHHFFKVILPSQCVGETGKFMVKDEILEVNGLKVVGLPTKEVLNTLRKVTN----YFQIVVAR-------SIIHN----YDLASDYGGSED---NINSPISFYDMDDDESSQNGTLRSNVSNYSTTSRDFGSSVSFGGLIDGQHETVNDY-LRNMVGWRGPI-----VIELRKQNSPFGLALEEIRNPLHNAMIIVFKYVVPEMTAGKDGRLHAGDRLLQVNGKSVEGVDFRQVCKWIKSSPRGRLVLYICKPHFETINYDPSSPANDDKYYFNTIRDMDKLPKLSE-----ETDGECLRLPAVPEYME----THITLKRTENKLGIFLDIVDEGKNGARIKKMT-HGIAKNDGRLHEGDFVTKVNE-----------ISLKVDNKSKLDLCLKQISADKRNYNISYITAEDVRLHNGKYGTVSSATNRLPQSSQIYPEFL--SIKVTEPLNEINSDKTRNHKFSFETFDIIIKNDKQTGLGLVLSPSLKDPNRYISITDIHDNSLCGKSGLLKINDEILKVNNVDFENISINELGHFLKRAHKTENELRFQVRRLTCSENVPVDPLIEKLTWFPDIYHRVLKRGPN-GFGFSLLELDSNNGVVVDKVDLNKVCD----LKPGERFVMINKCTVITCSKPNVVQMVKNS--TRNLEL--IIETPKYREFR----------------------------------------------VKISKDSSMSLGLNIAGGRDTRFP-IPV-IESLVPNRTSKFSEELFTLDLITEVDGTNVTKQNHAEIIQIFRSTGRETTFKIL 2475
            ++SLG+++  GR   +R +  EV++  F K +L     G+ G     D I+EV+G+ +     ++ +  +RK  N      Q ++ R       S++HN    Y+ +S    ++    N +   S  + + +++          S ++    D   S +     D   E    Y  +N+    G +     +IEL K +S  GL+L    N   + M +    + P   AGKDGRL   D LL++NG+ + G   +     IK +P    +++I   + + +N     P N           ++ LP  SE     ET+       A  +        H+ L + +  LGI +   D   +G  IK +T HG+A  DGRL  GD +  V++           ISL    K  + L +   + D +    +   A   + +       SS +  +PQS    PE +  + + + P    +   T       ET   I K   +TGLGL +          I I ++++     K G L   D+IL+VN +D    + +E  + L+   +T   +R  + R         D    K     D     L++ P  G G S++   ++ GV V  +    + D    L  G++ +M+N   V   ++  V  ++K S  T  LE+  I   P + E R                                              V++ K  + SLG++IAGG  +    +P+ I  + P   +  +++L   D I  + GT+     H + + + ++       +++
Sbjct: 1159 SKSLGISIVGGRGMGSRLSNGEVMRGIFIKHVLEDSPAGKNGTLKPGDRIVEVDGMDLRDASHEQAVEAIRKAGNPVVFMVQSIINRPRKSPLPSLLHNLYPKYNFSSTNPFADSLQINADKAPSQSESEPEKAPLCSVPPPPPSAFAEMGSDHTQSSASKISQDVDKEDEFGYSWKNIRERYGTLTGELHMIELEKGHSGLGLSLA--GNKDRSRMSVFIVGIDPNGAAGKDGRLQIADELLEINGQILYGRSHQNASSIIKCAPSKVKIIFI--RNKDAVNQMAVCPGN----------AVEPLPSNSENLQNKETEPTVTTSDAAVDLSSFKNVQHLELPKDQGGLGIAISEEDT-LSGVIIKSLTEHGVAATDGRLKVGDQILAVDDEIVVGYPIEKFISLLKTAKMTVKLTIHAENPDSQAVPSAAGAASGEKKN-------SSQSLMVPQSGSPEPESIRNTSRSSTPAIFASDPATCPIIPGCETTIEISKG--RTGLGLSIVGGSDTLLGAIIIHEVYEEGAACKDGRLWAGDQILEVNGIDLRKATHDEAINVLR---QTPQRVRLTLYR---------DEAPYKEEEVCDTLTIELQKKPGKGLGLSIVGKRNDTGVFVSDIVKGGIADADGRLMQGDQILMVNGEDVRNATQEAVAALLKCSLGTVTLEVGRIKAGPFHSERRPSQSSQVSEGSLSSFTFPLSGSSTSESLESSSKKNALASEIQGLRTVEMKKGPTDSLGISIAGGVGSPLGDVPIFIAMMHPTGVAAQTQKLRVGDRIVTICGTSTEGMTHTQAVNLLKNASGSIEMQVV 1945          

HSP 3 Score: 64.6994 bits (156), Expect = 6.660e-9
Identity = 138/660 (20.91%), Postives = 255/660 (38.64%), Query Frame = 1
Query:  349 EGRNEIARNTQEVVQHHFFKVILPSQCVGETGKFMVKDEILEVNGLKVVGLPTKEVLNTLRKVTNYFQIVVARSIIHNYDLASDYGG-SEDNINSPISFYDMDDDESSQNGTLRSNVSNYSTTSRDFGSSVSFGGLIDGQHETVNDYLRNMVGWRGPIVIELRKQNSPFGLALEEIRNPLHNAMIIVFKYVVPEMTAGKDGRLHAGDRLLQVNGKSVEGVDFRQVCKWIKSSP-RGRLVLYICKPHFETINYDPSSPANDDKYYFNTIRDMDKLPKLSEETDGECLRLPAVPEYMETHITLKRTENKLGIFLDIVDEGKNGARIKKMTHGIAKNDGRLHEGDFVTKVNEISLKVDNKSKLDLCLKQISADKRNYNISYITAEDVRLHNGKYGTVSSATNRLPQSSQI---------YPEFLSIKVTEPLNEINSDKTRNHKFSFETFDIIIKNDKQTGLGLVLSPSLKDP--NRYISITDIHDNSLCGKSGLLKINDEILKVNNVDFENISINELGHFLKRAHKTENELRFQVRRLTCSENVPV------DPLIEKLTWF--------------PDIYHRVLKRGPNGFGFSLL-ELDSNNG-------VVVDKVDLNKVCDLKPGERFVMINKCTVITCSKPNVVQMVKNSTRNLELII 2205
            +G   IA + ++ +     K +         G+  V D+IL V+   VVG P ++ ++ L+      ++ +      +  + S  G  S +  NS  S   +    S +  ++R+  ++ S+T   F S  +   +I G   T                IE+ K  +  GL++    + L  A+II    V  E  A KDGRL AGD++L+VNG  +      +    ++ +P R RL LY              +P  +++       ++ K P       G+ L L          I  KR  N  G+F+  + +G           GIA  DGRL +GD +  VN   ++   +  +   LK         ++  +T E  R+  G +     +  R  QSSQ+         +P   S       +    +   +      T +  +K      LG+ ++  +  P  +  I I  +H   +  ++  L++ D I+ +     E ++  +  + LK A  +   +  QV       +V V      +P    L++               P      L+RGP+G GFS++    S +G        V  K   ++   LK G++ + +N  ++   +    V ++K +   + L++
Sbjct: 1490 QGGLGIAISEEDTLSGVIIKSLTEHGVAATDGRLKVGDQILAVDDEIVVGYPIEKFISLLKTAKMTVKLTIHAENPDSQAVPSAAGAASGEKKNSSQSLM-VPQSGSPEPESIRN--TSRSSTPAIFASDPATCPIIPGCETT----------------IEISKGRTGLGLSIVGGSDTLLGAIII--HEVYEEGAACKDGRLWAGDQILEVNGIDLRKATHDEAINVLRQTPQRVRLTLY-----------RDEAPYKEEEVCDTLTIELQKKP-------GKGLGL---------SIVGKR--NDTGVFVSDIVKG-----------GIADADGRLMQGDQILMVNGEDVRNATQEAVAALLK--------CSLGTVTLEVGRIKAGPF----HSERRPSQSSQVSEGSLSSFTFPLSGSSTSESLESSSKKNALASEIQGLRTVE--MKKGPTDSLGISIAGGVGSPLGDVPIFIAMMHPTGVAAQTQKLRVGDRIVTICGTSTEGMTHTQAVNLLKNASGS---IEMQV---VAGGDVSVVTGHQQEPASSSLSFTGLTSSSIFQDDLGPPQCKSITLERGPDGLGFSIVGGYGSPHGDLPIYVKTVFAKGAASEDGRLKRGDQIIAVNGQSLEGVTHEEAVAILKRTKGTVTLMV 2068          

HSP 4 Score: 56.9954 bits (136), Expect = 1.506e-6
Identity = 98/417 (23.50%), Postives = 166/417 (39.81%), Query Frame = 1
Query:  283 GIDYEIISMNLCKRNQSLGVALEGRNEIARNTQEVVQHHFFKVILPSQCVGETGKFMVKDEILEVNGLKVVGLPTKEVLNTLRKVTNYFQI-VVARSIIHNYDLASDYGGSEDNINSPISF------YDMDDD--ESSQN-GTLRSNVSNYSTTSRDFGSSVSFGGLIDGQHET---VNDYLRNMVGWRGPIVIELRK--QNSPFGLALEEIRNPLHNAMIIVFKYVVPEMTAGKDGRLHAGDRLLQVNGKSVEGVDFRQVCKWIKSSPRGRLVLYIC------------------------KPHFETINYDPSSPANDDKYYFNTIRDMDKLPKLSEETDGECLRLPAVPEYMETHITLKRTENKLGI----FLDIVDEGKNGARIKKMT-HGIAKNDGRLHEGDFVTKVNEISLK 1401
            G + E   + L K  Q LG+ + G   I     E     F K I  S  V   G+  + D+I+ V+G  + G   ++ +  LR       + ++ R +    +L S    ++D   SP++       Y+ D+D   S++N   L +    Y   S +         + D Q +    +  + R M      +V  + K  +NS  G++LE      H+      + V+PE   G  G+L +GD LL+VNG ++ G + + V   +K  P   + +  C                        KPH +   +  SS   D       +  M    + +EE         A+ E    HI L++    LG     + D +D       I+ +   GIA+ DGRL  GD +  VN+++L+
Sbjct:  370 GEESETFDVELTKNVQGLGITIAGY--IGDKKLEP-SGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRRGMKQEAELMSREDVTKDADLSPVNASIIKENYEKDEDFLSSTRNTNILPTEEEGYPLLSAEIEE------IEDAQKQEAALLTKWQRIMGINYEIVVAHVSKFSENSGLGISLEATVG--HH----FIRSVLPEGPVGHSGKLFSGDELLEVNGITLLGENHQDVVNILKELPI-EVTMVCCRRTVPPTTQSELDSLDLCDIELTEKPHVDLGEFIGSSETED------PVLAMTDAGQSTEEVQAPL----AMWEAGIQHIELEKGSKGLGFSILDYQDPIDPASTVIIIRSLVPGGIAEKDGRLLPGDRLMFVNDVNLE 760          

HSP 5 Score: 56.225 bits (134), Expect = 2.562e-6
Identity = 120/572 (20.98%), Postives = 210/572 (36.71%), Query Frame = 1
Query:  208 IDKYFRFNITESSSKAIQENWIRILGIDYEIISMNLCKRNQSLGVALEGRNEIARNTQEVVQHHFFKVILPSQCVGETGKFMVKDEILEVNGLKVVGLPTKEVLNTLRKVTNYFQIVVARSIIHNYDLASDYGGSEDNINSPISFYDMDDDESSQNGTLRSNVSNYSTTSRDFGSSVSFGGLIDGQHETVNDYLRNMVGWRGPIVIELRKQNSPFGLALEEIRNPLHNAMIIVFKYVVPEMTAGKDGRLHAGDRLLQVNGKSVEGVDFRQVCKWIKSSPRG-RLVLYICKPHFETINYDPSSPANDDKYYFN-------------TIRDMDK--LPKLSEETDGECLRLPAVPEYMETHITLKRTENKLGIFLDIVDEGKNGARI--KKMTHGIAKNDGRLHEGDFVTKVNEISLKVDNKSKLDLCLKQISADKRNYNISYITAEDVRLHNGKYGTVSSATNRLPQSSQIYPEFLSIKVTEPLNEINSDKTRNHKFSFETFDIIIKNDKQTGLGLVLSPSLKDPNRYISITDIHDNSLCGKSGLLKINDEILKVNNVDFENISINELGHFLK 1869
            +DK   F     S K I+E +  + G   E+  + L K +  LG++L G  + +R +       F   I P+   G+ G+  + DE+LE+NG  + G   +   + ++   +  +I+     I N D  +       N   P+          S +  L++  +  + T+ D  ++V      + QH                  +EL K     G+A+ E  + L     ++ K +     A  DGRL  GD++L V+ + V G    +    +K++    +L ++   P  + +     + + + K                 +IR+  +   P +       C  +P      ET I + +    LG+ +    +   GA I  +    G A  DGRL  GD + +VN I L+   K+  D  +          N+   T + VRL                    +Y +    K  E                 +T  I ++     GLGL +     D   ++S  DI    +    G L   D+IL VN  D  N +   +   LK
Sbjct: 1324 VDKEDEFGY---SWKNIRERYGTLTG---ELHMIELEKGHSGLGLSLAGNKDRSRMSV------FIVGIDPNGAAGKDGRLQIADELLEINGQILYGRSHQNASSIIKCAPSKVKII----FIRNKDAVNQMAVCPGNAVEPL---------PSNSENLQNKETEPTVTTSD--AAVDLSSFKNVQH------------------LELPKDQGGLGIAISE-EDTLSG---VIIKSLTEHGVAATDGRLKVGDQILAVDDEIVVGYPIEKFISLLKTAKMTVKLTIHAENPDSQAVPSAAGAASGEKKNSSQSLMVPQSGSPEPESIRNTSRSSTPAIFASDPATCPIIPGC----ETTIEISKGRTGLGLSIVGGSDTLLGAIIIHEVYEEGAACKDGRLWAGDQILEVNGIDLR---KATHDEAI----------NVLRQTPQRVRL-------------------TLYRDEAPYKEEE---------------VCDTLTIELQKKPGKGLGLSIVGKRNDTGVFVS--DIVKGGIADADGRLMQGDQILMVNGEDVRNATQEAVAALLK 1793          
BLAST of Glutamate receptor-interacting protein 2 vs. UniProt/SwissProt
Match: sp|Q8VBX6|MPDZ_MOUSE (Multiple PDZ domain protein OS=Mus musculus OX=10090 GN=Mpdz PE=1 SV=2)

HSP 1 Score: 103.605 bits (257), Expect = 9.697e-21
Identity = 80/279 (28.67%), Postives = 135/279 (48.39%), Query Frame = 1
Query:  253 AIQENWIRILGIDYEIISMNLCK--RNQSLGVALEGRNEIARNTQEVVQHHFFKVILPSQCVGETGKFMVKDEILEVNGLKVVGLPTKEVLNTLRKVTNYFQIVVARSIIHNYDLASDYGGSEDNINSPISFYDMDDDESSQNGTLRSNVSNYSTTSRDFGSSVSFGGLIDGQHETVNDYLRNMVGWR-GPIVIELRKQNSPFGLALEEIRNPLHNA-MIIVFKYVVPEMTAGKDGRLHAGDRLLQVNGKSVEGVDFRQVCKWIKSSPRGRLVLYICKP 1077
            A+   W RI+GI+YEI+  ++ K   N  LG++LE            V HHF + +LP   VG +GK    DE+LEVNG+ ++G   ++V+N L+++     +V  R  +    L            S +   D++D E ++   +       S+ + D   ++S    +D   E +   L     W  G   IEL K +   G ++ + ++P+  A  +IV + +VP   A KDGRL  GDRL+ VN  ++E     +  + +K +P G + + + KP
Sbjct:  529 ALLTKWQRIMGINYEIVVAHVSKFSENSGLGISLEA----------TVGHHFIRSVLPEGPVGHSGKLFSGDELLEVNGINLLGENHQDVVNILKELPIDVTMVCCRRTVPPIAL------------SEMDSLDINDLELTEKPHIDLGEFIGSSETEDPMLAMSD---VDQNAEEIQTPLAM---WEAGGQSIELEKGSRGLGFSILDYQDPIDPANTVIVIRSLVPGGIAEKDGRLFPGDRLMFVNDINLENSTLEEAVEALKGAPSGMVRIGVAKP 779          

HSP 2 Score: 86.2705 bits (212), Expect = 1.917e-15
Identity = 182/825 (22.06%), Postives = 318/825 (38.55%), Query Frame = 1
Query:  325 NQSLGVAL-EGRNEIAR-NTQEVVQHHFFKVILPSQCVGETGKFMVKDEILEVNGLKVVGLPTKEVLNTLRKVTN----YFQIVVAR-------SIIHNY----------------DLASDYGGSED----------NI--NSPISFYDMDDDESSQNGTLRSNVSNYSTTSRDFGSSVS-----FGGLIDGQHETVNDYLRNMVGWRGPIVIELRKQNSPFGLALEEIRNPLHNAMIIVFKYVVPEMTAGKDGRLHAGDRLLQVNGKSVEGVDFRQVCKWIKSSPRGRLVLYICKPHFETINYDPSSPA-NDDKYYFNTIRDMDKLPKLSEETDGECLRLPAVPEYMETHITLKRTENKLGIFLDIVDEGKNGARIKKMT-HGIAKNDGRLHEGDFVTKVNE-----------ISLKVDNKSKLDLCLKQISADKRNYNISYITAEDVRLHNGKYGTVSSA-TNRLPQSSQIYPE--FLSIKVTEPLNEINSDKTRNHKFSFETFDIIIKNDKQTGLGLVLSPSLKDPNRYISITDIHDNSLCGKSGLLKINDEILKVNNVDFENISINELGHFLKRAHKTENELRFQVRRLTCSENVPVDPLIEKLTWFPDIYHRVLKRGPN-GFGFSLLELDSNNGVVVDKVDLNKVCD----LKPGERFVMINKCTVITCSKPNVVQMVKNSTRNLEL----IIETPKYREFR----------------------------------------------VKISKDSSMSLGLNIAGGRDTRFP-IPV-IESLVPNRTSKFSEELFTLDLITEVDGTNVTKQNHAEIIQIFR 2442
            ++SLG+++  GR   +R +  EV++  F K +L     G+ G     D I+EV+G+ +     ++ +  +RK  N      Q ++ R       S+ H+                  L +D   S+           N+  +SP  F +M  D +  + T    VS       +FG S       +G L    H                 VIEL K  S  GL+L   ++    ++ IV   + P   AG+DGRL   D LL++NG+ + G   +     IK +P    +++I   + + +N     P    D     +    +K  +    T      L ++ +  +  + L + +  LGI +   ++  NG  I+ +T HG A  DGRL  GD +  V++           ISL    K+ + L ++  +        S +T    R  N +   V +     +P +S+      F S   T P+  I   +T        T +I   +  QTGLGL +          I I ++++     K G L   D+IL+VN +D    + +E  + L+   +T   +R  + R         D    K     D +   L++ P  G G S++   ++ GV V  +    + D    L  G++ +M+N   V   ++  V  ++K S   + L    +   P + E R                                              V+I K  + SLGL+IAGG  +    +P+ I  + PN  +  +++L   D I  + GT+     H + + + +
Sbjct: 1147 SKSLGISIVGGRGMGSRLSNGEVMRGIFIKHVLEDSPAGKNGTLKPGDRIIEVDGMDLRDASHEQAVEAIRKAGNPVVFMVQSIINRPRKSPLPSLPHSLYPKYSFSSTNPFADSLQLTTDQAPSQSESETEKPALCNVPPSSPSVFSEMGSDCAQPSATA---VSEDEDKEDEFGYSWKNIQERYGSLTGQLH-----------------VIELEKGQSGLGLSLAGNKDRTRMSVFIV--GIDPTGAAGRDGRLQIADELLEINGQILYGRSHQNASSIIKCAPSKVKIIFI--RNADAVNQMAVCPGIAADSPSSTSDSPQNKEVEPCSTTSASAADLSSLTDVYQ--LELPKDQGGLGIAI-CEEDTINGVMIESLTEHGGAAKDGRLKPGDHILAVDDEVVAGCPVEKFISLLKTAKATVKLTVRAENPACPAVPSSAVTVSGERKDNSQTPAVPAPDLEPIPSTSRSSTPAVFASDPATCPI--IPGCET--------TIEI---SKGQTGLGLSIVGGSDTLLGAIIIHEVYEEGAACKDGRLWAGDQILEVNGIDLRKATHDEAINVLR---QTPQRVRLTLYR---------DEAPYKEEDVCDTFTIELQKRPGKGLGLSIVGKRNDTGVFVSDIVKGGIADADGRLMQGDQILMVNGEDVRHATQEAVAALLKCSLGAVTLEVGRVKAAPFHSERRPSQSSQVSESSLSSFTPPLSGINTSESLESNSKKNALASEIQGLRTVEIKKGPADSLGLSIAGGVGSPLGDVPIFIAMMHPNGVAAQTQKLRVGDRIVTICGTSTDGMTHTQAVNLMK 1919          

