ARF-GAP with dual PH domain-containing protein 1

Overview
NameARF-GAP with dual PH domain-containing protein 1
Smed IDSMED30009149
Length (bp)1581
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of ARF-GAP with dual PH domain-containing protein 1 (SMED30009149) t-SNE clustered cells

Violin plots show distribution of expression levels for ARF-GAP with dual PH domain-containing protein 1 (SMED30009149) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of ARF-GAP with dual PH domain-containing protein 1 (SMED30009149) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for ARF-GAP with dual PH domain-containing protein 1 (SMED30009149) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30009149

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
muscle cellSMED30009149SMESG000066067.1 dd_Smed_v4_1479_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
lateral region of the whole animalSMED30009149SMESG000066067.1 dd_Smed_v4_1479_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30009149SMESG000066067.1 dd_Smed_v4_1479_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30009149SMESG000066067.1 dd_Smed_v4_1479_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30009149SMESG000066067.1 dd_Smed_v6_1479_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30009149SMESG000066067.1 dd_Smed_v4_1479_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of ARF-GAP with dual PH domain-containing protein 1 vs. Ensembl Human
Match: ADAP1 (ArfGAP with dual PH domains 1 [Source:HGNC Symbol;Acc:HGNC:16486])

HSP 1 Score: 190.66 bits (483), Expect = 6.435e-55
Identity = 116/395 (29.37%), Postives = 197/395 (49.87%), Query Frame = 1
Query:   61 MSQER---LIKLYSVPGNNICADCNAEKPDYLVLSYNIIICRKCAGVHRSMENV-RVRDLNFDKISDAEINEVLKFGNKKSNDIYLKYLPIFYRLPNSNGPEILRRSFIIAKYQIKQFSVKEIDRPYIVNQKLGILKKRCKDKNIYNSRFFRLSIPDISFNYFIKETDVTNYDRSQMKLKSRKDPKRNLRLDRINASF----IDNPDSRARIPDEILMISFFRHEEASWRHIYLKSNTPEDLVDWYQTIRFAKFSLRAAYVVGTGDEANELELARDLTLDITMSGWMYKTGSQLTEQWQKRWCVLLGRRLLYSSGPLSASGKGEIVIGERSKGYGAVSGAPPNSRSVMSDQTALTIKTPGREYLFAVDSEGDVAERWIKCINNLADVEMSIREMA 1221
            M++ER   +++L   PGN  CADC A  PD+   +  + IC  C+G+HR++  V +V+ +  D   +A++  +   GN  +   +   +P FY  P  +  ++LR  +I AKY+ ++F   E   PY    + G L KR +D   + SR F L+  + +  YF +                 K+PK  ++++ +NA+F    I +P          L +++ +  + S R+I++     +++VDW+  +R A+F        G GD     +L   L+ +    G+M KTG + TE ++KRW  +  RRL+Y   PL A  +GE+ IG +  GY  + G PP+++        +TI TP R++LFA ++E D  E W+       D  M  +E A
Sbjct:    1 MAKERRRAVLELLQRPGNARCADCGAPDPDWASYTLGVFICLSCSGIHRNIPQVSKVKSVRLDAWEEAQVEFMASHGNDAARARFESKVPSFYYRPTPSDCQLLREQWIRAKYERQEFIYPEKQEPYSAGYREGFLWKRGRDNGQFLSRKFVLTEREGALKYFNR--------------NDAKEPKAVMKIEHLNATFQPAKIGHPHG--------LQVTYLK--DNSTRNIFIYHEDGKEIVDWFNALRAARFHYLQVAFPGAGD----ADLVPKLSRNYLKEGYMEKTGPKQTEGFRKRWFTMDDRRLMYFKDPLDAFARGEVFIGSKESGYTVLHGFPPSTQGHHWPH-GITIVTPDRKFLFACETESDQRE-WVAAFQKAVDRPMLPQEYA 365          
BLAST of ARF-GAP with dual PH domain-containing protein 1 vs. Ensembl Human
Match: ADAP1 (ArfGAP with dual PH domains 1 [Source:HGNC Symbol;Acc:HGNC:16486])

HSP 1 Score: 185.267 bits (469), Expect = 6.753e-53
Identity = 116/395 (29.37%), Postives = 196/395 (49.62%), Query Frame = 1
Query:   61 MSQER---LIKLYSVPGNNICADCNAEKPDYLVLSYNIIICRKCAGVHRSMENV-RVRDLNFDKISDAEINEVLKFGNKKSNDIYLKYLPIFYRLPNSNGPEILRRSFIIAKYQIKQFSVKEIDRPYIVNQKLGILKKRCKDKNIYNSRFFRLSIPDISFNYFIKETDVTNYDRSQMKLKSRKDPKRNLRLDRINASF----IDNPDSRARIPDEILMISFFRHEEASWRHIYLKSNTPEDLVDWYQTIRFAKFSLRAAYVVGTGDEANELELARDLTLDITMSGWMYKTGSQLTEQWQKRWCVLLGRRLLYSSGPLSASGKGEIVIGERSKGYGAVSGAPPNSRSVMSDQTALTIKTPGREYLFAVDSEGDVAERWIKCINNLADVEMSIREMA 1221
            M++ER   +++L   PGN  CADC A  PD+   +  + IC  C+G+HR++  V +V+ +  D   +A++  +   GN  +   +   +P FY  P  +  ++LR  +I AKY+ ++F   E   PY    + G L KR +D   + SR F L+  + +  YF +                 K+PK  ++++ +NA+F    I +P          L +++ +  + S R+I++     + +VDW+  +R A+F        G GD     +L   L+ +    G+M KTG + TE ++KRW  +  RRL+Y   PL A  +GE+ IG +  GY  + G PP+++        +TI TP R++LFA ++E D  E W+       D  M  +E A
Sbjct:    1 MAKERRRAVLELLQRPGNARCADCGAPDPDWASYTLGVFICLSCSGIHRNIPQVSKVKSVRLDAWEEAQVEFMASHGNDAARARFESKVPSFYYRPTPSDCQLLREQWIRAKYERQEFIYPEKQEPYSAGYREGFLWKRGRDNGQFLSRKFVLTEREGALKYFNR--------------NDAKEPKAVMKIEHLNATFQPAKIGHPHG--------LQVTYLK--DNSTRNIFIYHEDGK-IVDWFNALRAARFHYLQVAFPGAGD----ADLVPKLSRNYLKEGYMEKTGPKQTEGFRKRWFTMDDRRLMYFKDPLDAFARGEVFIGSKESGYTVLHGFPPSTQGHHWPH-GITIVTPDRKFLFACETESDQRE-WVAAFQKAVDRPMLPQEYA 364          
BLAST of ARF-GAP with dual PH domain-containing protein 1 vs. Ensembl Human
Match: ADAP1 (ArfGAP with dual PH domains 1 [Source:HGNC Symbol;Acc:HGNC:16486])

HSP 1 Score: 168.703 bits (426), Expect = 1.374e-46
Identity = 104/367 (28.34%), Postives = 180/367 (49.05%), Query Frame = 1
Query:  136 PDYLVLSYNIIICRKCAGVHRSMENV-RVRDLNFDKISDAEINEVLKFGNKKSNDIYLKYLPIFYRLPNSNGPEILRRSFIIAKYQIKQFSVKEIDRPYIVNQKLGILKKRCKDKNIYNSRFFRLSIPDISFNYFIKETDVTNYDRSQMKLKSRKDPKRNLRLDRINASF----IDNPDSRARIPDEILMISFFRHEEASWRHIYLKSNTPEDLVDWYQTIRFAKFSLRAAYVVGTGDEANELELARDLTLDITMSGWMYKTGSQLTEQWQKRWCVLLGRRLLYSSGPLSASGKGEIVIGERSKGYGAVSGAPPNSRSVMSDQTALTIKTPGREYLFAVDSEGDVAERWIKCINNLADVEMSIREMA 1221
            PD+   +  + IC  C+G+HR++  V +V+ +  D   +A++  +   GN  +   +   +P FY  P  +  ++LR  +I AKY+ ++F   E   PY    + G L KR +D   + SR F L+  + +  YF +                 K+PK  ++++ +NA+F    I +P          L +++ +  + S R+I++     +++VDW+  +R A+F        G GD     +L   L+ +    G+M KTG + TE ++KRW  +  RRL+Y   PL A  +GE+ IG +  GY  + G PP+++        +TI TP R++LFA ++E D  E W+       D  M  +E A
Sbjct:   40 PDWASYTLGVFICLSCSGIHRNIPQVSKVKSVRLDAWEEAQVEFMASHGNDAARARFESKVPSFYYRPTPSDCQLLREQWIRAKYERQEFIYPEKQEPYSAGYREGFLWKRGRDNGQFLSRKFVLTEREGALKYFNR--------------NDAKEPKAVMKIEHLNATFQPAKIGHPHG--------LQVTYLK--DNSTRNIFIYHEDGKEIVDWFNALRAARFHYLQVAFPGAGD----ADLVPKLSRNYLKEGYMEKTGPKQTEGFRKRWFTMDDRRLMYFKDPLDAFARGEVFIGSKESGYTVLHGFPPSTQGHHWPH-GITIVTPDRKFLFACETESDQRE-WVAAFQKAVDRPMLPQEYA 376          
BLAST of ARF-GAP with dual PH domain-containing protein 1 vs. Ensembl Human
Match: ADAP2 (ArfGAP with dual PH domains 2 [Source:HGNC Symbol;Acc:HGNC:16487])

HSP 1 Score: 146.362 bits (368), Expect = 1.820e-38
Identity = 110/384 (28.65%), Postives = 183/384 (47.66%), Query Frame = 1
Query:   64 SQERLIKLYSVP--GNNICADCNAEKPDYLVLSYNIIICRKCAGVHRSMENV-RVRDLNFDKISDAEINEVLKFGNKKSNDIYLKYLPIFYRLPNSNGPEILRRSFIIAKYQIKQFSVKEIDRPYIVNQKLGILKKRCKDKNIYNSRFFRLSIPDISFNYFIKETDVTNYDRSQMKLKSRKDPKRNLRLDRINASF----IDNPDSRARIPDEILMISFFRHEEASWRHIYLKSNTPEDLVDWYQTIRFAKFSLRAAYVVGTGDEANELELARDLTLDITMSGWMYKTGSQLTEQWQKRWCVL--LGRRLLYSSGPLSASGKGEIVIGERSKGYGAVSGAPPNSRSVMSDQTALTIKTPGREYLFAVDSEGDVAERWIKCINNL 1188
            +++RL++L   P  GN  CADC A  PD+      I IC  C GVHR+  ++ RV+ +  D   D+ +  ++  GN +    +   +P FY +P +N   +L+  +I AKY+ ++F + + +   +   + G L KR +D + +  R F L   +    YF KE                K PK  + +  +NA+F    I +P          L I++ R  +   R++++   + +++VDW+  +R A    R  Y+     E  E EL   LT +    G+M KTG +  E ++KRW  L    RRLLY   PL A  +G++ +G + +GY A    P   R     +  LTI TP R ++    SE +  E W++ +  +
Sbjct:    7 NKKRLLELLRAPDTGNAHCADCGAADPDWASYKLGIFICLNCCGVHRNFPDISRVKSVRLDFWDDSIVEFMIHNGNLRVKAKFEARVPAFYYIPQANDCLVLKEQWIRAKYERREF-MADGETISLPGNREGFLWKRGRDNSQFLRRKFVLLAREGLLKYFTKEQG--------------KSPKAVISIKDLNATFQTEKIGHPHG--------LQITYRR--DGHTRNLFVYHESGKEIVDWFNALRAA----RLQYLKMAFPELPESELVPFLTRNYLKQGFMEKTGPKQKEPFKKRWFALDCHERRLLYYKNPLDAFEQGQVFLGNKEQGYEAYEDLPKGIRGNRW-KAGLTIVTPERRFVLTCPSEKEQQE-WLESLRGV 359          
BLAST of ARF-GAP with dual PH domain-containing protein 1 vs. Ensembl Human
Match: ADAP2 (ArfGAP with dual PH domains 2 [Source:HGNC Symbol;Acc:HGNC:16487])

HSP 1 Score: 145.591 bits (366), Expect = 4.229e-38
Identity = 114/390 (29.23%), Postives = 186/390 (47.69%), Query Frame = 1
Query:   64 SQERLIKLYSVP--GNNICADCNAEKPDYLVLSYNIIICRKCAGVHRSMENV-RVRDLNFDKISDA--EINEVLKF----GNKKSNDIYLKYLPIFYRLPNSNGPEILRRSFIIAKYQIKQFSVKEIDRPYIVNQKLGILKKRCKDKNIYNSRFFRLSIPDISFNYFIKETDVTNYDRSQMKLKSRKDPKRNLRLDRINASF----IDNPDSRARIPDEILMISFFRHEEASWRHIYLKSNTPEDLVDWYQTIRFAKFSLRAAYVVGTGDEANELELARDLTLDITMSGWMYKTGSQLTEQWQKRWCVL--LGRRLLYSSGPLSASGKGEIVIGERSKGYGAVSGAPPNSRSVMSDQTALTIKTPGREYLFAVDSEGDVAERWIKCINNL 1188
            +++RL++L   P  GN  CADC A  PD+      I IC  C GVHR+  ++ RV+ +  D   D+  E+  VL+F    GN +    +   +P FY +P +N   +L+  +I AKY+ ++F + + +   +   + G L KR +D + +  R F L   +    YF KE                K PK  + +  +NA+F    I +P          L I++ R  +   R++++   + +++VDW+  +R A    R  Y+     E  E EL   LT +    G+M KTG +  E ++KRW  L    RRLLY   PL A  +G++ +G + +GY A    P   R     +  LTI TP R ++    SE +  E W++ +  +
Sbjct:    7 NKKRLLELLRAPDTGNAHCADCGAADPDWASYKLGIFICLNCCGVHRNFPDISRVKSVRLDFWDDSIVEVAVVLQFMIHNGNLRVKAKFEARVPAFYYIPQANDCLVLKEQWIRAKYERREF-MADGETISLPGNREGFLWKRGRDNSQFLRRKFVLLAREGLLKYFTKEQG--------------KSPKAVISIKDLNATFQTEKIGHPHG--------LQITYRR--DGHTRNLFVYHESGKEIVDWFNALRAA----RLQYLKMAFPELPESELVPFLTRNYLKQGFMEKTGPKQKEPFKKRWFALDCHERRLLYYKNPLDAFEQGQVFLGNKEQGYEAYEDLPKGIRGNRW-KAGLTIVTPERRFVLTCPSEKEQQE-WLESLRGV 365          
BLAST of ARF-GAP with dual PH domain-containing protein 1 vs. Ensembl Celegans
Match: cnt-1 (Arf-GAP with ANK repeat and PH domain-containing protein cnt-1 Truncated ctn-1 [Source:UniProtKB/Swiss-Prot;Acc:Q9XXH8])

HSP 1 Score: 79.337 bits (194), Expect = 2.731e-15
Identity = 42/117 (35.90%), Postives = 68/117 (58.12%), Query Frame = 1
Query:   94 VPGNNICADCNAEKPDYLVLSYNIIICRKCAGVHRSM--ENVRVRDLNFDKISDAEINEV-LKFGNKKSNDIYLKYLP----IFYRLPNSNGPEILRRSFIIAKYQIKQFSVKEIDR 423
            VPGN +CADC +  P ++ ++  +++C +C+G HRS+  +  +VR L  D I D E+ +V L  GN++ N+I+L +LP    I     N       R ++I AKY  ++F+V E  R
Sbjct:  372 VPGNEVCADCGSPAPKWVSINLGVVLCIECSGAHRSLGVQTSKVRSLCMDSI-DNELRDVLLALGNRQVNEIFLAHLPPADSIVPPQINEKSARPAREAWIKAKYVERRFAVAEDTR 487          
BLAST of ARF-GAP with dual PH domain-containing protein 1 vs. Ensembl Celegans
Match: cnt-1 (Arf-GAP with ANK repeat and PH domain-containing protein cnt-1 Truncated ctn-1 [Source:UniProtKB/Swiss-Prot;Acc:Q9XXH8])

HSP 1 Score: 78.9518 bits (193), Expect = 2.799e-15
Identity = 42/117 (35.90%), Postives = 68/117 (58.12%), Query Frame = 1
Query:   94 VPGNNICADCNAEKPDYLVLSYNIIICRKCAGVHRSM--ENVRVRDLNFDKISDAEINEV-LKFGNKKSNDIYLKYLP----IFYRLPNSNGPEILRRSFIIAKYQIKQFSVKEIDR 423
            VPGN +CADC +  P ++ ++  +++C +C+G HRS+  +  +VR L  D I D E+ +V L  GN++ N+I+L +LP    I     N       R ++I AKY  ++F+V E  R
Sbjct:  205 VPGNEVCADCGSPAPKWVSINLGVVLCIECSGAHRSLGVQTSKVRSLCMDSI-DNELRDVLLALGNRQVNEIFLAHLPPADSIVPPQINEKSARPAREAWIKAKYVERRFAVAEDTR 320          
BLAST of ARF-GAP with dual PH domain-containing protein 1 vs. Ensembl Celegans
Match: cnt-1 (Arf-GAP with ANK repeat and PH domain-containing protein cnt-1 Truncated ctn-1 [Source:UniProtKB/Swiss-Prot;Acc:Q9XXH8])

HSP 1 Score: 78.5666 bits (192), Expect = 5.430e-15
Identity = 42/117 (35.90%), Postives = 68/117 (58.12%), Query Frame = 1
Query:   94 VPGNNICADCNAEKPDYLVLSYNIIICRKCAGVHRSM--ENVRVRDLNFDKISDAEINEV-LKFGNKKSNDIYLKYLP----IFYRLPNSNGPEILRRSFIIAKYQIKQFSVKEIDR 423
            VPGN +CADC +  P ++ ++  +++C +C+G HRS+  +  +VR L  D I D E+ +V L  GN++ N+I+L +LP    I     N       R ++I AKY  ++F+V E  R
Sbjct:  456 VPGNEVCADCGSPAPKWVSINLGVVLCIECSGAHRSLGVQTSKVRSLCMDSI-DNELRDVLLALGNRQVNEIFLAHLPPADSIVPPQINEKSARPAREAWIKAKYVERRFAVAEDTR 571          
BLAST of ARF-GAP with dual PH domain-containing protein 1 vs. Ensembl Celegans
Match: W09D10.1 (pep chromosome:WBcel235:III:10736919:10739786:-1 gene:WBGene00012359.1 transcript:W09D10.1.3 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:W09D10.1)

HSP 1 Score: 63.5438 bits (153), Expect = 1.734e-10
Identity = 33/117 (28.21%), Postives = 62/117 (52.99%), Query Frame = 1
Query:  103 NNICADCNAEKPDYLVLSYNIIICRKCAGVHRSM--ENVRVRDLNFDKISDAEINEVLKFGNKKSNDIYLKYLPIFYRLPNSNGPEILRRSFIIAKYQIKQFSVKEIDRPYIVNQKL 447
            N  CADC A+ P +   +  + IC +CAG+HR++     +VR +N D  +  ++  +   GN+K+  +Y   LP  +R P +   +     FI +KY+ K++ +++   P +   +L
Sbjct:   29 NKYCADCQAKTPRWAAWNLGVFICIRCAGIHRNLGVHISKVRSVNLDSWTPEQVQTMRVMGNEKARQVYEHDLPAQFRRPTN---DQQMEQFIRSKYEQKRYILRDFVYPRVDASQL 142          
BLAST of ARF-GAP with dual PH domain-containing protein 1 vs. Ensembl Celegans
Match: W09D10.1 (pep chromosome:WBcel235:III:10736919:10739792:-1 gene:WBGene00012359.1 transcript:W09D10.1.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:W09D10.1)

