WH2 domain-containing protein

Overview
NameWH2 domain-containing protein
Smed IDSMED30009156
Length (bp)1230
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of WH2 domain-containing protein (SMED30009156) t-SNE clustered cells

Violin plots show distribution of expression levels for WH2 domain-containing protein (SMED30009156) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of WH2 domain-containing protein (SMED30009156) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for WH2 domain-containing protein (SMED30009156) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30009156

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30009156SMESG000024265.1 PL05003A2D02ncbi_smed_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
pharynxSMED30009156SMESG000024265.1 dd_Smed_v4_3207_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30009156SMESG000024265.1 dd_Smed_v4_3207_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30009156SMESG000024265.1 dd_Smed_v4_3207_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30009156SMESG000024265.1 dd_Smed_v4_3207_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of WH2 domain-containing protein vs. Ensembl Human
Match: WASF3 (WASP family member 3 [Source:HGNC Symbol;Acc:HGNC:12734])

HSP 1 Score: 87.8113 bits (216), Expect = 1.760e-18
Identity = 50/163 (30.67%), Postives = 92/163 (56.44%), Query Frame = 1
Query:   97 MPIANRCIVPVCVSQVKVPASVENEFEYIVNATLSNFIKQISCLTLKAKDIFDELAVSLTNMVDRSLILENKIDLLSLQVKKNDSLILEPLVNQQ----VEVYKIHLSRDDERFVQMEMPDCIKEMFDVAEPPPDLYKLDEFRKEEGDSLKYYTDPDFFLREW 573
            MP+  R I P  + +  +P  + +E E + N+TL+  I+Q+S L+  A+DIF EL     N   R+  L+++ID L+++V + DS + E  V+ Q     + +K    +D +   +  +P+ + ++++ ++ PP L  L  +R ++ D LK+YTDP +F   W
Sbjct:    1 MPLVKRNIEPRHLCRGALPEGITSELECVTNSTLAAIIRQLSSLSKHAEDIFGELFNEANNFYIRANSLQDRIDRLAVKVTQLDSTVEE--VSLQDINMKKAFKSSTVQDQQVVSKNSIPNPVADIYNQSDKPPPLNILTPYRDDKKDGLKFYTDPSYFFDLW 161          
BLAST of WH2 domain-containing protein vs. Ensembl Human
Match: WASF1 (WASP family member 1 [Source:HGNC Symbol;Acc:HGNC:12732])

HSP 1 Score: 83.9593 bits (206), Expect = 1.964e-18
Identity = 50/163 (30.67%), Postives = 87/163 (53.37%), Query Frame = 1
Query:   97 MPIANRCIVPVCVSQVKVPASVENEFEYIVNATLSNFIKQISCLTLKAKDIFDELAVSLTNMVDRSLILENKIDLLSLQVK----KNDSLILEPLVNQQVEVYKIHLSRDDERFVQMEMPDCIKEMFDVAEPPPDLYKLDEFRKEEGDSLKYYTDPDFFLREW 573
            MP+  R I P  +    +P  ++NE E + N +L+N I+Q+S L+  A+DIF EL     +   R   L+ ++D LS+ V     K + L L+ +  ++   ++    +D + F +  +P  ++E +DV E PP L  L  +R +  + LK+YT+P +F   W
Sbjct:    1 MPLVKRNIDPRHLCHTALPRGIKNELECVTNISLANIIRQLSSLSKYAEDIFGELFNEAHSFSFRVNSLQERVDRLSVSVTQLDPKEEELSLQDITMRK--AFRSSTIQDQQLFDRKTLPIPLQETYDVCEQPPPLNILTPYRDDGKEGLKFYTNPSYFFDLW 161          
BLAST of WH2 domain-containing protein vs. Ensembl Human
Match: WASF3 (WASP family member 3 [Source:HGNC Symbol;Acc:HGNC:12734])

HSP 1 Score: 87.0409 bits (214), Expect = 6.207e-18
Identity = 50/163 (30.67%), Postives = 92/163 (56.44%), Query Frame = 1
Query:   97 MPIANRCIVPVCVSQVKVPASVENEFEYIVNATLSNFIKQISCLTLKAKDIFDELAVSLTNMVDRSLILENKIDLLSLQVKKNDSLILEPLVNQQ----VEVYKIHLSRDDERFVQMEMPDCIKEMFDVAEPPPDLYKLDEFRKEEGDSLKYYTDPDFFLREW 573
            MP+  R I P  + +  +P  + +E E + N+TL+  I+Q+S L+  A+DIF EL     N   R+  L+++ID L+++V + DS + E  V+ Q     + +K    +D +   +  +P+ + ++++ ++ PP L  L  +R ++ D LK+YTDP +F   W
Sbjct:    1 MPLVKRNIEPRHLCRGALPEGITSELECVTNSTLAAIIRQLSSLSKHAEDIFGELFNEANNFYIRANSLQDRIDRLAVKVTQLDSTVEE--VSLQDINMKKAFKSSTVQDQQVVSKNSIPNPVADIYNQSDKPPPLNILTPYRDDKKDGLKFYTDPSYFFDLW 161          
BLAST of WH2 domain-containing protein vs. Ensembl Human
Match: WASF3 (WASP family member 3 [Source:HGNC Symbol;Acc:HGNC:12734])

HSP 1 Score: 87.0409 bits (214), Expect = 6.678e-18
Identity = 50/163 (30.67%), Postives = 92/163 (56.44%), Query Frame = 1
Query:   97 MPIANRCIVPVCVSQVKVPASVENEFEYIVNATLSNFIKQISCLTLKAKDIFDELAVSLTNMVDRSLILENKIDLLSLQVKKNDSLILEPLVNQQ----VEVYKIHLSRDDERFVQMEMPDCIKEMFDVAEPPPDLYKLDEFRKEEGDSLKYYTDPDFFLREW 573
            MP+  R I P  + +  +P  + +E E + N+TL+  I+Q+S L+  A+DIF EL     N   R+  L+++ID L+++V + DS + E  V+ Q     + +K    +D +   +  +P+ + ++++ ++ PP L  L  +R ++ D LK+YTDP +F   W
Sbjct:    1 MPLVKRNIEPRHLCRGALPEGITSELECVTNSTLAAIIRQLSSLSKHAEDIFGELFNEANNFYIRANSLQDRIDRLAVKVTQLDSTVEE--VSLQDINMKKAFKSSTVQDQQVVSKNSIPNPVADIYNQSDKPPPLNILTPYRDDKKDGLKFYTDPSYFFDLW 161          
BLAST of WH2 domain-containing protein vs. Ensembl Human
Match: WASF1 (WASP family member 1 [Source:HGNC Symbol;Acc:HGNC:12732])

HSP 1 Score: 82.8037 bits (203), Expect = 1.777e-16
Identity = 53/162 (32.72%), Postives = 86/162 (53.09%), Query Frame = 1
Query:   97 MPIANRCIVPVCVSQVKVPASVENEFEYIVNATLSNFIKQISCLTLKAKDIFDELAVSLTNMVDRSLILENKIDLLSLQVKKNDSLILEPLVNQQVEVYKIHLS---RDDERFVQMEMPDCIKEMFDVAEPPPDLYKLDEFRKEEGDSLKYYTDPDFFLREW 573
            MP+  R I P  +    +P  ++NE E + N +L+N I+Q+S L+  A+DIF EL     +   R   L+ ++D LS+ V + D    E L  Q + + K   S   +D + F +  +P  ++E +DV E PP L  L  +R +  + LK+YT+P +F   W
Sbjct:    1 MPLVKRNIDPRHLCHTALPRGIKNELECVTNISLANIIRQLSSLSKYAEDIFGELFNEAHSFSFRVNSLQERVDRLSVSVTQLDPKEEE-LSLQDITMRKAFRSSTIQDQQLFDRKTLPIPLQETYDVCEQPPPLNILTPYRDDGKEGLKFYTNPSYFFDLW 161          
BLAST of WH2 domain-containing protein vs. Ensembl Celegans
Match: wve-1 (WAVE (Actin cytoskeleton modulator) homolog [Source:UniProtKB/TrEMBL;Acc:Q9XVK6])

HSP 1 Score: 81.6481 bits (200), Expect = 1.200e-16
Identity = 46/162 (28.40%), Postives = 87/162 (53.70%), Query Frame = 1
Query:   97 MPIANRCIVPVCVSQVKVPASVE-NEFEYIVNATLSNFIKQISCLTLKAKDIFDELAVSLTNMVDRSLILENKIDLLSLQVKKNDSLILEPLVNQQ--VEVYKIHLSRDDERFVQMEMPDCIKEMFDVAEPPPDLYKLDEFRKEEGDSLKYYTDPDFFLREW 573
            MP+  R + PV +S+  +P+++  +E +   N T++N ++Q+S L+  A++IF E+      +  +S  L+ +ID L  +V+  DS   +  +N+    + +K  +  D     +  +P  + E++   +PPPDL  L+ +R  E  +L  YT+P FF   W
Sbjct:    1 MPLTKRAVSPVNLSRGTIPSTIHRDELQCTANGTIANLVRQLSSLSKHAENIFGEIYHDAMIINHKSNTLQQRIDRLHKKVEDLDSNSDQATLNEANMRKAFKSSMLVDQHILDRSTLPTALTEIYAKCDPPPDLDALNPYRDSEIPALSLYTNPSFFFDLW 162          
BLAST of WH2 domain-containing protein vs. Ensembl Fly
Match: SCAR (gene:FBgn0041781 transcript:FBtr0080148)

HSP 1 Score: 96.6709 bits (239), Expect = 3.082e-21
Identity = 59/165 (35.76%), Postives = 94/165 (56.97%), Query Frame = 1
Query:   97 MPIANRCIVPVCVS----QVKVPASVENEFEYIVNATLSNFIKQISCLTLKAKDIFDELAVSLTNMVDRSLILENKIDLLSLQVKKNDSLILE-PLVN-QQVEVYKIHLSRDDERFVQMEMPDCIKEMFDVAEPPPDLYKLDEFRKEEGDSLKYYTDPDFFLREW 573
            MP+  R I PV V+    Q     SVE   E + N TL+N I+Q+S L+  A+D+F ELA  + N+ DR+  L+ +ID L+++V + DS + E PL +  + + +K     D + F +  MP  + + +   + PP L KL+ +R +  D LK+YTDP++F   W
Sbjct:    1 MPLPKRSIEPVHVARSVYQQDELQSVE--LETVTNTTLTNIIRQLSSLSKHAEDVFGELARDVGNIGDRANSLQARIDRLAIKVTQLDSTVEEVPLTDITRKKAFKSAKVFDQQIFSRATMPAPMMDTYAQCDKPPPLDKLNVYRDDGKDGLKFYTDPNYFFELW 163          
BLAST of WH2 domain-containing protein vs. Ensembl Fly
Match: SCAR (gene:FBgn0041781 transcript:FBtr0305256)