HSP 3 Score: 61.2326 bits (147), Expect = 6.878e-8
Identity = 114/494 (23.08%), Postives = 198/494 (40.08%), Query Frame = 1
Query:  823 IELRKQNSPFGLALEEIRNPLHNAMIIVFKYVVPEMTAGKDGRLHAGDRLLQVNGKSVEGVDFRQVCKWIKSSP-RGRLVLYICKPHFETINYDPSSPANDDKYYFNTIRDMDKLPKLSEETDGECLRLPAVPEYMETHITLKRTENKLGIFLDIVDEGKNGARIKKMTHGIAKNDGRLHEGDFVTKVNEISLKVDNKSKLDLCLKQISADKRNYNISYITAEDVRLHNGKYGTVSSATNRLPQSSQIYPEFLSIKVTEPLNEINSDKT--RNHKFSFETFDII------IKNDKQTGLGLVLSPSLKDP--NRYISITDIHDNSLCGKSGLLKINDEILKVNNVDFENISINELGHFLKRAH---KTENELRFQVRRLTCSENVPVDPLIE-----KLTWFPDIYHR------VLKRGPNGFGFSLL-ELDSNNG-------VVVDKVDLNKVCDLKPGERFVMINKCTVITCSKPNVVQMVKNSTRNLELII 2205
            IE+ K  +  GL++    + L  A+II    V  E  A KDGRL AGD++L+VNG  +      +    ++ +P R RL LY           D +    +D     TI ++ K P       G+ L L          I  KR  N  G+F+  + +G           GIA  DGRL +GD +  VN   ++   +  +   LK         ++  +T E  R+    +      + R P  S    E      T PL+ IN+ ++   N K +    +I       IK      LGL ++  +  P  +  I I  +H N +  ++  L++ D I+ +     + ++  +  + +K A    + +      V  +T  +    +P +        + FPD           L RGP+G GFS++    S +G        V  K    +   LK G++ + +N  ++   +    V ++K +   + L++
Sbjct: 1615 IEISKGQTGLGLSIVGGSDTLLGAIII--HEVYEEGAACKDGRLWAGDQILEVNGIDLRKATHDEAINVLRQTPQRVRLTLY----------RDEAPYKEEDVCDTFTI-ELQKRP-------GKGLGL---------SIVGKR--NDTGVFVSDIVKG-----------GIADADGRLMQGDQILMVNGEDVRHATQEAVAALLK--------CSLGAVTLEVGRVKAAPF-----HSERRPSQSSQVSESSLSSFTPPLSGINTSESLESNSKKNALASEIQGLRTVEIKKGPADSLGLSIAGGVGSPLGDVPIFIAMMHPNGVAAQTQKLRVGDRIVTICGTSTDGMTHTQAVNLMKNASGSIEVQVVAGGDVSVVTGHQQELANPCLAFTGLTSSSIFPDDLGPPQSKTITLDRGPDGLGFSIVGGYGSPHGDLPIYVKTVFAKGAAAEDGRLKRGDQIIAVNGQSLEGVTHEEAVAILKRTKGTVTLMV 2053          

HSP 4 Score: 61.2326 bits (147), Expect = 8.005e-8
Identity = 91/401 (22.69%), Postives = 163/401 (40.65%), Query Frame = 1
Query:  289 DYEIISMNLCKRNQSLGVALEGRNEIARNTQEVVQHHFFKVILPSQCVGETGKFMVKDEILEVNGLKVVGLPTKEVLNTLRKVTNYFQIVVARSIIHNYDLASDYGGSEDNINSPISFYDMDDDESSQNGTLRSNVSNYSTTSRDFGSSVSFGGLIDGQHETVNDYLRN---MVGWR-------GPIVIELRK--QNSPFGLALEEIRNPLHNAMIIVFKYVVPEMTAGKDGRLHAGDRLLQVNGKSVEGVDFRQVCKWIKSSPRG-------RLVLYICKPHFETINYD----PSSPANDDKYYFNTIRDMDKLPKLSE-ETDGECLRLP-AVPEYMETHITLKRTENKLGI----FLDIVDEGKNGARIKKMT-HGIAKNDGRLHEGDFVTKVNEISLK 1401
            + E   + L K  Q LG+ + G   I     E     F K I  S  V   G+  + D+I+ V+G  + G   ++ +  LR      ++ + R         +  G +  +++ P    + D++  S    L+ N S        F        L+  + E   D  +    +  W+         +V  + K  +NS  G++LE      H+      + V+PE   G  G+L +GD LL+VNG ++ G + + V   +K  P         R V  I     ++++ +       P  D   +  +    D +  +S+ + + E ++ P A+ E     I L++    LG     + D +D       I+ +   GIA+ DGRL  GD +  VN+I+L+
Sbjct:  373 ESETFDVELTKNVQGLGITIAGY--IGDKKLEP-SGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVRLTLMRKGASQEAELTSRGDTAKDVDLPAENCEKDEESLS----LKRNTSILPIEEEGFP-------LLSAELEEAEDVQQEAALLTKWQRIMGINYEIVVAHVSKFSENSGLGISLEATVG--HH----FIRSVLPEGPVGHSGKLFSGDELLEVNGINLLGENHQDVVNILKELPIDVTMVCCRRTVPPIALSEMDSLDINDLELTEKPHIDLGEFIGSSETEDPMLAMSDVDQNAEEIQTPLAMWEAGGQSIELEKGSRGLGFSILDYQDPIDPANTVIVIRSLVPGGIAEKDGRLFPGDRLMFVNDINLE 753          
BLAST of Glutamate receptor-interacting protein 2 vs. UniProt/SwissProt
Match: sp|Q9NB04|PATJ_DROME (Patj homolog OS=Drosophila melanogaster OX=7227 GN=Patj PE=1 SV=2)

HSP 1 Score: 96.6709 bits (239), Expect = 8.965e-19
Identity = 90/341 (26.39%), Postives = 146/341 (42.82%), Query Frame = 1
Query:  217 YFRFNITESSSKAIQENWIRILGIDYEIISMNLCK-RNQSLGVALEGRNEIARNTQEVVQHHFFKVILPSQCVGETGKFMVKDEILEVNGLKVVGLPTKEVLNTLRKVTNYFQIVVARSIIHNYDLASDYGGSEDNINSPISFYDMDDDESSQNGTLRSNVSNYS---------TTSRDFGSSVSFGGLIDGQHETVN------------DYLRNMVGWRG-PIVIELRKQNSPFGLALEEIRNPLH-NAMIIVFKYVVPEMTAGKDGRLHAGDRLLQVNGKSVEGVDFRQVCKWIKSSPRGRLVLYICKP-----------------HFETINYDPSSPA 1116
            Y    +++ +   I   W +I+G D E+I   + K     LG++LEG  ++    +EV  HH+ + ILP   VG  G     DE+LEVNG +++G+   EV+  L+++    ++V  R                 N NS  S     DD      TL+   +N+            ++  GS  + G + DG                  + L  +  W   P +IEL K +   G ++ + ++PL  N  +IV + +VP   A  DGRL  GDRLL VN  ++E     Q  + +K + +G + + + KP                   ET++  PS PA
Sbjct:  530 YTDPELSDDAETEIIRKWQKIVGSDVEVIVAQIKKFAVGGLGISLEGTVDV-EGGREVRPHHYIRSILPDGPVGVNGVLRSGDELLEVNGERLLGMNHLEVVAILKELPLDVRMVCGR-----------------NRNS--SLLPFSDD------TLKKLSNNFENLLPATDRLVKAKSDGSLATAGSVADGDSVAAAAASFSKLKSRSLEPLTGLAMWSSQPQIIELVKGDRGLGFSILDYQDPLDPNDTLIVIRSLVPGGVAQLDGRLIPGDRLLFVNSINLENASLDQAVQALKGASKGVVRIGVAKPLPMTDNSLKACSNASTTSEETLDAQPSPPA 844          
BLAST of Glutamate receptor-interacting protein 2 vs. UniProt/SwissProt
Match: sp|Q13425|SNTB2_HUMAN (Beta-2-syntrophin OS=Homo sapiens OX=9606 GN=SNTB2 PE=1 SV=1)

HSP 1 Score: 57.3806 bits (137), Expect = 8.257e-7
Identity = 31/93 (33.33%), Postives = 52/93 (55.91%), Query Frame = 1
Query: 2230 RVKISKDSSMSLGLNIAGGRDTRFPIPVIESLVPNRTSKFSEELFTLDLITEVDGTNVTKQNHAEIIQIFRSTGRETTF--KILRKI-PYIKR 2499
            RV++ K  +  LG++I GGR+ R PI +I  + P   +  S  L   D I  V+GT++ +  H + +Q  +  G+E     K +R++ PYIK+
Sbjct:  115 RVRVVKQEAGGLGISIKGGRENRMPI-LISKIFPGLAADQSRALRLGDAILSVNGTDLRQATHDQAVQALKRAGKEVLLEVKFIREVTPYIKK 206          
BLAST of Glutamate receptor-interacting protein 2 vs. TrEMBL
Match: A0A2C9KCL7 (Uncharacterized protein OS=Biomphalaria glabrata OX=6526 GN=106060106 PE=4 SV=1)

HSP 1 Score: 140.584 bits (353), Expect = 1.385e-29
Identity = 156/643 (24.26%), Postives = 279/643 (43.39%), Query Frame = 1
Query:  253 AIQENWIRILGIDYEIISMNLCK--RNQSLGVALEGRNEIARNTQEVVQHHFFKVILPSQCVGETGKFMVKDEILEVNGLKVVGLPTKEVLNTLRKVTNYFQIVVARSIIHNYDLASDYGGSEDNI------------NSPISFYDMDDDESSQNGTLRSNVSNYSTTSRDFGSSVSFGGLIDGQHETVNDYLRNMVGWRG-PIVIELRKQNSPFGLALEEIRNPLH-NAMIIVFKYVVPEMTAGKDGRLHAGDRLLQVNGKSVEGVDFRQVCKWIKSSPRGRLVLYICKP-----HFE---------TINYDPSSPANDDKYYFNTIRDMDKLPKLSEETDGECLRLPAVPEYMETH---ITLKRTENKLGIFLDIVDEGKNGARIKKMTHGIA-KNDGRLHEGDFVTKVNEISLKVDNKSKLDLCLKQISADKRNYNISYITAEDVR-------------LHNGKYGTVSSATNRLPQSSQIYPEFLSIKVTEPLNE--INSDKT---RNHKFS-FETFDIIIKNDKQTGLGLV------LSPSLKDPNRYISITDIHDNSLCGKSGLLKINDEILKVNNVDFENISINELGHFLKRAHKTENELRFQVRRLTCS------ENVPVDPL--IEKLTWFPDI 1980
            AI+  W  I+G D+ ++   L K      LG++LEG  ++  +  EV  HH+ + ILP   VG  G+    DE+LEVNG +++GL    V+  L+ +  + ++V AR     Y L   +   +  I              P++   +         T  +   +  T SR                ET+N +      W   P+VIEL K     G ++ + ++P++ N  +IV + +VP   A +DGRL  GDRL+ VN  +VE     +  + +K +PRG + + + KP      F+         T +   SS ++ +    + ++     P++        L  P V      H   I + +    LG+ ++ VD+G NG  +K +    A  +DGR+H GDF+  +N+ SL+    ++    L++ S    + +I+YI+ ++ +             L    +    S    +   +Q  P     + T  + +  + +D T    N  +S     +++ +  K  G+ +V       + S ++ N  I I  +   S  G++G LK  D IL+VN VD  N + +E    ++    + + + F V+ L+ S      E+V + P   IE+ T  P +
Sbjct:  616 AIKAAWEPIVGNDFLVVVAQLSKFKEGGGLGISLEGTVDV-EDGVEVRPHHYIRSILPDGPVGLNGRLKSSDELLEVNGRRLLGLNHVNVVEILKDLPQHVRLVCAR---RKYPLPDTFTAPDMQIPGTLPYSHGVEPGPPLTERLVKAKSEMALSTTEAPPVDIKTKSRSM--------------ETLNAFAM----WSSQPVVIELEKGERGLGFSILDYQDPVNPNETVIVIRSLVPGGVAMQDGRLVPGDRLIFVNSVNVEHATLDEAVQALKGAPRGTVKIGVAKPLPISEAFKQDAQRRPGLTKHRTASSSSSPEHLTSSDLKSPPSSPRILSPLH-STLASPEVHRISANHERTIHILKGSQHLGLTVEAVDKGVNGCIVKSINKPSAVDSDGRIHPGDFIVSINKESLRRITNAQARAILRRSSLLTSDISITYISGQNNQSANLVSEPQQSPLLQKLAHSLSKSEDEDVTNQTQPAPSPPPTEQTSTIGQKTLQTDGTPALGNQAWSPPRIVELVREPGKSLGISIVGGRVDMFNVSQENCNAGIFIKHVLPESPAGRNGTLKKGDRILEVNGVDVRNATHDEAVEVIR---NSSSPITFVVQSLSYSSCPGDLESVQLQPTSSIEESTAVPSV 1232          

HSP 2 Score: 76.6406 bits (187), Expect = 5.259e-10
Identity = 175/793 (22.07%), Postives = 316/793 (39.85%), Query Frame = 1
Query:  325 NQSLGVAL-EGRNEIARNTQEVVQHHFF-KVILPSQCVGETGKFMVKDEILEVNGLKVVGLPTKEVLNTLRKVTNYFQIVVARSIIHNYDLASDYGGSEDNINSPISFYDMDDDESSQNGTLRSNVSNYSTTSRDFGSSVSFGGLIDGQHETVND--------YLRNMVGWR-----GPI-VIELRKQNSPFGLALEEIRNPLHNAMIIVFKYVVPEMTAGKDGRLHAGDRLLQVNGKSVEGVDFRQVCKWIKS--SPRGRLVLY---------ICKP-------HFETINYDPSSPANDDKYYFNTIRDMDKLPKLSEETDGECLRLPAVPEYMETHITLKRTENKLGIFLDIVDE-GKNGARIKKMTHG-IAKNDGRLHEGDFVTKVNEISLKVDNKSKLDLCLKQISADKRNYNISY-ITAEDVRLHNGKYGTVSSATNRLPQSSQIYPEFLSIKVTEPL-NEINSD-KTRNHKFSFETFDIIIKNDKQTGLGLVLSPSLKDPNRYISITDIHDNSLCGKSGLLKINDEILKVNNVDFENISINELGHFLKRAHKTENELRFQVRRLTCSENVPVDPLIEKLTWFPDIYHRVLKRGPNGFGFSLLELDSNNGVVVDKVDLNKVCD----LKPGERFVMINKCTVITCSKPNVVQMVKNSTRNLELIIETPK---------------------------------------YREFR-VKISKDSSMSLGLNIAGGRDTRF---PIPVIESLVPNRTSKFSEELFTLDLITEVDGTNVTKQNHAEIIQIFRS 2445
             +SLG+++  GR ++   +QE      F K +LP    G  G     D ILEVNG+ V      E +  +R  ++    VV      +   +S  G  E     P S        S +  T   +V + ++TS       SF  +   Q E+ +D        Y +  +  +     G + +++L + ++  G+ L    N   + M +    + P+  A +DGR+  GD LL+VNG ++ G+    V   IK   +P  +LV +           KP        F+  +  P SP+  +    N++R    L  +S  T       PA  E ++  I L +    LG  ++  ++ G+NG  +K +T G +A  D +L  GD + +V + +L   +    D  +  + A + +  +    T +   L  G Y          P   Q+    L    T+P  ++ N D KT       +TF  I K   +TGLGL +          I I +++++    + G L   D+IL+VNN D  + + N     L+   +T   ++  V R      +  + +++  T        +LKR   G G S++   S+ G+ +  +    V +    L  G++ + +N   +   ++     ++K     + L +   K                                           R V++ +D S S G+++AGG ++     P+ +I +L P   +  S +L   D I  ++GT+     H ++I   R+
Sbjct: 1120 GKSLGISIVGGRVDMFNVSQENCNAGIFIKHVLPESPAGRNGTLKKGDRILEVNGVDVRNATHDEAVEVIRNSSSPITFVV-----QSLSYSSCPGDLESVQLQPTS--------SIEESTAVPSVGSIASTSPGTTPQQSFDKVDVKQLESYSDSEEEDEFGYTKKRIQKKYSDLPGLVQLVDLNRGSAAMGMGLA--GNKDRSKMSVFVAGIQPDSPADQDGRIQVGDELLEVNGINLHGLSHLNVSAVIKGVNTPIVKLVTHRREDFLEHMAVKPLRYGGSSQFDVQSVPPVSPSGKE----NSVRSQSPL-TISGPTTHVAQSSPAS-EPVQV-IILHKQSQGLGFGIEEDNKNGRNGIYVKTITAGGLADKDQQLEVGDEILEVGDKTL---SGCHYDKAIDILRAAQGSVRLKVRKTNQSNNLATGSY---------TPGKMQLL-NTLGESTTDPSESDDNPDPKTCPIVIGKKTFIEIEKG--KTGLGLSIVGGSDTLLGAIIIHEVYEDGAAARDGRLWAGDQILEVNNEDLTDATHNRALQVLR---QTPPVVQMTVYR--DESQIREEDILDVFTV------ELLKRPGKGLGLSIVGKKSDVGIYISDIVKGGVAEADARLMQGDQILAVNGEDMRNATQEYAAAVLKTLMGKVSLTVGRLKAGSKSSSRKNSNYESSLKKSDSSVSNKSKGKHSKNPSEDLNHLRVVELEQDLSGSFGISVAGGLNSPIGDAPV-IIATLNPTGPAAMSGKLRAGDKIININGTSTEGMTHEQVISALRA 1863          
BLAST of Glutamate receptor-interacting protein 2 vs. TrEMBL
Match: A0A224X4S0 (Uncharacterized protein (Fragment) OS=Panstrongylus lignarius OX=156445 PE=4 SV=1)