HSP 1 Score: 63.5438 bits (153), Expect = 1.734e-10
Identity = 33/117 (28.21%), Postives = 62/117 (52.99%), Query Frame = 1
Query:  103 NNICADCNAEKPDYLVLSYNIIICRKCAGVHRSM--ENVRVRDLNFDKISDAEINEVLKFGNKKSNDIYLKYLPIFYRLPNSNGPEILRRSFIIAKYQIKQFSVKEIDRPYIVNQKL 447
            N  CADC A+ P +   +  + IC +CAG+HR++     +VR +N D  +  ++  +   GN+K+  +Y   LP  +R P +   +     FI +KY+ K++ +++   P +   +L
Sbjct:   29 NKYCADCQAKTPRWAAWNLGVFICIRCAGIHRNLGVHISKVRSVNLDSWTPEQVQTMRVMGNEKARQVYEHDLPAQFRRPTN---DQQMEQFIRSKYEQKRYILRDFVYPRVDASQL 142          
BLAST of ARF-GAP with dual PH domain-containing protein 1 vs. Ensembl Fly
Match: CG8243 (gene:FBgn0033349 transcript:FBtr0088652)

HSP 1 Score: 62.7734 bits (151), Expect = 3.738e-10
Identity = 30/106 (28.30%), Postives = 58/106 (54.72%), Query Frame = 1
Query:  103 NNICADCNAEKPDYLVLSYNIIICRKCAGVHRSM--ENVRVRDLNFDKISDAEINEVLKFGNKKSNDIYLKYLPIFYRLPNSNGPEILRRSFIIAKYQIKQFSVKE 414
            N  C DC+A+ P +   +  + +C +CAG+HR++     RV+ +N D  +  ++  + + GN ++  +Y   LP  +R P +   +    +FI AKY+ K++  +E
Sbjct:   30 NKYCVDCDAKGPRWASWNLGMFLCIRCAGIHRNLGVHISRVKSVNLDTWTPEQVISLQQMGNSRARAVYEAQLPDGFRRPQT---DTALENFIRAKYEHKKYLARE 132          
BLAST of ARF-GAP with dual PH domain-containing protein 1 vs. Ensembl Fly
Match: CenG1A (gene:FBgn0028509 transcript:FBtr0080548)

HSP 1 Score: 62.003 bits (149), Expect = 9.890e-10
Identity = 30/105 (28.57%), Postives = 55/105 (52.38%), Query Frame = 1
Query:   94 VPGNNICADCNAEKPDYLVLSYNIIICRKCAGVHRSMEN--VRVRDLNFDKISDAEINEVLKFGNKKSNDIYLKYLPIFYRLPNSNGPEILRRSFIIAKYQIKQF 402
            VPGN  C DC A  P++  L+  +++C +C+GVHR++ +   +VR L  D      ++ +L  GN  +N ++        + P S      +  ++ +KY+ K+F
Sbjct:  479 VPGNGFCVDCGAPNPEWASLNLGVLMCIECSGVHRNLGSHISKVRSLGLDDWPSPHLSVMLAIGNSLANSVWESNTRQRVK-PTSQASREDKERWVRSKYEAKEF 582          
BLAST of ARF-GAP with dual PH domain-containing protein 1 vs. Ensembl Fly
Match: CenG1A (gene:FBgn0028509 transcript:FBtr0080547)

HSP 1 Score: 62.003 bits (149), Expect = 1.076e-9
Identity = 30/105 (28.57%), Postives = 55/105 (52.38%), Query Frame = 1
Query:   94 VPGNNICADCNAEKPDYLVLSYNIIICRKCAGVHRSMEN--VRVRDLNFDKISDAEINEVLKFGNKKSNDIYLKYLPIFYRLPNSNGPEILRRSFIIAKYQIKQF 402
            VPGN  C DC A  P++  L+  +++C +C+GVHR++ +   +VR L  D      ++ +L  GN  +N ++        + P S      +  ++ +KY+ K+F
Sbjct:  643 VPGNGFCVDCGAPNPEWASLNLGVLMCIECSGVHRNLGSHISKVRSLGLDDWPSPHLSVMLAIGNSLANSVWESNTRQRVK-PTSQASREDKERWVRSKYEAKEF 746          
BLAST of ARF-GAP with dual PH domain-containing protein 1 vs. Ensembl Fly
Match: CenG1A (gene:FBgn0028509 transcript:FBtr0080546)

HSP 1 Score: 61.6178 bits (148), Expect = 1.503e-9
Identity = 30/105 (28.57%), Postives = 55/105 (52.38%), Query Frame = 1
Query:   94 VPGNNICADCNAEKPDYLVLSYNIIICRKCAGVHRSMEN--VRVRDLNFDKISDAEINEVLKFGNKKSNDIYLKYLPIFYRLPNSNGPEILRRSFIIAKYQIKQF 402
            VPGN  C DC A  P++  L+  +++C +C+GVHR++ +   +VR L  D      ++ +L  GN  +N ++        + P S      +  ++ +KY+ K+F
Sbjct:  711 VPGNGFCVDCGAPNPEWASLNLGVLMCIECSGVHRNLGSHISKVRSLGLDDWPSPHLSVMLAIGNSLANSVWESNTRQRVK-PTSQASREDKERWVRSKYEAKEF 814          
BLAST of ARF-GAP with dual PH domain-containing protein 1 vs. Ensembl Fly
Match: CenB1A (gene:FBgn0039056 transcript:FBtr0084369)

HSP 1 Score: 57.3806 bits (137), Expect = 2.316e-8
Identity = 31/107 (28.97%), Postives = 54/107 (50.47%), Query Frame = 1
Query:   94 VPGNNICADCNAEKPDYLVLSYNIIICRKCAGVHRSM--ENVRVRDLNFDKISDAEINEVLKFGNKKSNDIYLKYLP--IFYRLPNSNGPEILRRSFIIAKYQIKQF 402
            +PGN  C DC + +P +  ++  I +C +C+GVHRS+     +VR L  D      +  +++ GN+  N IY   +      + P       +R ++I AKY  ++F
Sbjct:  160 IPGNAYCCDCRSPEPRWASINLGITLCIECSGVHRSLGVHYSKVRSLTLDAWESENVKVMMELGNEVVNRIYEARIGDDCGLKKPTEQCEIGVREAWIKAKYVERRF 266          
BLAST of ARF-GAP with dual PH domain-containing protein 1 vs. Ensembl Zebrafish
Match: zgc:92360 (zgc:92360 [Source:ZFIN;Acc:ZDB-GENE-040718-470])

HSP 1 Score: 182.956 bits (463), Expect = 3.279e-52
Identity = 114/380 (30.00%), Postives = 188/380 (49.47%), Query Frame = 1
Query:   97 PGNNICADCNAEKPDYLVLSYNIIICRKCAGVHRSMENV-RVRDLNFDKISDAEINEVLKFGNKKSNDIYLKYLPIFYRLPNSNGPEILRRSFIIAKYQIKQFSVKEIDRPYIVNQKLGILKKRCKDKNIYNSRFFRLSIPDISFNYFIKETDVTNYDRSQMKLKSRKDPKRNLRLDRINASF----IDNPDSRARIPDEILMISFFRHEEASWRHIYLKSNTPEDLVDWYQTIRFAKFSLRAAYVVGTGDEANELELARDLTLDITMSGWMYKTGSQLTEQWQKRWCVLLGRRLLYSSGPLSASGKGEIVIGERSKGYGAVSGAPPNSRSVMSDQTALTIKTPGREYLFAVDSEGDVAERWIKCINNLADVEMSIREMA 1221
            PGN  CADC A+ P++   S  + IC  C+GVHRS+  + +V+ L   +  D+E+  + + GN     +Y   +P++Y  P     ++L+  +I AKY+ ++F+       Y    + G+L KR +D   + +R F LS+ +    Y+ K                 K+PK  +++D +NA F    I NP+         L I++ +      R+I++  ++ +++VDW+ +IR A+         G    A + EL   LT      G+M KTG + TE ++KRW  L  RRL+Y   PL A  KGE+ +G R  GY    G P  S    + Q  +TI+TP R +LF  +++ +  + W+   N L    MS +E +
Sbjct:   18 PGNGSCADCGADNPEWGSCSLGVFICLACSGVHRSIPTIGKVKSLRLSRWEDSEVQFLSECGNDLMKAVYEAAVPVYYYKPTHRDCQVLKEQWIRAKYERQEFTEVGKKLTYEDESRDGMLMKRGRDNGQFLNRRFVLSVREGILKYYTK--------------LDAKEPKALMKVDTLNACFQPDKIGNPNG--------LQITYIKDNIT--RNIFVYHDSSKEIVDWFNSIRAAQLHYLKVAFPG----ATDAELKPKLTRSFLKEGYMEKTGPRQTEGFKKRWFTLDHRRLMYFKDPLDAFAKGEVFLGHRDHGYRVTIGLPAGSHCNGAWQFGITIETPERSFLFTCETDTEQKD-WMSHFNTLICTPMSPQEYS 368          
BLAST of ARF-GAP with dual PH domain-containing protein 1 vs. Ensembl Zebrafish
Match: adap2 (ArfGAP with dual PH domains 2 [Source:ZFIN;Acc:ZDB-GENE-070912-21])

HSP 1 Score: 161.384 bits (407), Expect = 3.350e-44
Identity = 101/379 (26.65%), Postives = 185/379 (48.81%), Query Frame = 1
Query:   76 LIKLYSVPGNNICADCNAEKPDYLVLSYNIIICRKCAGVHRSMENV-RVRDLNFDKISDAEINEVLKFGNKKSNDIYLKYLPIFYRLPNSNGPEILRRSFIIAKYQIKQFSVKEIDRPYIVNQKLGILKKRCKDKNIYNSRFFRLSIPDISFNYFIKETDVTNYDRSQMKLKSRKDPKRNLRLDRINASFIDNPDSRARIPDEILMISFFRHEEASWRHIYLKSNTPEDLVDWYQTIRFAKFSLRAAYVVGTGDEANELELARDLTLDITMSGWMYKTGSQLTEQWQKRWCVL--LGRRLLYSSGPLSASGKGEIVIGERSKGYGAVSGAPPNSRSVMSDQTALTIKTPGREYLFAVDSEGDVAERWIKCINNLADVEM 1203
            L++L  +P NN CADC A  PD+      I +C  C+G HR++  + R++ +  D   D  +  +   GN  + + Y K +P+FY  P+ +  E+LR  +I AKY+  +F+ ++ +RPY  +   G+L K+ +D   +  R F LS+ D +  Y+              K    K PK  + +  +NA+F       A      L I++   +    R++++     +++V+W+  IR    ++R AY+      A+++++   ++ +    G+M KTG    E ++KRW +L  + R+LLY    L A   G + IG  + GY      P  +R     +  + ++TP R+++F  + E D  E W++ +  +    M
Sbjct:   11 LLELVKLPENNCCADCGAADPDWASCKLGIFVCLTCSGTHRNLPTISRIKSIRLDFWDDELVQFMKANGNCSAKNFYEKCVPVFYYRPHPHDCEVLREQWIRAKYERMEFTEEKTERPYTADVYEGMLWKKGRDNGQFLERKFVLSVHDFTLKYY--------------KEDESKGPKATIYVKNLNATFQPEKIGHA----HGLQITYCVEDHT--RNLFVYHKNGQEIVNWFNAIR----AVRHAYLKTAFPTASDVDIIPWISRNYLKEGYMEKTGPLQREPFKKRWFILDSMDRKLLYFKTQLDAIELGVVFIGSENHGYSVRECVPKGTRG-NKWKCGVIVETPDRQFVFMCEQERDQRE-WVEALKTVISKPM 363          
BLAST of ARF-GAP with dual PH domain-containing protein 1 vs. Ensembl Zebrafish
Match: FO704810.1 (arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1-like [Source:NCBI gene;Acc:100005008])

HSP 1 Score: 72.7886 bits (177), Expect = 4.985e-13
Identity = 40/117 (34.19%), Postives = 65/117 (55.56%), Query Frame = 1
Query:   52 NLIMSQERLIKLYSVPGNNICADCNAEKPDYLVLSYNIIICRKCAGVHRSMENVR--VRDLNF-DKI-SDAEINEVLKFGNKKSNDIYLKYLPIFYRLPNSNGPEILRRSFIIAKYQ 390
            N +   E  ++L+S P N +CADC A  P++  ++  ++IC  CAG HRSM + R  VR L   DK+ ++  I   +  GNK +N+++   +P   ++     P+  R  FI+AKY 
Sbjct:  381 NALSYSEVALRLWSSPCNKVCADCGAANPEWASVNLLVVICEACAGAHRSMGSSRSKVRGLKLDDKVWTEPLIQLFVLHGNKTANNVWGHNIPPTEQISPLASPD-QRAEFILAKYH 496          
BLAST of ARF-GAP with dual PH domain-containing protein 1 vs. Ensembl Zebrafish
Match: unm_sa1614 (un-named sa1614 [Source:ZFIN;Acc:ZDB-GENE-120411-1])

HSP 1 Score: 72.7886 bits (177), Expect = 5.286e-13
Identity = 34/106 (32.08%), Postives = 59/106 (55.66%), Query Frame = 1
Query:   94 VPGNNICADCNAEKPDYLVLSYNIIICRKCAGVHRSM--ENVRVRDLNFDKISDAEINEVLKFGNKKSNDIYLKYLPIFYRLPNSNGPEILRRSFIIAKYQIKQFS 405
            +PGN++C DC A  P ++ ++  I+ C +C+G+HR M     R++ L+ DK+  +E+      GN   N+I    LP     P++     +R+ FI++KY   QF+
Sbjct:  428 MPGNSVCCDCGASDPSWISINLGILTCIECSGIHREMGVHYSRIQSLSLDKLGTSELLLARNVGNLGFNEIAEANLPSVSVKPSAESDMAVRKDFILSKYMEWQFA 533          
BLAST of ARF-GAP with dual PH domain-containing protein 1 vs. Ensembl Zebrafish
Match: asap3 (ArfGAP with SH3 domain, ankyrin repeat and PH domain 3 [Source:ZFIN;Acc:ZDB-GENE-050913-39])

HSP 1 Score: 68.5514 bits (166), Expect = 8.895e-12
Identity = 36/110 (32.73%), Postives = 59/110 (53.64%), Query Frame = 1
Query:   85 LYSVPGNNICADCNAEKPDYLVLSYNIIICRKCAGVHRSM--ENVRVRDLNFDKISDAEINEVLKFGNKKSNDIYLKYLP--IFYRLPNSNGPEILRRSFIIAKYQIKQF 402
            L ++PGN  C DC A  P +L  +  I+ C +C+G+HR +     R++ L  D +S +E+   +  GN + NDI    LP      LP S+     R+ +I+AKY  +++
Sbjct:   48 LRNLPGNESCCDCGAPDPTWLSTNLGILTCIECSGIHRELGVHQSRIQSLTLDVLSTSELLLAVSIGNARFNDIMEVNLPNDAVKPLPKSD--MTARKEYIVAKYAERRY 155          
BLAST of ARF-GAP with dual PH domain-containing protein 1 vs. Ensembl Xenopus
Match: ksr1 (kinase suppressor of ras 1 [Source:Xenbase;Acc:XB-GENE-1004628])

HSP 1 Score: 198.749 bits (504), Expect = 5.482e-58
Identity = 129/397 (32.49%), Postives = 204/397 (51.39%), Query Frame = 1
Query:   61 MSQER----LIKLYSVPGNNICADCNAEKPDYLVLSYNIIICRKCAGVHRSMENV-RVRDLNFDKISDAEINEVLKFGNKKSNDIYLKYLPIFYRLPNSNGPEILRRSFIIAKYQIKQFSVKEIDRPYIVNQKLGILKKRCKDKNIYNSRFFRLSIPDISFNYFIKETDVTNYDRSQMKLKSRKDPKRNLRLDRINASF----IDNPDSRARIPDEILMISFFRHEEASWRHIYLKSNTPEDLVDWYQTIRFAKFS-LRAAYVVGTGDEANELELARDLTLDITMSGWMYKTGSQLTEQWQKRWCVLLGRRLLYSSGPLSASGKGEIVIGERSKGYGAVSGAPPNSRSVMSDQTALTIKTPGREYLFAVDSEGDVAERWIKCINNLADVEMSIREMA 1221
            M++ER    + +L   PGN +CADC A  PD+   +  + +C  C+G+HR++  + RV+ ++ D   D +I  +   GNK +   Y   +P FY  P S+  ++LR  +I AKY+ K+F + E   PY    + G+L KR +D   + SR F LS  + +  YF K                 K+PK  ++++ INA+F    I NP+         L I++ +  + S R+I++     +++VDW+  IR A+F  L+ AY       A ++EL   LT +    G+M KTG + TE ++KRW  L  RRL+Y   PL A  KGE+ IG     Y    G P +++     Q  +TI TP R++LFA +++ D AE W+     +    M  +E A
Sbjct:    1 MAEERNKRAVTELARKPGNTVCADCGAPDPDWASYTLGLFVCLSCSGIHRNIPQISRVKSVHLDPWDDVQIEYMSCLGNKVAEAKYESKVPAFYYKPASSDCQVLREQWIRAKYERKEFILIEKQEPYSAGYREGLLWKRGRDNGQFLSRKFVLSEREGALKYFNK--------------NDAKEPKAVMKIEYINATFQPAKIGNPNG--------LQITYLK--DNSTRNIFVYHEDGKEIVDWFNAIRAARFHYLQVAY-----PRARDIELVPKLTRNFLKEGFMEKTGPKHTEGFKKRWFTLDDRRLMYFKDPLDAFAKGEVFIGSAENNYQVQEGLPSSTQGNHW-QYGITIVTPDRKFLFACETDTDRAE-WVAAFRTVLSRPMLPQEYA 366          
BLAST of ARF-GAP with dual PH domain-containing protein 1 vs. Ensembl Xenopus
Match: ksr1 (kinase suppressor of ras 1 [Source:Xenbase;Acc:XB-GENE-1004628])