HSP 1 Score: 96.6709 bits (239), Expect = 3.215e-21
Identity = 59/165 (35.76%), Postives = 94/165 (56.97%), Query Frame = 1
Query:   97 MPIANRCIVPVCVS----QVKVPASVENEFEYIVNATLSNFIKQISCLTLKAKDIFDELAVSLTNMVDRSLILENKIDLLSLQVKKNDSLILE-PLVN-QQVEVYKIHLSRDDERFVQMEMPDCIKEMFDVAEPPPDLYKLDEFRKEEGDSLKYYTDPDFFLREW 573
            MP+  R I PV V+    Q     SVE   E + N TL+N I+Q+S L+  A+D+F ELA  + N+ DR+  L+ +ID L+++V + DS + E PL +  + + +K     D + F +  MP  + + +   + PP L KL+ +R +  D LK+YTDP++F   W
Sbjct:    1 MPLPKRSIEPVHVARSVYQQDELQSVE--LETVTNTTLTNIIRQLSSLSKHAEDVFGELARDVGNIGDRANSLQARIDRLAIKVTQLDSTVEEVPLTDITRKKAFKSAKVFDQQIFSRATMPAPMMDTYAQCDKPPPLDKLNVYRDDGKDGLKFYTDPNYFFELW 163          
BLAST of WH2 domain-containing protein vs. Ensembl Fly
Match: SCAR (gene:FBgn0041781 transcript:FBtr0340223)

HSP 1 Score: 96.6709 bits (239), Expect = 3.307e-21
Identity = 59/165 (35.76%), Postives = 94/165 (56.97%), Query Frame = 1
Query:   97 MPIANRCIVPVCVS----QVKVPASVENEFEYIVNATLSNFIKQISCLTLKAKDIFDELAVSLTNMVDRSLILENKIDLLSLQVKKNDSLILE-PLVN-QQVEVYKIHLSRDDERFVQMEMPDCIKEMFDVAEPPPDLYKLDEFRKEEGDSLKYYTDPDFFLREW 573
            MP+  R I PV V+    Q     SVE   E + N TL+N I+Q+S L+  A+D+F ELA  + N+ DR+  L+ +ID L+++V + DS + E PL +  + + +K     D + F +  MP  + + +   + PP L KL+ +R +  D LK+YTDP++F   W
Sbjct:    1 MPLPKRSIEPVHVARSVYQQDELQSVE--LETVTNTTLTNIIRQLSSLSKHAEDVFGELARDVGNIGDRANSLQARIDRLAIKVTQLDSTVEEVPLTDITRKKAFKSAKVFDQQIFSRATMPAPMMDTYAQCDKPPPLDKLNVYRDDGKDGLKFYTDPNYFFELW 163          
BLAST of WH2 domain-containing protein vs. Ensembl Fly
Match: SCAR (gene:FBgn0041781 transcript:FBtr0305255)

HSP 1 Score: 96.6709 bits (239), Expect = 3.340e-21
Identity = 59/165 (35.76%), Postives = 94/165 (56.97%), Query Frame = 1
Query:   97 MPIANRCIVPVCVS----QVKVPASVENEFEYIVNATLSNFIKQISCLTLKAKDIFDELAVSLTNMVDRSLILENKIDLLSLQVKKNDSLILE-PLVN-QQVEVYKIHLSRDDERFVQMEMPDCIKEMFDVAEPPPDLYKLDEFRKEEGDSLKYYTDPDFFLREW 573
            MP+  R I PV V+    Q     SVE   E + N TL+N I+Q+S L+  A+D+F ELA  + N+ DR+  L+ +ID L+++V + DS + E PL +  + + +K     D + F +  MP  + + +   + PP L KL+ +R +  D LK+YTDP++F   W
Sbjct:    1 MPLPKRSIEPVHVARSVYQQDELQSVE--LETVTNTTLTNIIRQLSSLSKHAEDVFGELARDVGNIGDRANSLQARIDRLAIKVTQLDSTVEEVPLTDITRKKAFKSAKVFDQQIFSRATMPAPMMDTYAQCDKPPPLDKLNVYRDDGKDGLKFYTDPNYFFELW 163          
BLAST of WH2 domain-containing protein vs. Ensembl Fly
Match: SCAR (gene:FBgn0041781 transcript:FBtr0329949)

HSP 1 Score: 96.6709 bits (239), Expect = 3.392e-21
Identity = 59/165 (35.76%), Postives = 94/165 (56.97%), Query Frame = 1
Query:   97 MPIANRCIVPVCVS----QVKVPASVENEFEYIVNATLSNFIKQISCLTLKAKDIFDELAVSLTNMVDRSLILENKIDLLSLQVKKNDSLILE-PLVN-QQVEVYKIHLSRDDERFVQMEMPDCIKEMFDVAEPPPDLYKLDEFRKEEGDSLKYYTDPDFFLREW 573
            MP+  R I PV V+    Q     SVE   E + N TL+N I+Q+S L+  A+D+F ELA  + N+ DR+  L+ +ID L+++V + DS + E PL +  + + +K     D + F +  MP  + + +   + PP L KL+ +R +  D LK+YTDP++F   W
Sbjct:    1 MPLPKRSIEPVHVARSVYQQDELQSVE--LETVTNTTLTNIIRQLSSLSKHAEDVFGELARDVGNIGDRANSLQARIDRLAIKVTQLDSTVEEVPLTDITRKKAFKSAKVFDQQIFSRATMPAPMMDTYAQCDKPPPLDKLNVYRDDGKDGLKFYTDPNYFFELW 163          
BLAST of WH2 domain-containing protein vs. Ensembl Zebrafish
Match: wasf3a (WASP family member 3a [Source:ZFIN;Acc:ZDB-GENE-060531-55])

HSP 1 Score: 93.5893 bits (231), Expect = 2.222e-20
Identity = 52/161 (32.30%), Postives = 89/161 (55.28%), Query Frame = 1
Query:   97 MPIANRCIVPVCVSQVKVPASVENEFEYIVNATLSNFIKQISCLTLKAKDIFDELAVSLTNMVDRSLILENKIDLLSLQVKKNDSLILEPLVN--QQVEVYKIHLSRDDERFVQMEMPDCIKEMFDVAEPPPDLYKLDEFRKEEGDSLKYYTDPDFFLREW 573
            MP+  R I P  +S+  +P S+ NE E + N TLS  I+Q+S L+  A+D+F EL         R+  L+++ID L+++V + DS + E  +      + +K    +D +   +  +P+ I EM++ ++ PP L  L  +R +  D +K+YTDP +F   W
Sbjct:    1 MPLVKRNIEPKHLSRGALPESISNELECVTNNTLSAIIRQLSSLSKHAEDVFGELFNEANTFYLRANSLQDRIDRLAVKVTQLDSSVEEVSLQDINMRKAFKSSTVQDQQVVTKSSVPNPITEMYNTSDKPPPLNILSAYRDDHIDGIKFYTDPSYFFDLW 161          
BLAST of WH2 domain-containing protein vs. Ensembl Zebrafish
Match: wasf2 (WASP family member 2 [Source:ZFIN;Acc:ZDB-GENE-040426-865])

HSP 1 Score: 93.2041 bits (230), Expect = 3.915e-20
Identity = 48/163 (29.45%), Postives = 92/163 (56.44%), Query Frame = 1
Query:   97 MPIANRCIVPVCVSQVKVPASVENEFEYIVNATLSNFIKQISCLTLKAKDIFDELAVSLTNMVDRSLILENKIDLLSLQVK----KNDSLILEPLVNQQVEVYKIHLSRDDERFVQMEMPDCIKEMFDVAEPPPDLYKLDEFRKEEGDSLKYYTDPDFFLREW 573
            MP+  R I P  + +  +P ++++E E + N TL+N I+Q+  L+  A+D+F EL V  +   DR   L  ++D L ++V     K + + L+ + +++   +  +L +D + F++  +P  I + +   + PP L KL  +R++  ++LK+YTDP +F   W
Sbjct:    1 MPLVTRNIEPRHLCRQTLPNTIKSELECVTNITLANIIRQLGSLSKYAEDVFGELFVQASKFADRVTTLGERVDKLQVKVTQLDPKEEEVSLQAITSRKA--FHSNLIQDQQLFIRASLPQPINDTYLTCDQPPPLDKLSPYREDGKEALKFYTDPSYFFDLW 161          
BLAST of WH2 domain-containing protein vs. Ensembl Zebrafish
Match: zgc:109889 (zgc:109889 [Source:ZFIN;Acc:ZDB-GENE-050522-547])

HSP 1 Score: 85.8853 bits (211), Expect = 2.236e-19
Identity = 51/162 (31.48%), Postives = 89/162 (54.94%), Query Frame = 1
Query:   97 MPIANRCIVPVCVSQVKVPASVENEFEYIVNATLSNFIKQISCLTLKAKDIFDELAVSLTNMVDRSLILENKIDLLSLQVKKNDSLILEPLVNQQVEVYKIHLS---RDDERFVQMEMPDCIKEMFDVAEPPPDLYKLDEFRKEEGDSLKYYTDPDFFLREW 573
            MP+  R I P  + +  +P  V +E E + N+TL+  IKQ+  L+  A+DIF EL     +   R   L+ ++DLL+++V + DS + E +  Q + + K   S   +D +   +  +P+ + E++   + PP L  L  +R ++ D+LK+YTDP +F   W
Sbjct:    1 MPLVKRSIEPKHLCRGALPDGVPSELECVTNSTLAAIIKQLGSLSRHAEDIFGELFNEANSFYMRMNNLQERVDLLAIKVTQLDSTV-EEVSLQDINMRKAFKSSTIQDQQVVSRNSIPNPVLELYHRGDKPPPLNILSPYRDDKKDALKFYTDPSYFFILW 161          
BLAST of WH2 domain-containing protein vs. Ensembl Zebrafish
Match: zgc:109889 (zgc:109889 [Source:ZFIN;Acc:ZDB-GENE-050522-547])