HSP 1 Score: 139.428 bits (350), Expect = 3.504e-29
Identity = 124/496 (25.00%), Postives = 221/496 (44.56%), Query Frame = 1
Query:  208 IDKYFRFNITESSSKAIQENWIRILGIDYEIISMNLCKRNQS--LGVALEGRNEIARNTQEVVQHHFFKVILPSQCVGETGKFMVKDEILEVNGLKVVGLPTKEVLNTLRKVTNYFQIVVAR-----SIIHNYDLASD---------YGGSEDNINSPISFYDMDDDESSQNGTLRSNVSNYSTTSRDFGSSVSFGGLIDGQHETVNDYLRNMVGWRGPIVIELRKQNSPFGLALEEIRNPLH-NAMIIVFKYVVPEMTAGKDGRLHAGDRLLQVNGKSVEGVDFRQVCKWIKSSPRGRLVLYICKP---------HFET------------------------INYDPSSPANDDKYYFNTI-RDMD---------------KLPKLSEETD-----GECLRLPAVPEYMETHITLKRTENKLGIFLDIVDEGKNGARIKKMTHGIA-KNDGRLHEGDFVTKVNEISLKVDNKSKLDLCLKQISADKRNYNISYI 1479
            ID  +   ++ S+ +AI+E W  ILG D EI+   L K  +   LG++LEG  ++  + QEV  HH+ + IL    VG+ GK    DE+LEVNG +++G+   EV+  L+++    ++V AR     + +   D + D          GGS  N+   +        + S   T  + V+  S +     S     GL     E              P +IEL K     G ++ + ++P++ N  +IV + +VP   A  DGRL  GDRLL VN  ++E     Q  + +K +PRG + + + KP           +T                        I + P +   D ++  + + RD +               ++ +L +E D      E L + ++P+ +E  + +++    LG+ ++ V++  NGA +  +  G A + DGR++ GD++T +N  SL+    +++   + +      + +I YI
Sbjct:  654 IDTDYEGPLSASTEEAIKEKWHNILGPDVEIVVGQLKKFGEGGGLGISLEGTVDV-EDGQEVRPHHYIRSILAEGPVGQNGKLKSGDELLEVNGHRLLGMNHIEVVTILKELPIAVRMVCARRNGDANALRLIDTSQDRAAFAARSILGGSLQNLIPAMERLVKAKSDGSLASTATTAVTEPSLSKLRSRSLEPITGLAMWSSE--------------PHIIELVKGERGLGFSILDYQDPMNSNETVIVIRSLVPGGVAQTDGRLIPGDRLLSVNSVNLEHASLDQAVQALKGAPRGVVTIAVAKPLPIPDSVSQELDTGLRQDTPTLDDNSMYSCSGSLQSDIEFSPENLQMDIQFVEDDLERDSEEMVAEKSEDIEAQDVRIDELGDEEDVENNSEEILPIVSLPQTLEVEVKIRKGSEPLGLCVENVNDAVNGATVTSIISGSAIEQDGRINVGDYITSINNESLRRSTHAQMSCIIARAQLVSTDISIRYI 1134          
BLAST of Glutamate receptor-interacting protein 2 vs. TrEMBL
Match: A0A267DNP0 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig008379g1 PE=4 SV=1)

HSP 1 Score: 132.88 bits (333), Expect = 2.214e-27
Identity = 122/463 (26.35%), Postives = 204/463 (44.06%), Query Frame = 1
Query:  220 FRFNITESSSKAIQENWIRILG-IDYEIISMNLCKRNQS--LGVALEGRNEIARNTQEVVQHHFFKVILPSQCVGETGKFMVKDEILEVNGLKVVGLPTKEVLNTLRKVTNYFQIVVARSIIHNYDLASDYGGSEDNINSPISFYDMDDDESSQNGTLRSNVSNYSTTSRDFGSSVSFGGLIDGQHETVNDYLRNMVGWRGPIV-IELRKQNSPFGLALEEIRNPL-HNAMIIVFKYVVPEMTAGKDGRLHAGDRLLQVNGKSVEGVDFRQVCKWIKSSPRGRLVLYICKPHFETINYDPSSPA---------NDDKYYFNTIRDMDKLPKLSEETDGEC---------------LRLPAVPEYMETHITLKRTE-NKLGIFLDIVDEGKNGARIKKMTHG-IAKNDGRLHEGDFVTKVNEISLKVDNKSKLDL----CLKQISADKRNYNISYITAEDVRLH 1503
            F   ++++   A+Q  W   LG  D EI+     K + S  LG++LEG  ++  N  E   HH+ + ++P    G  G    +DE+LEVN  +V+GL   EV+  L+ +     IV ARS     D   +Y   ED      +  ++D D +S                    S+V  GG   G+  +V D+   M  W      +EL K     G ++ + ++PL  +  +I+ + +VP   A KDGR+  GDRLL VN   +E     +  + +KS+P GR+V+ + KP         ++ A          DD    +T       P+    +DG+                  LP +P  +E  + L+++   +LG+ +    +G NG  + ++  G  A   G L  GD+VT VN  SL+     +LD+       + +A+  + ++ YI + D  +H
Sbjct:  605 FSAPLSDADMAALQTRWRLELGDPDCEIVVAQFAKFSDSPGLGISLEGTVDVLENGDEARPHHYIREVVPDGPAGREGTLRRRDELLEVNNRRVLGLNHLEVVEVLKSLPQQVCIVCARSTRPEIDEMDEY---EDQ----AADEEVDSDSAS-------------------ASAVVVGGASGGKSRSVEDF-SGMGVWSDQATEVELEKTARGLGFSVLDYQDPLCSDRTVIIVRSLVPGGLAHKDGRILPGDRLLYVNDVRLEQATLEEAVQCLKSAPEGRIVIGVAKPSPLAAASVDAAAALAAAVAKTDGDDTATADTPE-----PRRCSLSDGKSDGDDADQEEAEDEEEEELPPIPSALERTLKLRKSGFEELGLVIAAGGKGTNGCVVTEVLPGSAAARSGTLQPGDYVTAVNSESLR-----RLDVADARAALRRAAELSDISVIYIPSTDAEVH 1030          
BLAST of Glutamate receptor-interacting protein 2 vs. TrEMBL
Match: A0A5B7F8E4 (Patj OS=Portunus trituberculatus OX=210409 GN=Patj PE=4 SV=1)

HSP 1 Score: 127.487 bits (319), Expect = 8.340e-27
Identity = 90/306 (29.41%), Postives = 143/306 (46.73%), Query Frame = 1
Query:  208 IDKYFRFNITESSSKAIQENWIRILGIDYEIISMNLCK--RNQSLGVALEGRNEIARNTQEVVQHHFFKVILPSQCVGETGKFMVKDEILEVNGLKVVGLPTKEVLNTLRKVTNYFQIVVARSIIHNYDLASDYGGSEDNINSPISFYDMDDDESSQNGTLRSNVSNYSTTSRDFGSSVSFGGLIDGQHETVND------------YLRNMVGWRGPI-VIELRKQNSPFGLALEEIRNPLH-NAMIIVFKYVVPEMTAGKDGRLHAGDRLLQVNGKSVEGVDFRQVCKWIKSSPRGRLVLYICKP 1077
            ID  +  ++  S   AIQ  W RI+G +++I+   L K      LG++LEG  ++    +EV  HH+ + ILP   VG+  +    DE+LEVNG K++GL   EV+  L+++  Y ++V  R             G+   ++ PI     D D  +    L  ++ N    S     + S G L        ND             L  +  W     VIEL K +   G ++ + ++PL+    +IV + +VP   A KDGRL  GDRL+ VNG ++E     Q    +K +P+G + + + KP
Sbjct:  151 IDTNYSGDLRPSVESAIQRKWSRIVGPEFDIVVAQLSKFEEGGGLGISLEGTVDV-EGGREVRPHHYIRSILPDGPVGKNNRLCSGDELLEVNGQKLLGLNHVEVVGILKELPRYVRLVCGRR----------APGAPPPLH-PIDAPTADRDTFAARNILGGSLQNLIPGSERLVKAKSDGSLASSATAATNDNSFNRMKSRSLEPLTGLAMWSSECQVIELTKGDRGLGFSILDYQDPLNPQETVIVIRSLVPGGVAEKDGRLIPGDRLVAVNGTNLENATLDQAVAALKGAPKGTVSIAVAKP 444          
BLAST of Glutamate receptor-interacting protein 2 vs. TrEMBL
Match: A0A0K2SZ76 (Multiple PDZ domain proteinlike [Acyrthosiphon pisum] OS=Lepeophtheirus salmonis OX=72036 PE=4 SV=1)

HSP 1 Score: 128.257 bits (321), Expect = 7.543e-26
Identity = 137/531 (25.80%), Postives = 246/531 (46.33%), Query Frame = 1
Query:  202 NKIDKYFRFNITESSSKAIQENWIRILGIDYEIISMNLCKRNQS--LGVALEGRNEIARNTQEVVQHHFFKVILPSQCVGETGKFMVKDEILEVNGLKVVGLPTKEVLNTLRKVTNYFQIVVARSIIHN---YDLASDYGGSEDNINSPISFYDMDDDESSQNGTLRSNVSNYSTTSRDFGSSVSFGGLIDGQHETVNDYLRNMVGWRGPIV-IELRKQNSPFGLALEEIRNPLH-NAMIIVFKYVVPEMTAGKDGRLHAGDRLLQVNGKSVEGVDFRQVCKWIKSSPRGRLVLYICKPHFE------TINYDPS------SPANDDKYYFNTIRDMDK-LPKL---------SEETD-------GECLRLPAVPEYMETHITLKRTENKLGIFLDIVDEGKNGARIKKMT-HGIAKNDGRLHEGDFVTKVNEISLKVDNKSKLDLCLKQISADKRNYN--ISYITAEDVRLHNGKYGTVSSATNRLPQSSQIYPEFLSIKVTEPLNEINSDKTRNHKFSFETFDIIIKND 1677
            N++D  F   +     + I + W   +G+ YEI+   L K   +  LG++LEG  E   + +E   HH+ + +LP   VG  G     DE+LEVNG K++GL   +V++ L+ +  + +IV AR+   +     L S+   S+++  S         D S    ++ +N  N  +TS     S S             + L ++  W   ++ I+L K +   G ++ + ++PL+ +  +IV + +VP   A +DGRL  GDRL++VN   +      +  + +K +P+G +++ + KP         T++ D S      + ++D+    + I DM+   P L          E+ D        + + +P +PE +E HI + +    LG+ +DI ++G NG  +K +T  G    DGR+  GD++ KVN   L+    S+    LK+      N +  IS++ A D  ++       ++   RL Q  +     +  KVT  +  IN+ K     F+ E  + +I  +
Sbjct:  562 NRVDS-FEGELDPIIEREIIQKWSDYMGVQYEIVVAQLKKFQSTGGLGISLEGTVEKV-DGEEHNPHHYIRSVLPDGPVGHNGLLKSGDELLEVNGQKLIGLYHTDVVSILKDLPVWVRIVCARNTSVDPPRSKLISNNNTSDESTVSVERLVKAKSDGSIS--SMGTNTGNNESTSSMNSKSRSL------------EPLTSLAMWAEEVLDIDLIKGDKGLGFSILDYQDPLNKDETVIVIRSLVPGGVAQQDGRLIPGDRLMKVNQVDLCHATLDEAVQALKGAPKGLVIIGVSKPLPSQLDDDLTLSKDASITNSNNNGSDDNTEVRSEISDMESDTPNLPPPIPTSPPPEDEDEKNSSRINKSIGIPPLPEALERHIKVIKDSEALGVQVDIEEDGINGLIVKSITPGGTLARDGRIQPGDYMVKVNNELLRNIKHSEALNILKRTHKVPLNQDIQISFVPAGDAVVYK------TTMITRLAQQKEPPIPAVREKVTSFIT-INNSKPEVSVFNLEDSNAVITQE 1069          
BLAST of Glutamate receptor-interacting protein 2 vs. Ensembl Cavefish
Match: ENSAMXT00000021866.2 (pep primary_assembly:Astyanax_mexicanus-2.0:21:12814175:12879031:-1 gene:ENSAMXG00000021159.2 transcript:ENSAMXT00000021866.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 105.916 bits (263), Expect = 2.237e-22
Identity = 145/621 (23.35%), Postives = 251/621 (40.42%), Query Frame = 1
Query:  256 IQENWIRILGIDYEIISMNLCKRNQS--LGVALEGRNEIARNTQEVVQHHFFKVILPSQCVGETGKFMVKDEILEVNGLKVVGLPTKEVLNTLRKVTNYFQIVVARSIIHNYDLASDYGGSEDNINSPISFYDMDDDESSQNGTLRSNVSNYSTTSRDFGSSVSFGGLIDGQHET-VNDYLRN------MVGWRGPIV-IELRKQNSPFGLALEEIRNPLHNA-MIIVFKYVVPEMTAGKDGRLHAGDRLLQVNGKSVEGVDFRQVCKWIKSSPRGRLVLYICKP-HFETINYDPSSPANDDKYYFNTIRD---------------------MDKLPKLSEETDGECLRLPAVPEY--------METHITLKRTENKLGIFLDIVDEGKNGARIKKMTHGIA-KNDGRLHEGDFVTKVN-EISLKVDNKSKLDLCLKQ--ISADKRN-----------YNISYITAEDVRLHNGK-------YGTVSSATNR----LPQSSQIYPEFLSIKVTEPLNEINSDKTRNHKFSFETFDIIIKNDKQTGLGLVLSPSLKDPNRYISITDIHDNSLCGKSGLLKINDEILKVNNVDFENISINELGHFLKRAHKTENELRFQVRRL 1917
            + E W   LG   E+I + + K ++S  LG++LE              HH+ + +LP   VG +GK    DE+LEVNG+ + G   KEV++ L+++     +   R                    +P+   D    +S           N      DF        L+ G+ E  V D++        +  W   I  IEL K     G ++ + ++P+  A  +IV + +VPE  A  DGRL  GDRL+ VN  ++E     +  + +K +  G + + + KP   ++ + D S     D+++ N   D                     M+      +E D   ++    P+          E  IT+ +  + LG+ +  V +G  G  I+ + HG +   DGRL  GD +  +N E +  + N     +  +   I  D  +           Y I+Y+ AE +  +          +   +SAT R    LP+      E   ++     N     K   ++ + ++  I I   +  G+G  LS    +  R I I  I ++S  G++G LK  D I++V+ VD  + S  E    +++A    N + F V+ +
Sbjct:  498 LTEKWQNTLGPSNEVIVVQVEKFSESSGLGISLEASG----------GHHYIRSVLPEGPVGRSGKLYSGDELLEVNGISLRGETHKEVVSILKELPVCVCMTCCRP-------------------APLPPTDSQAGQSGLEDVAIETTENVLGEVEDF--------LVSGESEKRVRDHVTKETAGAPLAMWESEIQNIELEKGEQGLGFSILDYQDPVDPAKTVIVIRSLVPEGVAEMDGRLLPGDRLMYVNNTNLESASLEEAVQALKGANLGTVSIGVAKPLPIDSNDVDLSDEKAFDRHFNNEEDDTFQSSMIALHGSTCSADLTYQMNMQASTPQEEDFPMVKPVEEPDQPDMTPGSNFERTITVVKGNSSLGMTVSAVKDGV-GMLIRSIIHGGSISRDGRLGVGDLILAINGEPAGNLTNAQARAMLRRHSLIGPDMGSSVAPEEELCPFYIITYVPAEYLEEYRASKQAKDELFAVDASATPRCVAELPEREDGEGEESELQTATFSNWNQPRKVELYREAGKSLGISIVGGR--GMGSRLSNG--EVMRGIFIKHILEDSPAGRNGTLKTGDRIVEVDGVDLRDASHEEAVEAIRKAG---NPVEFLVQSI 1073          

HSP 2 Score: 77.0258 bits (188), Expect = 1.357e-13
Identity = 172/811 (21.21%), Postives = 315/811 (38.84%), Query Frame = 1
Query:  325 NQSLGVAL-EGRNEIAR-NTQEVVQHHFFKVILPSQCVGETGKFMVKDEILEVNGLKVVGLPTKEVLNTLRKVTN----YFQIVVARSIIHNYDLASDYGGSEDNINSPISFYDMDDDESSQNGTLRSNVSNYSTTSRDFGSSVSFGGLIDGQHETVND-------YLRNMVGWRGPI-----VIELRKQNSPFGLALEEIRNPLHNAMIIVFKYVVPEMTAGKDGRLHAGDRLLQVNGKSVEGVDFRQVCKWIKSSPRGRLVLYICKPHFETINYDPSSPANDDKYYFNTIRDM----DKLPKLSEETDGECLRLPAVPEYME---THITLKRTENKLGIFLDIVDEGKNGARIKKMTHGIAKNDGRLHEGDFVTKV-NEISLKVDNKSKLDLCLKQISADKRNYNISYITAEDVRLHNGKYGT-------VSSATNRL------PQSSQIY--------PEFLSIKVTEPLNEINSDKTRNHKFSFETFDIIIKNDKQTGLGLVLSPSLKDPNRYISITDIHDNSLCGKSGLLKINDEILKVNNVDFENISINELGHFLKRAHKTENELRFQVRRLTCSENVPVDPLIEKLTWFPDIYHRVLKRGPN-GFGFSLLELDSNNGVVVDKVDLNKVCD----LKPGERFVMINKCTVITCSKPNVVQMVKNSTRNLELII----ETPKYREFR---------------------------------------------VKISKDSSMSLGLNIAGGRDTRFP-IPV-IESLVPNRTSKFSEELFTLDLITEVDGTNVTKQNHAEIIQIFRST 2448
             +SLG+++  GR   +R +  EV++  F K IL     G  G     D I+EV+G+ +     +E +  +RK  N      Q ++ R      D   D   S+   NS  +  + + ++ S   +  S          D  +       I   H++  +         + +V   G +     +IEL K  S  GL+L   R+   + M +    + P   AG+DGR+  GD LL++NG+ + G   +     IKS+P    +++I                N D      +  M    D +   +E      L LP     M     HI L   E+ +G+ L   D   NG  ++ +  G A  +G +  GD +  V +E+ L +  +  + L    +++ K +  ++   A+   + N    T        +S +N L      P++  I            +S  VT P+  I   +T        T DI   +  +TGLGL +          I I ++++     K G L   D+IL+VN +D    + +E  + L+   +T   +R  + R             E+  W  DI++  L++ P    G S++   ++ GV V  +    V +    L  G++ + +N   V + ++ +V  ++K     +++ +      P + E R                                             V++ K  S SLG++IAGG  +    +P+ I  + P   +  +++L   D I  + GT+     H++ + + ++T
Sbjct:  990 GKSLGISIVGGRGMGSRLSNGEVMRGIFIKHILEDSPAGRNGTLKTGDRIVEVDGVDLRDASHEEAVEAIRKAGNPVEFLVQSIINRPRTSATDSVEDRTASDSKPNS--NKLNREPEKVSPTTSFLSLPVVPHVGETDTDTLTEIPDRITLPHDSTEEEEDEFGYTWKKVVERYGSLPGVLHMIELEKGRSGLGLSLAGNRD--RSRMSVFVVGIDPSGAAGRDGRIVVGDELLEINGQILYGRSHQNASSIIKSAPSKVKIIFI---------------RNTDALSQMAVGPMKEFGDTIDTQTEPETCSSLNLPLPDLDMSKCVQHIILPVEESGVGLHL-AEDNNGNGVIVQSIKEGPALKEGSIQPGDRLMAVDDEMLLGLSAEKVMSL----LNSGKSSVKLTICRADSTPVLNASNQTCRDLEPETTSLSNMLLFSVTPPETETIRSSSRSSTPATLVSDPVTCPI--IPGCET--------TIDI---SKGRTGLGLSIVGGCDTLLGAIIIHEVYEEGAAAKDGRLWAGDQILEVNGIDLRMATHDEAINVLR---QTPQRVRLTMFRDEGQYK-------EEELW--DIFNVELQKKPGQSLGLSIVGRRNDTGVFVSDIVKGGVVESDGRLMQGDQILSVNGEDVRSATQESVAALLKCCVGPIKMELGRFKAGPFHSERRMSQASQLSESGNCKITQQSFSGSGSLQGDFEIRRSHESLEQDIRTVELCKGPSDSLGISIAGGVGSPLGDVPIFIAMMNPAGLAAQTQKLRVGDRIISICGTSTEGMAHSQAVSLLKNT 1751          