HSP 1 Score: 198.364 bits (503), Expect = 6.687e-58
Identity = 129/397 (32.49%), Postives = 204/397 (51.39%), Query Frame = 1
Query:   61 MSQER----LIKLYSVPGNNICADCNAEKPDYLVLSYNIIICRKCAGVHRSMENV-RVRDLNFDKISDAEINEVLKFGNKKSNDIYLKYLPIFYRLPNSNGPEILRRSFIIAKYQIKQFSVKEIDRPYIVNQKLGILKKRCKDKNIYNSRFFRLSIPDISFNYFIKETDVTNYDRSQMKLKSRKDPKRNLRLDRINASF----IDNPDSRARIPDEILMISFFRHEEASWRHIYLKSNTPEDLVDWYQTIRFAKFS-LRAAYVVGTGDEANELELARDLTLDITMSGWMYKTGSQLTEQWQKRWCVLLGRRLLYSSGPLSASGKGEIVIGERSKGYGAVSGAPPNSRSVMSDQTALTIKTPGREYLFAVDSEGDVAERWIKCINNLADVEMSIREMA 1221
            M++ER    + +L   PGN +CADC A  PD+   +  + +C  C+G+HR++  + RV+ ++ D   D +I  +   GNK +   Y   +P FY  P S+  ++LR  +I AKY+ K+F + E   PY    + G+L KR +D   + SR F LS  + +  YF K                 K+PK  ++++ INA+F    I NP+         L I++ +  + S R+I++     +++VDW+  IR A+F  L+ AY       A ++EL   LT +    G+M KTG + TE ++KRW  L  RRL+Y   PL A  KGE+ IG     Y    G P +++     Q  +TI TP R++LFA +++ D AE W+     +    M  +E A
Sbjct:    1 MAEERNKRAVTELARKPGNTVCADCGAPDPDWASYTLGLFVCLSCSGIHRNIPQISRVKSVHLDPWDDVQIEYMSCLGNKVAEAKYESKVPAFYYKPASSDCQVLREQWIRAKYERKEFILIEKQEPYSAGYREGLLWKRGRDNGQFLSRKFVLSEREGALKYFNK--------------NDAKEPKAVMKIEYINATFQPAKIGNPNG--------LQITYLK--DNSTRNIFVYHEDGKEIVDWFNAIRAARFHYLQVAY-----PRARDIELVPKLTRNFLKEGFMEKTGPKHTEGFKKRWFTLDDRRLMYFKDPLDAFAKGEVFIGSAENNYQVQEGLPSSTQGNHW-QYGITIVTPDRKFLFACETDTDRAE-WVAAFRTVLSRPMLPQEYA 366          
BLAST of ARF-GAP with dual PH domain-containing protein 1 vs. Ensembl Xenopus
Match: ksr1 (kinase suppressor of ras 1 [Source:Xenbase;Acc:XB-GENE-1004628])

HSP 1 Score: 176.022 bits (445), Expect = 1.195e-49
Identity = 120/377 (31.83%), Postives = 191/377 (50.66%), Query Frame = 1
Query:  109 ICADCNAEKPDYLVLSYNIIICRKCAGVHRSMENV-RVRDLNFDKISDAEINEVLKFGNKKSNDIYLKYLPIFYRLPNSNGPEILRRSFIIAKYQIKQFSVKEIDRPYIVNQKLGILKKRCKDKNIYNSRFFRLSIPDISFNYFIKETDVTNYDRSQMKLKSRKDPKRNLRLDRINASF----IDNPDSRARIPDEILMISFFRHEEASWRHIYLKSNTPEDLVDWYQTIRFAKFS-LRAAYVVGTGDEANELELARDLTLDITMSGWMYKTGSQLTEQWQKRWCVLLGRRLLYSSGPLSASGKGEIVIGERSKGYGAVSGAPPNSRSVMSDQTALTIKTPGREYLFAVDSEGDVAERWIKCINNLADVEMSIREMA 1221
            IC + N   PD+   +  + +C  C+G+HR++  + RV+ ++ D   D +I  +   GNK +   Y   +P FY  P S+  ++LR  +I AKY+ K+F + E   PY    + G+L KR +D   + SR F LS  + +  YF K                 K+PK  ++++ INA+F    I NP+         L I++ +  + S R+I++     +++VDW+  IR A+F  L+ AY       A ++EL   LT +    G+M KTG + TE ++KRW  L  RRL+Y   PL A  KGE+ IG     Y    G P +++     Q  +TI TP R++LFA +++ D AE W+     +    M  +E A
Sbjct:   17 ICINTN---PDWASYTLGLFVCLSCSGIHRNIPQISRVKSVHLDPWDDVQIEYMSCLGNKVAEAKYESKVPAFYYKPASSDCQVLREQWIRAKYERKEFILIEKQEPYSAGYREGLLWKRGRDNGQFLSRKFVLSEREGALKYFNK--------------NDAKEPKAVMKIEYINATFQPAKIGNPNG--------LQITYLK--DNSTRNIFVYHEDGKEIVDWFNAIRAARFHYLQVAY-----PRARDIELVPKLTRNFLKEGFMEKTGPKHTEGFKKRWFTLDDRRLMYFKDPLDAFAKGEVFIGSAENNYQVQEGLPSSTQGNHW-QYGITIVTPDRKFLFACETDTDRAE-WVAAFRTVLSRPMLPQEYA 359          
BLAST of ARF-GAP with dual PH domain-containing protein 1 vs. Ensembl Xenopus
Match: adap1l (ArfGAP with dual PH domains 1-like [Source:NCBI gene;Acc:394901])

HSP 1 Score: 170.629 bits (431), Expect = 1.690e-47
Identity = 114/376 (30.32%), Postives = 183/376 (48.67%), Query Frame = 1
Query:  100 GNNICADCNAEKPDYLVLSYNIIICRKCAGVHRSMENV-RVRDLNFDKISDAEINEVLKFGNKKSNDIYLKYLPIFYRLPNSNGPEILRRSFIIAKYQIKQFSVKEIDRPYIVN-QKLGILKKRCKDKNIYNSRFFRLSIPDISFNYFIKETDVTNYDRSQMKLKSRKDPKRNLRLDRINASFIDNPDSRARIPDEILMISFFRHEEASWRHIYLKSNTPEDLVDWYQTIRFAKFSLRAAYVVGTGDEANELELARDLTLDITMSGWMYKTGSQLTEQWQKRWCVLLGRRLLYSSGPLSASGKGEIVIGERSKGYGAVSGAPPNSRSVMSDQTALTIKTPGREYLFAVDSEGDVAERWIKCINNLADVEMSIREMA 1221
            GN  CADC A  P +   +  I +C  C+G+HR++  + +V+ L  D   D ++  +   GN  +  IY  ++P++Y  P      +LR  +I +KY+ K+F   + +   I N  K G L KR +D   Y  R F LS  D +  YF K                 K+PK  +R+D +NASF       A      L I++ +  +   R+I++  N  +++V W+  IR A+FS    Y+     +A++ E+   LT +    G+M KTG + T+ ++KRW  L  RRL+Y   PL A  KGE+ +G    GY       P++    +    ++I TP R YLF  +SE +  E W+     +    M++RE +
Sbjct:   20 GNGTCADCRAPDPQWASHTLGIFLCVDCSGIHRNLPEISKVKSLIMDNWDDTQVQFLASHGNIAAKAIYEAHVPVYYYRPKHTDCHVLREQWIRSKYERKEFIKPKGN---ISNGSKEGNLLKRGRDNGQYLPRKFFLSEIDGTLKYFTKP--------------DAKEPKTVIRIDTVNASFQPVKMKNA----NGLQITYVKDNKT--RNIFVYHNDGQEIVSWFNAIRSAQFS----YMQIAFPKASDKEIISRLTRNFLKEGYMEKTGPKQTDGFKKRWFTLDHRRLMYFKDPLDAFAKGELFLGSSQNGYEVKPVIVPSTHGNCTWNYGISITTPERTYLFTCESESE-RENWLLVFKEVISQPMTVREFS 367          
BLAST of ARF-GAP with dual PH domain-containing protein 1 vs. Ensembl Xenopus
Match: ksr1 (kinase suppressor of ras 1 [Source:Xenbase;Acc:XB-GENE-1004628])

HSP 1 Score: 165.622 bits (418), Expect = 4.747e-46
Identity = 114/353 (32.29%), Postives = 180/353 (50.99%), Query Frame = 1
Query:  181 CAGVHRSMENV-RVRDLNFDKISDAEINEVLKFGNKKSNDIYLKYLPIFYRLPNSNGPEILRRSFIIAKYQIKQFSVKEIDRPYIVNQKLGILKKRCKDKNIYNSRFFRLSIPDISFNYFIKETDVTNYDRSQMKLKSRKDPKRNLRLDRINASF----IDNPDSRARIPDEILMISFFRHEEASWRHIYLKSNTPEDLVDWYQTIRFAKFS-LRAAYVVGTGDEANELELARDLTLDITMSGWMYKTGSQLTEQWQKRWCVLLGRRLLYSSGPLSASGKGEIVIGERSKGYGAVSGAPPNSRSVMSDQTALTIKTPGREYLFAVDSEGDVAERWIKCINNLADVEMSIREMA 1221
            C+G+HR++  + RV+ ++ D   D +I  +   GNK +   Y   +P FY  P S+  ++LR  +I AKY+ K+F + E   PY    + G+L KR +D   + SR F LS  + +  YF K                 K+PK  ++++ INA+F    I NP+         L I++ +  + S R+I++     +++VDW+  IR A+F  L+ AY       A ++EL   LT +    G+M KTG + TE ++KRW  L  RRL+Y   PL A  KGE+ IG     Y    G P +++     Q  +TI TP R++LFA +++ D AE W+     +    M  +E A
Sbjct:    2 CSGIHRNIPQISRVKSVHLDPWDDVQIEYMSCLGNKVAEAKYESKVPAFYYKPASSDCQVLREQWIRAKYERKEFILIEKQEPYSAGYREGLLWKRGRDNGQFLSRKFVLSEREGALKYFNK--------------NDAKEPKAVMKIEYINATFQPAKIGNPNG--------LQITYLK--DNSTRNIFVYHEDGKEIVDWFNAIRAARFHYLQVAY-----PRARDIELVPKLTRNFLKEGFMEKTGPKHTEGFKKRWFTLDDRRLMYFKDPLDAFAKGEVFIGSAENNYQVQEGLPSSTQGNHW-QYGITIVTPDRKFLFACETDTDRAE-WVAAFRTVLSRPMLPQEYA 323          
BLAST of ARF-GAP with dual PH domain-containing protein 1 vs. Ensembl Mouse
Match: Adap1 (ArfGAP with dual PH domains 1 [Source:MGI Symbol;Acc:MGI:2442201])

HSP 1 Score: 186.037 bits (471), Expect = 2.520e-53
Identity = 115/395 (29.11%), Postives = 199/395 (50.38%), Query Frame = 1
Query:   61 MSQER---LIKLYSVPGNNICADCNAEKPDYLVLSYNIIICRKCAGVHRSMENV-RVRDLNFDKISDAEINEVLKFGNKKSNDIYLKYLPIFYRLPNSNGPEILRRSFIIAKYQIKQFSVKEIDRPYIVNQKLGILKKRCKDKNIYNSRFFRLSIPDISFNYFIKETDVTNYDRSQMKLKSRKDPKRNLRLDRINASF----IDNPDSRARIPDEILMISFFRHEEASWRHIYLKSNTPEDLVDWYQTIRFAKFSLRAAYVVGTGDEANELELARDLTLDITMSGWMYKTGSQLTEQWQKRWCVLLGRRLLYSSGPLSASGKGEIVIGERSKGYGAVSGAPPNSRSVMSDQTALTIKTPGREYLFAVDSEGDVAERWIKCINNLADVEMSIREMA 1221
            M+ ER   L++L + PGN  CADC A  PD+   +  + IC  C+G+HR++  V +V+ +  D   +A++  +   GN+ +   +   +P FY  P  +  ++LR  +I AKY+ ++F   E   PY    + G+L KR +D   + SR F L+  + +  YF K                 K+PK  ++++ +NA+F    + +P          L +++ +  + S R+I++     +++VDW+  +R A+F        G    A++ +L   L+ +    G+M KTG + TE ++KRW  +  RRL+Y   PL A  +GE+ IG +  GY  + G P +++        +TI TP R++LF  ++E D  E WI     + D  M  +E A
Sbjct:    1 MAGERRRALLELLTRPGNTRCADCGAPDPDWASYTLGVFICLSCSGIHRNIPQVSKVKSVRLDAWDEAQVEFMASHGNEAARATFESKVPPFYYRPTFSDCQLLREQWIRAKYERQEFVHVEKQEPYSTGYREGLLWKRGRDNGQFLSRKFVLTEREGALKYFNK--------------NDAKEPKAVMKIEHLNATFQPAKMGHPHG--------LQVTYLK--DNSTRNIFIYHEDGKEIVDWFNALRAARFHYLQVAFPG----ASDADLVPKLSRNYLKEGYMEKTGPKQTEGFRKRWFTMDDRRLMYFKDPLDAFARGEVFIGSKESGYTVLEGLPLSTQGHHWPH-GITIVTPDRKFLFTCETESDQRE-WIAAFQKVVDRPMLPQEYA 365          
BLAST of ARF-GAP with dual PH domain-containing protein 1 vs. Ensembl Mouse
Match: Adap2 (ArfGAP with dual PH domains 2 [Source:MGI Symbol;Acc:MGI:2663075])

HSP 1 Score: 137.117 bits (344), Expect = 2.386e-35
Identity = 106/392 (27.04%), Postives = 182/392 (46.43%), Query Frame = 1
Query:   64 SQERLIKLYSVPG--NNICADCNAEKPDYLVLSYNIIICRKCAGVHRSMENV-RVRDLNFDKISDAEINEVLKFGNKKSNDIYLKYLPIFYRLPNSNGPEILRRSFIIAKYQIKQFSV--KEIDRPYIVNQKLGILKKRCKDKNIYNSRFFRLSIPDISFNYFIKETDVTNYDRSQMKLKSRKDPKRNLRLDRINASF----IDNPDSRARIPDEILMISFFRHEEASWRHIYLKSNTPEDLVDWYQTIRFAKFSLRAAYVVGTGDEANELELARDLTLDITMSGWMYKTGSQLTEQWQKRWCVL--LGRRLLYSSGPLSASGKGEIVIGERSKGYGAVSGAPPNSRSVMSDQTALTIKTPGREYLFAVDSEGDVAERWIKCINNLADVEMS 1206
            +++RL++L    G  N  CADC A  PD+      I IC  C+GVHR+  ++ +V+ +  D   D+ +  +   GN      +   +P FY +P +N   +L+  +I AKY+ ++F+   K +  P     + G L KR +D   +  R F L   +    Y+ KE                K PK  + +  +NA+F    I +P          L I++   +E   R++++  ++ +++VDW+  +R A    R  Y+     +  E EL   +T +    G+M KTG +  E ++KRW  L    RRLLY   PL A   G++ +G   +GY      P   R     +  LT+ TP R+++F   +E +  E W++ +  +    +S
Sbjct:    7 NKKRLLELLQAAGTGNGHCADCGAADPDWASYKLGIFICLHCSGVHRNFPDISKVKSVRLDFWDDSMVEFMTHHGNLNVKAKFEARVPAFYYVPQANDCLVLKEQWIRAKYERQEFTAIDKAVSHP---GNREGFLWKRGRDNAQFLRRRFVLLSREGLLKYYTKEEG--------------KAPKAVISIKDLNATFQTEKIGHPHG--------LQITY--RKEGHTRNLFVYHDSGKEIVDWFNALRAA----RLQYLKLAFPDLPESELVPLITRNYLKQGFMEKTGPKHREPFKKRWFALDPQERRLLYYKNPLDAFELGQVFLGSNEQGYEVWEDLPKGIRGNRW-KAGLTVITPERKFIFTCPTEKEQRE-WLESLRGVLSSPLS 365          
BLAST of ARF-GAP with dual PH domain-containing protein 1 vs. Ensembl Mouse
Match: Adap2 (ArfGAP with dual PH domains 2 [Source:MGI Symbol;Acc:MGI:2663075])

HSP 1 Score: 72.0182 bits (175), Expect = 9.724e-15
Identity = 38/126 (30.16%), Postives = 66/126 (52.38%), Query Frame = 1
Query:   64 SQERLIKLYSVPG--NNICADCNAEKPDYLVLSYNIIICRKCAGVHRSMENV-RVRDLNFDKISDAEINEVLKFGNKKSNDIYLKYLPIFYRLPNSNGPEILRRSFIIAKYQIKQFSV--KEIDRP 426
            +++RL++L    G  N  CADC A  PD+      I IC  C+GVHR+  ++ +V+ +  D   D+ +  +   GN      +   +P FY +P +N   +L+  +I AKY+ ++F+   K +  P
Sbjct:    7 NKKRLLELLQAAGTGNGHCADCGAADPDWASYKLGIFICLHCSGVHRNFPDISKVKSVRLDFWDDSMVEFMTHHGNLNVKAKFEARVPAFYYVPQANDCLVLKEQWIRAKYERQEFTAIDKAVSHP 132          
BLAST of ARF-GAP with dual PH domain-containing protein 1 vs. Ensembl Mouse
Match: Smap2 (small ArfGAP 2 [Source:MGI Symbol;Acc:MGI:1917030])

HSP 1 Score: 70.0922 bits (170), Expect = 2.449e-12
Identity = 41/127 (32.28%), Postives = 69/127 (54.33%), Query Frame = 1
Query:  103 NNICADCNAEKPDYLVLSYNIIICRKCAGVHRSM--ENVRVRDLNFDKISDAEINEVLKFGNKKSNDIYLKYLPIFYRLPNSNGPEILRRSFIIAKYQIKQFSVKEIDRPYIVNQKLGILKKRCKDK 477
            N  CADC ++ P +   +  + IC +CAG+HR++     RV+ +N D+ +  +I  + + GN K+N +Y  YLP  +R P  + P +    FI  KY+ K++    +DR   +N    +L+K   DK
Sbjct:   25 NKFCADCQSKGPRWASWNIGVFICIRCAGIHRNLGVHISRVKSVNLDQWTQEQIQCMQEMGNGKANRLYEAYLPETFRRPQID-PAV--EGFIRDKYEKKKY----MDRSLDIN----VLRKEKDDK 140          
BLAST of ARF-GAP with dual PH domain-containing protein 1 vs. Ensembl Mouse
Match: Asap3 (ArfGAP with SH3 domain, ankyrin repeat and PH domain 3 [Source:MGI Symbol;Acc:MGI:2684986])

HSP 1 Score: 67.781 bits (164), Expect = 2.470e-11
Identity = 35/120 (29.17%), Postives = 61/120 (50.83%), Query Frame = 1
Query:   76 LIKLYSVPGNNICADCNAEKPDYLVLSYNIIICRKCAGVHRSM--ENVRVRDLNFDKISDAEINEVLKFGNKKSNDIYLKYLPIFYRL-PNSNGPEILRRSFIIAKYQIKQFSVKEIDRP 426
            + ++ S PGN+ C DC A  P +L  +  ++ C +C+GVHR +     R++ L  D +  +E+   L  GN   N++   +LP      P++      RR++I+AKY   +F+      P
Sbjct:  428 VAEVKSRPGNDRCCDCGAADPTWLSTNLGVLTCIQCSGVHRELGVRFSRIQSLTLDLLGPSELLLALNIGNSHFNEVMEAHLPSHGSPKPSAESDMSSRRNYIVAKYVEHKFARHSTPDP 547          
BLAST of ARF-GAP with dual PH domain-containing protein 1 vs. UniProt/SwissProt
Match: sp|O75689|ADAP1_HUMAN (Arf-GAP with dual PH domain-containing protein 1 OS=Homo sapiens OX=9606 GN=ADAP1 PE=1 SV=2)