HSP 1 Score: 85.8853 bits (211), Expect = 1.734e-18
Identity = 49/161 (30.43%), Postives = 87/161 (54.04%), Query Frame = 1
Query:   97 MPIANRCIVPVCVSQVKVPASVENEFEYIVNATLSNFIKQISCLTLKAKDIFDELAVSLTNMVDRSLILENKIDLLSLQVKKNDSLILEPLVN--QQVEVYKIHLSRDDERFVQMEMPDCIKEMFDVAEPPPDLYKLDEFRKEEGDSLKYYTDPDFFLREW 573
            MP+  R I P  + +  +P  V +E E + N+TL+  IKQ+  L+  A+DIF EL     +   R   L+ ++DLL+++V + DS + E  +      + +K    +D +   +  +P+ + E++   + PP L  L  +R ++ D+LK+YTDP +F   W
Sbjct:    1 MPLVKRSIEPKHLCRGALPDGVPSELECVTNSTLAAIIKQLGSLSRHAEDIFGELFNEANSFYMRMNNLQERVDLLAIKVTQLDSTVEEVSLQDINMRKAFKSSTIQDQQVVSRNSIPNPVLELYHRGDKPPPLNILSPYRDDKKDALKFYTDPSYFFILW 161          
BLAST of WH2 domain-containing protein vs. Ensembl Zebrafish
Match: zgc:109889 (zgc:109889 [Source:ZFIN;Acc:ZDB-GENE-050522-547])

HSP 1 Score: 85.8853 bits (211), Expect = 1.734e-18
Identity = 49/161 (30.43%), Postives = 87/161 (54.04%), Query Frame = 1
Query:   97 MPIANRCIVPVCVSQVKVPASVENEFEYIVNATLSNFIKQISCLTLKAKDIFDELAVSLTNMVDRSLILENKIDLLSLQVKKNDSLILEPLVN--QQVEVYKIHLSRDDERFVQMEMPDCIKEMFDVAEPPPDLYKLDEFRKEEGDSLKYYTDPDFFLREW 573
            MP+  R I P  + +  +P  V +E E + N+TL+  IKQ+  L+  A+DIF EL     +   R   L+ ++DLL+++V + DS + E  +      + +K    +D +   +  +P+ + E++   + PP L  L  +R ++ D+LK+YTDP +F   W
Sbjct:    1 MPLVKRSIEPKHLCRGALPDGVPSELECVTNSTLAAIIKQLGSLSRHAEDIFGELFNEANSFYMRMNNLQERVDLLAIKVTQLDSTVEEVSLQDINMRKAFKSSTIQDQQVVSRNSIPNPVLELYHRGDKPPPLNILSPYRDDKKDALKFYTDPSYFFILW 161          
BLAST of WH2 domain-containing protein vs. Ensembl Xenopus
Match: wasf3 (WAS protein family member 3 [Source:NCBI gene;Acc:779716])

HSP 1 Score: 87.4261 bits (215), Expect = 3.977e-18
Identity = 49/161 (30.43%), Postives = 89/161 (55.28%), Query Frame = 1
Query:   97 MPIANRCIVPVCVSQVKVPASVENEFEYIVNATLSNFIKQISCLTLKAKDIFDELAVSLTNMVDRSLILENKIDLLSLQVKKNDSLILEPLVN--QQVEVYKIHLSRDDERFVQMEMPDCIKEMFDVAEPPPDLYKLDEFRKEEGDSLKYYTDPDFFLREW 573
            MP+  R I P  + +  +P  + +E E + N+TL+  I+Q+S L+  A+DIF EL     N   R+  L+++ID L+++V + DS + E  +      + +K   ++D +   +  +P  + +++   + PP L  L  +R ++ DSLK+YTDP +F   W
Sbjct:    1 MPLVKRNIEPRHLCRGTLPDGITSELECVTNSTLAAIIRQLSSLSKHAEDIFGELFNEANNFYIRANSLQDRIDRLAVKVTQLDSTVEEVSLQDINMRKAFKSSTTQDQQVVSKNSIPKPVIDIYRTCDRPPPLDILSAYRDDKKDSLKFYTDPSYFFDLW 161          
BLAST of WH2 domain-containing protein vs. Ensembl Xenopus
Match: wasf3 (WAS protein family member 3 [Source:NCBI gene;Acc:779716])

HSP 1 Score: 87.4261 bits (215), Expect = 4.672e-18
Identity = 49/161 (30.43%), Postives = 89/161 (55.28%), Query Frame = 1
Query:   97 MPIANRCIVPVCVSQVKVPASVENEFEYIVNATLSNFIKQISCLTLKAKDIFDELAVSLTNMVDRSLILENKIDLLSLQVKKNDSLILEPLVN--QQVEVYKIHLSRDDERFVQMEMPDCIKEMFDVAEPPPDLYKLDEFRKEEGDSLKYYTDPDFFLREW 573
            MP+  R I P  + +  +P  + +E E + N+TL+  I+Q+S L+  A+DIF EL     N   R+  L+++ID L+++V + DS + E  +      + +K   ++D +   +  +P  + +++   + PP L  L  +R ++ DSLK+YTDP +F   W
Sbjct:    1 MPLVKRNIEPRHLCRGTLPDGITSELECVTNSTLAAIIRQLSSLSKHAEDIFGELFNEANNFYIRANSLQDRIDRLAVKVTQLDSTVEEVSLQDINMRKAFKSSTTQDQQVVSKNSIPKPVIDIYRTCDRPPPLDILSAYRDDKKDSLKFYTDPSYFFDLW 161          
BLAST of WH2 domain-containing protein vs. Ensembl Xenopus
Match: tmprss13 (transmembrane serine protease 13 [Source:Xenbase;Acc:XB-GENE-940757])

HSP 1 Score: 85.1149 bits (209), Expect = 2.396e-17
Identity = 51/163 (31.29%), Postives = 87/163 (53.37%), Query Frame = 1
Query:   97 MPIANRCIVPVCVSQVKVPASVENEFEYIVNATLSNFIKQISCLTLKAKDIFDELAVSLTNMVDRSLILENKIDLLSLQVKKNDSLILEPLVNQQ----VEVYKIHLSRDDERFVQMEMPDCIKEMFDVAEPPPDLYKLDEFRKEEGDSLKYYTDPDFFLREW 573
            MP+  R I P  + +  VP  V +E E + N+TL+  IKQ+  L+  A+DIF EL     +   R   L+ ++DLL ++V + DS + E  V+ Q     + +K    ++ +   +  +P+ + EM+   + PP L  L  +R ++ D L++YTDP +F   W
Sbjct:    1 MPLVKRNIEPRHLCRGTVPDGVTSELECVTNSTLAAIIKQLGSLSRHAEDIFGELFNEANSFYMRMNSLQERVDLLVIKVTQLDSTVEE--VSLQDINMRKAFKSSTVQNQQVVSRNSIPNPVMEMYQRGDKPPPLNILTPYRDDKKDGLRFYTDPSYFFNLW 161          
BLAST of WH2 domain-containing protein vs. Ensembl Xenopus
Match: foxq1 (forkhead box Q1 [Source:Xenbase;Acc:XB-GENE-483842])

HSP 1 Score: 83.9593 bits (206), Expect = 5.440e-17
Identity = 49/163 (30.06%), Postives = 90/163 (55.21%), Query Frame = 1
Query:   97 MPIANRCIVPVCVSQVKVPASVENEFEYIVNATLSNFIKQISCLTLKAKDIFDELAVSLTNMVDRSLILENKIDLLSLQV----KKNDSLILEPLVNQQVEVYKIHLSRDDERFVQMEMPDCIKEMFDVAEPPPDLYKLDEFRKEEGDSLKYYTDPDFFLREW 573
            MP+  RCI P  + + K+P  V +E E + N TLSN I+Q+  L+  A+DIF EL    +    R   L  +++ L ++V     K + + L+ +  ++   ++ + S+D + F++  +   ++E +   + PP L  L  +R++E ++LK+YTDP +F   W
Sbjct:    7 MPLVARCIEPRFLCRQKLPP-VRSELECMTNLTLSNVIRQLGSLSRYAEDIFGELFSEASMFAHRVGSLGERVERLQVKVTQLDPKEEEVSLQGINTRKA--FRSNTSQDQQLFIRDSLSLPVRETYSTCDMPPPLNILSPYREDEKEALKFYTDPSYFFDLW 166          
BLAST of WH2 domain-containing protein vs. Ensembl Xenopus
Match: foxq1 (forkhead box Q1 [Source:Xenbase;Acc:XB-GENE-483842])

HSP 1 Score: 83.9593 bits (206), Expect = 5.601e-17
Identity = 49/164 (29.88%), Postives = 90/164 (54.88%), Query Frame = 1
Query:   94 FMPIANRCIVPVCVSQVKVPASVENEFEYIVNATLSNFIKQISCLTLKAKDIFDELAVSLTNMVDRSLILENKIDLLSLQV----KKNDSLILEPLVNQQVEVYKIHLSRDDERFVQMEMPDCIKEMFDVAEPPPDLYKLDEFRKEEGDSLKYYTDPDFFLREW 573
             MP+  RCI P  + + K+P  V +E E + N TLSN I+Q+  L+  A+DIF EL    +    R   L  +++ L ++V     K + + L+ +  ++   ++ + S+D + F++  +   ++E +   + PP L  L  +R++E ++LK+YTDP +F   W
Sbjct:    1 MMPLVARCIEPRFLCRQKLPP-VRSELECMTNLTLSNVIRQLGSLSRYAEDIFGELFSEASMFAHRVGSLGERVERLQVKVTQLDPKEEEVSLQGINTRKA--FRSNTSQDQQLFIRDSLSLPVRETYSTCDMPPPLNILSPYREDEKEALKFYTDPSYFFDLW 161          
BLAST of WH2 domain-containing protein vs. Ensembl Mouse
Match: Wasf3 (WAS protein family, member 3 [Source:MGI Symbol;Acc:MGI:2658986])