HSP 3 Score: 61.2326 bits (147), Expect = 7.685e-9
Identity = 128/580 (22.07%), Postives = 236/580 (40.69%), Query Frame = 1
Query:  307 MNLCKRNQSLGVALEGRNEIARNTQEVVQHHFFKVILPSQCVGETGKFMVKDEILEVNGLKVVGLPTKEVLNTLRKVTNYFQIVVARSIIHNYDLASDYGGSEDNINSPISFYDMDDDESSQNGTLRSNVS-NYSTTSRDFGSSV--SFGGLIDGQHETVNDYLRNMVGWR---GP----IVIELRK--QNSPFGLALEEIRNPLHNAMIIVFKYVVPEMTAGKDGRLHAGDRLLQVNGKSVEGVDFRQVCKWIKSSPRGRLVLYICKPH-------------FETINYDPSSPANDDKYYFNTIRDMDKLPK--LSEETDGECLRLPAVPEYMETHITLKRTENKLGI----FLDIVDEGKNGARIKKMT-HGIAKNDGRLHEGDFVTKVNEISLKVDNKSKLDLCLKQISADKRNYNISY---ITAEDVRLHNGK---------------------YGTVSSATNRLPQSSQI-YPEFLSIKVTEPLNEINS-DKTRNHKFSFETFDIIIKNDKQTGLGLVLSPSLKDPNRYISITDIHDNSLCGKSGLLKINDEILKVNNVDFENISINELGHFLKR 1872
            ++L K  Q LG+ + G   I     E     F K I     V + G+  V D+I+ V+GL + G   ++ +  LR       + + R      +              PI   D   +  + + +    ++ + S TSR+  ++         +G   ++ +       W+   GP    IV+++ K  ++S  G++LE      H+      + V+PE   G+ G+L++GD LL+VNG S+ G   ++V   +K  P   + +  C+P               E +  + +     +   F    + +K  +  +++ET G  L   A+ E    +I L++ E  LG     + D VD  K    I+ +   G+A+ DGRL  GD +  VN  +L+  +  +    LK  +    +  ++    I + DV L + K                     +G+  SA      + Q   P+     + +P+ E +  D T    F   T  ++  N   + LG+ +S ++KD    +  + IH  S+  + G L + D IL +N     N++  +    L+R
Sbjct:  336 VSLTKNAQGLGITIAGY--IGDKNSEP-SGIFVKSITTGSAVEQDGRIHVGDQIIAVDGLDIQGFTNQQAVEVLRHTGQTVHLKLVRRGFMPEETPPPVVCVVTETKPPILSLDSTLERVAMDTSHEEKLNVDTSETSRNTATAAPPCTPEQKNGIKLSIEEEEELTEKWQNTLGPSNEVIVVQVEKFSESSGLGISLEASGG--HH----YIRSVLPEGPVGRSGKLYSGDELLEVNGISLRGETHKEVVSILKELPV-CVCMTCCRPAPLPPTDSQAGQSGLEDVAIETTENVLGEVEDFLVSGESEKRVRDHVTKETAGAPL---AMWESEIQNIELEKGEQGLGFSILDYQDPVDPAKTVIVIRSLVPEGVAEMDGRLLPGDRLMYVNNTNLESASLEEAVQALKGANLGTVSIGVAKPLPIDSNDVDLSDEKAFDRHFNNEEDDTFQSSMIALHGSTCSADLTYQMNMQASTPQEEDFPMVKPVEEPDQPDMTPGSNFE-RTITVVKGN---SSLGMTVS-AVKDGVGMLIRSIIHGGSIS-RDGRLGVGDLILAINGEPAGNLTNAQARAMLRR 896          
BLAST of Glutamate receptor-interacting protein 2 vs. Ensembl Cavefish
Match: ENSAMXT00000037958.1 (pep primary_assembly:Astyanax_mexicanus-2.0:21:12814175:12879031:-1 gene:ENSAMXG00000021159.2 transcript:ENSAMXT00000037958.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 88.9669 bits (219), Expect = 2.818e-17
Identity = 74/285 (25.96%), Postives = 122/285 (42.81%), Query Frame = 1
Query:  256 IQENWIRILGIDYEIISMNLCKRNQS--LGVALEGRNEIARNTQEVVQHHFFKVILPSQCVGETGKFMVKDEILEVNGLKVVGLPTKEVLNTLRKVTNYFQIVVARSIIHNYDLASDYGGSEDNINSPISFYDMDDDESSQNGTLRSNVSNYSTTSRDFGSSVSFGGLIDGQHET-VNDYLRN------MVGWRGPIV-IELRKQNSPFGLALEEIRNPLHNA-MIIVFKYVVPEMTAGKDGRLHAGDRLLQVNGKSVEGVDFRQVCKWIKSSPRGRLVLYICKP 1077
            + E W   LG   E+I + + K ++S  LG++LE              HH+ + +LP   VG +GK    DE+LEVNG+ + G   KEV++ L+++     +   R                    +P+   D    +S           N      DF        L+ G+ E  V D++        +  W   I  IEL K     G ++ + ++P+  A  +IV + +VPE  A  DGRL  GDRL+ VN  ++E     +  + +K +  G + + + KP
Sbjct:  498 LTEKWQNTLGPSNEVIVVQVEKFSESSGLGISLEASG----------GHHYIRSVLPEGPVGRSGKLYSGDELLEVNGISLRGETHKEVVSILKELPVCVCMTCCRP-------------------APLPPTDSQAGQSGLEDVAIETTENVLGEVEDF--------LVSGESEKRVRDHVTKETAGAPLAMWESEIQNIELEKGEQGLGFSILDYQDPVDPAKTVIVIRSLVPEGVAEMDGRLLPGDRLMYVNNTNLESASLEEAVQALKGANLGTVSIGVAKP 745          

HSP 2 Score: 77.7962 bits (190), Expect = 7.870e-14
Identity = 172/811 (21.21%), Postives = 315/811 (38.84%), Query Frame = 1
Query:  325 NQSLGVAL-EGRNEIAR-NTQEVVQHHFFKVILPSQCVGETGKFMVKDEILEVNGLKVVGLPTKEVLNTLRKVTN----YFQIVVARSIIHNYDLASDYGGSEDNINSPISFYDMDDDESSQNGTLRSNVSNYSTTSRDFGSSVSFGGLIDGQHETVND-------YLRNMVGWRGPI-----VIELRKQNSPFGLALEEIRNPLHNAMIIVFKYVVPEMTAGKDGRLHAGDRLLQVNGKSVEGVDFRQVCKWIKSSPRGRLVLYICKPHFETINYDPSSPANDDKYYFNTIRDM----DKLPKLSEETDGECLRLPAVPEYME---THITLKRTENKLGIFLDIVDEGKNGARIKKMTHGIAKNDGRLHEGDFVTKV-NEISLKVDNKSKLDLCLKQISADKRNYNISYITAEDVRLHNGKYGT-------VSSATNRL------PQSSQIY--------PEFLSIKVTEPLNEINSDKTRNHKFSFETFDIIIKNDKQTGLGLVLSPSLKDPNRYISITDIHDNSLCGKSGLLKINDEILKVNNVDFENISINELGHFLKRAHKTENELRFQVRRLTCSENVPVDPLIEKLTWFPDIYHRVLKRGPN-GFGFSLLELDSNNGVVVDKVDLNKVCD----LKPGERFVMINKCTVITCSKPNVVQMVKNSTRNLELII----ETPKYREFR---------------------------------------------VKISKDSSMSLGLNIAGGRDTRFP-IPV-IESLVPNRTSKFSEELFTLDLITEVDGTNVTKQNHAEIIQIFRST 2448
             +SLG+++  GR   +R +  EV++  F K IL     G  G     D I+EV+G+ +     +E +  +RK  N      Q ++ R      D   D   S+   NS  +  + + ++ S   +  S          D  +       I   H++  +         + +V   G +     +IEL K  S  GL+L   R+   + M +    + P   AG+DGR+  GD LL++NG+ + G   +     IKS+P    +++I                N D      +  M    D +   +E      L LP     M     HI L   E+ +G+ L   D   NG  ++ +  G A  +G +  GD +  V +E+ L +  +  + L    +++ K +  ++   A+   + N    T        +S +N L      P++  I            +S  VT P+  I   +T        T DI   +  +TGLGL +          I I ++++     K G L   D+IL+VN +D    + +E  + L+   +T   +R  + R             E+  W  DI++  L++ P    G S++   ++ GV V  +    V +    L  G++ + +N   V + ++ +V  ++K     +++ +      P + E R                                             V++ K  S SLG++IAGG  +    +P+ I  + P   +  +++L   D I  + GT+     H++ + + ++T
Sbjct: 1107 GKSLGISIVGGRGMGSRLSNGEVMRGIFIKHILEDSPAGRNGTLKTGDRIVEVDGVDLRDASHEEAVEAIRKAGNPVEFLVQSIINRPRTSATDSVEDRTASDSKPNS--NKLNREPEKVSPTTSFLSLPVVPHVGETDTDTLTEIPDRITLPHDSTEEEEDEFGYTWKKVVERYGSLPGVLHMIELEKGRSGLGLSLAGNRD--RSRMSVFVVGIDPSGAAGRDGRIVVGDELLEINGQILYGRSHQNASSIIKSAPSKVKIIFI---------------RNTDALSQMAVGPMKEFGDTIDTQTEPETCSSLNLPLPDLDMSKCVQHIILPVEESGVGLHL-AEDNNGNGVIVQSIKEGPALKEGSIQPGDRLMAVDDEMLLGLSAEKVMSL----LNSGKSSVKLTICRADSTPVLNASNQTCRDLEPETTSLSNMLLFSVTPPETETIRSSSRSSTPATLVSDPVTCPI--IPGCET--------TIDI---SKGRTGLGLSIVGGCDTLLGAIIIHEVYEEGAAAKDGRLWAGDQILEVNGIDLRMATHDEAINVLR---QTPQRVRLTMFRDEGQYK-------EEELW--DIFNVELQKKPGQSLGLSIVGRRNDTGVFVSDIVKGGVVESDGRLMQGDQILSVNGEDVRSATQESVAALLKCCVGPIKMELGRFKAGPFHSERRMSQASQLSESGNCKITQQSFSGSGSLQGDFEIRRSHESLEQDIRTVELCKGPSDSLGISIAGGVGSPLGDVPIFIAMMNPAGLAAQTQKLRVGDRIISICGTSTEGMAHSQAVSLLKNT 1868          

HSP 3 Score: 59.3066 bits (142), Expect = 3.170e-8
Identity = 92/397 (23.17%), Postives = 167/397 (42.07%), Query Frame = 1
Query:  307 MNLCKRNQSLGVALEGRNEIARNTQEVVQHHFFKVILPSQCVGETGKFMVKDEILEVNGLKVVGLPTKEVLNTLRKVTNYFQIVVARSIIHNYDLASDYGGSEDNINSPISFYDMDDDESSQNGTLRSNVS-NYSTTSRDFGSSV--SFGGLIDGQHETVNDYLRNMVGWR---GP----IVIELRK--QNSPFGLALEEIRNPLHNAMIIVFKYVVPEMTAGKDGRLHAGDRLLQVNGKSVEGVDFRQVCKWIKSSPRGRLVLYICKPH-------------FETINYDPSSPANDDKYYFNTIRDMDKLPK--LSEETDGECLRLPAVPEYMETHITLKRTENKLGI----FLDIVDEGKNGARIKKMT-HGIAKNDGRLHEGDFVTKVNEISLK 1401
            ++L K  Q LG+ + G   I     E     F K I     V + G+  V D+I+ V+GL + G   ++ +  LR       + + R      +              PI   D   +  + + +    ++ + S TSR+  ++         +G   ++ +       W+   GP    IV+++ K  ++S  G++LE      H+      + V+PE   G+ G+L++GD LL+VNG S+ G   ++V   +K  P   + +  C+P               E +  + +     +   F    + +K  +  +++ET G  L   A+ E    +I L++ E  LG     + D VD  K    I+ +   G+A+ DGRL  GD +  VN  +L+
Sbjct:  336 VSLTKNAQGLGITIAGY--IGDKNSEP-SGIFVKSITTGSAVEQDGRIHVGDQIIAVDGLDIQGFTNQQAVEVLRHTGQTVHLKLVRRGFMPEETPPPVVCVVTETKPPILSLDSTLERVAMDTSHEEKLNVDTSETSRNTATAAPPCTPEQKNGIKLSIEEEEELTEKWQNTLGPSNEVIVVQVEKFSESSGLGISLEASGG--HH----YIRSVLPEGPVGRSGKLYSGDELLEVNGISLRGETHKEVVSILKELPV-CVCMTCCRPAPLPPTDSQAGQSGLEDVAIETTENVLGEVEDFLVSGESEKRVRDHVTKETAGAPL---AMWESEIQNIELEKGEQGLGFSILDYQDPVDPAKTVIVIRSLVPEGVAEMDGRLLPGDRLMYVNNTNLE 719          
BLAST of Glutamate receptor-interacting protein 2 vs. Ensembl Cavefish
Match: ENSAMXT00000041966.1 (pep primary_assembly:Astyanax_mexicanus-2.0:21:12814175:12875129:-1 gene:ENSAMXG00000021159.2 transcript:ENSAMXT00000041966.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 88.9669 bits (219), Expect = 3.220e-17
Identity = 74/285 (25.96%), Postives = 122/285 (42.81%), Query Frame = 1
Query:  256 IQENWIRILGIDYEIISMNLCKRNQS--LGVALEGRNEIARNTQEVVQHHFFKVILPSQCVGETGKFMVKDEILEVNGLKVVGLPTKEVLNTLRKVTNYFQIVVARSIIHNYDLASDYGGSEDNINSPISFYDMDDDESSQNGTLRSNVSNYSTTSRDFGSSVSFGGLIDGQHET-VNDYLRN------MVGWRGPIV-IELRKQNSPFGLALEEIRNPLHNA-MIIVFKYVVPEMTAGKDGRLHAGDRLLQVNGKSVEGVDFRQVCKWIKSSPRGRLVLYICKP 1077
            + E W   LG   E+I + + K ++S  LG++LE              HH+ + +LP   VG +GK    DE+LEVNG+ + G   KEV++ L+++     +   R                    +P+   D    +S           N      DF        L+ G+ E  V D++        +  W   I  IEL K     G ++ + ++P+  A  +IV + +VPE  A  DGRL  GDRL+ VN  ++E     +  + +K +  G + + + KP
Sbjct:  498 LTEKWQNTLGPSNEVIVVQVEKFSESSGLGISLEASG----------GHHYIRSVLPEGPVGRSGKLYSGDELLEVNGISLRGETHKEVVSILKELPVCVCMTCCRP-------------------APLPPTDSQAGQSGLEDVAIETTENVLGEVEDF--------LVSGESEKRVRDHVTKETAGAPLAMWESEIQNIELEKGEQGLGFSILDYQDPVDPAKTVIVIRSLVPEGVAEMDGRLLPGDRLMYVNNTNLESASLEEAVQALKGANLGTVSIGVAKP 745          

HSP 2 Score: 77.411 bits (189), Expect = 1.149e-13
Identity = 172/811 (21.21%), Postives = 315/811 (38.84%), Query Frame = 1
Query:  325 NQSLGVAL-EGRNEIAR-NTQEVVQHHFFKVILPSQCVGETGKFMVKDEILEVNGLKVVGLPTKEVLNTLRKVTN----YFQIVVARSIIHNYDLASDYGGSEDNINSPISFYDMDDDESSQNGTLRSNVSNYSTTSRDFGSSVSFGGLIDGQHETVND-------YLRNMVGWRGPI-----VIELRKQNSPFGLALEEIRNPLHNAMIIVFKYVVPEMTAGKDGRLHAGDRLLQVNGKSVEGVDFRQVCKWIKSSPRGRLVLYICKPHFETINYDPSSPANDDKYYFNTIRDM----DKLPKLSEETDGECLRLPAVPEYME---THITLKRTENKLGIFLDIVDEGKNGARIKKMTHGIAKNDGRLHEGDFVTKV-NEISLKVDNKSKLDLCLKQISADKRNYNISYITAEDVRLHNGKYGT-------VSSATNRL------PQSSQIY--------PEFLSIKVTEPLNEINSDKTRNHKFSFETFDIIIKNDKQTGLGLVLSPSLKDPNRYISITDIHDNSLCGKSGLLKINDEILKVNNVDFENISINELGHFLKRAHKTENELRFQVRRLTCSENVPVDPLIEKLTWFPDIYHRVLKRGPN-GFGFSLLELDSNNGVVVDKVDLNKVCD----LKPGERFVMINKCTVITCSKPNVVQMVKNSTRNLELII----ETPKYREFR---------------------------------------------VKISKDSSMSLGLNIAGGRDTRFP-IPV-IESLVPNRTSKFSEELFTLDLITEVDGTNVTKQNHAEIIQIFRST 2448
             +SLG+++  GR   +R +  EV++  F K IL     G  G     D I+EV+G+ +     +E +  +RK  N      Q ++ R      D   D   S+   NS  +  + + ++ S   +  S          D  +       I   H++  +         + +V   G +     +IEL K  S  GL+L   R+   + M +    + P   AG+DGR+  GD LL++NG+ + G   +     IKS+P    +++I                N D      +  M    D +   +E      L LP     M     HI L   E+ +G+ L   D   NG  ++ +  G A  +G +  GD +  V +E+ L +  +  + L    +++ K +  ++   A+   + N    T        +S +N L      P++  I            +S  VT P+  I   +T        T DI   +  +TGLGL +          I I ++++     K G L   D+IL+VN +D    + +E  + L+   +T   +R  + R             E+  W  DI++  L++ P    G S++   ++ GV V  +    V +    L  G++ + +N   V + ++ +V  ++K     +++ +      P + E R                                             V++ K  S SLG++IAGG  +    +P+ I  + P   +  +++L   D I  + GT+     H++ + + ++T
Sbjct: 1093 GKSLGISIVGGRGMGSRLSNGEVMRGIFIKHILEDSPAGRNGTLKTGDRIVEVDGVDLRDASHEEAVEAIRKAGNPVEFLVQSIINRPRTSATDSVEDRTASDSKPNS--NKLNREPEKVSPTTSFLSLPVVPHVGETDTDTLTEIPDRITLPHDSTEEEEDEFGYTWKKVVERYGSLPGVLHMIELEKGRSGLGLSLAGNRD--RSRMSVFVVGIDPSGAAGRDGRIVVGDELLEINGQILYGRSHQNASSIIKSAPSKVKIIFI---------------RNTDALSQMAVGPMKEFGDTIDTQTEPETCSSLNLPLPDLDMSKCVQHIILPVEESGVGLHL-AEDNNGNGVIVQSIKEGPALKEGSIQPGDRLMAVDDEMLLGLSAEKVMSL----LNSGKSSVKLTICRADSTPVLNASNQTCRDLEPETTSLSNMLLFSVTPPETETIRSSSRSSTPATLVSDPVTCPI--IPGCET--------TIDI---SKGRTGLGLSIVGGCDTLLGAIIIHEVYEEGAAAKDGRLWAGDQILEVNGIDLRMATHDEAINVLR---QTPQRVRLTMFRDEGQYK-------EEELW--DIFNVELQKKPGQSLGLSIVGRRNDTGVFVSDIVKGGVVESDGRLMQGDQILSVNGEDVRSATQESVAALLKCCVGPIKMELGRFKAGPFHSERRMSQASQLSESGNCKITQQSFSGSGSLQGDFEIRRSHESLEQDIRTVELCKGPSDSLGISIAGGVGSPLGDVPIFIAMMNPAGLAAQTQKLRVGDRIISICGTSTEGMAHSQAVSLLKNT 1854          