HSP 1 Score: 190.66 bits (483), Expect = 3.090e-54
Identity = 116/395 (29.37%), Postives = 197/395 (49.87%), Query Frame = 1
Query:   61 MSQER---LIKLYSVPGNNICADCNAEKPDYLVLSYNIIICRKCAGVHRSMENV-RVRDLNFDKISDAEINEVLKFGNKKSNDIYLKYLPIFYRLPNSNGPEILRRSFIIAKYQIKQFSVKEIDRPYIVNQKLGILKKRCKDKNIYNSRFFRLSIPDISFNYFIKETDVTNYDRSQMKLKSRKDPKRNLRLDRINASF----IDNPDSRARIPDEILMISFFRHEEASWRHIYLKSNTPEDLVDWYQTIRFAKFSLRAAYVVGTGDEANELELARDLTLDITMSGWMYKTGSQLTEQWQKRWCVLLGRRLLYSSGPLSASGKGEIVIGERSKGYGAVSGAPPNSRSVMSDQTALTIKTPGREYLFAVDSEGDVAERWIKCINNLADVEMSIREMA 1221
            M++ER   +++L   PGN  CADC A  PD+   +  + IC  C+G+HR++  V +V+ +  D   +A++  +   GN  +   +   +P FY  P  +  ++LR  +I AKY+ ++F   E   PY    + G L KR +D   + SR F L+  + +  YF +                 K+PK  ++++ +NA+F    I +P          L +++ +  + S R+I++     +++VDW+  +R A+F        G GD     +L   L+ +    G+M KTG + TE ++KRW  +  RRL+Y   PL A  +GE+ IG +  GY  + G PP+++        +TI TP R++LFA ++E D  E W+       D  M  +E A
Sbjct:    1 MAKERRRAVLELLQRPGNARCADCGAPDPDWASYTLGVFICLSCSGIHRNIPQVSKVKSVRLDAWEEAQVEFMASHGNDAARARFESKVPSFYYRPTPSDCQLLREQWIRAKYERQEFIYPEKQEPYSAGYREGFLWKRGRDNGQFLSRKFVLTEREGALKYFNR--------------NDAKEPKAVMKIEHLNATFQPAKIGHPHG--------LQVTYLK--DNSTRNIFIYHEDGKEIVDWFNALRAARFHYLQVAFPGAGD----ADLVPKLSRNYLKEGYMEKTGPKQTEGFRKRWFTMDDRRLMYFKDPLDAFARGEVFIGSKESGYTVLHGFPPSTQGHHWPH-GITIVTPDRKFLFACETESDQRE-WVAAFQKAVDRPMLPQEYA 365          
BLAST of ARF-GAP with dual PH domain-containing protein 1 vs. UniProt/SwissProt
Match: sp|Q9NPF8|ADAP2_HUMAN (Arf-GAP with dual PH domain-containing protein 2 OS=Homo sapiens OX=9606 GN=ADAP2 PE=1 SV=1)

HSP 1 Score: 146.362 bits (368), Expect = 8.739e-38
Identity = 110/384 (28.65%), Postives = 183/384 (47.66%), Query Frame = 1
Query:   64 SQERLIKLYSVP--GNNICADCNAEKPDYLVLSYNIIICRKCAGVHRSMENV-RVRDLNFDKISDAEINEVLKFGNKKSNDIYLKYLPIFYRLPNSNGPEILRRSFIIAKYQIKQFSVKEIDRPYIVNQKLGILKKRCKDKNIYNSRFFRLSIPDISFNYFIKETDVTNYDRSQMKLKSRKDPKRNLRLDRINASF----IDNPDSRARIPDEILMISFFRHEEASWRHIYLKSNTPEDLVDWYQTIRFAKFSLRAAYVVGTGDEANELELARDLTLDITMSGWMYKTGSQLTEQWQKRWCVL--LGRRLLYSSGPLSASGKGEIVIGERSKGYGAVSGAPPNSRSVMSDQTALTIKTPGREYLFAVDSEGDVAERWIKCINNL 1188
            +++RL++L   P  GN  CADC A  PD+      I IC  C GVHR+  ++ RV+ +  D   D+ +  ++  GN +    +   +P FY +P +N   +L+  +I AKY+ ++F + + +   +   + G L KR +D + +  R F L   +    YF KE                K PK  + +  +NA+F    I +P          L I++ R  +   R++++   + +++VDW+  +R A    R  Y+     E  E EL   LT +    G+M KTG +  E ++KRW  L    RRLLY   PL A  +G++ +G + +GY A    P   R     +  LTI TP R ++    SE +  E W++ +  +
Sbjct:    7 NKKRLLELLRAPDTGNAHCADCGAADPDWASYKLGIFICLNCCGVHRNFPDISRVKSVRLDFWDDSIVEFMIHNGNLRVKAKFEARVPAFYYIPQANDCLVLKEQWIRAKYERREF-MADGETISLPGNREGFLWKRGRDNSQFLRRKFVLLAREGLLKYFTKEQG--------------KSPKAVISIKDLNATFQTEKIGHPHG--------LQITYRR--DGHTRNLFVYHESGKEIVDWFNALRAA----RLQYLKMAFPELPESELVPFLTRNYLKQGFMEKTGPKQKEPFKKRWFALDCHERRLLYYKNPLDAFEQGQVFLGNKEQGYEAYEDLPKGIRGNRW-KAGLTIVTPERRFVLTCPSEKEQQE-WLESLRGV 359          
BLAST of ARF-GAP with dual PH domain-containing protein 1 vs. UniProt/SwissProt
Match: sp|Q9JK15|ADAP2_RAT (Arf-GAP with dual PH domain-containing protein 2 OS=Rattus norvegicus OX=10116 GN=Adap2 PE=1 SV=1)

HSP 1 Score: 138.658 bits (348), Expect = 5.493e-35
Identity = 104/390 (26.67%), Postives = 184/390 (47.18%), Query Frame = 1
Query:   64 SQERLIKLYSVPG--NNICADCNAEKPDYLVLSYNIIICRKCAGVHRSMENV-RVRDLNFDKISDAEINEVLKFGNKKSNDIYLKYLPIFYRLPNSNGPEILRRSFIIAKYQIKQFSVKEIDRPYIVNQKLGILKKRCKDKNIYNSRFFRLSIPDISFNYFIKETDVTNYDRSQMKLKSRKDPKRNLRLDRINASF----IDNPDSRARIPDEILMISFFRHEEASWRHIYLKSNTPEDLVDWYQTIRFAKFSLRAAYVVGTGDEANELELARDLTLDITMSGWMYKTGSQLTEQWQKRWCVL--LGRRLLYSSGPLSASGKGEIVIGERSKGYGAVSGAPPNSRSVMSDQTALTIKTPGREYLFAVDSEGDVAERWIKCINNLADVEMS 1206
            +++RL++L    G  N  CADC A  PD+      + IC  C+GVHR+  ++ +V+ +  D   D+ +  +   GN      +   +P FY +P ++   +L+  +I AKY+ ++F  ++   P     + G L KR +D + +  R F L   +    Y+ KE                K PK  + +  +NA+F    I +P          L I++   +E   R++++  ++ +++VDW+  +R A    R  Y+     +  E EL   +T +    G+M KTG +  E ++KRW  L    RRLLY   PL A  +G++ +G   +GY    G P   R     +  LT+ TP R+++F   +E +  E W++ +  +    +S
Sbjct:    7 NKKRLLELLQAAGTGNGHCADCGAADPDWASYKLGVFICLHCSGVHRNFPDISKVKSVRLDFWDDSMVEFMTHNGNLSVKAKFEARVPTFYYVPQASDCLVLKEQWIRAKYERQEFMAEKAVSP--PGDREGFLWKRGRDNSQFLRRRFVLLSREGLLKYYTKEEG--------------KTPKAIINIKDLNATFQTEKIGHPHG--------LQITY--RKEGQTRNLFVYHDSGKEIVDWFNALRAA----RLQYLKLAFPDLPESELVPLITRNYLKQGFMEKTGPKHREPFKKRWFALDPQERRLLYYKNPLDAFEQGQVFLGSNEQGYEVWEGLPQGIRGNRW-KVGLTVITPERKFVFTCPTEKEQRE-WLESLRGVLSSPLS 364          
BLAST of ARF-GAP with dual PH domain-containing protein 1 vs. UniProt/SwissProt
Match: sp|Q8R2V5|ADAP2_MOUSE (Arf-GAP with dual PH domain-containing protein 2 OS=Mus musculus OX=10090 GN=Adap2 PE=1 SV=1)

HSP 1 Score: 137.117 bits (344), Expect = 1.669e-34
Identity = 106/392 (27.04%), Postives = 182/392 (46.43%), Query Frame = 1
Query:   64 SQERLIKLYSVPG--NNICADCNAEKPDYLVLSYNIIICRKCAGVHRSMENV-RVRDLNFDKISDAEINEVLKFGNKKSNDIYLKYLPIFYRLPNSNGPEILRRSFIIAKYQIKQFSV--KEIDRPYIVNQKLGILKKRCKDKNIYNSRFFRLSIPDISFNYFIKETDVTNYDRSQMKLKSRKDPKRNLRLDRINASF----IDNPDSRARIPDEILMISFFRHEEASWRHIYLKSNTPEDLVDWYQTIRFAKFSLRAAYVVGTGDEANELELARDLTLDITMSGWMYKTGSQLTEQWQKRWCVL--LGRRLLYSSGPLSASGKGEIVIGERSKGYGAVSGAPPNSRSVMSDQTALTIKTPGREYLFAVDSEGDVAERWIKCINNLADVEMS 1206
            +++RL++L    G  N  CADC A  PD+      I IC  C+GVHR+  ++ +V+ +  D   D+ +  +   GN      +   +P FY +P +N   +L+  +I AKY+ ++F+   K +  P     + G L KR +D   +  R F L   +    Y+ KE                K PK  + +  +NA+F    I +P          L I++   +E   R++++  ++ +++VDW+  +R A    R  Y+     +  E EL   +T +    G+M KTG +  E ++KRW  L    RRLLY   PL A   G++ +G   +GY      P   R     +  LT+ TP R+++F   +E +  E W++ +  +    +S
Sbjct:    7 NKKRLLELLQAAGTGNGHCADCGAADPDWASYKLGIFICLHCSGVHRNFPDISKVKSVRLDFWDDSMVEFMTHHGNLNVKAKFEARVPAFYYVPQANDCLVLKEQWIRAKYERQEFTAIDKAVSHP---GNREGFLWKRGRDNAQFLRRRFVLLSREGLLKYYTKEEG--------------KAPKAVISIKDLNATFQTEKIGHPHG--------LQITY--RKEGHTRNLFVYHDSGKEIVDWFNALRAA----RLQYLKLAFPDLPESELVPLITRNYLKQGFMEKTGPKHREPFKKRWFALDPQERRLLYYKNPLDAFELGQVFLGSNEQGYEVWEDLPKGIRGNRW-KAGLTVITPERKFIFTCPTEKEQRE-WLESLRGVLSSPLS 365          
BLAST of ARF-GAP with dual PH domain-containing protein 1 vs. UniProt/SwissProt
Match: sp|Q9XXH8|CNT1_CAEEL (Arf-GAP with ANK repeat and PH domain-containing protein cnt-1 OS=Caenorhabditis elegans OX=6239 GN=cnt-1 PE=1 SV=2)

HSP 1 Score: 78.5666 bits (192), Expect = 6.907e-14
Identity = 42/117 (35.90%), Postives = 68/117 (58.12%), Query Frame = 1
Query:   94 VPGNNICADCNAEKPDYLVLSYNIIICRKCAGVHRSM--ENVRVRDLNFDKISDAEINEV-LKFGNKKSNDIYLKYLP----IFYRLPNSNGPEILRRSFIIAKYQIKQFSVKEIDR 423
            VPGN +CADC +  P ++ ++  +++C +C+G HRS+  +  +VR L  D I D E+ +V L  GN++ N+I+L +LP    I     N       R ++I AKY  ++F+V E  R
Sbjct:  456 VPGNEVCADCGSPAPKWVSINLGVVLCIECSGAHRSLGVQTSKVRSLCMDSI-DNELRDVLLALGNRQVNEIFLAHLPPADSIVPPQINEKSARPAREAWIKAKYVERRFAVAEDTR 571          
BLAST of ARF-GAP with dual PH domain-containing protein 1 vs. TrEMBL
Match: E2C8N7 (Centaurin-alpha-1 OS=Harpegnathos saltator OX=610380 GN=EAI_09771 PE=4 SV=1)

HSP 1 Score: 220.32 bits (560), Expect = 7.411e-63
Identity = 129/386 (33.42%), Postives = 205/386 (53.11%), Query Frame = 1
Query:   76 LIKLYSVPGNNICADCNAEKPDYLVLSYNIIICRKCAGVHRSM--ENVRVRDLNFDKISDAEINEVLKFGNKKSNDIYLKYLPIFYRLPNSNGPEILRRSFIIAKYQIKQFSVKEIDRPYIVNQKLGILKKRCKDKNIYNSRFFRLSIPDISFNYFIKETDVTNYDRSQMKLKSRKDPKRNLRLDRINASFIDNPDSRARIPDEILMISFFRHEEASWRHIYLKSNTPEDLVDWYQTIRFAKFS-LRAAYVVGTGDEANELELARDLTLDITMSGWMYKTGSQLTEQWQKRWCVLLGRRLLYSSGPLSASGKGEIVIGERSKGYGAVSGAPPNSRSVMSDQT-ALTIKTPGREYLFAVDSEGDVAERWIKCINNLADVEMSIREMA 1221
            L +L   PGNN+CADC A+ P++   +  I +C++CAGVHRSM     +V+ L  D+  D+++N + + GN  +   Y + +P  YR P+ + P++L   +I AKY+ ++F   E    Y+     G L KR K+ + Y+ R F LS  + +  Y +KE                K+PK  LR+  +N +F+             L +SF +  + + RHIY+    PE + +WY  IR AK   L+ AY       ANE EL   LT D    G+++KTG + T+ ++KRW  L GR+L+Y   P+ A  KGEI +G  S+G+   +G PP +R    DQ  + T++TP R YL +  S+ D ++ WI  I  + D  ++ ++ +
Sbjct:    9 LAELLKKPGNNVCADCGAKNPEWASYNIGIFVCKRCAGVHRSMGAHISKVKHLKLDRWEDSQVNRMREVGNAAARLHYEERVPSCYRRPSPDAPQVLVEQWIRAKYEREEFCHPERQNHYVSGFMEGFLMKRGKEDSRYHPRKFVLSEAEDTLKYHVKEN---------------KEPKAILRISELNVAFVPTKTGN----QNSLQLSFMK--DGTTRHIYVYHEDPEVITNWYLAIRCAKLHRLQVAY-----PGANENELLSQLTRDFPREGFLWKTGPRHTDAYKKRWFTLDGRKLMYHDDPMDAHPKGEIFLGHGSEGFAVKTGVPPGAR----DQGFSFTLETPDRTYLLSAQSDDDRSQ-WINVIQKVIDKPLTPQDAS 363          
BLAST of ARF-GAP with dual PH domain-containing protein 1 vs. TrEMBL
Match: K7IQS0 (Uncharacterized protein OS=Nasonia vitripennis OX=7425 GN=100120815 PE=4 SV=1)

HSP 1 Score: 217.238 bits (552), Expect = 1.118e-61
Identity = 134/384 (34.90%), Postives = 197/384 (51.30%), Query Frame = 1
Query:   76 LIKLYSVPGNNICADCNAEKPDYLVLSYNIIICRKCAGVHRSM--ENVRVRDLNFDKISDAEINEVLKFGNKKSNDIYLKYLPIFYRLPNSNGPEILRRSFIIAKYQIKQFSVKEIDRPYIVNQKLGILKKRCKDKNIYNSRFFRLSIPDISFNYFIKETDVTNYDRSQMKLKSRKDPKRNLRLDRINASFIDNPDSRARIPDEILMISFFRHEEASWRHIYLKSNTPEDLVDWYQTIRFAKFS-LRAAYVVGTGDEANELELARDLTLDITMSGWMYKTGSQLTEQWQKRWCVLLGRRLLYSSGPLSASGKGEIVIGERSKGYGAVSGAPPNSRSVMSDQ-TALTIKTPGREYLFAVDSEGDVAERWIKCINNLADVEMSIRE 1215
            L +L   PGNN CADC A+ P++   +  I +C +CAGVHRSM     +V+ L  DK  D+++N V + GN  +   Y + +P  YR PN + P++L   +I AKYQ ++F   E    Y+     G L KR K+   Y  R F LS  D +  Y++KE                K+PK  LR+  +N SF              L ISF +  + + RHIY+    PE + +WY  IR AK   L+ AY       A+E EL   L+ D    G+++KTG + ++ ++KRW  L GR+L+Y   P+ A  KGEI +G  S+GY    G PP  R    DQ  + T++TP R YL +  SE D A+ W+     + D  ++ ++
Sbjct:    9 LAELLKKPGNNACADCGAKNPEWASYNIGIFVCTRCAGVHRSMGAHISKVKHLKLDKWEDSQVNRVREVGNAAARLHYEERVPPCYRRPNQDSPQVLIEQWIRAKYQREEFCHPERQNHYVSGFMEGFLMKRGKEDARYQPRKFVLSEADDTLKYYVKEN---------------KEPKAVLRISELNVSFAPPKTGN----QNSLQISFMK--DGTTRHIYVYHEDPEIITNWYLAIRCAKLHRLQVAY-----PGASESELLCQLSKDFPREGFLWKTGPRQSDSYKKRWFTLDGRKLMYHDDPMDAHPKGEIFLGHTSEGYAVKMGVPPGFR----DQWFSFTLETPDRNYLLSAQSEDDRAQ-WMNVFQKVIDKPLTPQD 361          
BLAST of ARF-GAP with dual PH domain-containing protein 1 vs. TrEMBL
Match: A0A232FKG3 (Uncharacterized protein OS=Trichomalopsis sarcophagae OX=543379 GN=TSAR_015981 PE=4 SV=1)

HSP 1 Score: 216.853 bits (551), Expect = 3.022e-61
Identity = 134/385 (34.81%), Postives = 198/385 (51.43%), Query Frame = 1
Query:   64 SQERLIKLYSVPGNNICADCNAEKPDYLVLSYNIIICRKCAGVHRSM--ENVRVRDLNFDKISDAEINEVLKFGNKKSNDIYLKYLPIFYRLPNSNGPEILRRSFIIAKYQIKQFSVKEIDRPYIVNQKLGILKKRCKDKNIYNSRFFRLSIPDISFNYFIKETDVTNYDRSQMKLKSRKDPKRNLRLDRINASFIDNPDSRARIPDEILMISFFRHEEASWRHIYLKSNTPEDLVDWYQTIRFAKFS-LRAAYVVGTGDEANELELARDLTLDITMSGWMYKTGSQLTEQWQKRWCVLLGRRLLYSSGPLSASGKGEIVIGERSKGYGAVSGAPPNSRSVMSDQ-TALTIKTPGREYLFAVDSEGDVAERWIKCINNLADVEMS 1206
            +++ L +L   PGNN CADC A+ P++   +  I +C +CAGVHRSM     +V+ L  DK  D+++N V + GN  +   Y + +P  YR PN + P++L   +I AKYQ ++F   E    Y+     G L KR K+   Y  R F LS  D +  Y++KE                K+PK  LR+  +N SF              L ISF +  + + RHIY+    PE + +WY  IR AK   L+ AY       A+E EL   L+ D    G+++KTG + ++ ++KRW  L GR+L+Y   P+ A  KGEI +G  S+GY    G PP  R    DQ  + T++TP R YL +  SE D A+ W+     + D  ++
Sbjct:   39 NEKMLSELLKKPGNNACADCGAKNPEWASYNIGIFVCTRCAGVHRSMGAHISKVKHLKLDKWEDSQVNRVREVGNAAARLHYEERVPPCYRRPNQDSPQVLIEQWIRAKYQREEFCHPERQNHYVSGFMEGFLMKRGKEDARYQPRKFVLSEADDTLKYYVKEN---------------KEPKAVLRISELNVSFAPPKTGN----QNSLQISFMK--DGTTRHIYVYHEDPEIITNWYLAIRCAKLHRLQVAY-----PGASESELLCQLSKDFPREGFLWKTGPRQSDSYKKRWFTLDGRKLMYHDDPMDAHPKGEIFLGHTSEGYAVKMGVPPGFR----DQWFSFTLETPDRNYLLSAQSEDDRAQ-WMNVFQKVIDKPLT 392          
BLAST of ARF-GAP with dual PH domain-containing protein 1 vs. TrEMBL
Match: A0A088A3I4 (Uncharacterized protein OS=Apis mellifera OX=7460 GN=LOC551790 PE=4 SV=1)