HSP 1 Score: 88.1965 bits (217), Expect = 2.161e-18
Identity = 51/163 (31.29%), Postives = 92/163 (56.44%), Query Frame = 1
Query:   97 MPIANRCIVPVCVSQVKVPASVENEFEYIVNATLSNFIKQISCLTLKAKDIFDELAVSLTNMVDRSLILENKIDLLSLQVKKNDSLILEPLVNQQ----VEVYKIHLSRDDERFVQMEMPDCIKEMFDVAEPPPDLYKLDEFRKEEGDSLKYYTDPDFFLREW 573
            MP+  R I P  + +  +P  V +E E + N+TL+  I+Q+S L+  A+DIF EL     N   R+  L+++ID L+++V + DS + E  V+ Q     + +K    +D +   +  +P+ + ++++ ++ PP L  L  +R ++ D LK+YTDP +F   W
Sbjct:    1 MPLVKRNIEPRHLCRGALPEGVTSELECVTNSTLAAIIRQLSSLSKHAEDIFGELFNEANNFYIRANSLQDRIDRLAVKVTQLDSTVEE--VSLQDINMKKAFKSSTIQDQQVVSKNSIPNPVADIYNQSDKPPPLSILTPYRDDKKDGLKFYTDPSYFFDLW 161          
BLAST of WH2 domain-containing protein vs. Ensembl Mouse
Match: Wasf1 (WAS protein family, member 1 [Source:MGI Symbol;Acc:MGI:1890563])

HSP 1 Score: 82.8037 bits (203), Expect = 1.372e-16
Identity = 53/162 (32.72%), Postives = 86/162 (53.09%), Query Frame = 1
Query:   97 MPIANRCIVPVCVSQVKVPASVENEFEYIVNATLSNFIKQISCLTLKAKDIFDELAVSLTNMVDRSLILENKIDLLSLQVKKNDSLILEPLVNQQVEVYKIHLS---RDDERFVQMEMPDCIKEMFDVAEPPPDLYKLDEFRKEEGDSLKYYTDPDFFLREW 573
            MP+  R I P  +    +P  ++NE E + N +L+N I+Q+S L+  A+DIF EL     +   R   L+ ++D LS+ V + D    E L  Q + + K   S   +D + F +  +P  ++E +DV E PP L  L  +R +  + LK+YT+P +F   W
Sbjct:    1 MPLVKRNIDPRHLCHTALPRGIKNELECVTNISLANIIRQLSSLSKYAEDIFGELFNEAHSFSFRVNSLQERVDRLSVSVTQLDPKEEE-LSLQDITMRKAFRSSTIQDQQLFDRKTLPIPLQETYDVCEQPPPLNILTPYRDDGKEGLKFYTNPSYFFDLW 161          
BLAST of WH2 domain-containing protein vs. Ensembl Mouse
Match: Wasf1 (WAS protein family, member 1 [Source:MGI Symbol;Acc:MGI:1890563])

HSP 1 Score: 82.8037 bits (203), Expect = 1.372e-16
Identity = 53/162 (32.72%), Postives = 86/162 (53.09%), Query Frame = 1
Query:   97 MPIANRCIVPVCVSQVKVPASVENEFEYIVNATLSNFIKQISCLTLKAKDIFDELAVSLTNMVDRSLILENKIDLLSLQVKKNDSLILEPLVNQQVEVYKIHLS---RDDERFVQMEMPDCIKEMFDVAEPPPDLYKLDEFRKEEGDSLKYYTDPDFFLREW 573
            MP+  R I P  +    +P  ++NE E + N +L+N I+Q+S L+  A+DIF EL     +   R   L+ ++D LS+ V + D    E L  Q + + K   S   +D + F +  +P  ++E +DV E PP L  L  +R +  + LK+YT+P +F   W
Sbjct:    1 MPLVKRNIDPRHLCHTALPRGIKNELECVTNISLANIIRQLSSLSKYAEDIFGELFNEAHSFSFRVNSLQERVDRLSVSVTQLDPKEEE-LSLQDITMRKAFRSSTIQDQQLFDRKTLPIPLQETYDVCEQPPPLNILTPYRDDGKEGLKFYTNPSYFFDLW 161          
BLAST of WH2 domain-containing protein vs. Ensembl Mouse
Match: Wasf2 (WAS protein family, member 2 [Source:MGI Symbol;Acc:MGI:1098641])

HSP 1 Score: 70.4774 bits (171), Expect = 9.987e-13
Identity = 42/163 (25.77%), Postives = 84/163 (51.53%), Query Frame = 1
Query:   97 MPIANRCIVPVCVSQVKVPASVENEFEYIVNATLSNFIKQISCLTLKAKDIFDELAVSLTNMVDRSLILENKIDLLSLQVK----KNDSLILEPLVNQQVEVYKIHLSRDDERFVQMEMPDCIKEMFDVAEPPPDLYKLDEFRKEEGDSLKYYTDPDFFLREW 573
            MP+  R I P  + +  +P+   +E E   N TL+N I+Q+  L+  A+DIF E+    +    R   L  ++D + ++V     K + + L+ +  ++   ++   ++D + F +  +P  + E ++  + PP L  L  +R +  ++LK+YT+P +F   W
Sbjct:    1 MPLVTRNIEPRHLCRQTLPSDT-SELECRTNITLANVIRQLGSLSKYAEDIFGEICTQASAFASRVNSLAERVDRVQVKVTQLDPKEEEVSLQGINTRKA--FRSSTTQDQKLFDRNSLPVPVLETYNSCDAPPPLNNLSPYRDDGKEALKFYTNPSYFFDLW 160          
BLAST of WH2 domain-containing protein vs. Ensembl Mouse
Match: Wasf2 (WAS protein family, member 2 [Source:MGI Symbol;Acc:MGI:1098641])

HSP 1 Score: 70.4774 bits (171), Expect = 9.987e-13
Identity = 42/163 (25.77%), Postives = 84/163 (51.53%), Query Frame = 1
Query:   97 MPIANRCIVPVCVSQVKVPASVENEFEYIVNATLSNFIKQISCLTLKAKDIFDELAVSLTNMVDRSLILENKIDLLSLQVK----KNDSLILEPLVNQQVEVYKIHLSRDDERFVQMEMPDCIKEMFDVAEPPPDLYKLDEFRKEEGDSLKYYTDPDFFLREW 573
            MP+  R I P  + +  +P+   +E E   N TL+N I+Q+  L+  A+DIF E+    +    R   L  ++D + ++V     K + + L+ +  ++   ++   ++D + F +  +P  + E ++  + PP L  L  +R +  ++LK+YT+P +F   W
Sbjct:    1 MPLVTRNIEPRHLCRQTLPSDT-SELECRTNITLANVIRQLGSLSKYAEDIFGEICTQASAFASRVNSLAERVDRVQVKVTQLDPKEEEVSLQGINTRKA--FRSSTTQDQKLFDRNSLPVPVLETYNSCDAPPPLNNLSPYRDDGKEALKFYTNPSYFFDLW 160          
BLAST of WH2 domain-containing protein vs. UniProt/SwissProt
Match: sp|Q8VHI6|WASF3_MOUSE (Wiskott-Aldrich syndrome protein family member 3 OS=Mus musculus OX=10090 GN=Wasf3 PE=1 SV=1)

HSP 1 Score: 88.1965 bits (217), Expect = 1.512e-17
Identity = 51/163 (31.29%), Postives = 92/163 (56.44%), Query Frame = 1
Query:   97 MPIANRCIVPVCVSQVKVPASVENEFEYIVNATLSNFIKQISCLTLKAKDIFDELAVSLTNMVDRSLILENKIDLLSLQVKKNDSLILEPLVNQQ----VEVYKIHLSRDDERFVQMEMPDCIKEMFDVAEPPPDLYKLDEFRKEEGDSLKYYTDPDFFLREW 573
            MP+  R I P  + +  +P  V +E E + N+TL+  I+Q+S L+  A+DIF EL     N   R+  L+++ID L+++V + DS + E  V+ Q     + +K    +D +   +  +P+ + ++++ ++ PP L  L  +R ++ D LK+YTDP +F   W
Sbjct:    1 MPLVKRNIEPRHLCRGALPEGVTSELECVTNSTLAAIIRQLSSLSKHAEDIFGELFNEANNFYIRANSLQDRIDRLAVKVTQLDSTVEE--VSLQDINMKKAFKSSTIQDQQVVSKNSIPNPVADIYNQSDKPPPLSILTPYRDDKKDGLKFYTDPSYFFDLW 161          
BLAST of WH2 domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9UPY6|WASF3_HUMAN (Wiskott-Aldrich syndrome protein family member 3 OS=Homo sapiens OX=9606 GN=WASF3 PE=1 SV=2)

HSP 1 Score: 87.0409 bits (214), Expect = 3.207e-17
Identity = 50/163 (30.67%), Postives = 92/163 (56.44%), Query Frame = 1
Query:   97 MPIANRCIVPVCVSQVKVPASVENEFEYIVNATLSNFIKQISCLTLKAKDIFDELAVSLTNMVDRSLILENKIDLLSLQVKKNDSLILEPLVNQQ----VEVYKIHLSRDDERFVQMEMPDCIKEMFDVAEPPPDLYKLDEFRKEEGDSLKYYTDPDFFLREW 573
            MP+  R I P  + +  +P  + +E E + N+TL+  I+Q+S L+  A+DIF EL     N   R+  L+++ID L+++V + DS + E  V+ Q     + +K    +D +   +  +P+ + ++++ ++ PP L  L  +R ++ D LK+YTDP +F   W
Sbjct:    1 MPLVKRNIEPRHLCRGALPEGITSELECVTNSTLAAIIRQLSSLSKHAEDIFGELFNEANNFYIRANSLQDRIDRLAVKVTQLDSTVEE--VSLQDINMKKAFKSSTVQDQQVVSKNSIPNPVADIYNQSDKPPPLNILTPYRDDKKDGLKFYTDPSYFFDLW 161          
BLAST of WH2 domain-containing protein vs. UniProt/SwissProt
Match: sp|Q5BJU7|WASF1_RAT (Wiskott-Aldrich syndrome protein family member 1 OS=Rattus norvegicus OX=10116 GN=Wasf1 PE=1 SV=1)