HSP 3 Score: 58.9214 bits (141), Expect = 3.977e-8
Identity = 92/397 (23.17%), Postives = 167/397 (42.07%), Query Frame = 1
Query:  307 MNLCKRNQSLGVALEGRNEIARNTQEVVQHHFFKVILPSQCVGETGKFMVKDEILEVNGLKVVGLPTKEVLNTLRKVTNYFQIVVARSIIHNYDLASDYGGSEDNINSPISFYDMDDDESSQNGTLRSNVS-NYSTTSRDFGSSV--SFGGLIDGQHETVNDYLRNMVGWR---GP----IVIELRK--QNSPFGLALEEIRNPLHNAMIIVFKYVVPEMTAGKDGRLHAGDRLLQVNGKSVEGVDFRQVCKWIKSSPRGRLVLYICKPH-------------FETINYDPSSPANDDKYYFNTIRDMDKLPK--LSEETDGECLRLPAVPEYMETHITLKRTENKLGI----FLDIVDEGKNGARIKKMT-HGIAKNDGRLHEGDFVTKVNEISLK 1401
            ++L K  Q LG+ + G   I     E     F K I     V + G+  V D+I+ V+GL + G   ++ +  LR       + + R      +              PI   D   +  + + +    ++ + S TSR+  ++         +G   ++ +       W+   GP    IV+++ K  ++S  G++LE      H+      + V+PE   G+ G+L++GD LL+VNG S+ G   ++V   +K  P   + +  C+P               E +  + +     +   F    + +K  +  +++ET G  L   A+ E    +I L++ E  LG     + D VD  K    I+ +   G+A+ DGRL  GD +  VN  +L+
Sbjct:  336 VSLTKNAQGLGITIAGY--IGDKNSEP-SGIFVKSITTGSAVEQDGRIHVGDQIIAVDGLDIQGFTNQQAVEVLRHTGQTVHLKLVRRGFMPEETPPPVVCVVTETKPPILSLDSTLERVAMDTSHEEKLNVDTSETSRNTATAAPPCTPEQKNGIKLSIEEEEELTEKWQNTLGPSNEVIVVQVEKFSESSGLGISLEASGG--HH----YIRSVLPEGPVGRSGKLYSGDELLEVNGISLRGETHKEVVSILKELPV-CVCMTCCRPAPLPPTDSQAGQSGLEDVAIETTENVLGEVEDFLVSGESEKRVRDHVTKETAGAPL---AMWESEIQNIELEKGEQGLGFSILDYQDPVDPAKTVIVIRSLVPEGVAEMDGRLLPGDRLMYVNNTNLE 719          
BLAST of Glutamate receptor-interacting protein 2 vs. Ensembl Cavefish
Match: patj (PATJ crumbs cell polarity complex component [Source:ZFIN;Acc:ZDB-GENE-030616-129])

HSP 1 Score: 65.4698 bits (158), Expect = 4.417e-10
Identity = 58/231 (25.11%), Postives = 99/231 (42.86%), Query Frame = 1
Query:  394 HHFFKVILPSQCVGETGKFMVKDEILEVNGLKVVGLPTKEVLNTLRKVTNYFQIVVARSIIHNYDLASDYGGSEDNINSP-ISFYDMDDDESSQNGTLRSNVSNYSTTSRDFGSSVSFGGLIDGQHETVNDYLRNMVGWRGPI-VIELRKQNSPFGLALEEIRNPLHNAM-IIVFKYVVPEMTAGKDGRLHAGDRLLQVNGKSVEGVDFRQVCKWIKSSPRGRLVLYICKP 1077
            HH+   + P   V   G    +DE+LEVNG+++ G   +E +  LR+V   F +V  R +             E + +SP +S  +       Q   ++  V                     G+ E   +    +  W   + V+EL K     G ++ + ++PL NA  +IV + +VP   A   G L  GD+L+ VN   ++     Q  + +K++P G++ L I KP
Sbjct:  576 HHYISTVAPEGPVANHGLLRPEDELLEVNGVQLYGKSRREAVAFLREVPPPFTLVCCRRLNEEGQEYQPEDAEEWSSSSPTVSLQE-------QAQVMQQEVPELREVPESISLEREEERKEPGEREEEEEDEGELALWSQEVQVLELEKGEQGLGFSILDYQDPLDNARSVIVIRSLVPGGVAESHGGLLPGDQLVFVNDTHLDSCTLTQAVEVLKAAPAGKVYLGIKKP 799          

HSP 2 Score: 55.4546 bits (132), Expect = 4.904e-7
Identity = 31/95 (32.63%), Postives = 52/95 (54.74%), Query Frame = 1
Query:  292 YEIISMNLCKRN-QSLGVALEGRNEIARNTQEVVQHHFFKVILPSQCVGETGKFMVKDEILEVNGLKVVGLPTKEVLNTLRKVTNYFQIVVARSI 573
            YEI  +NL K+  QSLG+++  RN    +T E     F K ++P     ++G  MV D I+ +NG+ + G  T+EVL+ +++      + + R I
Sbjct:  362 YEIHEVNLKKKEGQSLGISIVARNT---STSEDGMGIFVKSVVPGSAAEQSGNIMVNDRIIAMNGVNLQGFTTQEVLDVMKQTGQTVHLTLVRKI 453          
BLAST of Glutamate receptor-interacting protein 2 vs. Ensembl Cavefish
Match: lnx2a (ligand of numb-protein X 2a [Source:ZFIN;Acc:ZDB-GENE-060228-2])

HSP 1 Score: 59.6918 bits (143), Expect = 2.066e-8
Identity = 102/476 (21.43%), Postives = 170/476 (35.71%), Query Frame = 1
Query:  901 IVFKYVVPEMTAGKDGRLHAGDRLLQVNGKSVEGVDFRQVCKWIKSSPRGRLVLYI---------CKPHFETINYDPSSPANDDKYYFNTIRDMDKLPKLSEETDGECLRLPAVPEYMETHITLKRTENKLGIF-LDIVDEGKNGARIKKMTHGIAKNDGRLHEGDFVTKVNEISLKVDNKSKLDLCLKQISADKRNYNISYITAEDVRLHNGKYGTVSSATNRLPQSSQIYPEFLSIKVTEPLNEINSDKTRNHKFSFETFDIIIKNDKQTGLGLVLSPSL--KDPNRYISITDIHDNSLCGKSGLLKINDEILKVNNVDFENISINELGHFLKRAHKTENELRFQVRRLTCSE------------------NVPVDPLIEKLTWFPDIYHR----VLKRG-PNGFGFSLL----ELDSNNGVVVDKVDLNKVC----DLKPGERFVMINKCTVITCSKPNVVQMVKNSTRNLEL 2199
            IV + V  +    +DGRL AGD++LQVN      VD   +      S  GR    +         C      +   PSSP         T+   +   +L                     I L R  ++ G+F LD++D             G+A  DGRL   D V  VNE  L+     +    + Q S ++ N  IS    + + +H G+          LP+++   P       +  L+  ++ +  +   + +   I +K +    LG+ ++     K     I +T +  +    + G +K  D +L +N  D   +S +E    LK +  + +    Q+R L  S                   +    P        P   H     +L+R  P  +GFS++    E  SN    +  + L         LK G+  V +N  +    S   +V M+K     L L
Sbjct:  297 IVIQEVYRDGVIARDGRLLAGDQILQVN-----NVDISNMPHSFARSTLGRPCATLQLTVLRERRCTARPPAVAPTPSSPEGSPASMRITLHKRESTEQLG--------------------IKLVRRTDEAGVFVLDLLDG------------GLAAKDGRLRSNDRVLAVNEHDLRHGTPEQAAQII-QASGERVNLLISRPAKQTMAVHTGRESWCHEHFLPLPRTAAPSP-----APSLQLSRSSTHRDLSQCVTCKEKHITVKKEPHESLGMTVAGGRGSKSGELPIFVTSVQPHGCLSRDGRIKRGDVLLSINGQDLTCLSHSEAVGTLKSSAASSS---VQLRALEVSTVDEPGHDEGLLPHHESDYDASWSPSWVMWLGLPSYLHSSHEIILRRSHPGSWGFSIVGGYEENHSNQAFFIKTIVLGTPAYYDGRLKCGDMIVAVNGLSTAGMSHSALVPMLKEQRSRLAL 726          
BLAST of Glutamate receptor-interacting protein 2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006056.1 (pep scaffold:Pmarinus_7.0:GL477535:225:55869:1 gene:ENSPMAG00000005437.1 transcript:ENSPMAT00000006056.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 52.7582 bits (125), Expect = 5.581e-7
Identity = 58/205 (28.29%), Postives = 85/205 (41.46%), Query Frame = 1
Query:  817 IVIELRKQNSPFGLALEEIRNPLHNAMIIVFKYVVPEMTAGKDGRLHAGDRLLQVNGKSVEGVDFRQVCKWIKSSPRGRLVLYICKPHFETINYDPSSPA--NDDKYYFNTIRDMDKLPKLSEETDGECLRLPAVPEYMETHITL---------KRTENKLGIFLDIVDEGKNGARIKKMTHGIAKNDGRLHEGDFVTKVNEISL 1398
            I I L+K     G  +     P+     I  K ++ +  A  DGRL +GDRLL+VNG  V      +V   ++S+  G  V  +   H + +   P  PA  N   +  +   + D+L  LS +   E L L  +P +     +L         +RT   LGIF+  +  G           G A  DGRL   D +  VN  SL
Sbjct:  413 IPIHLKKGLDGLGFTIATRDTPVGGRTPIYVKSIMSKGAALSDGRLKSGDRLLEVNGLDVTSRTQEEVVAILRSTKLGGSVDLLVSRHHD-VPLSPDDPAGLNSRVWRCSAAEEEDRL--LSPDGSREFLTL-HIPLHDMGAASLGVSVKGTKDRRTNADLGIFIKTIIAG-----------GAAAKDGRLRVDDQLIAVNRESL 602          
BLAST of Glutamate receptor-interacting protein 2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002205.1 (pep scaffold:Pmarinus_7.0:GL477144:51012:68257:1 gene:ENSPMAG00000001988.1 transcript:ENSPMAT00000002205.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 51.9878 bits (123), Expect = 7.447e-7
Identity = 56/228 (24.56%), Postives = 91/228 (39.91%), Query Frame = 1
Query:  823 IELRKQNSPFGLALEEIRNPLHNAMIIVFKYVVPEMTAGKDGRLHAGDRLLQVNGKSVEGVDFRQVCKWIKSSPRGRLVLYICKPHFETINYDPSSPANDDKYYFNTIRDMDKLPKLSEETDG---------ECLRLPAV-----PEYMETHITLKRTENK---LGIFLDIVDEGKNGARIKKMTHGIAKNDGRLHEGDFVTKVN-EISLKVDNKSKLDLCLKQISAD 1452
            ++L+K     G +L     P+     +  K+++P   A  DGRLHAGDRL+ VNG  V  +   QV   ++    G  V  +   H   +    + PA + +       D     + +E + G         ECL L        P  +   +   R+ +    LGI++  +  G           G A  DGRL  GD +  VN E  L   N + ++   + ++ D
Sbjct:  388 VQLQKGPEGLGFSLTSRDTPVSGLGHVYIKHILPRGAAIADGRLHAGDRLIMVNGVDVSSMSQDQVVSILRGVHPGSSVDLLVSRHDALL----TPPAQEARLVKQMHPD-----QQAERSGGMIVTASGPCECLNLEIALSECGPAGLGVSVKGNRSRDGAHDLGIYVKSIIAG-----------GAAAKDGRLRIGDQLVAVNREPLLGRSNAAAMETLRRCMATD 595          
BLAST of Glutamate receptor-interacting protein 2 vs. Ensembl Nematostella
Match: EDO33706 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SRG3])

HSP 1 Score: 80.8777 bits (198), Expect = 2.989e-15
Identity = 99/432 (22.92%), Postives = 187/432 (43.29%), Query Frame = 1
Query:  247 SKAIQENWIRILGIDYEIISMNLCKRNQS--LGVALEGRNEIARNTQEVVQHHFFKVILPSQCVGETGKFMVKDEILEVNGLKVVGLPTKEVLNTLRKVTNYFQIVVARSIIHNYDLASDYGGSEDNINSPISFYDMDDDESSQNGTLRSNVSNYSTTSRDFGSSVSFGGLIDGQHETVNDYLRNMVGWRGPI-VIELRKQNSPFGLALEEIRNPLH-NAMIIVFKYVVPEMTAGKDGRLHAGDRLLQVNGKSVEGVDFRQVCKWIKSSPRGRLVLYICK-----------------------PHFETINYD-PSSPANDDKYYFNTI----RDMDKLPKLSEET------------DGECLRLPAVPEYMETH---ITLKRTE-NKLGIFLDIVDEGKNGARIKKMTHGIAKNDGRLHEGDFVTKVNEISL 1398
            ++A+++++  I+G + EI+   + K + +  LG++LEG       +   +  H    + P   VG+ G     D ++EVNG+ V+ L   EV+  ++ +   F++VVAR   +  +  +    S+  + S +    +DD  S+ +  + +  S  S+                 + ++V+D  ++M  W   I  +EL K +   G ++ + ++P +    +IV + +V    A +DG LH GDRL+ VN  ++E        + +K + RG +++ + K                       P   T + D  S P   D    + I    +D D    ++ E              G+ L L  +P+ +++    IT++R    KLG+ L   ++G        M  G    DGR+  GD +  VN+ SL
Sbjct:  766 TEAVKQHYQTIIGDNMEILVAEMTKFSPAGGLGISLEGTQYPLDGS---MPWHRIHAVNPEGPVGKNGIIQSGDHLIEVNGVGVLDLGHNEVVTLIQSLPMEFRLVVARKKDYPEEPETSVTMSQSEVES-LPTVQLDDVSSTIDAPVGTGPSPSSSR----------------RQKSVSD--QSM--WSNKIEYVELEKADKGLGFSILDYQDPSNPEKTVIVIRSLVHGGVAEQDGSLHPGDRLMSVNEVNLEHASLDFAVQTLKGTNRGNVIIGVAKPIPVPDDYEEDSNQGESLPDTTRPFLPTFDLDNESRPGKADISLMDNIENNGKDSDTDSMVTSEQSSKFDFGPPLLFSGDSLDLDNLPDSVKSRMQTITIRRQMVGKLGVSLKGDEDGSGCVVTSVMRGGAIAIDGRIGVGDHIVAVNDESL 1173          
BLAST of Glutamate receptor-interacting protein 2 vs. Ensembl Nematostella
Match: EDO27241 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T9T3])

HSP 1 Score: 49.6766 bits (117), Expect = 2.059e-7
Identity = 23/56 (41.07%), Postives = 38/56 (67.86%), Query Frame = 1
Query:  907 FKYVVPEMTAGKDGRLHAGDRLLQVNGKSVEGVDFRQVCKWIKSSPRGRLVLYICK 1074
             ++VVP   A KDGR+  GDR+L VNG+S +G+  ++V   +++ PR R+VL + +
Sbjct:   30 VRHVVPLGVAAKDGRIRKGDRVLSVNGRSTKGLTHQEVLNLLQNLPR-RVVLVVSR 84          
BLAST of Glutamate receptor-interacting protein 2 vs. Ensembl Medaka
Match: MPDZ (multiple PDZ domain protein-like [Source:NCBI gene;Acc:101166191])

HSP 1 Score: 87.8113 bits (216), Expect = 7.572e-17
Identity = 71/279 (25.45%), Postives = 128/279 (45.88%), Query Frame = 1
Query:  256 IQENWIRILGIDYEIISMNLCKRNQS--LGVALEGRNEIARNTQEVVQHHFFKVILPSQCVGETGKFMVKDEILEVNGLKVVGLPTKEVLNTLRKVTNYFQIVVARSIIHNYDLASDYGGSEDNINSPISFYDM-DDDESSQNGTLRSNVSNYSTTSRDFGSSVSFGGLIDGQHETVNDYLRNMVGW-RGPIVIELRKQNSPFGLALEEIRNPL-HNAMIIVFKYVVPEMTAGKDGRLHAGDRLLQVNGKSVEGVDFRQVCKWIKSSPRGRLVLYICKP 1077
            +++ W   +G  YE+    L + +++  LG++LE R            HH+   ILP   VG++GK ++ D ILEVNG+ +VG   KEV+N L+++     +V +R +                   P S  +  +DD++    +L+  ++ ++    D G  +      D     V      +  W +   V+EL K     G ++ + ++P      +++ + +VP   A +DGRL  GDRL+ VN   +EG         +KS+  G + + + KP
Sbjct:  440 LRKRWQHAVGPRYEVTVCQLQRFSETSGLGISLEAR----------AGHHYLCSILPEGPVGQSGKILIGDRILEVNGIPLVGETHKEVVNILKELPRSVHLVCSRVV-------------------PPSIPESEEDDDNDVQLSLKELLAEFN-DKLDQGCVIPCPTAEDITKRGVPPMSPPLAMWEKDAQVVELEKGELGLGFSILDYQDPEDATKTVLIIRSLVPGGVADRDGRLLPGDRLMFVNETDLEGSSLDYAVHVLKSTDYGPVRIGVAKP 688          
BLAST of Glutamate receptor-interacting protein 2 vs. Ensembl Medaka
Match: MPDZ (multiple PDZ domain crumbs cell polarity complex component [Source:NCBI gene;Acc:101165593])

HSP 1 Score: 87.4261 bits (215), Expect = 9.780e-17
Identity = 134/599 (22.37%), Postives = 242/599 (40.40%), Query Frame = 1
Query:  262 ENWIRILGIDYEIISMNLCKRNQS--LGVALEGRNEIARNTQEVVQHHFFKVILPSQCVGETGKFMVKDEILEVNGLKVVGLPTKEVLNTLRKVTNYFQIVVARSIIHNYDLASDYGGSEDNINSPISFYDMDDDESSQNGTLRSNVSNYSTTSRDFGSSVSFGGLIDGQHETVNDYLRNMVGWRGPIV-IELRKQNSPFGLALEEIRNPLHNA-MIIVFKYVVPEMTAGKDGRLHAGDRLLQVNGKSVEGVDFRQVCKWIKSSPRGRLVLYICKPHFETINY------DPS--------------SPANDDKYYFNTIR--------DMDKLPKLSEETDGECLRLPAVPEYMETHITLKRTENKL---------GIFLDIVDEGKNGARIKKMTHGIA-KNDGRLHEGDFVTKVN-EISLKVDNKSKLDLCLKQ--ISAD---KRN-------YNISYITAEDVRLHNGKYGTVSSATNRLPQSSQI---YPEFLSIKVTEPLNEINSDKTRNHKFSFE---TFDIIIKNDKQTGLGLVLSPSLKDPNRYISITDIHDNSLCGKSGLLKINDEILKVNNVDFENISINELGHFLKRA 1875
            + W +ILG   E+I   + K ++S  LG++LE              HH+ + +LP   VG  G+    DE++EVNG+ ++G   KEV+  L+++  +  +   R                     P +  +  D  S Q      +  N    ++D  +    G               ++  W   I  IEL K     G ++ + ++PL  A  +IV + +VP+  A  DGRL  GDRL+ VN  ++E        + +K +  G++ + + KP   +++       DP               S   +D +  + I         D+D L + S    G C        + + +   ++ E++          G+ +  + +G  G  I+ + HG +   DGRL  GD +  +N E +  + N     +  +   I  D   +R+       ++I+Y+ AE +  +             LP SS++    PE    +  E  +  N ++ R  +   E   +  I I   +  G+G  LS    +  R I I  I ++S  G++G L+  D I++V+ VD  + S  E    ++R 
Sbjct:  491 KKWQKILGPSNEVIVAQVEKFSESSGLGISLEASR----------GHHYIRSVLPEGPVGRCGQLFSGDELVEVNGISLIGETHKEVVRILKELPIFVYMTCCR--------------------PPETQSERSDPRSEQ--VTEESAGNPEAATQDTVTEEGIG--------------SSLAMWELEIQNIELEKGEGGLGFSILDYQDPLDPAKTVIVIRSLVPDGVAETDGRLLPGDRLMYVNDTNLENASLEDAVQALKGAKLGKVQIGVAKPLPVSLSVSIPTFIDPCEGDLSDERMLDHTYSGVEEDTFQVSMIALHGSACSTDLDYL-QSSTPKVGTCFGFGG--SFFDVY--RQKYEDQFNGCIMSYPKGMTVSAMKDGL-GMLIRSIIHGGSISRDGRLGVGDLILAINGEPTTNLSNAQARAMLRRHSLIGPDLGQRRSNFCVFVGFSITYVPAEYLEEYK---------LQCLPPSSRMISTLPEREDGEGEESASYGNWNQPRKVELFREHGKSLGISIVGGR--GMGSRLSNG--EVMRGIFIKHILEDSPAGQNGTLRTGDRIVEVDGVDLRDASHEEAVEAIRRG 1024          