HSP 1 Score: 214.927 bits (546), Expect = 6.718e-61
Identity = 127/386 (32.90%), Postives = 201/386 (52.07%), Query Frame = 1
Query:   61 MSQERLIKLYSVPGNNICADCNAEKPDYLVLSYNIIICRKCAGVHRSM--ENVRVRDLNFDKISDAEINEVLKFGNKKSNDIYLKYLPIFYRLPNSNGPEILRRSFIIAKYQIKQFSVKEIDRPYIVNQKLGILKKRCKDKNIYNSRFFRLSIPDISFNYFIKETDVTNYDRSQMKLKSRKDPKRNLRLDRINASFIDNPDSRARIPDEILMISFFRHEEASWRHIYLKSNTPEDLVDWYQTIRFAKFS-LRAAYVVGTGDEANELELARDLTLDITMSGWMYKTGSQLTEQWQKRWCVLLGRRLLYSSGPLSASGKGEIVIGERSKGYGAVSGAPPNSRSVMSDQT-ALTIKTPGREYLFAVDSEGDVAERWIKCINNLADVEMS 1206
            ++++ L +L   PGNN+CADC A+ P++   +  I +C +CAG+HRSM     +V+ L  D+  D+++N + + GN  +   Y + +P  YR PN + P++L   +I AKY+ ++F   E    Y+     G L KR K+ + Y+ R F L   + +  Y +KE                K+PK  LR+  +N +F              L ISF +  + + RHIY+    PE + +WY  IR AK   L+ AY   T     E EL   LT D    G+++KTG + T+ ++KRW  L GR+L+Y   P+ A  KGEI +G  S G+   +G PP +R    DQ  + T++TP R YL +  S+ D ++ W+  I  + D  ++
Sbjct:    4 LNEKLLAELLKKPGNNVCADCGAKNPEWASYNIGIFVCTRCAGIHRSMGAHISKVKHLKLDRWEDSQVNRIREVGNIAARLHYEERVPPCYRRPNPDAPQVLIEQWIRAKYEREEFCHPERQNHYVSGFMEGFLMKRGKEDSRYHPRKFVLCEAEDTLKYHVKEN---------------KEPKAVLRISELNVAFAPPKTGN----QNSLQISFMK--DGTTRHIYVYHEDPEVITNWYLAIRCAKLHRLQVAYPGAT-----EAELLSQLTRDFPREGFLWKTGPRYTDAYKKRWFTLDGRKLMYHDDPMDAHPKGEIFLGHSSDGFAVKTGVPPGAR----DQGFSFTLETPDRTYLLSAQSDDDRSQ-WMNVIQKVIDKPLT 358          
BLAST of ARF-GAP with dual PH domain-containing protein 1 vs. TrEMBL
Match: A0A2A3E3E3 (Arf-GAP with dual PH domain-containing protein OS=Apis cerana cerana OX=94128 GN=APICC_04298 PE=4 SV=1)

HSP 1 Score: 214.542 bits (545), Expect = 1.103e-60
Identity = 127/386 (32.90%), Postives = 201/386 (52.07%), Query Frame = 1
Query:   61 MSQERLIKLYSVPGNNICADCNAEKPDYLVLSYNIIICRKCAGVHRSM--ENVRVRDLNFDKISDAEINEVLKFGNKKSNDIYLKYLPIFYRLPNSNGPEILRRSFIIAKYQIKQFSVKEIDRPYIVNQKLGILKKRCKDKNIYNSRFFRLSIPDISFNYFIKETDVTNYDRSQMKLKSRKDPKRNLRLDRINASFIDNPDSRARIPDEILMISFFRHEEASWRHIYLKSNTPEDLVDWYQTIRFAKFS-LRAAYVVGTGDEANELELARDLTLDITMSGWMYKTGSQLTEQWQKRWCVLLGRRLLYSSGPLSASGKGEIVIGERSKGYGAVSGAPPNSRSVMSDQT-ALTIKTPGREYLFAVDSEGDVAERWIKCINNLADVEMS 1206
            ++++ L +L   PGNN+CADC A+ P++   +  I +C +CAG+HRSM     +V+ L  D+  D+++N + + GN  +   Y + +P  YR PN + P++L   +I AKY+ ++F   E    Y+     G L KR K+ + Y+ R F L   + +  Y +KE                K+PK  LR+  +N +F              L ISF +  + + RHIY+    PE + +WY  IR AK   L+ AY   T     E EL   LT D    G+++KTG + T+ ++KRW  L GR+L+Y   P+ A  KGEI +G  S G+   +G PP +R    DQ  + T++TP R YL +  S+ D ++ W+  I  + D  ++
Sbjct:    4 LNEKLLAELLKKPGNNVCADCGAKNPEWASYNIGIFVCTRCAGIHRSMGAHISKVKHLKLDRWEDSQVNRIREVGNIAARLHYEERVPPCYRRPNPDAPQVLIEQWIRAKYEREEFCHPERQNHYVSGFMEGFLMKRGKEDSRYHPRKFVLCEAEDTLKYHVKEN---------------KEPKAVLRISELNVAFAPPKTGN----QNSLQISFMK--DGTTRHIYVYHEDPEVITNWYLAIRCAKLHRLQVAYPGAT-----EAELLSQLTRDFPREGFLWKTGPRYTDAYKKRWFTLDGRKLMYHDDPMDAHPKGEIFLGHSSDGFAIKTGVPPGAR----DQGFSFTLETPDRTYLLSAQSDDDRSQ-WMNVIQKVIDKPLT 358          
BLAST of ARF-GAP with dual PH domain-containing protein 1 vs. Ensembl Cavefish
Match: ENSAMXT00000020635.2 (arf-GAP with dual PH domain-containing protein 1 [Source:NCBI gene;Acc:103031562])

HSP 1 Score: 199.134 bits (505), Expect = 2.235e-58
Identity = 121/387 (31.27%), Postives = 207/387 (53.49%), Query Frame = 1
Query:   76 LIKLYSVPGNNICADCNAEKPDYLVLSYNIIICRKCAGVHRSMEN-VRVRDLNFDKISDAEINEVLKFGNKKSNDIYLKYLPIFYRLPNSNGPEILRRSFIIAKYQIKQFSVKEIDRPYIVNQKLGILKKRCKDKNIYNSRFFRLSIPDISFNYFIKETDVTNYDRSQMKLKSRKDPKRNLRLDRINASF----IDNPDSRARIPDEILMISFFRHEEASWRHIYLKSNTPEDLVDWYQTIRFAKFSLRAAYVVGTGDEANELELARDLTLDITMSGWMYKTGSQLTEQWQKRWCVLLGRRLLYSSGPLSASGKGEIVIGERSKGYGAVSGAPPNSRSVMSDQTALTIKTPGREYLFAVDSEGDVAERWIKCINNLADVEMSIREMA 1221
            L ++   PGN+ CADC +  P++   S  + IC  C+G+HR+ ++  +V+ +   +  D+E+  + + GN+ +   Y   +P++Y  P     ++L+  +I AKY+  +F+V      Y    + G L KR +D   + +R F LS  + +  YF K TD              K+PK  +++D INASF    I NP+         L I++ +  + + R+I+L + + +++VDW+ +IR    +++  Y+      A+++EL   LT +    G+M KTG + TE ++KRW  L  RRL+Y   PL A  KGE+ +G +  GY A +G PPN+    + Q  +TI+TP R YLF  ++E +  + W+K  N L +  MS +E +
Sbjct:   11 LKEILKRPGNDTCADCGSPDPEWGSCSLGVFICLACSGIHRNFQSPAKVKSVRLSRWEDSEVQFMAENGNEVARSKYEAQVPVYYYKPTHKDCQVLKEQWIKAKYERLEFTVDRKPLLYEEGTREGPLMKRGRDNGQFLTRRFVLSEREGTLKYFTK-TDA-------------KEPKAIIKVDTINASFQPEKIGNPNG--------LQITYLK--DFNTRNIFLYNESSKEIVDWFNSIR----AVQLHYLKVAFPGASDVELKPKLTRNFLKEGYMEKTGPRQTEGFKKRWFTLDHRRLMYFKDPLDAFAKGEVFLGHKDLGYSASAGLPPNTHCNGTWQNGITIQTPDRSYLFTCETEVE-QQDWLKHFNELINTVMSPQEYS 368          
BLAST of ARF-GAP with dual PH domain-containing protein 1 vs. Ensembl Cavefish
Match: adap2 (arf-GAP with dual PH domain-containing protein 2 [Source:NCBI gene;Acc:103042683])

HSP 1 Score: 149.058 bits (375), Expect = 9.949e-40
Identity = 106/375 (28.27%), Postives = 176/375 (46.93%), Query Frame = 1
Query:   76 LIKLYSVPGNNICADCNAEKPDYLVLSYNIIICRKCAGVHRSMENV-RVRDLNFDKISDAEINEVLKFGNKKSNDIYLKYLPIFYRLPNSNGPEILRRSFIIAKYQIKQFSVKEIDRPYIVNQKLGILKKRCKDKNIYNSRFFRLSIPDISFNYFIKETDVTNYDRSQMKLKSRKDPKRNLRLDRINASFIDNPDSRARIPDEILMISFFRHEEASWRHIYLKSNTPEDLVDWYQTIRFAKFS-LRAAYVVGTGDEANELELARDLTLDITMSGWMYKTGSQLTEQWQKRWCVL--LGRRLLYSSGPLSASGKGEIVIGERSKGYGAVSGAPPNSRSVMSDQTALTIKTPGREYLFAVDSEGDVAERWIKCINNL 1188
            L+    +P N  CADC A  PD+      I +C  C+G HR++ +V RV+ +  D   D  +  +   GN+ + + Y K++P+FY  P  +  E+LR  +I AKY+  +FS +     Y      G+L K+ KD   +  R F LS  D +  YF              K    K PK  + +  +NA+F       A      L IS+   +    R++++   + +++V+W+  IR  +F  L+ A+   T +     EL   +T +    G+M KTG    E ++KRW +L  L R+LLY    L A   G I IG  + GY      P  +R     +  + ++TP R+++F  + E +  E W++ +  +
Sbjct:   11 LLDQAKLPDNCTCADCGAPDPDWASYKLGIFVCLNCSGTHRNLSSVSRVKSIRLDFWDDDLVEFMKANGNRTAKEFYEKFVPVFYYRPQQDDCEVLREQWIRAKYERLEFSEENKLLAYSSGVYEGVLWKKGKDNGQFLKRKFVLSEQDFTLKYF--------------KEDEGKGPKAVISVKHLNATFQPQKIGHAH----GLQISYCVDDHT--RNLFVYHESGQEIVNWFNAIRATRFVYLKTAFPTATDE-----ELLPWITRNYLKEGYMEKTGPLQREPFKKRWFILDALDRKLLYFKTQLDAVELGVIFIGTENHGYSVRECVPKGTRG-NKWKCGVVMETPDRQFVFMCEQERERNE-WLEALQQV 358          
BLAST of ARF-GAP with dual PH domain-containing protein 1 vs. Ensembl Cavefish
Match: ADAP1 (ArfGAP with dual PH domains 1 [Source:HGNC Symbol;Acc:HGNC:16486])

HSP 1 Score: 146.747 bits (369), Expect = 4.082e-39
Identity = 99/319 (31.03%), Postives = 156/319 (48.90%), Query Frame = 1
Query:  277 GNKKSNDIYLKYLPIFYRLPNSNGPEILRRSFIIAKYQIKQFSVKEIDRPYIVNQKLGILKKRCKDKNIYNSRFFRLSIPDISFNYFIKETDVTNYDRSQMKLKSRKDPKRNLRLDRINASF----IDNPDSRARIPDEILMISFFRHEEASWRHIYLKSNTPEDLVDWYQTIRFAKFSLRAAYVVGTGDEANELELARDLTLDITMSGWMYKTGSQLTEQWQKRWCVLLGRRLLYSSGPLSASGKGEIVIGERSKGYGAVSGAPPNSRSVMSDQTALTIKTPGREYLFAVDSEGDVAERWIKCINNLADVEMSIREMA 1221
            GN  +   Y + +P FY  P     ++LR  +I A+Y+  +F   E   PY    + G L KR +D   + SR F LS  + +  YF K                 ++PK  +++  INA+F    I NP          L I++ +  + S R+I++     +++VDW+  IR A+F        G    A++++L   LT +    G+M KTG + TE ++KRW  L  RRL+Y   PL A  +GE+ IG +  GY  V G PP+++     Q  +TI TP R++LFA ++E +  E WI    +  +  M  +E A
Sbjct:   57 GNSAAKAKYEQKVPAFYYCPTQTDCQLLREQWIRARYERNEFIYVERQEPYSAGYREGFLWKRGRDNGQFLSRKFILSEREGALKYFNKH--------------DAREPKALMKIHTINATFQPAKIGNPHG--------LQITYLK--DNSTRNIFVYHEDGKEMVDWFNAIRAARFHYLQVAFPG----AHDVDLVSKLTRNYIKEGYMEKTGPKHTEGFKKRWFTLDDRRLMYFKDPLDAYARGEVFIGSKENGYTVVPGLPPSTQGYHW-QFGITIVTPDRKFLFACETEEEQKE-WIAMFQSAVNRPMLPQEYA 345          
BLAST of ARF-GAP with dual PH domain-containing protein 1 vs. Ensembl Cavefish
Match: ENSAMXT00000000841.2 (arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1-like [Source:NCBI gene;Acc:103047121])

HSP 1 Score: 71.2478 bits (173), Expect = 1.405e-12
Identity = 46/131 (35.11%), Postives = 72/131 (54.96%), Query Frame = 1
Query:   70 ERLIKLYSVPGNNICADCNAEKPDYLVLSYNIIICRKCAGVHRSMENVR--VRDLNFD-KI-SDAEINEVLKFGNKKSNDIYLKYLPIFYR-LPNSNGPEILRRSFIIAKYQIKQFSVKEIDRPYIVNQKL 447
            E  ++L++ P N +CADC +  P++  ++  ++IC  CAGVHRS+   R  VR L  D KI ++  I   + +GNK SN+++   +P   + LP++   E  R +FI AKY    +       P I NQ L
Sbjct:  365 EVALRLWASPWNKVCADCGSSNPEWASINLLVVICEACAGVHRSIGTSRSKVRSLKLDSKIWTEPLIKLFIIYGNKASNNVWGHNVPAAEQILPDAGQEE--RDAFIKAKYCSGLY---RKTHPLISNQTL 490          
BLAST of ARF-GAP with dual PH domain-containing protein 1 vs. Ensembl Cavefish
Match: asap1b (ArfGAP with SH3 domain, ankyrin repeat and PH domain 1b [Source:ZFIN;Acc:ZDB-GENE-091112-16])