HSP 1 Score: 82.8037 bits (203), Expect = 8.532e-16
Identity = 53/162 (32.72%), Postives = 86/162 (53.09%), Query Frame = 1
Query:   97 MPIANRCIVPVCVSQVKVPASVENEFEYIVNATLSNFIKQISCLTLKAKDIFDELAVSLTNMVDRSLILENKIDLLSLQVKKNDSLILEPLVNQQVEVYKIHLS---RDDERFVQMEMPDCIKEMFDVAEPPPDLYKLDEFRKEEGDSLKYYTDPDFFLREW 573
            MP+  R I P  +    +P  ++NE E + N +L+N I+Q+S L+  A+DIF EL     +   R   L+ ++D LS+ V + D    E L  Q + + K   S   +D + F +  +P  ++E +DV E PP L  L  +R +  + LK+YT+P +F   W
Sbjct:    1 MPLVKRNIDPRHLCHTALPRGIKNELECVTNISLANIIRQLSSLSKYAEDIFGELFNEAHSFSFRVNSLQERVDRLSVSVTQLDPKEEE-LSLQDITMRKAFRSSTIQDQQLFDRKTLPIPLQETYDVCEQPPPLNVLTPYRDDGKEGLKFYTNPSYFFDLW 161          
BLAST of WH2 domain-containing protein vs. UniProt/SwissProt
Match: sp|Q92558|WASF1_HUMAN (Wiskott-Aldrich syndrome protein family member 1 OS=Homo sapiens OX=9606 GN=WASF1 PE=1 SV=1)

HSP 1 Score: 82.8037 bits (203), Expect = 8.532e-16
Identity = 53/162 (32.72%), Postives = 86/162 (53.09%), Query Frame = 1
Query:   97 MPIANRCIVPVCVSQVKVPASVENEFEYIVNATLSNFIKQISCLTLKAKDIFDELAVSLTNMVDRSLILENKIDLLSLQVKKNDSLILEPLVNQQVEVYKIHLS---RDDERFVQMEMPDCIKEMFDVAEPPPDLYKLDEFRKEEGDSLKYYTDPDFFLREW 573
            MP+  R I P  +    +P  ++NE E + N +L+N I+Q+S L+  A+DIF EL     +   R   L+ ++D LS+ V + D    E L  Q + + K   S   +D + F +  +P  ++E +DV E PP L  L  +R +  + LK+YT+P +F   W
Sbjct:    1 MPLVKRNIDPRHLCHTALPRGIKNELECVTNISLANIIRQLSSLSKYAEDIFGELFNEAHSFSFRVNSLQERVDRLSVSVTQLDPKEEE-LSLQDITMRKAFRSSTIQDQQLFDRKTLPIPLQETYDVCEQPPPLNILTPYRDDGKEGLKFYTNPSYFFDLW 161          
BLAST of WH2 domain-containing protein vs. UniProt/SwissProt
Match: sp|Q0IIJ3|WASF1_BOVIN (Wiskott-Aldrich syndrome protein family member 1 OS=Bos taurus OX=9913 GN=WASF1 PE=2 SV=1)

HSP 1 Score: 82.8037 bits (203), Expect = 8.532e-16
Identity = 50/163 (30.67%), Postives = 87/163 (53.37%), Query Frame = 1
Query:   97 MPIANRCIVPVCVSQVKVPASVENEFEYIVNATLSNFIKQISCLTLKAKDIFDELAVSLTNMVDRSLILENKIDLLSLQV----KKNDSLILEPLVNQQVEVYKIHLSRDDERFVQMEMPDCIKEMFDVAEPPPDLYKLDEFRKEEGDSLKYYTDPDFFLREW 573
            MP+  R I P  +    +P  ++NE E + N +L+N I+Q+S L+  A+DIF EL     +   R   L+ ++D LS+ V     K + L L+ +  ++   ++    +D + F +  +P  ++E +DV E PP L  L  +R +  + LK+YT+P +F   W
Sbjct:    1 MPLVKRNIDPRHLCHTALPRGIKNELECVTNISLANIIRQLSSLSKYAEDIFGELFNEAHSFSFRVNSLQERVDRLSVSVTQLDPKEEELSLQDITMRK--AFRSSTIQDQQLFDRKTLPIPLQETYDVCEQPPPLNILTPYRDDGKEGLKFYTNPSYFFDLW 161          
BLAST of WH2 domain-containing protein vs. TrEMBL
Match: H9JD81 (WH2 domain-containing protein OS=Bombyx mori OX=7091 PE=4 SV=1)

HSP 1 Score: 116.316 bits (290), Expect = 5.200e-25
Identity = 59/163 (36.20%), Postives = 97/163 (59.51%), Query Frame = 1
Query:   97 MPIANRCIVPVCVSQVKVPA--SVENEFEYIVNATLSNFIKQISCLTLKAKDIFDELAVSLTNMVDRSLILENKIDLLSLQVKKNDSLILEPLVN--QQVEVYKIHLSRDDERFVQMEMPDCIKEMFDVAEPPPDLYKLDEFRKEEGDSLKYYTDPDFFLREW 573
            MP+  RC+ PV VS+  VP   SV +E E + N TL+N ++Q+S L+  A+D+F EL    TN+ DR+ +L+ +ID L+++V + DS + E  +   Q  + ++   S + + F +  MP  +   +   + PP L +L+EFR +  D+ K+YTDPD+F   W
Sbjct:    1 MPLPKRCVEPVHVSRGTVPERLSVPSELEAVTNGTLANTVRQLSSLSKHAEDMFGELTREATNLADRTNVLQARIDRLAIKVTQLDSGVEEVSIQDIQMRKAFRSSRSFEQQLFSRNTMPSAMLATYAKCDRPPPLERLNEFRDDGRDARKFYTDPDYFFELW 163          
BLAST of WH2 domain-containing protein vs. TrEMBL
Match: A0A1E1W0T2 (Uncharacterized protein (Fragment) OS=Pectinophora gossypiella OX=13191 GN=g.1509 PE=4 SV=1)

HSP 1 Score: 111.309 bits (277), Expect = 6.869e-25
Identity = 56/163 (34.36%), Postives = 97/163 (59.51%), Query Frame = 1
Query:   97 MPIANRCIVPVCVSQVKVPASVE--NEFEYIVNATLSNFIKQISCLTLKAKDIFDELAVSLTNMVDRSLILENKIDLLSLQVKKNDSLILEPLVN--QQVEVYKIHLSRDDERFVQMEMPDCIKEMFDVAEPPPDLYKLDEFRKEEGDSLKYYTDPDFFLREW 573
            MP+  RC+ PV VS+  VP  ++  +E E + N TL+N ++Q+S L+  A+D+F EL    TN+ +R+ +L+ +ID L+++V + DS + E  +   Q  + ++   +   + F +  MP  + + +   + PP L KL+EFR +  D+ K+YTDPD+F   W
Sbjct:    1 MPLPKRCVEPVHVSRGTVPERLQLPSELEAVTNGTLANTVRQLSSLSKHAEDMFGELTREATNLAERTNVLQARIDRLAIKVTQLDSGVEEVSLQDIQMRKAFRSSRTFQQQLFSRNSMPSAMLDTYAKCDRPPPLEKLNEFRDDGRDARKFYTDPDYFFELW 163          
BLAST of WH2 domain-containing protein vs. TrEMBL
Match: A0A4C1UUL8 (Wiskott-Aldrich syndrome protein family member 3 OS=Eumeta variegata OX=151549 GN=Wasf3 PE=4 SV=1)

HSP 1 Score: 114.39 bits (285), Expect = 2.969e-24
Identity = 58/163 (35.58%), Postives = 97/163 (59.51%), Query Frame = 1
Query:   97 MPIANRCIVPVCVSQVKVPA--SVENEFEYIVNATLSNFIKQISCLTLKAKDIFDELAVSLTNMVDRSLILENKIDLLSLQVKKNDSLILEPLVN--QQVEVYKIHLSRDDERFVQMEMPDCIKEMFDVAEPPPDLYKLDEFRKEEGDSLKYYTDPDFFLREW 573
            MP+  RC+ PV VS+  VP   SV +E E + N TL+N ++Q+S L+  A+D+F EL    +N+ +R+ +L+ +ID L+++V + DS + E  +   Q  + ++   S   + F +  MP  + E +   + PP L +L+EFR +  D+ K+YTDPD+F   W
Sbjct:    1 MPLPKRCVEPVHVSRGTVPERLSVPSELEAVTNGTLANTVRQLSSLSKHAEDMFGELTREASNLAERTNVLQARIDRLAIKVTQLDSGVEEVSLQDIQMRKAFRSSRSFQQQLFSRGSMPSAMLETYAKCDRPPPLERLNEFRDDGKDARKFYTDPDYFFELW 163          
BLAST of WH2 domain-containing protein vs. TrEMBL
Match: A0A085NSL8 (WH2 domain-containing protein OS=Trichuris suis OX=68888 GN=M514_05450 PE=4 SV=1)

HSP 1 Score: 115.546 bits (288), Expect = 3.952e-24
Identity = 56/162 (34.57%), Postives = 99/162 (61.11%), Query Frame = 1
Query:   97 MPIANRCIVPVCVSQVKVPASVENE-FEYIVNATLSNFIKQISCLTLKAKDIFDELAVSLTNMVDRSLILENKIDLLSLQVKKNDSLILEPLVNQ--QVEVYKIHLSRDDERFVQMEMPDCIKEMFDVAEPPPDLYKLDEFRKEEGDSLKYYTDPDFFLREW 573
            MP+  R I PV +S+ ++P SV  E  E + N TL+N I+Q+S L+  A+D+F EL +    +  ++ +L  +++ LS +V + DS + EP + +    + +K +L+ D +   +  +P  + + ++  EPPPDL KL+ FR++  ++LK+YTDPD+F   W
Sbjct:    1 MPVTKRDISPVGLSRHRLPPSVRTEELECVSNGTLANLIRQLSSLSAHAEDVFGELYMETVKVQHKTAMLSGRLETLSAKVGELDSALDEPSIQEFYLCKPFKSNLAFDQQPLSRHTLPAAMSQRYERGEPPPDLEKLNGFREDGKNALKFYTDPDYFFELW 162          
BLAST of WH2 domain-containing protein vs. TrEMBL
Match: A0A085M949 (WH2 domain-containing protein OS=Trichuris suis OX=68888 GN=M513_05450 PE=4 SV=1)