HSP 2 Score: 56.225 bits (134), Expect = 3.027e-7
Identity = 108/511 (21.14%), Postives = 204/511 (39.92%), Query Frame = 1
Query:  901 IVFKYVVPEMTAGKDGRLHAGDRLLQVNGKSVEGVDFRQVCKWIKSSPRGRLVLYICKPHFETINYDPSSPANDDKYYFNTIRDMDKLPKLSEETDGECLRLPAVPEYMETHITLKRTENKLGIFLDIVDEGKN----GARIKKMTHGIA-KNDGRLHEGDFVTKVNEISLKVDNKSKLDLCLKQISADKRNYNISY-ITAEDVRLHNGKYGTVSSATNRLPQSSQIYPEFLSI-----------KVTEPLNEINSDKTRNHKFSFETFDIIIKNDKQTGLGLVLSPSLKDPNRYISITDIHDNSLCGKSGLLKINDEILKVNNVDFENISINELGHFLK-----------RAHKTENELRFQVRRLTCSENVPVDPLIEKLT---------------WFPDIYHRVLKRGPNGFGFSLLE----LDSNNGVVVDKVDL-NKVCD----LKPGERFVMINKCTVITCSKPNVVQMVKNSTRNLELIIETPKYREFRVKISKDSSMSLGLNI 2277
            ++ K ++P   A +DGRL +GD +L++    + G+   QV + ++     R+ L + +   E       +P+        T+ +  ++PK ++E + E             ++ L +    LGI +      KN    G  +K +T   A   DGR+H GD +T V+ ++++     +    L+      R   I      E++        +V S +  +P ++ +  E               K+  P NE+   +    KFS           + +GLG+    SL+    +  I  +      G+ G L   DE+++VN +     +  E+   LK           R  +T++E R   R    +E    +P  E  T               W  +I +  L++G  G GFS+L+    LD    V+V +  + + V +    L PG+R + +N   +   S  + VQ +K +           K  + ++ ++K   +SL ++I
Sbjct:  269 VIVKTILPGGIADQDGRLRSGDHILRIGDTDLHGMGSEQVAQVLRQCGN-RVKLVVTRAPVE------ETPSAVMSVVLPTVSEQ-QVPKQNKEEEAESF-----------NVCLTKNAQGLGITIAGYVGDKNSEPSGIFVKSITKDSAVDQDGRIHVGDQITAVDGVNIQGHTNQQAVELLRHTGQTVRLKLIRRGFRPEEIPPAVSPSASVLSPSAAIPTTTTVMRELELERRQEEVIKKWQKILGPSNEVIVAQV--EKFS-----------ESSGLGI----SLEASRGHHYIRSVLPEGPVGRCGQLFSGDELVEVNGISLIGETHKEVVRILKELPIFVYMTCCRPPETQSE-RSDPRSEQVTEESAGNP--EAATQDTVTEEGIGSSLAMWELEIQNIELEKGEGGLGFSILDYQDPLDPAKTVIVIRSLVPDGVAETDGRLLPGDRLMYVNDTNLENASLEDAVQALKGA-----------KLGKVQIGVAKPLPVSLSVSI 729          
BLAST of Glutamate receptor-interacting protein 2 vs. Ensembl Medaka
Match: PARD3 (partitioning defective 3 homolog [Source:NCBI gene;Acc:101161760])

HSP 1 Score: 62.003 bits (149), Expect = 5.017e-9
Identity = 59/229 (25.76%), Postives = 93/229 (40.61%), Query Frame = 1
Query:  823 IELRKQNSPFGLALEEIRNPLHNAMIIVFKYVVPEMTAGKDGRLHAGDRLLQVNGKSVEGVDFRQVCKWIKSSPRGRLVLYICKPHFETINYDPSSPANDDKYYFNTIRDMDK-LPKLSEETDGECLRLPAVPEYMETHITL-----------------KRTENKLGIFLDIVDEGKNGARIKKMTHGIAKNDGRLHEGDFVTKVN-EISLKVDNKSKLDLCLKQISAD 1452
            ++L+K     G ++     P+   + I  K ++P   A +DGRL AGDRLL+V+G+ + G    +V   ++++P   +V  +                         +RD D  LP+  EE D    R     E+M   I L                 K T+  LGIF+  +           M  G A  DGRLH  D +  VN E  L + N+  ++   K +S +
Sbjct:  434 VQLKKGEEGLGFSITSRDVPIGGMVPIYIKNILPRGAAIQDGRLKAGDRLLEVSGEDLSGKSQEEVVALLRAAPMDGIVNLLV------------------------VRDEDSLLPREVEEEDTALTR-DGTQEFMTFEIPLNDSGSAGLGVSVKGNRSKDTQADLGIFVKSI-----------MNGGAASKDGRLHVNDQLIAVNGESLLDMTNQEAMEALRKSMSVE 626          
BLAST of Glutamate receptor-interacting protein 2 vs. Ensembl Medaka
Match: PARD3 (partitioning defective 3 homolog [Source:NCBI gene;Acc:101161760])

HSP 1 Score: 61.6178 bits (148), Expect = 5.427e-9
Identity = 59/229 (25.76%), Postives = 93/229 (40.61%), Query Frame = 1
Query:  823 IELRKQNSPFGLALEEIRNPLHNAMIIVFKYVVPEMTAGKDGRLHAGDRLLQVNGKSVEGVDFRQVCKWIKSSPRGRLVLYICKPHFETINYDPSSPANDDKYYFNTIRDMDK-LPKLSEETDGECLRLPAVPEYMETHITL-----------------KRTENKLGIFLDIVDEGKNGARIKKMTHGIAKNDGRLHEGDFVTKVN-EISLKVDNKSKLDLCLKQISAD 1452
            ++L+K     G ++     P+   + I  K ++P   A +DGRL AGDRLL+V+G+ + G    +V   ++++P   +V  +                         +RD D  LP+  EE D    R     E+M   I L                 K T+  LGIF+  +           M  G A  DGRLH  D +  VN E  L + N+  ++   K +S +
Sbjct:  417 VQLKKGEEGLGFSITSRDVPIGGMVPIYIKNILPRGAAIQDGRLKAGDRLLEVSGEDLSGKSQEEVVALLRAAPMDGIVNLLV------------------------VRDEDSLLPREVEEEDTALTR-DGTQEFMTFEIPLNDSGSAGLGVSVKGNRSKDTQADLGIFVKSI-----------MNGGAASKDGRLHVNDQLIAVNGESLLDMTNQEAMEALRKSMSVE 609          
BLAST of Glutamate receptor-interacting protein 2 vs. Ensembl Medaka
Match: PARD3 (partitioning defective 3 homolog [Source:NCBI gene;Acc:101161760])

HSP 1 Score: 61.6178 bits (148), Expect = 5.455e-9
Identity = 59/229 (25.76%), Postives = 93/229 (40.61%), Query Frame = 1
Query:  823 IELRKQNSPFGLALEEIRNPLHNAMIIVFKYVVPEMTAGKDGRLHAGDRLLQVNGKSVEGVDFRQVCKWIKSSPRGRLVLYICKPHFETINYDPSSPANDDKYYFNTIRDMDK-LPKLSEETDGECLRLPAVPEYMETHITL-----------------KRTENKLGIFLDIVDEGKNGARIKKMTHGIAKNDGRLHEGDFVTKVN-EISLKVDNKSKLDLCLKQISAD 1452
            ++L+K     G ++     P+   + I  K ++P   A +DGRL AGDRLL+V+G+ + G    +V   ++++P   +V  +                         +RD D  LP+  EE D    R     E+M   I L                 K T+  LGIF+  +           M  G A  DGRLH  D +  VN E  L + N+  ++   K +S +
Sbjct:  480 VQLKKGEEGLGFSITSRDVPIGGMVPIYIKNILPRGAAIQDGRLKAGDRLLEVSGEDLSGKSQEEVVALLRAAPMDGIVNLLV------------------------VRDEDSLLPREVEEEDTALTR-DGTQEFMTFEIPLNDSGSAGLGVSVKGNRSKDTQADLGIFVKSI-----------MNGGAASKDGRLHVNDQLIAVNGESLLDMTNQEAMEALRKSMSVE 672          
BLAST of Glutamate receptor-interacting protein 2 vs. Planmine SMEST
Match: SMESG000031603.1 (SMESG000031603.1)

HSP 1 Score: 2432.91 bits (6304), Expect = 0.000e+0
Identity = 1217/1224 (99.43%), Postives = 1222/1224 (99.84%), Query Frame = 1
Query:  112 MTMKDFSDKKVSKKWKSYFTGIILSNFTSFNKIDKYFRFNITESSSKAIQENWIRILGIDYEIISMNLCKRNQSLGVALEGRNEIARNTQEVVQHHFFKVILPSQCVGETGKFMVKDEILEVNGLKVVGLPTKEVLNTLRKVTNYFQIVVARSIIHNYDLASDYGGSEDNINSPISFYDMDDDESSQNGTLRSNVSNYSTTSRDFGSSVSFGGLIDGQHETVNDYLRNMVGWRGPIVIELRKQNSPFGLALEEIRNPLHNAMIIVFKYVVPEMTAGKDGRLHAGDRLLQVNGKSVEGVDFRQVCKWIKSSPRGRLVLYICKPHFETINYDPSSPANDDKYYFNTIRDMDKLPKLSEETDGECLRLPAVPEYMETHITLKRTENKLGIFLDIVDEGKNGARIKKMTHGIAKNDGRLHEGDFVTKVNEISLKVDNKSKLDLCLKQISADKRNYNISYITAEDVRLHNGKYGTVSSATNRLPQSSQIYPEFLSIKVTEPLNEINSDKTRNHKFSFETFDIIIKNDKQTGLGLVLSPSLKDPNRYISITDIHDNSLCGKSGLLKINDEILKVNNVDFENISINELGHFLKRAHKTENELRFQVRRLTCSENVPVDPLIEKLTWFPDIYHRVLKRGPNGFGFSLLELDSNNGVVVDKVDLNKVCDLKPGERFVMINKCTVITCSKPNVVQMVKNSTRNLELIIETPKYREFRVKISKDSSMSLGLNIAGGRDTRFPIPVIESLVPNRTSKFSEELFTLDLITEVDGTNVTKQNHAEIIQIFRSTGRETTFKILRKIPYIKRGVFLNTEIPDFPRSYLQDVQYSVTLNKPVDSITSFGIHFTDIVIVDEKDNFEVLSRFKAVLFIQKNSLAEKYAPQIKEFDYLISIDGVSVNDCDLLCEDIKETIDKHNRVNLVFSKDIPYNLPEVKDHDSPILLRRXXXXXXXXXXXXXXXXXXXXQSLPSITCNLVTCDSSNTENGIVDVDKLANNEKRIEVISEMEDPEVDYPIVIPIEIEENSPDVDESTNILPLPPIICDLVNSDTNNTENGTVDVDKLADNKETIEKIESVIEDPEVDKPIANNNPDVDECTRDKVNNGENDSPENSLNISTGDQEDEKIKSDNPEMESDEIPGLPINISNVIIKRVPNIELGFQLYGGLEGGPRGESLPVFVIGVEKNTCNWPEDQEEPFLKNGQQLLKFNGQVLSALKVSTIQTMINEAHDELKFKLVSLK 3783
            MTMKDFSDKKVSKKWKSYFTGIILSNFTSFNKIDKYFRFNITESSSKAIQENWIRILGIDYEIISMNLCKRNQSLGVALEGRNEIARNTQEVVQHHFFKVILPSQCVGETGKFMVKDEILEVNGLKVVGLPTKEVLNTLRKVTNYFQIVVARSIIHNYDLASDYGGSEDNINSPISFYDMDDDESSQNGTLRSNVSNYSTTSRDFGSSVSFGGLIDGQHETVNDYLRNMVGWRGPIVIELRKQNSPFGLALEEIRNPLHNAMIIVFKYVVPEMTAGKDGRLHAGDRLLQVNGKSVEGVDFRQVCKWIKSSPRGRLVLYICKPHFETINYDP+SPANDDKYYFNTIRDMDKLPKLSEETDGECLRLPAVPEYMETHITLKRTENKLGIFLDIVDEGKNGARIKKMTHGIAKNDGRLHEGDFVTKVNEISLKVDNKSKLDLCLKQISADKRNYNISYITAEDVRLHNGKYGTVSSATNRLPQSSQIYPEFLSIKVTEPLNEINSDKTRNHKFSFETFDIIIKNDKQTGLGLVLSPSLKDPNRYISITDIHDNSLCGKSGLLKINDEILKVNNVDFENISINELGHFLKRAHKTENELRFQVRRLTCSENVPVDPLIEKLTWFPDIYHRVLKRGPNGFGFSLLELDSNNGVVVDKVDLNKVCDLKPGERFVMINKCTVITCSKPNVVQMVKNSTRNLELIIETPKYREF+VKISKDSSMSLGLNIAGGRDTRFPIPVIESLVPNRTSKFSEELFTLDLITEVDGTNVTKQNHAEIIQIFRSTGRETTFKILRKIPYIKRGVFLNTEIPDFPRSYLQDVQYSVTLNKPVDSITSFGIHFTDIVIVDEKDNFEVLSRFKAVLFIQKNSLAEKYAPQIKEFDYLISIDGVSVNDCDLLCEDIKETIDKHNRVNLVFSKDIPYNLPEVKDHDSPILLRRSNISQSESSSEENLSVHSNSQSLPSITCNLVT DSSNTENGIVDVDKLA+NEKRIEVISE+EDPEVDYPIVIP+EIEENSPDVDESTNILPLPPIICDLVNSDTNNTENGTVDVDKLADNKETIEKIESVIEDPEVDKPIANNNPDVDECTRDKVNN ENDSPENSLNISTGDQEDEKIKSDNPEMESDEIPGLPINISNVIIKRVPNIELGFQLYGGLEGGPRGESLPVFVIGVEKNTCNWPEDQEEPFLKNGQQLLKFNGQVLSALKVSTIQTMINEAHDELKFKLVSLK
Sbjct:    1 MTMKDFSDKKVSKKWKSYFTGIILSNFTSFNKIDKYFRFNITESSSKAIQENWIRILGIDYEIISMNLCKRNQSLGVALEGRNEIARNTQEVVQHHFFKVILPSQCVGETGKFMVKDEILEVNGLKVVGLPTKEVLNTLRKVTNYFQIVVARSIIHNYDLASDYGGSEDNINSPISFYDMDDDESSQNGTLRSNVSNYSTTSRDFGSSVSFGGLIDGQHETVNDYLRNMVGWRGPIVIELRKQNSPFGLALEEIRNPLHNAMIIVFKYVVPEMTAGKDGRLHAGDRLLQVNGKSVEGVDFRQVCKWIKSSPRGRLVLYICKPHFETINYDPTSPANDDKYYFNTIRDMDKLPKLSEETDGECLRLPAVPEYMETHITLKRTENKLGIFLDIVDEGKNGARIKKMTHGIAKNDGRLHEGDFVTKVNEISLKVDNKSKLDLCLKQISADKRNYNISYITAEDVRLHNGKYGTVSSATNRLPQSSQIYPEFLSIKVTEPLNEINSDKTRNHKFSFETFDIIIKNDKQTGLGLVLSPSLKDPNRYISITDIHDNSLCGKSGLLKINDEILKVNNVDFENISINELGHFLKRAHKTENELRFQVRRLTCSENVPVDPLIEKLTWFPDIYHRVLKRGPNGFGFSLLELDSNNGVVVDKVDLNKVCDLKPGERFVMINKCTVITCSKPNVVQMVKNSTRNLELIIETPKYREFQVKISKDSSMSLGLNIAGGRDTRFPIPVIESLVPNRTSKFSEELFTLDLITEVDGTNVTKQNHAEIIQIFRSTGRETTFKILRKIPYIKRGVFLNTEIPDFPRSYLQDVQYSVTLNKPVDSITSFGIHFTDIVIVDEKDNFEVLSRFKAVLFIQKNSLAEKYAPQIKEFDYLISIDGVSVNDCDLLCEDIKETIDKHNRVNLVFSKDIPYNLPEVKDHDSPILLRRSNISQSESSSEENLSVHSNSQSLPSITCNLVTGDSSNTENGIVDVDKLADNEKRIEVISEIEDPEVDYPIVIPVEIEENSPDVDESTNILPLPPIICDLVNSDTNNTENGTVDVDKLADNKETIEKIESVIEDPEVDKPIANNNPDVDECTRDKVNNDENDSPENSLNISTGDQEDEKIKSDNPEMESDEIPGLPINISNVIIKRVPNIELGFQLYGGLEGGPRGESLPVFVIGVEKNTCNWPEDQEEPFLKNGQQLLKFNGQVLSALKVSTIQTMINEAHDELKFKLVSLK 1224          
BLAST of Glutamate receptor-interacting protein 2 vs. Planmine SMEST
Match: SMESG000031603.1 (SMESG000031603.1)