HSP 1 Score: 70.8626 bits (172), Expect = 1.739e-12
Identity = 35/108 (32.41%), Postives = 55/108 (50.93%), Query Frame = 1
Query:   94 VPGNNICADCNAEKPDYLVLSYNIIICRKCAGVHRSM--ENVRVRDLNFDKISDAEINEVLKFGNKKSNDIYLKYLPIFYRLPNSNGPEILRRSFIIAKYQIKQFSVK 411
            +PGN +C DC A  P +L  +  I+ C +C+G+HR M     R++ +  DK+  +E+      GN   N+I    LP     P  +    +R+ FI AKY   +F+ K
Sbjct:  385 IPGNEVCCDCGAADPKWLSTNLGILTCIECSGIHREMGVHISRIQSMELDKLGTSELLLAKNVGNSNFNEIMEGNLPCPSPKPTPSSDMTVRKEFIHAKYVDHKFARK 492          
BLAST of ARF-GAP with dual PH domain-containing protein 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009789.1 (pep scaffold:Pmarinus_7.0:GL477354:7942:22234:1 gene:ENSPMAG00000008842.1 transcript:ENSPMAT00000009789.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 155.606 bits (392), Expect = 4.374e-43
Identity = 112/382 (29.32%), Postives = 181/382 (47.38%), Query Frame = 1
Query:  136 PDYLVLSYNIIICRKCAGVHRSMENV-RVRDLNFDKISDAEINEVLKFGNKKSNDIYLKYLPIFYRLPNSNG-PEILRRSFIIAKYQIKQFSVKEIDRPY-IVNQKLGILKKRCKDKNIYNSRFFRLSIPDISFNYFIKETDVTNYDRSQMKLKSRKDPKRNLRLDRINASF----IDNPDSRARIPDEILMISFFRHEEASWRHIYLKSNTPEDLVDWYQTIRFAKFSLRAAYVVGTGDEANELELARDLTLDITMSGWMYKTGSQLTEQWQKRWCVL--LGRRLLYSSGPLSASGKGEIVIGERSKGYGAVSGAPPNSRSVMSDQTALTIKTPGREYLFAVDSEGDVAERWIKCINNLADVEMSIREMADYQLHPKAAHK 1254
            P++   +  + +C +C+ +H ++ +  +V+    DK +D ++  +   GNK     Y K++P FY  P  N    ++R  +I AKY+ ++F   +   PY     + G+L KR +D   +  R F LS  + S  YF      T +D         K+PK  +++  IN +F    I NP+         L I++ +  + S R+I++     +++VDWY  IR A+F        G+ D     +L + L+ +    G+M KTG +  E ++KRWC L    RRL+Y   PL A  KGE+ IG    GY    G P  ++     Q  +TI TP R +LFA + E D  E WI    ++    M  +   DY +     HK
Sbjct:    1 PEWASYTLGVFLCLECSSIHANLRDTSKVKSTRADKWNDEQVQFMASLGNKAVKAKYEKHVPPFYYRPKPNDCHRVVREQWIRAKYERQEFIFIDRQEPYSAAGYREGVLWKRGRDNGQFLQRKFILSEKEGSLKYF------TKFDG--------KEPKATVKIADINPTFQPVKIGNPNG--------LQITYLK--DFSTRNIFIYHEEGKEIVDWYNAIRAARFHYHKVAFPGSQD----ADLIQKLSRNYIKEGYMEKTGPRQREGFKKRWCTLDAADRRLMYFKDPLDAFAKGEVFIGHSDHGYSVQEGLPGGTQGYRW-QFGITITTPDRGFLFACEKEADQQE-WISAFKSIIARSMCPQ---DYVMEAYFKHK 349          
BLAST of ARF-GAP with dual PH domain-containing protein 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000824.1 (pep scaffold:Pmarinus_7.0:GL477349:152854:172297:-1 gene:ENSPMAG00000000731.1 transcript:ENSPMAT00000000824.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 142.51 bits (358), Expect = 2.289e-38
Identity = 106/376 (28.19%), Postives = 174/376 (46.28%), Query Frame = 1
Query:  136 PDYLVLSYNIIICRKCAGVHRSMENV-RVRDLNFDKISDAEINEVLKFGNKKSNDIYLKYLPIFYRLPNSNGPEILRRSFIIAKYQIKQFSVKEIDRPYIVNQKLGILKKRCKDKNIYNSRFFRLSIPDISFNYFIKETDVTNYDRSQMKLKSRKDPKRNLRLDRINASFIDNPDSRARIPDEILMISFFRHEEASWRHIYLKSNTPEDLVDWYQTIRFAKFS-LRAAYVVGTGDEANELELARDLTLDITMSGWMYKTGSQLTEQWQKRWCVL--LGRRLLYSSGPLSASGKGEIVIGERSKGYGAVSGAPPNSRSVMSDQTALTIKTPGREYLFAVDSEGDVAERWIKCINNLADVEMSIREMADYQLHPKAAH 1251
            PD+   +  + IC  C+G+HR+M  V RV+ L  D   D ++  +   GN  + ++Y + +P FY  P ++  ++L+  +I A+Y+ ++F   E   PY    + G L KR +D + +  R F LS  +    YF K                 K+PK  L++  INA+F     +      + L+                +    + +VDW+  IR  ++  L+ AY  GT D+    E+   LT +    G+M KTG +  E +++RW  L    RRL+Y   PL A  KGE+ +G    GY  + G PP  +        +TI TP R+Y+    +E + A+ WI   + +    MS +E +  + H K  H
Sbjct:    2 PDWASYTLGVFICLHCSGIHRNMTEVSRVKSLRLDFWEDEQVEFMASKGNVAAKELYEQRIPPFYYRPTADDCQVLKEQWIRARYERREFIDVEKQEPYSTGYREGYLWKRGRDSSQFLRRKFILSEREGVLKYFTK--------------SDAKEPKDELKIAEINATFQPGVATYTHKVHQSLLTG---------NRGVRRVVGAQVIVDWFNAIRAVRYHYLKVAY-PGTVDK----EITPRLTRNYVKEGYMEKTGPKQKESFRRRWFTLDAADRRLMYFKDPLDAFAKGEVFLGNGDHGYAVLEGFPPGLQG-HHWAYGITIVTPERKYVLGCRTEDEQAQ-WITHFHRVIMRPMSPQEYSA-EAHFKRKH 346          
BLAST of ARF-GAP with dual PH domain-containing protein 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007633.1 (pep scaffold:Pmarinus_7.0:GL488501:137984:146551:-1 gene:ENSPMAG00000006898.1 transcript:ENSPMAT00000007633.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 70.0922 bits (170), Expect = 4.584e-13
Identity = 35/111 (31.53%), Postives = 67/111 (60.36%), Query Frame = 1
Query:   82 KLYSVPGNNICADCNAEKPDYLVLSYNIIICRKCAGVHRSM-ENV-RVRDLNFDK--ISDAEINEVLKFGNKKSNDIYLKYLPIFYRLPNSNGPEILRRSFIIAKYQIKQF 402
            +++++P N +CADC A KP +  ++  ++IC+ CAG HR++  N+ +VR L  DK   +D  I   ++ GN++ N+ +   +P    +  ++ P   RR F++AKY+  ++
Sbjct:  213 RIWALPANRLCADCGAAKPAWASINLCVVICKLCAGQHRALGPNISKVRSLKMDKKIWTDDLIELFVQIGNERVNEFWAANVPPSEEIDPASMPN-ERREFVVAKYRSGKY 322          
BLAST of ARF-GAP with dual PH domain-containing protein 1 vs. Ensembl Sea Lamprey
Match: smap1 (small ArfGAP 1 [Source:ZFIN;Acc:ZDB-GENE-060920-2])

HSP 1 Score: 67.0106 bits (162), Expect = 3.651e-12
Identity = 38/121 (31.40%), Postives = 65/121 (53.72%), Query Frame = 1
Query:   67 QERLIKLYSVPGNNICADCNAEKPDYLVLSYNIIICRKCAGVHRSM--ENVRVRDLNFDKISDAEINEVLKFGNKKSNDIYLKYLPIFYRLPNS-NGPEILRRSFIIAKYQIKQFSVKEID 420
            Q  L+ +     N  CADC A+ P +   +  + +C +CAG+HR++     RV+ +N D+ +  +I  + + GN+K+  +Y   LP  +R P S +  EI    FI  KY+ K++  K +D
Sbjct:   18 QALLVAMLREEDNKYCADCEAKGPRWASWNLGVFVCIRCAGIHRNLGVHISRVKSVNLDQWTPEQIQNIQEMGNRKARRLYEANLPDSFRRPQSDHAVEI----FIREKYEKKKYMDKSLD 134          
BLAST of ARF-GAP with dual PH domain-containing protein 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009914.1 (pep scaffold:Pmarinus_7.0:GL476634:533628:626389:1 gene:ENSPMAG00000008958.1 transcript:ENSPMAT00000009914.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 59.3066 bits (142), Expect = 1.344e-9
Identity = 26/76 (34.21%), Postives = 43/76 (56.58%), Query Frame = 1
Query:   94 VPGNNICADCNAEKPDYLVLSYNIIICRKCAGVHRSMEN--VRVRDLNFDKISDAEINEVLKFGNKKSNDIYLKYL 315
            V GN++C DC A  PD+  L+   +IC +C+G+HR++ +   RVR L+ D+  D     ++  GN  S  ++   L
Sbjct:  541 VQGNDVCIDCGAPNPDWASLNLGALICIECSGIHRNLGSHVSRVRSLDLDEWPDELAQVMVSVGNAMSRGVWEGSL 616          
BLAST of ARF-GAP with dual PH domain-containing protein 1 vs. Ensembl Yeast
Match: AGE2 (ADP-ribosylation factor (ARF) GTPase activating protein (GAP) effector; involved in Trans-Golgi-Network (TGN) transport; contains C2C2H2 cysteine/histidine motif [Source:SGD;Acc:S000001306])

HSP 1 Score: 51.6026 bits (122), Expect = 1.162e-7
Identity = 27/83 (32.53%), Postives = 47/83 (56.63%), Query Frame = 1
Query:   67 QERLIKLYSVPGNNICADCNAE-KPDYLVLSYNIIICRKCAGVHRSMEN--VRVRDLNFDKISDAEINEVLKFGNK-KSNDIY 303
            ++ L  L   PGN+ CADC A+  P +   S  + IC KCAG+HRS+     +V+ ++ D   +  + ++++F N  ++N  Y
Sbjct:    8 KKALSALLRDPGNSHCADCKAQLHPRWASWSLGVFICIKCAGIHRSLGTHISKVKSVDLDTWKEEHLVKLIQFKNNLRANSYY 90          
BLAST of ARF-GAP with dual PH domain-containing protein 1 vs. Ensembl Yeast
Match: GCS1 (ADP-ribosylation factor GTPase activating protein (ARF GAP); involved in ER-Golgi transport; required for prospore membrane formation; regulates phospholipase Spo14p; shares functional similarity with Glo3p; GCS1 has a paralog, SPS18, that arose from the whole genome duplication [Source:SGD;Acc:S000002385])

HSP 1 Score: 51.6026 bits (122), Expect = 1.342e-7
Identity = 24/74 (32.43%), Postives = 37/74 (50.00%), Query Frame = 1
Query:   73 RLIKLYSVPGNNICADCNAEKPDYLVLSYNIIICRKCAGVHRSMENVR---VRDLNFDKISDAEINEVLKFGNK 285
            RL++L  +  N  C DC A  P +    +   IC +CAG+HR +  V    VR +  D+    E+  + K GN+
Sbjct:   13 RLLQLQKIGANKKCMDCGAPNPQWATPKFGAFICLECAGIHRGL-GVHISFVRSITMDQFKPEELLRMEKGGNE 85          
BLAST of ARF-GAP with dual PH domain-containing protein 1 vs. Ensembl Yeast
Match: GLO3 (ADP-ribosylation factor GTPase activating protein (ARF GAP); involved in ER-Golgi transport; shares functional similarity with Gcs1p [Source:SGD;Acc:S000000924])

HSP 1 Score: 50.8322 bits (120), Expect = 3.309e-7
Identity = 38/149 (25.50%), Postives = 67/149 (44.97%), Query Frame = 1
Query:   61 MSQERLIKLYSVPGNNICADCNAEKPDYLVLSYNIIICRKCAGVHRSMENVRVRDLNFDKISDAEINEVLKF---GNKKSNDIYLKYLPIFYRLPNSNGPEILRRSFIIAKYQIKQFSVKEIDRPYIVNQKLGILKKRCKDKNIYNSRF 498
             +Q+   KL S   N +C DC  + P +  + + +++C +C+ VHR+M  V +  +    +    IN + +F   GN K+ D +LK          +NG ++L  + + AK +           P     K+ + KK  KD  +Y S  
Sbjct:   14 TTQQVFQKLGSNMENRVCFDCGNKNPTWTSVPFGVMLCIQCSAVHRNM-GVHITFVKSSTLDKWTINNLRRFKLGGNHKARDFFLK----------NNGKQLLNTANVDAKTKYTS--------PVAKKYKIHLDKKVQKDMELYPSEL 143          
BLAST of ARF-GAP with dual PH domain-containing protein 1 vs. Ensembl Yeast
Match: AGE1 (ADP-ribosylation factor (ARF) GTPase activating protein (GAP) effector; involved in the secretory and endocytic pathways; contains C2C2H2 cysteine/histidine motif [Source:SGD;Acc:S000002932])

HSP 1 Score: 48.1358 bits (113), Expect = 2.350e-6
Identity = 35/107 (32.71%), Postives = 56/107 (52.34%), Query Frame = 1
Query:  112 CADCNAEKP-DYLVLSYNIIICRKCAGVHRSMEN--VRVRDLNFDKISDAEINEVLKFGNKKSND--IY---LKYLPIFYRLPNSNGPEILRRSFIIAKYQIKQFSV 408
            C DC +    +++ ++   I+C KC+GVHRS+ +   ++R L  D  +  E+  +L+     SN   IY   L+  P+     NS+  E  R  FII KYQ K+F +
Sbjct:  186 CCDCGSTATVEWVSINLLCILCIKCSGVHRSLGSHISKIRSLTLDNFTSLELMHLLQNNVSNSNVNAIYESNLRNFPVKKITANSDDSE--RSKFIIDKYQFKKFVI 290          
BLAST of ARF-GAP with dual PH domain-containing protein 1 vs. Ensembl Yeast
Match: SPS18 (Protein of unknown function, contains a putative zinc-binding domain; expressed during sporulation; SPS18 has a paralog, GCS1, that arose from the whole genome duplication [Source:SGD;Acc:S000005148])

HSP 1 Score: 45.8246 bits (107), Expect = 7.859e-6
Identity = 22/79 (27.85%), Postives = 40/79 (50.63%), Query Frame = 1
Query:   58 IMSQERLIKLYSVPGNNICADCNAEKPDYLVLSYNIIICRKCAGVHRSMEN--VRVRDLNFDKISDAEINEVLKFGNKK 288
            + +++RL++     GNN C +C +  P ++  S+ I IC  CA + R M      V+ +  D   + ++  V K GN +
Sbjct:   10 MENRKRLLRAKKAAGNNNCFECKSVNPQFVSCSFGIFICVNCANLLRGMGTNIFCVKSITMDNFEEKDVRRVEKSGNNR 88          
BLAST of ARF-GAP with dual PH domain-containing protein 1 vs. Ensembl Nematostella
Match: EDO47919 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RKJ9])

HSP 1 Score: 206.838 bits (525), Expect = 7.386e-62
Identity = 128/386 (33.16%), Postives = 200/386 (51.81%), Query Frame = 1
Query:   76 LIKLYSVPGNNICADCNAEKPDYLVLSYNIIICRKCAGVHRSMEN--VRVRDLNFDKISDAEINEVLKFGNKKSNDIYLKYLPIFYRLPNSNGPEILRRSFIIAKYQIKQFSVKEIDRPYIVNQKLGILKKRCKDKNIYNSRFFRLSIPDISFNYFIKETDVTNYDRSQMKLKSRKDPKRNLRLDRINASFI----DNPDSRARIPDEILMISFFRHEEASWRHIYLKSNTPEDLVDWYQTIRFAKFSLRAAYVVGTGDEANELELARDLTLDITMSGWMYKTGSQLTEQWQKRWCVLLGRRLLYSSGPLSASGKGEIVIGERSKGYGAVSGAPPNSRSVMSDQTALTIKTPGREYLFAVDSEGDVAERWIKCINNLADVEMSIRE 1215
            L++L   PGNN CADC A+ P++   S  I IC  C+GVHR++      V+ L  D  +D  +  +++ GN+KSN I+ K +PI YR P    P +LR  +I AKY+ K+F     +  Y+   K GILKK+ KD+N +  + F L+  + S  YF++ TD                PK  L++  +N  F     D P+S          + F   +E   R+ ++ S++ +D+VDWY  IR AK +L      G   E    +++  L+ D  M G+++KTG +  + W KRW  L GRRLLY   P+ A GKGE+ IG + +G+    G     + +      LT+KTP R Y  + D+E +  + W+  I ++  + M+ +E
Sbjct:    8 LLELAKRPGNNTCADCGAKHPEWASASKGIFICITCSGVHRNLGTQISVVKSLRLDTWTDERLQFMIENGNEKSNAIWAKNVPICYRRPKCTDPHVLREQWIRAKYERKEFIDGAPEPCYLSGSKTGILKKKKKDENQWKDKLFVLNQDENSLCYFLQATD--------------PHPKDVLKITEVNVVFAEEKSDKPNS----------LQFTWVKEGKTRNYFVCSDSGKDIVDWYMAIRAAKLNLLGLNKPGVKHE----DVSHLLSKDFLMEGYLHKTGPKSNDGWLKRWFTLDGRRLLYFDKPMDAFGKGEVYIGSKEEGFSITEGITTEHKPIGQ---CLTLKTPNRVYNLSADTENE-RQMWVDAIQSIVSMPMTDQE 361          
BLAST of ARF-GAP with dual PH domain-containing protein 1 vs. Ensembl Nematostella
Match: EDO34178 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SQ28])

HSP 1 Score: 73.559 bits (179), Expect = 9.906e-14
Identity = 41/120 (34.17%), Postives = 63/120 (52.50%), Query Frame = 1
Query:   94 VPGNNICADCNAEKPDYLVLSYNIIICRKCAGVHRSM--ENVRVRDLNFDKISDAEINEVLKFGNKKSNDIYLKYLPIFYRLPNSNGPEILRRSFIIAKYQIKQFSVKEIDRPYIVNQKL 447
            +PGN+ CADC ++ P +L  +  ++ C +C+GVHR M     RV+ +  D I  AE+      GN   N+I    L I  + P +N     ++ FI AKY   Q++ K  + P  V Q+L
Sbjct:  424 LPGNDTCADCTSKDPTWLSTNLGVLTCIECSGVHRGMGVHVSRVQSITLDNIGTAELLLAKAIGNGGFNEIMEATLDIDQK-PTANSKMDEKKEFIHAKYIKHQYAQKSGESPEKVLQEL 542          
BLAST of ARF-GAP with dual PH domain-containing protein 1 vs. Ensembl Nematostella
Match: EDO33091 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7ST58])

HSP 1 Score: 64.6994 bits (156), Expect = 1.244e-12
Identity = 33/119 (27.73%), Postives = 64/119 (53.78%), Query Frame = 1
Query:   64 SQERLIKLYSVPGNNICADCNAEKPDYLVLSYNIIICRKCAGVHRSM--ENVRVRDLNFDKISDAEINEVLKFGNKKSNDIYLKYLPIFYRLPNSNGPEILRRSFIIAKYQIKQFSVKE 414
            +Q  L+ +     N  CADC A+ P +   +  + IC +CAG+HR++     +V+ +N D  ++ ++  +  +GN+++   +  YLP  +R P ++       +FI  KY+ K+F  K+
Sbjct:   16 NQAILVDMLKEEKNKYCADCAAKGPRWASWNLGVFICIRCAGIHRNLGVHISKVKSVNLDSWTEEQMASIQSWGNRRAGLYWECYLPEDFRRPQTDSA---MEAFIRKKYEQKKFIKKD 131          
BLAST of ARF-GAP with dual PH domain-containing protein 1 vs. Ensembl Nematostella
Match: EDO43007 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZU7])

HSP 1 Score: 68.9366 bits (167), Expect = 2.395e-12
Identity = 39/109 (35.78%), Postives = 59/109 (54.13%), Query Frame = 1
Query:   82 KLYSVPGNNICADCNAEKPDYLVLSYNIIICRKCAGVHRSM--ENVRVRDLNFDKISDAEINEVLKFGNKKSNDIYLKYLPIFYRLPNSNGPEILRRSFIIAKYQIKQF 402
            ++  V GN  CADC+A +PD+  ++  I +C +C+GVHRSM     +VR L  DK     +  +   GN K N I+   L  F +L   +G    R++FI  KY  ++F
Sbjct:  514 RIRKVEGNKYCADCSAPRPDWASINLGITVCIECSGVHRSMGVHVSKVRSLTLDKWDGDTVEFMEAMGNTKVNKIFEANLNDFPKLTRDSGKHD-RQAFIKLKYVEQKF 621          
BLAST of ARF-GAP with dual PH domain-containing protein 1 vs. Ensembl Nematostella
Match: EDO37809 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SEL6])

HSP 1 Score: 60.8474 bits (146), Expect = 6.130e-10
Identity = 32/106 (30.19%), Postives = 54/106 (50.94%), Query Frame = 1
Query:   91 SVPGNNICADCNAEKPDYLVLSYNIIICRKCAGVHRSM--ENVRVRDLNFDKISDAEINEVLKFGNKKSNDIYLKYLPIFYRLPNSNGPEILRRSFIIAKYQIKQF 402
            SVPGN +CADCN   P +  ++  +++C +C+G+HRS+     +VR L  D      +  + + GN   N IY   +   ++  N       R ++I +KY   +F
Sbjct:  413 SVPGNEVCADCNHNDPKWASINLGVVLCIECSGIHRSLGVHVSKVRSLTLDAWEPEHLKLMSELGNSLINSIYEAKIAGDHKKINHLSNRSDREAWIKSKYIYHRF 518          
BLAST of ARF-GAP with dual PH domain-containing protein 1 vs. Ensembl Medaka
Match: ENSORLT00000032796.1 (arf-GAP with dual PH domain-containing protein 1 [Source:NCBI gene;Acc:101155162])