HSP 1 Score: 115.546 bits (288), Expect = 3.962e-24
Identity = 56/162 (34.57%), Postives = 99/162 (61.11%), Query Frame = 1
Query:   97 MPIANRCIVPVCVSQVKVPASVENE-FEYIVNATLSNFIKQISCLTLKAKDIFDELAVSLTNMVDRSLILENKIDLLSLQVKKNDSLILEPLVNQ--QVEVYKIHLSRDDERFVQMEMPDCIKEMFDVAEPPPDLYKLDEFRKEEGDSLKYYTDPDFFLREW 573
            MP+  R I PV +S+ ++P SV  E  E + N TL+N I+Q+S L+  A+D+F EL +    +  ++ +L  +++ LS +V + DS + EP + +    + +K +L+ D +   +  +P  + + ++  EPPPDL KL+ FR++  ++LK+YTDPD+F   W
Sbjct:    1 MPVTKRDISPVGLSRHRLPPSVRTEELECVSNGTLANLIRQLSSLSAHAEDVFGELYMETVKVQHKTAMLSGRLETLSAKVGELDSALDEPSIQEFYLCKPFKSNLAFDQQPLSRHTLPAAMSQRYERGEPPPDLEKLNGFREDGKNALKFYTDPDYFFELW 162          
BLAST of WH2 domain-containing protein vs. Ensembl Cavefish
Match: wasf3b (WASP family member 3 [Source:NCBI gene;Acc:103035227])

HSP 1 Score: 90.1225 bits (222), Expect = 2.917e-19
Identity = 51/161 (31.68%), Postives = 89/161 (55.28%), Query Frame = 1
Query:   97 MPIANRCIVPVCVSQVKVPASVENEFEYIVNATLSNFIKQISCLTLKAKDIFDELAVSLTNMVDRSLILENKIDLLSLQVKKNDSLILEPLVN--QQVEVYKIHLSRDDERFVQMEMPDCIKEMFDVAEPPPDLYKLDEFRKEEGDSLKYYTDPDFFLREW 573
            MP+  R I P  + +  +P  + +E E ++N TLS  I+Q+S L+  A+DIF EL         R+  L+++ID L+++V + DS + E  +      + +K    +D +   Q  +P  +KEM+++++ PP L  L  +R +  + LK+YTDP +F   W
Sbjct:    1 MPLVKRNIEPRHLCRGALPEGIGSELECVMNNTLSAIIRQLSSLSKHAEDIFGELFKEANMFYLRANSLQDRIDRLAVKVTQLDSTVEEVSLQDINMRKAFKSSTVQDQQVVSQRSIPIPVKEMYNISDKPPPLNILSPYRDDNKEGLKFYTDPSYFFDLW 161          
BLAST of WH2 domain-containing protein vs. Ensembl Cavefish
Match: zgc:109889 (wiskott-Aldrich syndrome protein family member 3-like [Source:NCBI gene;Acc:103028652])

HSP 1 Score: 90.1225 bits (222), Expect = 3.822e-19
Identity = 51/163 (31.29%), Postives = 90/163 (55.21%), Query Frame = 1
Query:   97 MPIANRCIVPVCVSQVKVPASVENEFEYIVNATLSNFIKQISCLTLKAKDIFDELAVSLTNMVDRSLILENKIDLLSLQVKKNDSLILEPLVNQQ----VEVYKIHLSRDDERFVQMEMPDCIKEMFDVAEPPPDLYKLDEFRKEEGDSLKYYTDPDFFLREW 573
            MP+  R I P  + +  +P  V +E E + N+TL+  IKQ+  L+  A+DIF EL     +   R   L+ ++DLL+++V + DS + E  V+ Q     + +K   ++D +   +  +P+ + E++   + PP L  L  +R ++ D+LK+YTDP +F   W
Sbjct:    1 MPLVKRSIEPRHLCRGALPDGVTSELECVTNSTLAAIIKQLGSLSRHAEDIFGELFKEANSFYLRMNHLQERVDLLAVKVTQLDSTVEE--VSLQDINMRKAFKSSTTQDQQVVSRASIPNPVMEIYHHGDKPPPLNILSPYRDDKKDALKFYTDPSYFFNLW 161          
BLAST of WH2 domain-containing protein vs. Ensembl Cavefish
Match: zgc:109889 (wiskott-Aldrich syndrome protein family member 3-like [Source:NCBI gene;Acc:103028652])

HSP 1 Score: 89.7373 bits (221), Expect = 4.465e-19
Identity = 51/163 (31.29%), Postives = 90/163 (55.21%), Query Frame = 1
Query:   97 MPIANRCIVPVCVSQVKVPASVENEFEYIVNATLSNFIKQISCLTLKAKDIFDELAVSLTNMVDRSLILENKIDLLSLQVKKNDSLILEPLVNQQ----VEVYKIHLSRDDERFVQMEMPDCIKEMFDVAEPPPDLYKLDEFRKEEGDSLKYYTDPDFFLREW 573
            MP+  R I P  + +  +P  V +E E + N+TL+  IKQ+  L+  A+DIF EL     +   R   L+ ++DLL+++V + DS + E  V+ Q     + +K   ++D +   +  +P+ + E++   + PP L  L  +R ++ D+LK+YTDP +F   W
Sbjct:    1 MPLVKRSIEPRHLCRGALPDGVTSELECVTNSTLAAIIKQLGSLSRHAEDIFGELFKEANSFYLRMNHLQERVDLLAVKVTQLDSTVEE--VSLQDINMRKAFKSSTTQDQQVVSRASIPNPVMEIYHHGDKPPPLNILSPYRDDKKDALKFYTDPSYFFNLW 161          
BLAST of WH2 domain-containing protein vs. Ensembl Cavefish
Match: zgc:109889 (wiskott-Aldrich syndrome protein family member 3-like [Source:NCBI gene;Acc:103028652])

HSP 1 Score: 89.7373 bits (221), Expect = 5.640e-19
Identity = 51/163 (31.29%), Postives = 90/163 (55.21%), Query Frame = 1
Query:   97 MPIANRCIVPVCVSQVKVPASVENEFEYIVNATLSNFIKQISCLTLKAKDIFDELAVSLTNMVDRSLILENKIDLLSLQVKKNDSLILEPLVNQQ----VEVYKIHLSRDDERFVQMEMPDCIKEMFDVAEPPPDLYKLDEFRKEEGDSLKYYTDPDFFLREW 573
            MP+  R I P  + +  +P  V +E E + N+TL+  IKQ+  L+  A+DIF EL     +   R   L+ ++DLL+++V + DS + E  V+ Q     + +K   ++D +   +  +P+ + E++   + PP L  L  +R ++ D+LK+YTDP +F   W
Sbjct:    1 MPLVKRSIEPRHLCRGALPDGVTSELECVTNSTLAAIIKQLGSLSRHAEDIFGELFKEANSFYLRMNHLQERVDLLAVKVTQLDSTVEE--VSLQDINMRKAFKSSTTQDQQVVSRASIPNPVMEIYHHGDKPPPLNILSPYRDDKKDALKFYTDPSYFFNLW 161          
BLAST of WH2 domain-containing protein vs. Ensembl Cavefish
Match: wasf3a (WASP family member 3a [Source:ZFIN;Acc:ZDB-GENE-060531-55])

HSP 1 Score: 88.9669 bits (219), Expect = 7.610e-19
Identity = 51/162 (31.48%), Postives = 89/162 (54.94%), Query Frame = 1
Query:   97 MPIANRCIVPVCVSQVKVPASVENEFEYIVNATLSNFIKQISCLTLKAKDIFDELAVSLTNMVDRSLILENKIDLLSLQVKKNDSLILEPLVNQQVEVYKIHLS---RDDERFVQMEMPDCIKEMFDVAEPPPDLYKLDEFRKEEGDSLKYYTDPDFFLREW 573
            MP+  R I P  +S+  +P  + +E E + N TLS  I+Q+S L+  A+D+F EL         R+  L++++D L+++V + DS + E +  Q + + K   S   +D +   +   P+ I E+++ +E PP L  L  +R +  D +K+YTDP +F   W
Sbjct:    1 MPLVKRNIEPRHLSRGALPEGIGSELECVTNNTLSAIIRQLSSLSKHAEDVFGELFNEANTFYLRANSLQDRVDRLAVKVTQLDSSVEE-VSLQDINMRKAFRSSTVQDQQVVSKSSTPNPITEIYNSSEKPPPLSVLSAYRDDHVDGMKFYTDPSYFFDLW 161          
BLAST of WH2 domain-containing protein vs. Ensembl Nematostella
Match: EDO33524 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SRY9])

HSP 1 Score: 86.6557 bits (213), Expect = 6.112e-20
Identity = 47/167 (28.14%), Postives = 91/167 (54.49%), Query Frame = 1
Query:   97 MPIANRCIVPVCVSQVKVPASVENEFEYIVNATLSNFIKQISCLTLKAKDIFDELAVSLTNMVDRSLILENKIDLLSLQVKKNDSLILEPLVNQQVEVYKIHLSR--------DDERFVQMEMPDCIKEMFDVAEPPPDLYKLDEFRKEEGDSLKYYTDPDFFLREW 573
            MP+  R I P  +S+ K+  ++ NE E +   TL   ++Q+S L+  A+D+F EL +   N+  RS  L+ +I  LS++V + DS        +Q+ +  I++ +        D +      +P  +++ +++ + PP L  ++++R ++ D+LK+YTDP +F   W
Sbjct:    1 MPLIKRLIEPTDLSRGKIGDNLANELEAVSVNTLCGIMRQLSSLSKHAEDVFGELYMEANNIFKRSNSLQERIHNLSMKVTQLDS------AGEQISLQDINMRKAFKSTIIVDQQVLSCNTLPSAMRDRYNMCDKPPRLSDMNKYRDDDKDALKFYTDPTYFFELW 161          
BLAST of WH2 domain-containing protein vs. Ensembl Medaka
Match: wasf3b (WASP family member 3 [Source:NCBI gene;Acc:101161761])