HSP 1 Score: 2429.05 bits (6294), Expect = 0.000e+0
Identity = 1215/1222 (99.43%), Postives = 1220/1222 (99.84%), Query Frame = 1
Query:  118 MKDFSDKKVSKKWKSYFTGIILSNFTSFNKIDKYFRFNITESSSKAIQENWIRILGIDYEIISMNLCKRNQSLGVALEGRNEIARNTQEVVQHHFFKVILPSQCVGETGKFMVKDEILEVNGLKVVGLPTKEVLNTLRKVTNYFQIVVARSIIHNYDLASDYGGSEDNINSPISFYDMDDDESSQNGTLRSNVSNYSTTSRDFGSSVSFGGLIDGQHETVNDYLRNMVGWRGPIVIELRKQNSPFGLALEEIRNPLHNAMIIVFKYVVPEMTAGKDGRLHAGDRLLQVNGKSVEGVDFRQVCKWIKSSPRGRLVLYICKPHFETINYDPSSPANDDKYYFNTIRDMDKLPKLSEETDGECLRLPAVPEYMETHITLKRTENKLGIFLDIVDEGKNGARIKKMTHGIAKNDGRLHEGDFVTKVNEISLKVDNKSKLDLCLKQISADKRNYNISYITAEDVRLHNGKYGTVSSATNRLPQSSQIYPEFLSIKVTEPLNEINSDKTRNHKFSFETFDIIIKNDKQTGLGLVLSPSLKDPNRYISITDIHDNSLCGKSGLLKINDEILKVNNVDFENISINELGHFLKRAHKTENELRFQVRRLTCSENVPVDPLIEKLTWFPDIYHRVLKRGPNGFGFSLLELDSNNGVVVDKVDLNKVCDLKPGERFVMINKCTVITCSKPNVVQMVKNSTRNLELIIETPKYREFRVKISKDSSMSLGLNIAGGRDTRFPIPVIESLVPNRTSKFSEELFTLDLITEVDGTNVTKQNHAEIIQIFRSTGRETTFKILRKIPYIKRGVFLNTEIPDFPRSYLQDVQYSVTLNKPVDSITSFGIHFTDIVIVDEKDNFEVLSRFKAVLFIQKNSLAEKYAPQIKEFDYLISIDGVSVNDCDLLCEDIKETIDKHNRVNLVFSKDIPYNLPEVKDHDSPILLRRXXXXXXXXXXXXXXXXXXXXQSLPSITCNLVTCDSSNTENGIVDVDKLANNEKRIEVISEMEDPEVDYPIVIPIEIEENSPDVDESTNILPLPPIICDLVNSDTNNTENGTVDVDKLADNKETIEKIESVIEDPEVDKPIANNNPDVDECTRDKVNNGENDSPENSLNISTGDQEDEKIKSDNPEMESDEIPGLPINISNVIIKRVPNIELGFQLYGGLEGGPRGESLPVFVIGVEKNTCNWPEDQEEPFLKNGQQLLKFNGQVLSALKVSTIQTMINEAHDELKFKLVSLK 3783
            MKDFSDKKVSKKWKSYFTGIILSNFTSFNKIDKYFRFNITESSSKAIQENWIRILGIDYEIISMNLCKRNQSLGVALEGRNEIARNTQEVVQHHFFKVILPSQCVGETGKFMVKDEILEVNGLKVVGLPTKEVLNTLRKVTNYFQIVVARSIIHNYDLASDYGGSEDNINSPISFYDMDDDESSQNGTLRSNVSNYSTTSRDFGSSVSFGGLIDGQHETVNDYLRNMVGWRGPIVIELRKQNSPFGLALEEIRNPLHNAMIIVFKYVVPEMTAGKDGRLHAGDRLLQVNGKSVEGVDFRQVCKWIKSSPRGRLVLYICKPHFETINYDP+SPANDDKYYFNTIRDMDKLPKLSEETDGECLRLPAVPEYMETHITLKRTENKLGIFLDIVDEGKNGARIKKMTHGIAKNDGRLHEGDFVTKVNEISLKVDNKSKLDLCLKQISADKRNYNISYITAEDVRLHNGKYGTVSSATNRLPQSSQIYPEFLSIKVTEPLNEINSDKTRNHKFSFETFDIIIKNDKQTGLGLVLSPSLKDPNRYISITDIHDNSLCGKSGLLKINDEILKVNNVDFENISINELGHFLKRAHKTENELRFQVRRLTCSENVPVDPLIEKLTWFPDIYHRVLKRGPNGFGFSLLELDSNNGVVVDKVDLNKVCDLKPGERFVMINKCTVITCSKPNVVQMVKNSTRNLELIIETPKYREF+VKISKDSSMSLGLNIAGGRDTRFPIPVIESLVPNRTSKFSEELFTLDLITEVDGTNVTKQNHAEIIQIFRSTGRETTFKILRKIPYIKRGVFLNTEIPDFPRSYLQDVQYSVTLNKPVDSITSFGIHFTDIVIVDEKDNFEVLSRFKAVLFIQKNSLAEKYAPQIKEFDYLISIDGVSVNDCDLLCEDIKETIDKHNRVNLVFSKDIPYNLPEVKDHDSPILLRRSNISQSESSSEENLSVHSNSQSLPSITCNLVT DSSNTENGIVDVDKLA+NEKRIEVISE+EDPEVDYPIVIP+EIEENSPDVDESTNILPLPPIICDLVNSDTNNTENGTVDVDKLADNKETIEKIESVIEDPEVDKPIANNNPDVDECTRDKVNN ENDSPENSLNISTGDQEDEKIKSDNPEMESDEIPGLPINISNVIIKRVPNIELGFQLYGGLEGGPRGESLPVFVIGVEKNTCNWPEDQEEPFLKNGQQLLKFNGQVLSALKVSTIQTMINEAHDELKFKLVSLK
Sbjct:    1 MKDFSDKKVSKKWKSYFTGIILSNFTSFNKIDKYFRFNITESSSKAIQENWIRILGIDYEIISMNLCKRNQSLGVALEGRNEIARNTQEVVQHHFFKVILPSQCVGETGKFMVKDEILEVNGLKVVGLPTKEVLNTLRKVTNYFQIVVARSIIHNYDLASDYGGSEDNINSPISFYDMDDDESSQNGTLRSNVSNYSTTSRDFGSSVSFGGLIDGQHETVNDYLRNMVGWRGPIVIELRKQNSPFGLALEEIRNPLHNAMIIVFKYVVPEMTAGKDGRLHAGDRLLQVNGKSVEGVDFRQVCKWIKSSPRGRLVLYICKPHFETINYDPTSPANDDKYYFNTIRDMDKLPKLSEETDGECLRLPAVPEYMETHITLKRTENKLGIFLDIVDEGKNGARIKKMTHGIAKNDGRLHEGDFVTKVNEISLKVDNKSKLDLCLKQISADKRNYNISYITAEDVRLHNGKYGTVSSATNRLPQSSQIYPEFLSIKVTEPLNEINSDKTRNHKFSFETFDIIIKNDKQTGLGLVLSPSLKDPNRYISITDIHDNSLCGKSGLLKINDEILKVNNVDFENISINELGHFLKRAHKTENELRFQVRRLTCSENVPVDPLIEKLTWFPDIYHRVLKRGPNGFGFSLLELDSNNGVVVDKVDLNKVCDLKPGERFVMINKCTVITCSKPNVVQMVKNSTRNLELIIETPKYREFQVKISKDSSMSLGLNIAGGRDTRFPIPVIESLVPNRTSKFSEELFTLDLITEVDGTNVTKQNHAEIIQIFRSTGRETTFKILRKIPYIKRGVFLNTEIPDFPRSYLQDVQYSVTLNKPVDSITSFGIHFTDIVIVDEKDNFEVLSRFKAVLFIQKNSLAEKYAPQIKEFDYLISIDGVSVNDCDLLCEDIKETIDKHNRVNLVFSKDIPYNLPEVKDHDSPILLRRSNISQSESSSEENLSVHSNSQSLPSITCNLVTGDSSNTENGIVDVDKLADNEKRIEVISEIEDPEVDYPIVIPVEIEENSPDVDESTNILPLPPIICDLVNSDTNNTENGTVDVDKLADNKETIEKIESVIEDPEVDKPIANNNPDVDECTRDKVNNDENDSPENSLNISTGDQEDEKIKSDNPEMESDEIPGLPINISNVIIKRVPNIELGFQLYGGLEGGPRGESLPVFVIGVEKNTCNWPEDQEEPFLKNGQQLLKFNGQVLSALKVSTIQTMINEAHDELKFKLVSLK 1222          
BLAST of Glutamate receptor-interacting protein 2 vs. Planmine SMEST
Match: SMESG000056195.1 (SMESG000056195.1)

HSP 1 Score: 120.168 bits (300), Expect = 4.506e-27
Identity = 115/434 (26.50%), Postives = 200/434 (46.08%), Query Frame = 1
Query:  268 WIRILGIDYEIISMNLCK--RNQSLGVALEGRNEIARNTQEVVQHHFFKVILPSQCVGETGKFMVKDEILEVNGLKVVGLPTKEVLNTLRKVTNYFQIVVARSIIHNYDLASDYGGSEDNINSPISFYDMDD--DESSQNGTLRS-------NVSNYSTTSRDFGSSVSFGGLIDGQHETVNDYLRNMVGW-RGPIVIELRKQNSPFGLALEEIRNPLH-NAMIIVFKYVVPEMTAGKDGRLHAGDRLLQVNGKSVEGVDFRQVCKWIKSSPRGRLVLYICKPHFETINYDPSSPANDDKYYFNTIRDMDKLPKLSEETDGECLRL-----PAVPEYMETHITL-KRTENKLGIFL---DIVDEGKNGARIKKMTHGI-AKNDGRLHEGDFVTKVNEISLKVDNKSKLDLCLKQISADKRNYNISYITAEDVRL 1500
            W + +  + EII     K   +  LG++LEG  ++  N  EV  HH+ + I P+   G  G   VKDE+LE N  ++ GL   E +N L+ +    +IVVAR++  + +   D   SE+   +     D+DD     + +G+L S       N+ ++           S    +D  H         +  W R    ++L K+++  G ++ + ++P+     +IV + +VP   A +DGR+  GDRL+ VN   V   +  +  + +K +  G + L I K      + +  +  ND   Y N        PKL +E D E   L       +PE +E  I + K +  KLGI L    +    +NG  I  +  G  A    RL  GD+VTK++  S++  +++++   LK+I++   +  +++I   D +L
Sbjct:  534 WKKRIDGNREIIIAEFSKFTEDGGLGISLEGTVDVEDNGLEVHPHHYIRSITPNGPAGRNGFLKVKDELLEANDKRIYGLNHLEAVNVLKNLPLSVRIVVARAVPVDSNCFLDDEVSEE---ADRLCQDLDDIIARETGSGSLYSIKAKSQDNIDDWPLQEGKLSEEASRSRSLDQVH--------GLAIWDRQVTYVDLEKRSNGLGFSVLDYQDPVDPQQSVIVIRSLVPNGAASRDGRIFPGDRLMSVNNIDVSRANMTEAVEALKKTEPGIVRLGIVKALCLESDNNQDTTINDCNLYENV-----SSPKLLDEIDSEFNNLDEDSIAPIPEALEHKIRIHKLSGQKLGIHLKSDKLSTNNENGFVITSIDVGSPAHKCNRLSIGDYVTKIDNFSIRQSSEAEVQAILKRITSYSDDIKVNFIPEADYQL 951          
BLAST of Glutamate receptor-interacting protein 2 vs. Planmine SMEST
Match: SMESG000056195.1 (SMESG000056195.1)

HSP 1 Score: 120.168 bits (300), Expect = 4.796e-27
Identity = 115/434 (26.50%), Postives = 200/434 (46.08%), Query Frame = 1
Query:  268 WIRILGIDYEIISMNLCK--RNQSLGVALEGRNEIARNTQEVVQHHFFKVILPSQCVGETGKFMVKDEILEVNGLKVVGLPTKEVLNTLRKVTNYFQIVVARSIIHNYDLASDYGGSEDNINSPISFYDMDD--DESSQNGTLRS-------NVSNYSTTSRDFGSSVSFGGLIDGQHETVNDYLRNMVGW-RGPIVIELRKQNSPFGLALEEIRNPLH-NAMIIVFKYVVPEMTAGKDGRLHAGDRLLQVNGKSVEGVDFRQVCKWIKSSPRGRLVLYICKPHFETINYDPSSPANDDKYYFNTIRDMDKLPKLSEETDGECLRL-----PAVPEYMETHITL-KRTENKLGIFL---DIVDEGKNGARIKKMTHGI-AKNDGRLHEGDFVTKVNEISLKVDNKSKLDLCLKQISADKRNYNISYITAEDVRL 1500
            W + +  + EII     K   +  LG++LEG  ++  N  EV  HH+ + I P+   G  G   VKDE+LE N  ++ GL   E +N L+ +    +IVVAR++  + +   D   SE+   +     D+DD     + +G+L S       N+ ++           S    +D  H         +  W R    ++L K+++  G ++ + ++P+     +IV + +VP   A +DGR+  GDRL+ VN   V   +  +  + +K +  G + L I K      + +  +  ND   Y N        PKL +E D E   L       +PE +E  I + K +  KLGI L    +    +NG  I  +  G  A    RL  GD+VTK++  S++  +++++   LK+I++   +  +++I   D +L
Sbjct:  550 WKKRIDGNREIIIAEFSKFTEDGGLGISLEGTVDVEDNGLEVHPHHYIRSITPNGPAGRNGFLKVKDELLEANDKRIYGLNHLEAVNVLKNLPLSVRIVVARAVPVDSNCFLDDEVSEE---ADRLCQDLDDIIARETGSGSLYSIKAKSQDNIDDWPLQEGKLSEEASRSRSLDQVH--------GLAIWDRQVTYVDLEKRSNGLGFSVLDYQDPVDPQQSVIVIRSLVPNGAASRDGRIFPGDRLMSVNNIDVSRANMTEAVEALKKTEPGIVRLGIVKALCLESDNNQDTTINDCNLYENV-----SSPKLLDEIDSEFNNLDEDSIAPIPEALEHKIRIHKLSGQKLGIHLKSDKLSTNNENGFVITSIDVGSPAHKCNRLSIGDYVTKIDNFSIRQSSEAEVQAILKRITSYSDDIKVNFIPEADYQL 967          
BLAST of Glutamate receptor-interacting protein 2 vs. Planmine SMEST
Match: SMESG000053393.1 (SMESG000053393.1)

HSP 1 Score: 76.6406 bits (187), Expect = 1.199e-13
Identity = 50/169 (29.59%), Postives = 90/169 (53.25%), Query Frame = 1
Query:   76 QFSHLYS*FDFSMTMKDFSDKKVSKKWKSYFTGIILSNF---TSFNKIDKYFRF-NITESSSKAIQENWIRILGIDYEIISMNLCKRNQSLGVALEGRNEIARNTQ-EVVQHHFFKVILPSQCVGETGKFMVKDEILEVNGLKVVGLPTKEVLNTLRKVTNYFQIVVAR 567
            Q ++  S  +  +++ DF   +   K  +  T ++++N    + FN      ++ +I ++    I+  W +I+G +Y+I+   + K N+ LG++LEG  ++   T  E   HH+ + I     +G  G F   DE+LE NG K+ G+P +EVL +L+ + N  QIV AR
Sbjct:  515 QLANSSSEDEAEISILDFPLNQRPAKENTTKTDVLIANILPNSGFNVQKMNLKYASIDKTIEDTIKSTWNKIIGGNYDILISYINKTNEGLGISLEGTVDVDDVTGLEDKPHHYIRTITADGPIGLDGTFKSGDELLEANGKKLHGVPYQEVLTSLKSLPNRVQIVAAR 683          

HSP 2 Score: 73.1738 bits (178), Expect = 1.457e-12
Identity = 41/124 (33.06%), Postives = 70/124 (56.45%), Query Frame = 1
Query:  724 FGSSVSFGGLIDGQHETVN---DYLRNMVGWRGPIVIELRKQNSPFGLALEEIRNPLHNAMIIVFKYVVPEMTAGKDGRLHAGDRLLQVNGKSVEGVDFRQ-VCKWIKSSPRGRLVLYICKPHF 1083
            F  S SF  ++  +  T N    YL+++  W GPI++EL K++   G ++E  ++   N  +IV   +VP   A  DGR+  GDRL+ +N   V+ +  +Q V + ++S  +G+++L I KP F
Sbjct:  790 FVKSNSFSEMLPIKTLTANRSLQYLKDVAMWSGPILVELTKESQGLGFSIEYYQDASSNVPVIVISSLVPNGVAHLDGRIIPGDRLIFINEVEVDALSSKQEVIEALQSLSKGQVLLGIAKPMF 913          