HSP 1 Score: 202.216 bits (513), Expect = 1.336e-59
Identity = 127/387 (32.82%), Postives = 204/387 (52.71%), Query Frame = 1
Query:   76 LIKLYSVPGNNICADCNAEKPDYLVLSYNIIICRKCAGVHRSMENV-RVRDLNFDKISDAEINEVLKFGNKKSNDIYLKYLPIFYRLPNSNGPEILRRSFIIAKYQIKQFSVKEIDRPYIVNQKLGILKKRCKDKNIYNSRFFRLSIPDISFNYFIKETDVTNYDRSQMKLKSRKDPKRNLRLDRINASF----IDNPDSRARIPDEILMISFFRHEEASWRHIYLKSNTPEDLVDWYQTIRFAKFSLRAAYVVGTGDEANELELARDLTLDITMSGWMYKTGSQLTEQWQKRWCVLLGRRLLYSSGPLSASGKGEIVIGERSKGYGAVSGAPPNSRSVMSDQTALTIKTPGREYLFAVDSEGDVAERWIKCINNLADVEMSIREMA 1221
            L ++   PGNN CADC A  P++   S  + IC  C+G+HR+++ + +V+ +      D E    L+ GN+ +  IY   +P++Y +PN    ++LR  +I AKY+ K+FS    +  Y    + G+L KR +D   + +R F LS  + +  YF      T +D         KDPK  +++D INA+F    I NP+         L I++ +    S R+I++  ++ +++VDW+ +IR    +++  Y+      A + EL   LT +    G+M KTG + TE ++KRW  L  RRL+Y   PL A  KGE+ +G +  GY    G P  +    S Q  +TIKTP R +LF  ++E D  E W+K  +++  V MS +E A
Sbjct:   11 LREILQKPGNNTCADCGAPDPEWASCSLGVFICLACSGIHRNIQEISKVKSVGLSHWEDHE----LENGNEPTKKIYEATVPVYYYIPNHKDCQVLREQWIRAKYERKEFSEAGRNLIYEEGTRDGMLMKRGRDNGQFLNRRFVLSEREGTLKYF------TKFDA--------KDPKAVIKVDTINATFKPEKIGNPNG--------LQITYLK--AYSTRNIFVYHDSSKEIVDWFNSIR----AVQLHYLKVAFPGATDAELVPKLTRNFLKEGYMEKTGPRQTEGFKKRWFTLDHRRLMYFKDPLDAFAKGEVFLGNKDHGYQIFPGLPSGTYHNGSWQHGITIKTPERCFLFTCETEED-QESWMKHFSDVMSVPMSPQEFA 364          
BLAST of ARF-GAP with dual PH domain-containing protein 1 vs. Ensembl Medaka
Match: ADAP1 (arf-GAP with dual PH domain-containing protein 1 [Source:NCBI gene;Acc:101173787])

HSP 1 Score: 174.866 bits (442), Expect = 2.766e-49
Identity = 116/386 (30.05%), Postives = 185/386 (47.93%), Query Frame = 1
Query:   73 RLIKLYSVPGNNICADCNAEKPDYLVLSYNIIICRKCAGVHRSMENV-RVRDLNFDKISDAEINEVLKFGNKKSNDIYLKYLPIFYRLPNSNGPEILRRSFIIAKYQIKQFSVKEIDRPYIVNQKLGILKKRCKDKNIYNSRFFRLSIPDISFNYFIKETDVTNYDRSQMKLKSRKDPKRNLRLDRINASFIDNPDSRARIPDEILMISFFRHEEASWRHIYLKSNTPEDLVDWYQTIRFAKFSLRAAYVVGTGDEANELELARDLTLDITMSGWMYKTGSQLTEQWQKRWCVLLGRRLLYSSGPLSASGKGEIVIGERSKGYGAVSGAPPNSRSVMSDQ--TALTIKTPGREYLFAVDSEGDVAERWIKCINNLADVEMSIREMA 1221
            R+ +L   PGN  CADC A  P++   +  +++C  C+G+HR++  + +V+ L  D  + +E+  +   GN  +   Y   +P FY  P      +L+  +I AKY+ K+F   E    Y    K G L KR +D   Y SR F LS  +    YF K                 K+PK  L++  +NA+F   PD         L I++ +  + S R++++     +++VDW+  IR A+F        G  D     EL    T +    G+M KTG + TE ++KRW  +  RRL+Y   PL A  +GE+ IG +   Y  + G P N   +  +     +TIKTP R +LFA ++E D  + W+  +  + +  M  +E A
Sbjct:   11 RIKQLLEKPGNGNCADCKAADPEWASYTLGVLVCHICSGLHRNIPQISKVKSLLLDPWNSSELEFIDSIGNNAAKAKYENIVPAFYYCPTYRDCLLLKEQWIRAKYERKEFMCVERQEAYSAGYKEGFLWKRGRDNGQYLSRKFILSEREGVLKYFTK--------------LDAKEPKATLKISSLNATF--QPDKIGTA--HGLQITYLK--DNSTRNVFVYHEDGKEIVDWFNAIRAARFHYLQVAFPGASDS----ELIPKATRNFIKEGYMEKTGPKHTEGFKKRWFSMDDRRLMYFKDPLDAFARGEVFIGSKENSYSVLPGLPAN---IQGNHWLYGITIKTPDRSFLFACETEKDQKD-WMVALQLVINRPMLPQEYA 368          
BLAST of ARF-GAP with dual PH domain-containing protein 1 vs. Ensembl Medaka
Match: adap2 (arf-GAP with dual PH domain-containing protein 2 [Source:NCBI gene;Acc:101166303])

HSP 1 Score: 153.295 bits (386), Expect = 2.511e-41
Identity = 116/402 (28.86%), Postives = 185/402 (46.02%), Query Frame = 1
Query:   76 LIKLYSVPGNNICADCNAEKPDYLVLSYNIIICRKCAGVHRSMENVRVRDLNFDKISDAEINEVLKFGNKKSNDIYLKYLPIFYRLPNSNGPEILRRSFIIAKYQIKQFS--VKEIDRPYIVNQKLGILKKRCKDKNIYNSRFFRLSIPDISFNYFIKETDVTNYDRSQMKLKSRKDPKRNLRLDRINASF----IDNPDSRARIPDEILMISFFRHEEASWRHIYLKSNTPEDLVDWYQTIRFAKFS-LRAAYVVGTGDEANELELARDLTLDITMSGWMYKTGSQLTEQWQKRWCVL--LGRRLLYSSGPLSASGKGEIVIGERSKGYGAVSGAPPNSRSVMSDQTALTIKTPGREYLFAVDSEGDVAERWIKCINNLADVEMSIREMADYQLHPKAAHK 1254
            L+ L   P N+ CADC A  PD+      + +C KC+G+HRS  + +++ +  D   D ++  +   GN  +  IY K +P +Y  P  +   +L   +I AKY+  +F+   K    PY      GIL K+ K+   +  R F LS    +  Y+ +E +              K PK  + +  +NA+F    I +P          L I++    E + R++++    PED+V WY  IR A++S L+ AY  G+     + EL   +T +    G+M KTG    EQ++KRW VL    R+L Y    L A   G I IG  S  Y   + AP ++R        + + TP R+++   + E +  E WI  +  +    MS +   DY    K  +K
Sbjct:   11 LLDLLKQPENSRCADCGAPDPDWASYRLGVFLCLKCSGIHRSF-SCQIKSIELDFWDDKQVEIMKSNGNASAKAIYEKAVPPYYYQPCQSDCNVLVEQWIRAKYERMEFTGETKYPPPPYTTGFYEGILWKKGKENTQFLKRKFVLSERGFTLTYYNREDE-------------SKGPKAVIFIKDLNATFQTEKIGHPHG--------LQITY--QTEHNTRNLFVYHENPEDIVTWYNVIRAARYSYLKTAYPTGS-----DKELVPKITRNYLKEGYMEKTGPNQKEQFKKRWFVLDSQTRKLYYFKDQLDAEELGVIFIGTESNSYSVAAFAPKSTRGNKWKH-GIMVDTPARQFVLMCEQEKEQRE-WIDALRKIQSRPMSPQ---DYTAEAKIRYK 378          
BLAST of ARF-GAP with dual PH domain-containing protein 1 vs. Ensembl Medaka
Match: ENSORLT00000004347.2 (arf-GAP with dual PH domain-containing protein 2 [Source:NCBI gene;Acc:101158081])

HSP 1 Score: 152.14 bits (383), Expect = 7.746e-41
Identity = 113/400 (28.25%), Postives = 191/400 (47.75%), Query Frame = 1
Query:   52 NLIMSQERLIKLYSVPGNNICADCNAEKPDYLVLSYNIIICRKCAGVHRSMENV-RVRDLNFDKISDAEINEVLKFGNKKSNDIYLKYLPIFYRLPNSNGPEILRRSFIIAKYQIKQFSVK--EIDRPYIVNQKLGILKKRCKDKNIYNSRFFRLSIPDISFNYFIKETDVTNYDRSQMKLKSRKDPKRNLRLDRINASF----IDNPDSRARIPDEILMISFFRHEEASWRHIYLKSNTPEDLVDWYQTIRFAKFSLRAAYVVGTGDEANELELARDLTLDITMSGWMYKTGSQLTEQWQKRWCV--LLGRRLLYSSGPLSASGKGEIVIGERSKGYGAVSGAPPNSRSVMSDQTALTIKTPGREYLFAVDSEGDVAERWIKCINNLADVEMSIREMAD 1224
            NL  + + L++L   PGNN+CADC+A +PD+   +  + +C  C+G+HR++ +V +V+ +  D    + +  + K GN ++  I+ K +P F+  P  N   +L+  +I AKY+ ++F+ +     + Y   Q    + K+ +    +  R F LS  D +  YFIKE                K PK  + +  +NA F    I +P          L IS+   E+   R++++  +  + +V ++  IR    + R AY++         +L   LT      G+M KTG    E ++KRW    L  R+LLY   PL A+ KG   IG  S GY +VS     S+     +  + +KTP REY+F  + E +  E WI+    +    M+  + A+
Sbjct:    3 NLARNNKILLELVQRPGNNVCADCSAPEPDWASYTLGVFVCLNCSGMHRNLPSVSKVKSIRLDYWDSSLVEFMQKRGNSEAKAIFEKCVPTFFYKPRQNDCIVLKDQWIRAKYERREFTGENNRFLQIYTSEQFESPMWKKGRVNKQFLKRNFLLSQRDFTLKYFIKEDS--------------KVPKAVISMKDLNADFQPEKIGHPHG--------LQISY--SEDDHTRNLFVYHDDGQTVVTFFNAIR----ATRLAYLLRKHQTLRNSDLVPQLTSKSLKEGYMEKTGPTTRESFKKRWFTLNLTNRKLLYLKSPLDATEKGFAFIGSESHGY-SVSACSGQSKRGGRWRWGIFLKTPDREYVFMCEQESEQKE-WIEAFRKIISQPMTPEDYAN 372          
BLAST of ARF-GAP with dual PH domain-containing protein 1 vs. Ensembl Medaka
Match: adap2 (arf-GAP with dual PH domain-containing protein 2 [Source:NCBI gene;Acc:101166303])

HSP 1 Score: 127.872 bits (320), Expect = 2.850e-32
Identity = 106/400 (26.50%), Postives = 172/400 (43.00%), Query Frame = 1
Query:   76 LIKLYSVPGNNICADCNAEKPDYLVLSYNIIICRKCAGVHRSMENVRVRDLNFDKISDAEINEVLKFGNKKSNDIYLKYLPIFYRLPNSNGPEILRRSFIIAKYQIKQFS--VKEIDRPYIVNQKLGILKKRCKDKNIYNSRFFRLSIPDISFNYFIKETDVTNYDRSQMKLKSRKDPKRNLRLDRINASF----IDNPDSRARIPDEILMISFFRHEEASWRHIYLKSNTPEDLVDWYQTIRFAKFS-LRAAYVVGTGDEANELELARDLTLDITMSGWMYKTGSQLTEQWQKRWCVLLGRRLLYSSGPLSASGKGEIVIGERSKGYGAVSGAPPNSRSVMSDQTALTIKTPGREYLFAVDSEGDVAERWIKCINNLADVEMSIREMADYQLHPKAAHK 1254
            L+ L   P N+ CADC A  PD+      + +C KC+G+HRS  + +++ +  D   D ++  +   GN  +  IY K +P +Y  P  +   +L   +I AKY+  +F+   K    PY      GIL K+ K+   +  R F LS    +  Y+ +E +              K PK  + +  +NA+F    I +P          L I++    E + R++++    PED+V WY  IR A++S L+ AY  G+     + EL   +T +    G+M KT                        GP  A   G I IG  S  Y   + AP ++R        + + TP R+++   + E +  E WI  +  +    MS +   DY    K  +K
Sbjct:   11 LLDLLKQPENSRCADCGAPDPDWASYRLGVFLCLKCSGIHRSF-SCQIKSIELDFWDDKQVEIMKSNGNASAKAIYEKAVPPYYYQPCQSDCNVLVEQWIRAKYERMEFTGETKYPPPPYTTGFYEGILWKKGKENTQFLKRKFVLSERGFTLTYYNREDE-------------SKGPKAVIFIKDLNATFQTEKIGHPHG--------LQITY--QTEHNTRNLFVYHENPEDIVTWYNVIRAARYSYLKTAYPTGS-----DKELVPKITRNYLKEGYMEKT------------------------GPNDAEELGVIFIGTESNSYSVAAFAPKSTRGNKWKH-GIMVDTPARQFVLMCEQEKEQRE-WIDALRKIQSRPMSPQ---DYTAEAKIRYK 352          
BLAST of ARF-GAP with dual PH domain-containing protein 1 vs. Planmine SMEST
Match: SMESG000066067.1 (SMESG000066067.1)

HSP 1 Score: 810.061 bits (2091), Expect = 0.000e+0
Identity = 393/398 (98.74%), Postives = 393/398 (98.74%), Query Frame = 1
Query:   61 MSQERLIKLYSVPGNNICADCNAEKPDYLVLSYNIIICRKCAGVHRSMENVRVRDLNFDKISDAEINEVLKFGNKKSNDIYLKYLPIFYRLPNSNGPEILRRSFIIAKYQIKQFSVKEIDRPYIVNQKLGILKKRCKDKNIYNSRFFRLSIPDISFNYFIKETDVTNYDRSQMKLKSRKDPKRNLRLDRINASFIDNPDSRARIPDEILMISFFRHEEASWRHIYLKSNTPEDLVDWYQTIRFAKFSLRAAYVVGTGDEANELELARDLTLDITMSGWMYKTGSQLTEQWQKRWCVLLGRRLLYSSGPLSASGKGEIVIGERSKGYGAVSGAPPNSRSVMSDQTALTIKTPGREYLFAVDSEGDVAERWIKCINNLADVEMSIREMADYQLHPKAAHK 1254
            MSQER IKLYSVPGNNICADCNAEKPDYLVLSYNIIICRKCAGVHRSMENVRVRDLNFDKISDAEINEVLKFGNKKSNDIYLKYLPIFYRLPNSNGPEILRRSFIIAKYQIKQFSVKEIDRPYIVNQKLGILKKRCKDKNIYNSRFFRLSIPDISFNYFIKETDVTNYDRSQMKL    DPKRNLRLDRINASFIDNPDSRARIPDEILMISFFRHEEASWRHIYLKSNTPEDLVDWYQTIRFAKFSLRAAYVVGTGDEANELELARDLTLDITMSGWMYKTGSQLTEQWQKRWCVLLGRRLLYSSGPLSASGKGEIVIGERSKGYGAVSGAPPNSRSVMSDQTALTIKTPGREYLFAVDSEGDVAERWIKCINNLADVEMSIREMADYQLHPKAAHK
Sbjct:    1 MSQERFIKLYSVPGNNICADCNAEKPDYLVLSYNIIICRKCAGVHRSMENVRVRDLNFDKISDAEINEVLKFGNKKSNDIYLKYLPIFYRLPNSNGPEILRRSFIIAKYQIKQFSVKEIDRPYIVNQKLGILKKRCKDKNIYNSRFFRLSIPDISFNYFIKETDVTNYDRSQMKL----DPKRNLRLDRINASFIDNPDSRARIPDEILMISFFRHEEASWRHIYLKSNTPEDLVDWYQTIRFAKFSLRAAYVVGTGDEANELELARDLTLDITMSGWMYKTGSQLTEQWQKRWCVLLGRRLLYSSGPLSASGKGEIVIGERSKGYGAVSGAPPNSRSVMSDQTALTIKTPGREYLFAVDSEGDVAERWIKCINNLADVEMSIREMADYQLHPKAAHK 394          
BLAST of ARF-GAP with dual PH domain-containing protein 1 vs. Planmine SMEST
Match: SMESG000066067.1 (SMESG000066067.1)

HSP 1 Score: 785.023 bits (2026), Expect = 0.000e+0
Identity = 383/398 (96.23%), Postives = 383/398 (96.23%), Query Frame = 1
Query:   61 MSQERLIKLYSVPGNNICADCNAEKPDYLVLSYNIIICRKCAGVHRSMENVRVRDLNFDKISDAEINEVLKFGNKKSNDIYLKYLPIFYRLPNSNGPEILRRSFIIAKYQIKQFSVKEIDRPYIVNQKLGILKKRCKDKNIYNSRFFRLSIPDISFNYFIKETDVTNYDRSQMKLKSRKDPKRNLRLDRINASFIDNPDSRARIPDEILMISFFRHEEASWRHIYLKSNTPEDLVDWYQTIRFAKFSLRAAYVVGTGDEANELELARDLTLDITMSGWMYKTGSQLTEQWQKRWCVLLGRRLLYSSGPLSASGKGEIVIGERSKGYGAVSGAPPNSRSVMSDQTALTIKTPGREYLFAVDSEGDVAERWIKCINNLADVEMSIREMADYQLHPKAAHK 1254
            MSQER IKLYSVPGNNICADCNAEKPDYLVLSYNIIICRKCAGVHRSMENVRVRDLNFDKISDAEINEVLKFGNKKSNDIYLKYLPIFYRLPNSNGPEILRRSFIIAKYQIKQFSVKEIDRPYIVNQKLGILKKRCKDKNIYNSRFFRLSIPDISFNYFIKETDV              DPKRNLRLDRINASFIDNPDSRARIPDEILMISFFRHEEASWRHIYLKSNTPEDLVDWYQTIRFAKFSLRAAYVVGTGDEANELELARDLTLDITMSGWMYKTGSQLTEQWQKRWCVLLGRRLLYSSGPLSASGKGEIVIGERSKGYGAVSGAPPNSRSVMSDQTALTIKTPGREYLFAVDSEGDVAERWIKCINNLADVEMSIREMADYQLHPKAAHK
Sbjct:    1 MSQERFIKLYSVPGNNICADCNAEKPDYLVLSYNIIICRKCAGVHRSMENVRVRDLNFDKISDAEINEVLKFGNKKSNDIYLKYLPIFYRLPNSNGPEILRRSFIIAKYQIKQFSVKEIDRPYIVNQKLGILKKRCKDKNIYNSRFFRLSIPDISFNYFIKETDV--------------DPKRNLRLDRINASFIDNPDSRARIPDEILMISFFRHEEASWRHIYLKSNTPEDLVDWYQTIRFAKFSLRAAYVVGTGDEANELELARDLTLDITMSGWMYKTGSQLTEQWQKRWCVLLGRRLLYSSGPLSASGKGEIVIGERSKGYGAVSGAPPNSRSVMSDQTALTIKTPGREYLFAVDSEGDVAERWIKCINNLADVEMSIREMADYQLHPKAAHK 384          
BLAST of ARF-GAP with dual PH domain-containing protein 1 vs. Planmine SMEST
Match: SMESG000066067.1 (SMESG000066067.1)