HSP 1 Score: 92.0485 bits (227), Expect = 7.642e-20
Identity = 52/163 (31.90%), Postives = 95/163 (58.28%), Query Frame = 1
Query:   97 MPIANRCIVPVCVSQVKVPASVENEFEYIVNATLSNFIKQISCLTLKAKDIFDELAVSLTNMVDRSLILENKIDLLSLQVKKNDSLILEPLVNQQ----VEVYKIHLSRDDERFVQMEMPDCIKEMFDVAEPPPDLYKLDEFRKEEGDSLKYYTDPDFFLREW 573
            MP+  R I P  + + ++P  + +E E ++N TLS  I+Q+S L+  A+DIF EL         R+  L+++ID L+++V + DS + E  V+ Q     + +K   ++D +   +  +P  +KEM+++++ PP L  L  +R ++ ++LK+YTDP +F   W
Sbjct:    1 MPLVKRNIEPRHLCRGQLPEGIGSELECVMNNTLSAIIRQLSSLSKHAEDIFGELFNEANTFYLRANSLQDRIDRLAVKVTQLDSTVEE--VSLQDINMRKAFKSSTTQDQQVVSKSSVPIPVKEMYNLSDKPPPLTILTPYRDDQKEALKFYTDPSYFFDLW 161          
BLAST of WH2 domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000008353.2 (wiskott-Aldrich syndrome protein family member 3-like [Source:NCBI gene;Acc:101160681])

HSP 1 Score: 90.5077 bits (223), Expect = 1.886e-19
Identity = 47/161 (29.19%), Postives = 88/161 (54.66%), Query Frame = 1
Query:   97 MPIANRCIVPVCVSQVKVPASVENEFEYIVNATLSNFIKQISCLTLKAKDIFDELAVSLTNMVDRSLILENKIDLLSLQVKKNDSLILEPLVN--QQVEVYKIHLSRDDERFVQMEMPDCIKEMFDVAEPPPDLYKLDEFRKEEGDSLKYYTDPDFFLREW 573
            MP+  R I P  + Q  VP  + NE E + N TLS  I+Q+S L+ +A+++F EL         R+  L+++ID L+++V + DS + E  +      + ++    ++ +   +   P C+ +M++  + PP L  L  +R++  D++K+Y+DP +F   W
Sbjct:    1 MPLVRRNIEPRHLCQGPVPGRIGNELECVTNNTLSAIIRQLSSLSKQAENVFGELFNEANTFYVRANSLQDRIDRLAVKVTQLDSGVEEVSLKDINMRKAFRSSAVQNQQVLSKSSTPSCVADMYNSCDRPPPLTTLSSYREDSIDAMKFYSDPSYFFDLW 161          
BLAST of WH2 domain-containing protein vs. Ensembl Medaka
Match: wasf2 (WASP family member 2 [Source:NCBI gene;Acc:101175491])

HSP 1 Score: 87.8113 bits (216), Expect = 1.721e-18
Identity = 46/163 (28.22%), Postives = 90/163 (55.21%), Query Frame = 1
Query:   97 MPIANRCIVPVCVSQVKVPASVENEFEYIVNATLSNFIKQISCLTLKAKDIFDELAVSLTNMVDRSLILENKIDLLSLQVK----KNDSLILEPLVNQQVEVYKIHLSRDDERFVQMEMPDCIKEMFDVAEPPPDLYKLDEFRKEEGDSLKYYTDPDFFLREW 573
            MP+  R I P  V +  +P+++ +E E + N +L+N I+Q+  L+  A+D+F EL V   +   R   L  +++ L ++V     K + + L+ +  ++   ++   S+D + F++  +P  I++ +    PPP L +L ++R +  + LK+YTDP +F   W
Sbjct:    1 MPLVTRNIEPRHVCRQTIPSTIRSELECVTNISLANIIRQLGSLSKFAEDVFGELFVEAGSFALRVDTLVKRVECLQVKVTQLDPKEEEVSLQAITTRKA--FRSDRSQDQQLFIRPSLPVPIQDTYLTCNPPPPLNQLSQYRDDGKEPLKFYTDPSYFFDLW 161          
BLAST of WH2 domain-containing protein vs. Ensembl Medaka
Match: zgc:109889 (wiskott-Aldrich syndrome protein family member 3 [Source:NCBI gene;Acc:101165595])

HSP 1 Score: 85.1149 bits (209), Expect = 1.734e-17
Identity = 51/162 (31.48%), Postives = 88/162 (54.32%), Query Frame = 1
Query:   97 MPIANRCIVPVCVSQVKVPASVENEFEYIVNATLSNFIKQISCLTLKAKDIFDELAVSLTNMVDRSLILENKIDLLSLQVKKNDSLILEPLVNQQVEVYKIHLS---RDDERFVQMEMPDCIKEMFDVAEPPPDLYKLDEFRKEEGDSLKYYTDPDFFLREW 573
            MP+  R I P  + +  +P  V +E E + N+TL+  IKQ+  L+  A+DIF EL     +   R   L+ ++D L+++V + DS + E +  Q + + K   S   +D +   +  +P+ + EM+   + PP L  L  +R ++ D+LK+YTDP +F   W
Sbjct:    1 MPLVKRNIEPRHLCRGALPDGVTSELECVTNSTLAAIIKQLGSLSRHAEDIFGELFNEANSFYLRMSGLQERVDQLAVKVTQLDSTVEE-VSLQDINMRKAFKSSTIQDQQVVSRTSVPNPVVEMYHRCDKPPPLNILTPYRDDKKDALKFYTDPSYFFNLW 161          
BLAST of WH2 domain-containing protein vs. Ensembl Medaka
Match: wasf1 (WASP family member 1 [Source:NCBI gene;Acc:101159716])

HSP 1 Score: 82.8037 bits (203), Expect = 9.538e-17
Identity = 48/163 (29.45%), Postives = 87/163 (53.37%), Query Frame = 1
Query:   97 MPIANRCIVPVCVSQVKVPASVENEFEYIVNATLSNFIKQISCLTLKAKDIFDELAVSLTNMVDRSLILENKIDLLSLQVK----KNDSLILEPLVNQQVEVYKIHLSRDDERFVQMEMPDCIKEMFDVAEPPPDLYKLDEFRKEEGDSLKYYTDPDFFLREW 573
            MP+  R I P  +    +P +++NE E + N +L+N I+Q+S L+  A+D+F EL     +   R   L+ ++D LS+ V     K + L L+ +  ++   ++    +D + F +  +P  ++E F   E PP L+ L  +R +  + LK+YT+P +F   W
Sbjct:    1 MPLVKRTIEPRHLCHTVLPRNIKNELECVTNISLANVIRQLSSLSKYAEDLFGELFNEAHSFSFRVNSLQERVDRLSISVTQLDPKEEELSLQDITMRK--AFRSSTIQDQQLFERTSLPVPMQETFHTCEQPPPLHILTPYRDDGKECLKFYTNPSYFFDLW 161          
BLAST of WH2 domain-containing protein vs. Planmine SMEST
Match: SMESG000024265.1 (SMESG000024265.1)

HSP 1 Score: 530.406 bits (1365), Expect = 0.000e+0
Identity = 337/339 (99.41%), Postives = 338/339 (99.71%), Query Frame = 1
Query:   97 MPIANRCIVPVCVSQVKVPASVENEFEYIVNATLSNFIKQISCLTLKAKDIFDELAVSLTNMVDRSLILENKIDLLSLQVKKNDSLILEPLVNQQVEVYKIHLSRDDERFVQMEMPDCIKEMFDVAEPPPDLYKLDEFRKEEGDSLKYYTDPDFFLREWLXXXXXXXXXXXXXXXXXXXXXXXENLSFLXXXXXXXXXXXGVETEECVTNYNYGDVSIYEDPHFYNQTIDESNADSQLEIDSPRIEDVNLXXXXXXXXXXXXXXXXXXISFSINTNXXXXXXXXXXXXNLLRDIQKGAILKPVTAQKESKRKTMDFRAMIAELRPAWDNCSESDETDED 1113
            MPIANRCIVPVCVSQVKVPASVENEFEYIVNATLSNFIKQISCLTLKAKDIFDELAVSLTNMVDRSLILENKIDLLSLQVKKNDS+ILEPLVNQQVEVYKIHLSRDDERFVQMEMPDCIKEMFDVAEPPPDLYKLDEFRKEEGDSLKYYTDPDFFLREWLKNVRVDKKKKKEKKRRKSLTKAKENLSFLPPPPIVQQIPQGVETEECVTNYNYGDVSIYEDPHFYNQTIDESNADSQLEIDSP IEDVNLPHPPPPPPLPPPPPAPVPISFSINTNPQPIIPQVDPIQNLLRDIQKGAILKPVTAQKESKRKTMDFRAMIAELRPAWDNCSESDETDED
Sbjct:    1 MPIANRCIVPVCVSQVKVPASVENEFEYIVNATLSNFIKQISCLTLKAKDIFDELAVSLTNMVDRSLILENKIDLLSLQVKKNDSVILEPLVNQQVEVYKIHLSRDDERFVQMEMPDCIKEMFDVAEPPPDLYKLDEFRKEEGDSLKYYTDPDFFLREWLKNVRVDKKKKKEKKRRKSLTKAKENLSFLPPPPIVQQIPQGVETEECVTNYNYGDVSIYEDPHFYNQTIDESNADSQLEIDSPGIEDVNLPHPPPPPPLPPPPPAPVPISFSINTNPQPIIPQVDPIQNLLRDIQKGAILKPVTAQKESKRKTMDFRAMIAELRPAWDNCSESDETDED 339          
BLAST of WH2 domain-containing protein vs. Planmine SMEST
Match: SMESG000061999.1 (SMESG000061999.1)