HSP 3 Score: 64.3142 bits (155), Expect = 6.880e-10
Identity = 64/259 (24.71%), Postives = 121/259 (46.72%), Query Frame = 1
Query: 1588 VTEPLNEINSDKTRNHKFSFETFDII-IKNDKQ--TGLGLVLSPSLKDPNRYISITDIHDNSLCGKSGLLKINDEILKVNNVDFENISINELGHFLKRAHKTENELRFQVRR-------LTC---SENVPVDPLIEK-------------------LTWFPDIYHRVLKRGPNGFGFSLLELDSNN--GVVVDKVDLNKVC----DLKPGERFVMINKCTVITCSKPNVVQMVKNSTRNLELIIETPKYREFRVKISKD 2250
            VT  L+EI + +  +   + E+  ++ I+ DKQ   G+GL+L  +    +    I    DNS+    G L I DE+LK+N++D   +S + +   +K+      ++   ++R       + C   S N  V P  EK                   L  + DI+H  L++   GFGF +++ ++N+  G+ V KV ++ +      L+ G+R ++IN   V+     +V++ ++     LE+++        R+ IS+D
Sbjct: 1476 VTPDLSEIEAIRNGHKSSTDESGKVMNIEIDKQGKKGMGLLLVGNKDCSSMNCYICGFKDNSVAALDGQLMIGDELLKINSIDVLGMSHSNVAPIIKKCQMESEKIMLTIKRHPDNLVKMACIPASVNTSVAPC-EKSENAVETSTDENQISSNNNLQGYGDIFHVHLEKSVQGFGFFIMDCNANDEAGIYVKKVTVDGIAANEGTLREGDRILLINDELVVNEDYDSVLKRLRGCKNALEMVV-------GRITISQD 1726          
The following BLAST results are available for this feature:
BLAST of Glutamate receptor-interacting protein 2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MPDZ1.709e-2126.88multiple PDZ domain crumbs cell polarity complex c... [more]
MPDZ1.771e-2126.88multiple PDZ domain crumbs cell polarity complex c... [more]
MPDZ1.836e-2126.88multiple PDZ domain crumbs cell polarity complex c... [more]
MPDZ1.939e-2126.88multiple PDZ domain crumbs cell polarity complex c... [more]
MPDZ2.101e-2126.88multiple PDZ domain crumbs cell polarity complex c... [more]
back to top
BLAST of Glutamate receptor-interacting protein 2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mpz-11.578e-630.71Multiple PDZ domain protein [Source:UniProtKB/TrE... [more]
mpz-11.829e-630.71Multiple PDZ domain protein [Source:UniProtKB/TrE... [more]
mpz-11.830e-630.71Multiple PDZ domain protein [Source:UniProtKB/TrE... [more]
mpz-11.844e-630.71Multiple PDZ domain protein [Source:UniProtKB/TrE... [more]
mpz-11.972e-630.71Multiple PDZ domain protein [Source:UniProtKB/TrE... [more]
back to top
BLAST of Glutamate receptor-interacting protein 2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Patj8.943e-2026.39gene:FBgn0067864 transcript:FBtr0072781[more]
Patj8.943e-2026.39gene:FBgn0067864 transcript:FBtr0301625[more]
Patj8.943e-2026.39gene:FBgn0067864 transcript:FBtr0072779[more]
CG158033.989e-923.31gene:FBgn0038606 transcript:FBtr0345256[more]
CG158031.849e-722.54gene:FBgn0038606 transcript:FBtr0302308[more]
back to top
BLAST of Glutamate receptor-interacting protein 2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:dkey-92j12.52.572e-2325.32si:dkey-92j12.5 [Source:ZFIN;Acc:ZDB-GENE-090313-3... [more]
si:dkey-92j12.52.646e-2325.32si:dkey-92j12.5 [Source:ZFIN;Acc:ZDB-GENE-090313-3... [more]
ptpn132.859e-826.92protein tyrosine phosphatase non-receptor type 13 ... [more]
pdzd22.454e-722.61PDZ domain containing 2 [Source:ZFIN;Acc:ZDB-GENE-... [more]
pdzd22.816e-722.61PDZ domain containing 2 [Source:ZFIN;Acc:ZDB-GENE-... [more]
back to top
BLAST of Glutamate receptor-interacting protein 2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
iffo23.638e-2223.42intermediate filament family orphan 2 [Source:Xenb... [more]
iffo22.201e-2123.61intermediate filament family orphan 2 [Source:Xenb... [more]
iffo24.413e-2123.77intermediate filament family orphan 2 [Source:Xenb... [more]
iffo26.793e-2123.25intermediate filament family orphan 2 [Source:Xenb... [more]
iffo21.168e-1927.33intermediate filament family orphan 2 [Source:Xenb... [more]
back to top
BLAST of Glutamate receptor-interacting protein 2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Mpdz1.301e-2128.67multiple PDZ domain protein [Source:MGI Symbol;Acc... [more]
Mpdz1.386e-2128.67multiple PDZ domain protein [Source:MGI Symbol;Acc... [more]
Mpdz1.446e-2128.67multiple PDZ domain protein [Source:MGI Symbol;Acc... [more]
Mpdz1.461e-2128.67multiple PDZ domain protein [Source:MGI Symbol;Acc... [more]
Sntb21.197e-733.33syntrophin, basic 2 [Source:MGI Symbol;Acc:MGI:101... [more]
back to top
BLAST of Glutamate receptor-interacting protein 2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O55164|MPDZ_RAT6.092e-2128.67Multiple PDZ domain protein OS=Rattus norvegicus O... [more]
sp|O75970|MPDZ_HUMAN8.206e-2126.88Multiple PDZ domain protein OS=Homo sapiens OX=960... [more]
sp|Q8VBX6|MPDZ_MOUSE9.697e-2128.67Multiple PDZ domain protein OS=Mus musculus OX=100... [more]
sp|Q9NB04|PATJ_DROME8.965e-1926.39Patj homolog OS=Drosophila melanogaster OX=7227 GN... [more]
sp|Q13425|SNTB2_HUMAN8.257e-733.33Beta-2-syntrophin OS=Homo sapiens OX=9606 GN=SNTB2... [more]
back to top
BLAST of Glutamate receptor-interacting protein 2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2C9KCL71.385e-2924.26Uncharacterized protein OS=Biomphalaria glabrata O... [more]
A0A224X4S03.504e-2925.00Uncharacterized protein (Fragment) OS=Panstrongylu... [more]
A0A267DNP02.214e-2726.35Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
A0A5B7F8E48.340e-2729.41Patj OS=Portunus trituberculatus OX=210409 GN=Patj... [more]
A0A0K2SZ767.543e-2625.80Multiple PDZ domain proteinlike [Acyrthosiphon pis... [more]
back to top
BLAST of Glutamate receptor-interacting protein 2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000021866.22.237e-2223.35pep primary_assembly:Astyanax_mexicanus-2.0:21:128... [more]
ENSAMXT00000037958.12.818e-1725.96pep primary_assembly:Astyanax_mexicanus-2.0:21:128... [more]
ENSAMXT00000041966.13.220e-1725.96pep primary_assembly:Astyanax_mexicanus-2.0:21:128... [more]
patj4.417e-1025.11PATJ crumbs cell polarity complex component [Sourc... [more]
lnx2a2.066e-821.43ligand of numb-protein X 2a [Source:ZFIN;Acc:ZDB-G... [more]
back to top
BLAST of Glutamate receptor-interacting protein 2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSPMAT00000006056.15.581e-728.29pep scaffold:Pmarinus_7.0:GL477535:225:55869:1 gen... [more]
ENSPMAT00000002205.17.447e-724.56pep scaffold:Pmarinus_7.0:GL477144:51012:68257:1 g... [more]
back to top
BLAST of Glutamate receptor-interacting protein 2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Glutamate receptor-interacting protein 2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO337062.989e-1522.92Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO272412.059e-741.07Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Glutamate receptor-interacting protein 2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MPDZ7.572e-1725.45multiple PDZ domain protein-like [Source:NCBI gene... [more]
MPDZ9.780e-1722.37multiple PDZ domain crumbs cell polarity complex c... [more]
PARD35.017e-925.76partitioning defective 3 homolog [Source:NCBI gene... [more]
PARD35.427e-925.76partitioning defective 3 homolog [Source:NCBI gene... [more]
PARD35.455e-925.76partitioning defective 3 homolog [Source:NCBI gene... [more]
back to top
BLAST of Glutamate receptor-interacting protein 2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000031603.10.000e+099.43SMESG000031603.1[more]
SMESG000031603.10.000e+099.43SMESG000031603.1[more]
SMESG000056195.14.506e-2726.50SMESG000056195.1[more]
SMESG000056195.14.796e-2726.50SMESG000056195.1[more]
SMESG000053393.11.199e-1329.59SMESG000053393.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30009173 ID=SMED30009173|Name=Glutamate receptor-interacting protein 2|organism=Schmidtea mediterranea sexual|type=transcript|length=3941bp
TCGAATAATATCGCGGCAATAATGTTTTAAAAATTTGTTCATATTTTGTT
ATTTATTGCATTCAAGTTAAATTTTCAATTTAGCCATTTATATTCATAAT
TTGATTTTTCTATGACGATGAAAGATTTTTCTGACAAGAAAGTTAGCAAA
AAATGGAAATCTTATTTCACTGGAATTATACTTTCTAATTTCACTTCATT
CAATAAAATCGACAAATATTTTCGATTCAATATTACTGAATCTTCATCTA
AAGCGATTCAGGAAAACTGGATACGAATATTGGGCATTGATTATGAAATT
ATAAGTATGAATCTTTGTAAGCGAAATCAATCACTTGGCGTAGCTCTTGA
AGGTAGAAATGAGATAGCTAGAAATACTCAAGAAGTAGTTCAACATCATT
TTTTTAAAGTCATATTACCAAGCCAATGTGTTGGTGAAACGGGTAAATTT
ATGGTAAAAGATGAGATTTTAGAGGTCAATGGTCTTAAGGTTGTTGGATT
ACCTACGAAAGAAGTTTTAAATACTCTTAGAAAAGTCACAAATTATTTTC
AAATTGTTGTTGCTAGGTCGATTATTCATAATTATGATCTAGCAAGTGAT
TATGGGGGCTCGGAAGATAATATAAATTCTCCAATTTCATTTTATGATAT
GGATGACGACGAGTCCAGTCAAAATGGTACCCTACGGAGCAATGTTAGCA
ATTATAGCACGACTAGCCGAGATTTTGGATCGTCTGTTTCATTCGGTGGA
CTGATCGATGGTCAACATGAAACCGTTAATGATTACCTGCGAAACATGGT
AGGCTGGCGTGGTCCGATAGTTATTGAATTGCGGAAACAAAATTCACCTT
TTGGACTAGCTTTGGAAGAAATACGGAATCCATTGCATAATGCCATGATT
ATCGTGTTCAAATATGTTGTTCCCGAAATGACGGCCGGGAAAGATGGTCG
GTTACACGCTGGTGATAGGTTGCTACAAGTAAATGGAAAGTCGGTAGAAG
GAGTTGATTTCAGACAAGTCTGTAAATGGATAAAAAGTTCTCCAAGGGGA
CGATTGGTTCTTTATATTTGTAAACCGCATTTCGAAACAATAAACTATGA
CCCCTCGAGTCCTGCTAATGACGATAAATACTATTTCAACACGATACGTG
ACATGGATAAACTGCCAAAATTATCAGAAGAAACAGACGGTGAATGTCTT
CGACTGCCTGCGGTTCCTGAATATATGGAAACCCATATTACATTAAAAAG
AACGGAAAATAAACTCGGCATCTTTCTAGACATTGTAGACGAAGGAAAAA
ATGGGGCACGGATTAAAAAAATGACTCACGGAATCGCTAAAAACGACGGA
AGACTTCATGAAGGCGATTTTGTAACAAAAGTGAACGAAATCAGCCTGAA
AGTTGACAATAAATCAAAACTAGATCTATGTCTAAAGCAAATCAGTGCAG
ACAAACGAAATTACAACATTTCTTACATCACCGCAGAAGATGTCCGGCTG
CACAACGGCAAGTATGGTACAGTTTCCAGTGCGACAAACCGATTACCTCA
GTCATCTCAGATCTATCCAGAATTTTTATCTATTAAAGTAACTGAACCAT
TAAATGAAATCAATTCTGATAAAACTAGGAATCATAAATTTTCATTCGAA
ACGTTTGATATTATAATAAAAAATGACAAGCAAACTGGATTGGGGTTGGT
ACTTTCTCCTAGCTTAAAAGATCCTAATCGATATATCTCCATCACTGATA
TCCACGATAATTCTCTTTGTGGGAAATCTGGCTTGTTGAAAATAAACGAT
GAGATCTTAAAGGTGAATAACGTTGATTTCGAAAATATTTCAATAAATGA
GCTTGGTCATTTTTTGAAACGTGCTCATAAAACAGAAAATGAATTGCGTT
TTCAAGTAAGACGGTTGACTTGTTCTGAAAATGTGCCCGTTGATCCGCTA
ATAGAGAAACTGACGTGGTTTCCAGATATTTACCACCGTGTTTTGAAAAG
AGGCCCTAACGGATTTGGGTTTTCATTGCTGGAATTGGACTCCAATAATG
GAGTTGTTGTTGATAAGGTTGATTTAAATAAAGTCTGTGACCTGAAACCT
GGTGAACGATTCGTTATGATTAACAAGTGCACTGTAATCACTTGTTCAAA
ACCAAATGTGGTTCAAATGGTTAAAAATTCAACGAGAAACTTGGAATTGA
TCATTGAAACTCCTAAATATCGAGAGTTTCGAGTGAAAATCTCTAAAGAT
TCCTCGATGTCACTGGGTCTGAATATTGCTGGAGGCCGTGATACCAGATT
TCCTATTCCGGTGATTGAGAGTTTGGTTCCAAATCGAACATCAAAGTTTA
GTGAAGAATTGTTTACCCTTGATCTGATAACAGAAGTAGATGGAACAAAT
GTTACTAAACAAAATCATGCTGAAATCATCCAAATATTTCGTTCGACTGG
TCGAGAAACTACTTTCAAAATCCTCAGGAAAATTCCTTATATCAAACGAG
GAGTGTTTCTAAACACAGAAATCCCAGATTTTCCTCGCAGTTATTTACAA
GACGTCCAATATTCCGTTACTCTCAATAAGCCCGTCGATTCCATTACCTC
GTTCGGGATCCATTTCACTGATATAGTTATTGTCGATGAAAAAGACAATT
TCGAAGTTTTAAGCCGTTTTAAAGCTGTCTTGTTTATTCAGAAGAATTCT
CTTGCAGAAAAATATGCTCCTCAAATTAAGGAGTTTGATTATTTAATCTC
CATTGACGGAGTTTCGGTGAATGACTGTGACCTTCTTTGTGAAGATATCA
AAGAAACTATTGATAAGCACAATCGTGTTAATCTAGTTTTCTCCAAAGAT
ATTCCTTATAATTTGCCTGAAGTGAAAGACCACGATTCTCCCATCTTACT
GAGACGAAGCAATATCTCACAATCAGAAAGCAGCAGTGAAGAAAATCTAA
GTGTTCACTCGAATTCTCAGTCACTGCCTTCAATCACCTGTAATCTTGTC
ACTTGTGATTCCAGCAATACTGAGAATGGTATTGTGGATGTTGATAAGCT
AGCGAATAATGAAAAGAGAATTGAAGTCATAAGTGAGATGGAAGATCCGG
AAGTCGATTATCCCATCGTAATTCCTATAGAGATAGAAGAGAATAGTCCA
GACGTCGATGAATCTACGAATATCCTGCCACTACCACCAATAATCTGTGA
TCTTGTGAATAGTGATACTAACAATACTGAGAATGGTACAGTGGATGTGG
ATAAGCTTGCTGATAATAAAGAGACAATTGAAAAAATAGAAAGTGTTATA
GAAGATCCGGAAGTGGATAAACCCATCGCAAATAATAATCCAGATGTTGA
TGAATGTACAAGGGATAAAGTTAATAATGGTGAGAATGATTCACCCGAAA
ATTCATTGAATATTTCCACTGGAGACCAAGAGGACGAGAAGATAAAATCA
GACAATCCTGAAATGGAATCCGATGAGATTCCAGGATTGCCTATTAATAT
CAGCAATGTGATTATTAAACGAGTTCCAAACATTGAGTTGGGATTTCAAT
TATATGGAGGTCTAGAAGGAGGGCCGAGAGGTGAATCGTTGCCCGTGTTT
GTAATCGGGGTAGAAAAGAACACTTGTAATTGGCCGGAAGATCAAGAAGA
ACCATTTTTAAAGAATGGACAACAATTGCTCAAGTTCAACGGCCAAGTAT
TATCAGCATTAAAGGTTTCCACTATTCAAACAATGATAAATGAAGCCCAC
GACGAATTAAAGTTTAAATTGGTTTCCTTAAAATAAATTCTAGCGCTGAA
AAACAGAGCAACTCATTCGCTGATTTTTGATTTTATTTTTCTACTTTTAA
ATTTTGGATACAATTCTTGTATAATTAGATTTTTATATTAATTTTTGTTA
ATTGTATTTCGTAATATTTGAGAAATAATCACATGGAAATT
back to top

protein sequence of SMED30009173-orf-1

>SMED30009173-orf-1 ID=SMED30009173-orf-1|Name=SMED30009173-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1225bp
MTMKDFSDKKVSKKWKSYFTGIILSNFTSFNKIDKYFRFNITESSSKAIQ
ENWIRILGIDYEIISMNLCKRNQSLGVALEGRNEIARNTQEVVQHHFFKV
ILPSQCVGETGKFMVKDEILEVNGLKVVGLPTKEVLNTLRKVTNYFQIVV
ARSIIHNYDLASDYGGSEDNINSPISFYDMDDDESSQNGTLRSNVSNYST
TSRDFGSSVSFGGLIDGQHETVNDYLRNMVGWRGPIVIELRKQNSPFGLA
LEEIRNPLHNAMIIVFKYVVPEMTAGKDGRLHAGDRLLQVNGKSVEGVDF
RQVCKWIKSSPRGRLVLYICKPHFETINYDPSSPANDDKYYFNTIRDMDK
LPKLSEETDGECLRLPAVPEYMETHITLKRTENKLGIFLDIVDEGKNGAR
IKKMTHGIAKNDGRLHEGDFVTKVNEISLKVDNKSKLDLCLKQISADKRN
YNISYITAEDVRLHNGKYGTVSSATNRLPQSSQIYPEFLSIKVTEPLNEI
NSDKTRNHKFSFETFDIIIKNDKQTGLGLVLSPSLKDPNRYISITDIHDN
SLCGKSGLLKINDEILKVNNVDFENISINELGHFLKRAHKTENELRFQVR
RLTCSENVPVDPLIEKLTWFPDIYHRVLKRGPNGFGFSLLELDSNNGVVV
DKVDLNKVCDLKPGERFVMINKCTVITCSKPNVVQMVKNSTRNLELIIET
PKYREFRVKISKDSSMSLGLNIAGGRDTRFPIPVIESLVPNRTSKFSEEL
FTLDLITEVDGTNVTKQNHAEIIQIFRSTGRETTFKILRKIPYIKRGVFL
NTEIPDFPRSYLQDVQYSVTLNKPVDSITSFGIHFTDIVIVDEKDNFEVL
SRFKAVLFIQKNSLAEKYAPQIKEFDYLISIDGVSVNDCDLLCEDIKETI
DKHNRVNLVFSKDIPYNLPEVKDHDSPILLRRSNISQSESSSEENLSVHS
NSQSLPSITCNLVTCDSSNTENGIVDVDKLANNEKRIEVISEMEDPEVDY
PIVIPIEIEENSPDVDESTNILPLPPIICDLVNSDTNNTENGTVDVDKLA
DNKETIEKIESVIEDPEVDKPIANNNPDVDECTRDKVNNGENDSPENSLN
ISTGDQEDEKIKSDNPEMESDEIPGLPINISNVIIKRVPNIELGFQLYGG
LEGGPRGESLPVFVIGVEKNTCNWPEDQEEPFLKNGQQLLKFNGQVLSAL
KVSTIQTMINEAHDELKFKLVSLK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0003674molecular_function
GO:0030159receptor signaling complex scaffold activity
GO:0005515protein binding
GO:0008022protein C-terminus binding
Vocabulary: cellular component
TermDefinition
GO:0005938cell cortex
GO:0032019mitochondrial cloud
GO:0045495pole plasm
GO:0005737cytoplasm
GO:0005886plasma membrane
GO:0005923bicellular tight junction
GO:0014069postsynaptic density
GO:0016020membrane
GO:0016324apical plasma membrane
GO:0016327apicolateral plasma membrane
GO:0030054cell junction
GO:0030425dendrite
GO:0031410cytoplasmic vesicle
GO:0042995cell projection
GO:0043005neuron projection
GO:0043220Schmidt-Lanterman incisure
GO:0045202synapse
GO:0045211postsynaptic membrane
Vocabulary: biological process
TermDefinition
GO:0007275multicellular organism development
GO:0007281germ cell development
GO:0008354germ cell migration
GO:0009967positive regulation of signal transduction
GO:0007155cell adhesion
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000026gut
PLANA:0000070intestinal phagocyte
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036034PDZ_sf
IPR041489PDZ_6
IPR001478PDZ
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001478PDZ domainSMARTSM00228pdz_newcoord: 245..323
e-value: 5.8E-9
score: 45.8
coord: 829..914
e-value: 13.0
score: 2.1
coord: 1141..1224
e-value: 2.0
score: 9.8
coord: 383..459
e-value: 1.1
score: 12.1
coord: 73..154
e-value: 0.15
score: 20.4
coord: 525..603
e-value: 8.5E-5
score: 31.9
coord: 633..702
e-value: 0.11
score: 21.6
coord: 716..791
e-value: 2.8E-4
score: 30.2
IPR001478PDZ domainPFAMPF00595PDZcoord: 517..594
e-value: 2.3E-7
score: 31.1
IPR001478PDZ domainPROSITEPS50106PDZcoord: 375..430
score: 8.989
IPR001478PDZ domainPROSITEPS50106PDZcoord: 65..154
score: 10.657
IPR001478PDZ domainPROSITEPS50106PDZcoord: 1132..1224
score: 9.592
IPR001478PDZ domainPROSITEPS50106PDZcoord: 237..311
score: 13.612
IPR001478PDZ domainPROSITEPS50106PDZcoord: 707..791
score: 12.988
IPR001478PDZ domainPROSITEPS50106PDZcoord: 625..702
score: 9.31
IPR001478PDZ domainPROSITEPS50106PDZcoord: 516..588
score: 11.32
IPR036034PDZ superfamilyGENE3DG3DSA:2.30.42.10coord: 625..701
e-value: 1.8E-8
score: 36.2
IPR036034PDZ superfamilyGENE3DG3DSA:2.30.42.10coord: 372..465
e-value: 6.0E-7
score: 31.3
IPR036034PDZ superfamilyGENE3DG3DSA:2.30.42.10coord: 45..153
e-value: 2.4E-11
score: 45.6
IPR036034PDZ superfamilyGENE3DG3DSA:2.30.42.10coord: 702..794
e-value: 3.5E-11
score: 44.9
IPR036034PDZ superfamilyGENE3DG3DSA:2.30.42.10coord: 228..324
e-value: 1.0E-16
score: 62.9
IPR036034PDZ superfamilyGENE3DG3DSA:2.30.42.10coord: 499..608
e-value: 1.7E-12
score: 49.1
IPR036034PDZ superfamilySUPERFAMILYSSF50156PDZ domain-likecoord: 61..154
IPR036034PDZ superfamilySUPERFAMILYSSF50156PDZ domain-likecoord: 1123..1221
IPR036034PDZ superfamilySUPERFAMILYSSF50156PDZ domain-likecoord: 225..324
IPR036034PDZ superfamilySUPERFAMILYSSF50156PDZ domain-likecoord: 508..602
IPR036034PDZ superfamilySUPERFAMILYSSF50156PDZ domain-likecoord: 366..430
IPR036034PDZ superfamilySUPERFAMILYSSF50156PDZ domain-likecoord: 702..793
IPR036034PDZ superfamilySUPERFAMILYSSF50156PDZ domain-likecoord: 614..701
IPR041489PDZ domain 6PFAMPF17820PDZ_6coord: 267..318
e-value: 9.1E-7
score: 28.6
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1103..1119
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1087..1120
NoneNo IPR availablePANTHERPTHR19964MULTIPLE PDZ DOMAIN PROTEINcoord: 390..587
coord: 45..407
coord: 706..791
NoneNo IPR availableCDDcd00992PDZ_signalingcoord: 705..788
e-value: 2.06171E-10
score: 56.0359
NoneNo IPR availableCDDcd00992PDZ_signalingcoord: 514..600
e-value: 1.91881E-8
score: 50.6431
NoneNo IPR availableCDDcd00992PDZ_signalingcoord: 235..320
e-value: 1.54199E-9
score: 53.7247
NoneNo IPR availableCDDcd00992PDZ_signalingcoord: 626..699
e-value: 4.74189E-7
score: 46.7911