HSP 1 Score: 768.459 bits (1983), Expect = 0.000e+0
Identity = 378/398 (94.97%), Postives = 378/398 (94.97%), Query Frame = 1
Query:   61 MSQERLIKLYSVPGNNICADCNAEKPDYLVLSYNIIICRKCAGVHRSMENVRVRDLNFDKISDAEINEVLKFGNKKSNDIYLKYLPIFYRLPNSNGPEILRRSFIIAKYQIKQFSVKEIDRPYIVNQKLGILKKRCKDKNIYNSRFFRLSIPDISFNYFIKETDVTNYDRSQMKLKSRKDPKRNLRLDRINASFIDNPDSRARIPDEILMISFFRHEEASWRHIYLKSNTPEDLVDWYQTIRFAKFSLRAAYVVGTGDEANELELARDLTLDITMSGWMYKTGSQLTEQWQKRWCVLLGRRLLYSSGPLSASGKGEIVIGERSKGYGAVSGAPPNSRSVMSDQTALTIKTPGREYLFAVDSEGDVAERWIKCINNLADVEMSIREMADYQLHPKAAHK 1254
            MSQER IKLYSVPGNNICADCNAEKPDYLVLSYNIIICRKCAGVHRSMENVRVRDLNFDKISDAEINEVLKFGNKKSNDIYLKYLPIFYRLPNSNGPEILRRSFIIAKYQIKQFSVKEIDRPYIVNQKLGILKKRCKDKNIYNSRFFRLSIPDISFNYFIKETDVTNYDRSQMKL    DPKRNLRLDRINASFIDNPDSRARIPDEILMISFFRHEEASWRHIYLKSNTPEDLVDWYQTIRFAKFSLRAAYVVGTGDEANELELARDLTLDITMSGWMYKTGSQLTEQWQKRWCVLLGRRLLYSSGPLSASGKGEIVIGERSKGYGAVSGAPPNSRSVMSDQTALTIKTPGREYLFAVDSE               DVEMSIREMADYQLHPKAAHK
Sbjct:    1 MSQERFIKLYSVPGNNICADCNAEKPDYLVLSYNIIICRKCAGVHRSMENVRVRDLNFDKISDAEINEVLKFGNKKSNDIYLKYLPIFYRLPNSNGPEILRRSFIIAKYQIKQFSVKEIDRPYIVNQKLGILKKRCKDKNIYNSRFFRLSIPDISFNYFIKETDVTNYDRSQMKL----DPKRNLRLDRINASFIDNPDSRARIPDEILMISFFRHEEASWRHIYLKSNTPEDLVDWYQTIRFAKFSLRAAYVVGTGDEANELELARDLTLDITMSGWMYKTGSQLTEQWQKRWCVLLGRRLLYSSGPLSASGKGEIVIGERSKGYGAVSGAPPNSRSVMSDQTALTIKTPGREYLFAVDSE---------------DVEMSIREMADYQLHPKAAHK 379          
BLAST of ARF-GAP with dual PH domain-containing protein 1 vs. Planmine SMEST
Match: SMESG000069155.1 (SMESG000069155.1)

HSP 1 Score: 63.929 bits (154), Expect = 6.759e-11
Identity = 34/113 (30.09%), Postives = 61/113 (53.98%), Query Frame = 1
Query:   76 LIKLYSVPGNNICADCNAEKPDYLVLSYNIIICRKCAGVHRSM--ENVRVRDLNFDKISDAEINEVLKFGNKKSNDIYLKYLPIFYRLPNSNGPEILRRSFIIAKYQIKQFSV 408
            L+K+    GN  CADC  E   +   ++ I +C +CAG+HR++     +V+ ++ D  +  ++  +   GN+KS++IY   LP  +  P +N        FI +KYQ K++ +
Sbjct:   12 LLKIIEKEGNKNCADCGTEGTRWASWNFGIFLCIRCAGIHRNLGVHISKVKSVDLDSWTGEQLQVMELMGNRKSHEIYEAALPGNFTRPQTN---YAIEEFIRSKYQYKRYCI 121          
BLAST of ARF-GAP with dual PH domain-containing protein 1 vs. Planmine SMEST
Match: SMESG000069229.1 (SMESG000069229.1)

HSP 1 Score: 65.0846 bits (157), Expect = 7.485e-11
Identity = 31/85 (36.47%), Postives = 50/85 (58.82%), Query Frame = 1
Query:   52 NLIMSQERLIKLYSVPGNNICADCNAEKPDYLVLSYNIIICRKCAGVHRSMEN--VRVRDLNFDKISDAEINEVLKFGNKKSNDI 300
            N I+S + L K+YS  GN+ICADC+A+ P ++V ++ I++C +CAG HR +     +V     D +   +I  +  FGN   N +
Sbjct:  512 NEILSDDILSKIYSQYGNDICADCDAKNPKWVVFNFGILVCERCAGGHRKLSTDISKVCSSKLDGMDKVKIQMLESFGNTLVNSV 596          
The following BLAST results are available for this feature:
BLAST of ARF-GAP with dual PH domain-containing protein 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ADAP16.435e-5529.37ArfGAP with dual PH domains 1 [Source:HGNC Symbol;... [more]
ADAP16.753e-5329.37ArfGAP with dual PH domains 1 [Source:HGNC Symbol;... [more]
ADAP11.374e-4628.34ArfGAP with dual PH domains 1 [Source:HGNC Symbol;... [more]
ADAP21.820e-3828.65ArfGAP with dual PH domains 2 [Source:HGNC Symbol;... [more]
ADAP24.229e-3829.23ArfGAP with dual PH domains 2 [Source:HGNC Symbol;... [more]
back to top
BLAST of ARF-GAP with dual PH domain-containing protein 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cnt-12.731e-1535.90Arf-GAP with ANK repeat and PH domain-containing p... [more]
cnt-12.799e-1535.90Arf-GAP with ANK repeat and PH domain-containing p... [more]
cnt-15.430e-1535.90Arf-GAP with ANK repeat and PH domain-containing p... [more]
W09D10.11.734e-1028.21pep chromosome:WBcel235:III:10736919:10739786:-1 g... [more]
W09D10.11.734e-1028.21pep chromosome:WBcel235:III:10736919:10739792:-1 g... [more]
back to top
BLAST of ARF-GAP with dual PH domain-containing protein 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG82433.738e-1028.30gene:FBgn0033349 transcript:FBtr0088652[more]
CenG1A9.890e-1028.57gene:FBgn0028509 transcript:FBtr0080548[more]
CenG1A1.076e-928.57gene:FBgn0028509 transcript:FBtr0080547[more]
CenG1A1.503e-928.57gene:FBgn0028509 transcript:FBtr0080546[more]
CenB1A2.316e-828.97gene:FBgn0039056 transcript:FBtr0084369[more]
back to top
BLAST of ARF-GAP with dual PH domain-containing protein 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
zgc:923603.279e-5230.00zgc:92360 [Source:ZFIN;Acc:ZDB-GENE-040718-470][more]
adap23.350e-4426.65ArfGAP with dual PH domains 2 [Source:ZFIN;Acc:ZDB... [more]
FO704810.14.985e-1334.19arf-GAP with Rho-GAP domain, ANK repeat and PH dom... [more]
unm_sa16145.286e-1332.08un-named sa1614 [Source:ZFIN;Acc:ZDB-GENE-120411-1... [more]
asap38.895e-1232.73ArfGAP with SH3 domain, ankyrin repeat and PH doma... [more]
back to top
BLAST of ARF-GAP with dual PH domain-containing protein 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ksr15.482e-5832.49kinase suppressor of ras 1 [Source:Xenbase;Acc:XB-... [more]
ksr16.687e-5832.49kinase suppressor of ras 1 [Source:Xenbase;Acc:XB-... [more]
ksr11.195e-4931.83kinase suppressor of ras 1 [Source:Xenbase;Acc:XB-... [more]
adap1l1.690e-4730.32ArfGAP with dual PH domains 1-like [Source:NCBI ge... [more]
ksr14.747e-4632.29kinase suppressor of ras 1 [Source:Xenbase;Acc:XB-... [more]
back to top
BLAST of ARF-GAP with dual PH domain-containing protein 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Adap12.520e-5329.11ArfGAP with dual PH domains 1 [Source:MGI Symbol;A... [more]
Adap22.386e-3527.04ArfGAP with dual PH domains 2 [Source:MGI Symbol;A... [more]
Adap29.724e-1530.16ArfGAP with dual PH domains 2 [Source:MGI Symbol;A... [more]
Smap22.449e-1232.28small ArfGAP 2 [Source:MGI Symbol;Acc:MGI:1917030][more]
Asap32.470e-1129.17ArfGAP with SH3 domain, ankyrin repeat and PH doma... [more]
back to top
BLAST of ARF-GAP with dual PH domain-containing protein 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O75689|ADAP1_HUMAN3.090e-5429.37Arf-GAP with dual PH domain-containing protein 1 O... [more]
sp|Q9NPF8|ADAP2_HUMAN8.739e-3828.65Arf-GAP with dual PH domain-containing protein 2 O... [more]
sp|Q9JK15|ADAP2_RAT5.493e-3526.67Arf-GAP with dual PH domain-containing protein 2 O... [more]
sp|Q8R2V5|ADAP2_MOUSE1.669e-3427.04Arf-GAP with dual PH domain-containing protein 2 O... [more]
sp|Q9XXH8|CNT1_CAEEL6.907e-1435.90Arf-GAP with ANK repeat and PH domain-containing p... [more]
back to top
BLAST of ARF-GAP with dual PH domain-containing protein 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
E2C8N77.411e-6333.42Centaurin-alpha-1 OS=Harpegnathos saltator OX=6103... [more]
K7IQS01.118e-6134.90Uncharacterized protein OS=Nasonia vitripennis OX=... [more]
A0A232FKG33.022e-6134.81Uncharacterized protein OS=Trichomalopsis sarcopha... [more]
A0A088A3I46.718e-6132.90Uncharacterized protein OS=Apis mellifera OX=7460 ... [more]
A0A2A3E3E31.103e-6032.90Arf-GAP with dual PH domain-containing protein OS=... [more]
back to top
BLAST of ARF-GAP with dual PH domain-containing protein 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000020635.22.235e-5831.27arf-GAP with dual PH domain-containing protein 1 [... [more]
adap29.949e-4028.27arf-GAP with dual PH domain-containing protein 2 [... [more]
ADAP14.082e-3931.03ArfGAP with dual PH domains 1 [Source:HGNC Symbol;... [more]
ENSAMXT00000000841.21.405e-1235.11arf-GAP with Rho-GAP domain, ANK repeat and PH dom... [more]
asap1b1.739e-1232.41ArfGAP with SH3 domain, ankyrin repeat and PH doma... [more]
back to top
BLAST of ARF-GAP with dual PH domain-containing protein 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000009789.14.374e-4329.32pep scaffold:Pmarinus_7.0:GL477354:7942:22234:1 ge... [more]
ENSPMAT00000000824.12.289e-3828.19pep scaffold:Pmarinus_7.0:GL477349:152854:172297:-... [more]
ENSPMAT00000007633.14.584e-1331.53pep scaffold:Pmarinus_7.0:GL488501:137984:146551:-... [more]
smap13.651e-1231.40small ArfGAP 1 [Source:ZFIN;Acc:ZDB-GENE-060920-2][more]
ENSPMAT00000009914.11.344e-934.21pep scaffold:Pmarinus_7.0:GL476634:533628:626389:1... [more]
back to top
BLAST of ARF-GAP with dual PH domain-containing protein 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
AGE21.162e-732.53ADP-ribosylation factor (ARF) GTPase activating pr... [more]
GCS11.342e-732.43ADP-ribosylation factor GTPase activating protein ... [more]
GLO33.309e-725.50ADP-ribosylation factor GTPase activating protein ... [more]
AGE12.350e-632.71ADP-ribosylation factor (ARF) GTPase activating pr... [more]
SPS187.859e-627.85Protein of unknown function, contains a putative z... [more]
back to top
BLAST of ARF-GAP with dual PH domain-containing protein 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO479197.386e-6233.16Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO341789.906e-1434.17Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO330911.244e-1227.73Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO430072.395e-1235.78Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO378096.130e-1030.19Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of ARF-GAP with dual PH domain-containing protein 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000032796.11.336e-5932.82arf-GAP with dual PH domain-containing protein 1 [... [more]
ADAP12.766e-4930.05arf-GAP with dual PH domain-containing protein 1 [... [more]
adap22.511e-4128.86arf-GAP with dual PH domain-containing protein 2 [... [more]
ENSORLT00000004347.27.746e-4128.25arf-GAP with dual PH domain-containing protein 2 [... [more]
adap22.850e-3226.50arf-GAP with dual PH domain-containing protein 2 [... [more]
back to top
BLAST of ARF-GAP with dual PH domain-containing protein 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000066067.10.000e+098.74SMESG000066067.1[more]
SMESG000066067.10.000e+096.23SMESG000066067.1[more]
SMESG000066067.10.000e+094.97SMESG000066067.1[more]
SMESG000069155.16.759e-1130.09SMESG000069155.1[more]
SMESG000069229.17.485e-1136.47SMESG000069229.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30009149 ID=SMED30009149|Name=ARF-GAP with dual PH domain-containing protein 1|organism=Schmidtea mediterranea sexual|type=transcript|length=1581bp
TCTACAATTTACTTTATATTGAAAACTATATTTGAATTATCAAATTTGTA
AAATCTAATAATGAGTCAAGAGAGATTGATTAAACTTTACAGTGTACCTG
GTAATAACATATGTGCTGACTGTAATGCAGAGAAACCAGATTATTTAGTT
TTAAGTTACAATATTATTATTTGTCGGAAATGTGCTGGAGTACATAGATC
AATGGAAAATGTTAGAGTAAGGGACTTGAACTTCGATAAAATTTCTGATG
CCGAAATTAATGAAGTCTTGAAGTTTGGAAATAAAAAATCAAACGATATT
TATTTAAAATATTTGCCTATATTTTATCGATTACCCAATTCCAATGGGCC
AGAAATTCTTCGACGTTCTTTTATAATAGCCAAATATCAAATAAAGCAAT
TTTCTGTCAAGGAAATTGATCGGCCATATATTGTAAATCAAAAATTAGGA
ATTCTAAAAAAGCGATGCAAAGATAAAAATATATACAATTCAAGATTTTT
TAGATTAAGCATTCCAGATATTTCTTTTAACTATTTCATAAAGGAAACAG
ATGTAACAAATTATGATCGTTCTCAAATGAAATTAAAGTCTCGGAAAGAT
CCTAAGCGAAATTTAAGACTTGATAGAATTAATGCGTCTTTTATTGATAA
TCCGGATTCTCGTGCAAGAATACCTGATGAAATATTAATGATATCGTTTT
TTCGACACGAAGAAGCCAGTTGGAGACACATTTACTTAAAATCTAACACG
CCAGAAGATTTGGTCGATTGGTATCAAACTATTAGATTTGCGAAGTTTTC
TCTACGAGCTGCGTATGTTGTTGGGACTGGCGACGAGGCCAATGAATTAG
AACTTGCACGAGATCTTACATTGGATATTACAATGAGTGGTTGGATGTAT
AAAACTGGATCTCAATTAACGGAACAGTGGCAGAAGCGATGGTGTGTTCT
TTTAGGCCGTCGATTATTGTATTCTTCTGGGCCACTGTCTGCTAGTGGAA
AGGGAGAAATTGTAATTGGGGAGCGATCTAAAGGATATGGAGCAGTATCG
GGTGCTCCTCCTAACTCAAGAAGTGTAATGTCGGACCAGACAGCATTAAC
GATTAAAACACCCGGTCGAGAATATCTGTTCGCAGTAGATAGTGAAGGTG
ATGTAGCAGAAAGGTGGATAAAATGTATTAACAATTTGGCAGATGTTGAA
ATGTCGATTCGGGAAATGGCGGATTATCAGTTGCACCCGAAGGCGGCCCA
TAAATGACATTAGTAGATTGAAGAAATAAGTTTACGAAATGTTTTGTTTT
TTATTGATATATATCATGTAATTTCTTTCAATCAATGTATATGACAATGT
GATTTTTAAATTTATTCAATTTTTTTAAAAAATTGAAATAAGTTGAATTA
TTGATTTTTTAAATTTTATTATTCTTCCCATTAAAACTTGTTGAAACTTG
CTGCGTACAACTGATATTTTCGGGTTGTTTTTCACGGATTTTATGCATGA
TGTTCGAGTTGAGTAATTTTTCATAAAATAATCAATAATATTTTTAAATA
TTTTGTTTAAATATAGTGCTGTATTAAAAAA
back to top

protein sequence of SMED30009149-orf-1

>SMED30009149-orf-1 ID=SMED30009149-orf-1|Name=SMED30009149-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=399bp
MSQERLIKLYSVPGNNICADCNAEKPDYLVLSYNIIICRKCAGVHRSMEN
VRVRDLNFDKISDAEINEVLKFGNKKSNDIYLKYLPIFYRLPNSNGPEIL
RRSFIIAKYQIKQFSVKEIDRPYIVNQKLGILKKRCKDKNIYNSRFFRLS
IPDISFNYFIKETDVTNYDRSQMKLKSRKDPKRNLRLDRINASFIDNPDS
RARIPDEILMISFFRHEEASWRHIYLKSNTPEDLVDWYQTIRFAKFSLRA
AYVVGTGDEANELELARDLTLDITMSGWMYKTGSQLTEQWQKRWCVLLGR
RLLYSSGPLSASGKGEIVIGERSKGYGAVSGAPPNSRSVMSDQTALTIKT
PGREYLFAVDSEGDVAERWIKCINNLADVEMSIREMADYQLHPKAAHK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0046872metal ion binding
GO:1902936phosphatidylinositol bisphosphate binding
GO:0005096GTPase activator activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000101muscle cell
PLANA:0002032epidermal cell
PLANA:0003001lateral region of the whole animal
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR001164ArfGAP_dom
IPR001849PH_domain
IPR011993PH-like_dom_sf
Vocabulary: biological process
TermDefinition
GO:0043547positive regulation of GTPase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001849Pleckstrin homology domainSMARTSM00233PH_updatecoord: 64..171
e-value: 5.8E-9
score: 45.8
IPR001849Pleckstrin homology domainPFAMPF00169PHcoord: 65..167
e-value: 9.2E-10
score: 39.0
IPR001849Pleckstrin homology domainPROSITEPS50003PH_DOMAINcoord: 63..169
score: 11.031
IPR011993PH-like domain superfamilyGENE3DG3DSA:2.30.29.30coord: 51..178
e-value: 1.6E-23
score: 84.7
NoneNo IPR availablePANTHERPTHR46021FAMILY NOT NAMEDcoord: 8..177
NoneNo IPR availableSUPERFAMILYSSF50729PH domain-likecoord: 60..168