HSP 1 Score: 124.79 bits (312), Expect = 2.760e-31
Identity = 63/162 (38.89%), Postives = 94/162 (58.02%), Query Frame = 1
Query:   97 MPIANRCIVPVCVSQVKVPASVENEFEYIVNATLSNFIKQISCLTLKAKDIFDELAVSLTNMVDRSLILENKIDLLSLQVKKN---DSLILEPLVNQQVEVYKIHLSRDDERFVQMEMPDCIKEMFDVAEPPPDLYKLDEFRKEEGDSLKYYTDPDFFLREW 573
            MP+  R I PV VS V VP  V+NE EY+ NATLSN  +Q++ L+L+A DIF EL   L  + +RS  L  +I+ L L + +    +  ++  L++ Q   Y+  +  D +      MP+ I  ++   EPPP L +LD+FR +   S+K+YTDP+FF   W
Sbjct:    1 MPLPKRAITPVNVSNVIVPKEVDNELEYVANATLSNLTRQLASLSLQASDIFSELTEQLIGITNRSERLNQRIETLKLTISQTAIREDDLMTGLMSLQANPYRSRMEADQQVLNTNSMPNSIVTIYQQCEPPPALDQLDKFRYDNKQSMKFYTDPNFFFHLW 162          
The following BLAST results are available for this feature:
BLAST of WH2 domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
WASF31.760e-1830.67WASP family member 3 [Source:HGNC Symbol;Acc:HGNC:... [more]
WASF11.964e-1830.67WASP family member 1 [Source:HGNC Symbol;Acc:HGNC:... [more]
WASF36.207e-1830.67WASP family member 3 [Source:HGNC Symbol;Acc:HGNC:... [more]
WASF36.678e-1830.67WASP family member 3 [Source:HGNC Symbol;Acc:HGNC:... [more]
WASF11.777e-1632.72WASP family member 1 [Source:HGNC Symbol;Acc:HGNC:... [more]
back to top
BLAST of WH2 domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
wve-11.200e-1628.40WAVE (Actin cytoskeleton modulator) homolog [Sour... [more]
back to top
BLAST of WH2 domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SCAR3.082e-2135.76gene:FBgn0041781 transcript:FBtr0080148[more]
SCAR3.215e-2135.76gene:FBgn0041781 transcript:FBtr0305256[more]
SCAR3.307e-2135.76gene:FBgn0041781 transcript:FBtr0340223[more]
SCAR3.340e-2135.76gene:FBgn0041781 transcript:FBtr0305255[more]
SCAR3.392e-2135.76gene:FBgn0041781 transcript:FBtr0329949[more]
back to top
BLAST of WH2 domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
wasf3a2.222e-2032.30WASP family member 3a [Source:ZFIN;Acc:ZDB-GENE-06... [more]
wasf23.915e-2029.45WASP family member 2 [Source:ZFIN;Acc:ZDB-GENE-040... [more]
zgc:1098892.236e-1931.48zgc:109889 [Source:ZFIN;Acc:ZDB-GENE-050522-547][more]
zgc:1098891.734e-1830.43zgc:109889 [Source:ZFIN;Acc:ZDB-GENE-050522-547][more]
zgc:1098891.734e-1830.43zgc:109889 [Source:ZFIN;Acc:ZDB-GENE-050522-547][more]
back to top
BLAST of WH2 domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
wasf33.977e-1830.43WAS protein family member 3 [Source:NCBI gene;Acc:... [more]
wasf34.672e-1830.43WAS protein family member 3 [Source:NCBI gene;Acc:... [more]
tmprss132.396e-1731.29transmembrane serine protease 13 [Source:Xenbase;A... [more]
foxq15.440e-1730.06forkhead box Q1 [Source:Xenbase;Acc:XB-GENE-483842... [more]
foxq15.601e-1729.88forkhead box Q1 [Source:Xenbase;Acc:XB-GENE-483842... [more]
back to top
BLAST of WH2 domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Wasf32.161e-1831.29WAS protein family, member 3 [Source:MGI Symbol;Ac... [more]
Wasf11.372e-1632.72WAS protein family, member 1 [Source:MGI Symbol;Ac... [more]
Wasf11.372e-1632.72WAS protein family, member 1 [Source:MGI Symbol;Ac... [more]
Wasf29.987e-1325.77WAS protein family, member 2 [Source:MGI Symbol;Ac... [more]
Wasf29.987e-1325.77WAS protein family, member 2 [Source:MGI Symbol;Ac... [more]
back to top
BLAST of WH2 domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8VHI6|WASF3_MOUSE1.512e-1731.29Wiskott-Aldrich syndrome protein family member 3 O... [more]
sp|Q9UPY6|WASF3_HUMAN3.207e-1730.67Wiskott-Aldrich syndrome protein family member 3 O... [more]
sp|Q5BJU7|WASF1_RAT8.532e-1632.72Wiskott-Aldrich syndrome protein family member 1 O... [more]
sp|Q92558|WASF1_HUMAN8.532e-1632.72Wiskott-Aldrich syndrome protein family member 1 O... [more]
sp|Q0IIJ3|WASF1_BOVIN8.532e-1630.67Wiskott-Aldrich syndrome protein family member 1 O... [more]
back to top
BLAST of WH2 domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
H9JD815.200e-2536.20WH2 domain-containing protein OS=Bombyx mori OX=70... [more]
A0A1E1W0T26.869e-2534.36Uncharacterized protein (Fragment) OS=Pectinophora... [more]
A0A4C1UUL82.969e-2435.58Wiskott-Aldrich syndrome protein family member 3 O... [more]
A0A085NSL83.952e-2434.57WH2 domain-containing protein OS=Trichuris suis OX... [more]
A0A085M9493.962e-2434.57WH2 domain-containing protein OS=Trichuris suis OX... [more]
back to top
BLAST of WH2 domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
wasf3b2.917e-1931.68WASP family member 3 [Source:NCBI gene;Acc:1030352... [more]
zgc:1098893.822e-1931.29wiskott-Aldrich syndrome protein family member 3-l... [more]
zgc:1098894.465e-1931.29wiskott-Aldrich syndrome protein family member 3-l... [more]
zgc:1098895.640e-1931.29wiskott-Aldrich syndrome protein family member 3-l... [more]
wasf3a7.610e-1931.48WASP family member 3a [Source:ZFIN;Acc:ZDB-GENE-06... [more]
back to top
BLAST of WH2 domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of WH2 domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of WH2 domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO335246.112e-2028.14Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of WH2 domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
wasf3b7.642e-2031.90WASP family member 3 [Source:NCBI gene;Acc:1011617... [more]
ENSORLT00000008353.21.886e-1929.19wiskott-Aldrich syndrome protein family member 3-l... [more]
wasf21.721e-1828.22WASP family member 2 [Source:NCBI gene;Acc:1011754... [more]
zgc:1098891.734e-1731.48wiskott-Aldrich syndrome protein family member 3 [... [more]
wasf19.538e-1729.45WASP family member 1 [Source:NCBI gene;Acc:1011597... [more]
back to top
BLAST of WH2 domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000024265.10.000e+099.41SMESG000024265.1[more]
SMESG000061999.12.760e-3138.89SMESG000061999.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30009156 ID=SMED30009156|Name=WH2 domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1230bp
TTTTAAAACATCAATTATATCAATTAGGAAACTTATATTTTAAATTGTCT
TATTTTAATAGTTATTTGTTAATAGATAAAGTGATAATCTTTTTTTATGC
CTATTGCTAATCGATGCATTGTACCGGTATGTGTAAGTCAAGTTAAAGTT
CCAGCATCTGTTGAAAATGAATTTGAATATATTGTTAATGCTACTTTGTC
AAATTTTATTAAACAAATATCCTGTTTAACTTTAAAAGCTAAAGATATTT
TTGATGAGTTAGCAGTTTCATTGACAAATATGGTTGATCGTAGTTTAATT
CTGGAAAACAAAATAGATTTACTTTCGTTACAAGTGAAAAAAAATGATTC
TCTAATTTTAGAACCTCTTGTAAATCAACAAGTTGAAGTTTATAAAATTC
ACTTGAGTCGCGATGATGAACGATTTGTTCAAATGGAAATGCCGGATTGT
ATTAAGGAAATGTTTGATGTTGCTGAACCACCGCCGGATTTATATAAACT
CGATGAATTTAGAAAAGAGGAAGGTGACAGTTTAAAGTATTACACTGATC
CTGACTTTTTTCTCCGAGAATGGTTGAAAAATGTCCGGGTTGATAAGAAA
AAGAAAAAGGAGAAGAAAAGACGAAAATCTTTGACCAAGGCTAAGGAAAA
TCTGTCATTTTTACCTCCACCTCCAATCGTCCAACAAATACCTCAAGGAG
TGGAAACGGAAGAATGCGTTACAAATTATAATTATGGTGACGTTTCTATT
TATGAAGATCCACACTTTTACAATCAAACCATTGATGAAAGCAATGCTGA
CAGCCAATTGGAAATAGATTCACCAAGGATAGAGGATGTAAATTTACCAC
ATCCGCCGCCACCACCCCCTCTTCCGCCTCCTCCCCCAGCACCAGTACCA
ATATCTTTTTCAATCAATACAAATCCACAACCTATCATTCCTCAGGTTGA
TCCCATTCAAAATTTGTTAAGGGACATTCAAAAAGGAGCAATTTTAAAGC
CTGTTACTGCTCAAAAAGAATCCAAGCGCAAAACTATGGACTTTCGGGCG
ATGATTGCTGAATTGCGACCGGCTTGGGACAATTGTTCTGAATCAGACGA
AACTGATGAAGATTAATATTTGAAAATTTTATATTTATTGCTGCTCAATT
TTTAATTTACTTATTTTTATTTTATAATTTCTATAAAATGGTTTGTATTT
GCCTAAATATAAATTTGTCTTTTTCTAAAA
back to top

protein sequence of SMED30009156-orf-1

>SMED30009156-orf-1 ID=SMED30009156-orf-1|Name=SMED30009156-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=340bp
MPIANRCIVPVCVSQVKVPASVENEFEYIVNATLSNFIKQISCLTLKAKD
IFDELAVSLTNMVDRSLILENKIDLLSLQVKKNDSLILEPLVNQQVEVYK
IHLSRDDERFVQMEMPDCIKEMFDVAEPPPDLYKLDEFRKEEGDSLKYYT
DPDFFLREWLKNVRVDKKKKKEKKRRKSLTKAKENLSFLPPPPIVQQIPQ
GVETEECVTNYNYGDVSIYEDPHFYNQTIDESNADSQLEIDSPRIEDVNL
PHPPPPPPLPPPPPAPVPISFSINTNPQPIIPQVDPIQNLLRDIQKGAIL
KPVTAQKESKRKTMDFRAMIAELRPAWDNCSESDETDED*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000070intestinal phagocyte
PLANA:0002032epidermal cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR028288SCAR/WAVE_fam
Vocabulary: molecular function
TermDefinition
GO:0003779actin binding
Vocabulary: cellular component
TermDefinition
GO:0005856cytoskeleton
Vocabulary: biological process
TermDefinition
GO:0030036actin cytoskeleton organization
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:1.20.5.340coord: 1..85
e-value: 2.9E-19
score: 71.1
NoneNo IPR availableGENE3DG3DSA:1.20.58.1570coord: 86..189
e-value: 4.1E-17
score: 64.4
NoneNo IPR availablePANTHERPTHR12902:SF7WISKOTT-ALDRICH SYNDROME PROTEIN FAMILY MEMBER 3coord: 1..178
IPR028288SCAR/WAVE familyPANTHERPTHR12902WASP-1coord: 1..178