slc20a-2

Overview
Nameslc20a-2 (AKN21545.1)
Smed IDSMED30009145
Length (bp)1675
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of slc20a-2 (SMED30009145) t-SNE clustered cells

Violin plots show distribution of expression levels for slc20a-2 (SMED30009145) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of slc20a-2 (SMED30009145) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for slc20a-2 (SMED30009145) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30009145

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
proximal tubuleSMED30009145SMESG000029269.1 Smed-slc20a-2smed_ncbi_20200123PMID:21828097
Rink et al., 2011
whole organism asexual adult fluorescence in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of slc20a-2 vs. Ensembl Human
Match: SLC20A1 (solute carrier family 20 member 1 [Source:HGNC Symbol;Acc:HGNC:10946])

HSP 1 Score: 233.417 bits (594), Expect = 9.281e-68
Identity = 113/178 (63.48%), Postives = 142/178 (79.78%), Query Frame = 1
Query: 1114 TVEKTVIKDKPELVTIFSWVQVLTAIFGSFAHGGNDVSNAIGPLVGLWIIAITQDVYSTEAVPIWVLVYGGLGITVGLWVWGRRVMKTIGDDLTTITPTSGVSIELGAAVTVLIASNIGIPISTTHCKVGSIVAVGRYRSNDNVDWSIFRNICFAWLVTVPVSAGISALTMFLLRMLI 1647
            ++E+   +DKPE+  +F ++Q+LTA FGSFAHGGNDVSNAIGPLV L+++  T DV S  A PIW+L+YGG+GI VGLWVWGRRV++T+G DLT ITP+SG SIEL +A+TV+IASNIG+PISTTHCKVGS+V+VG  RS   VDW +FRNI  AW VTVP+S  ISA  M + R +I
Sbjct:  499 SLEEWYDQDKPEVSLLFQFLQILTACFGSFAHGGNDVSNAIGPLVALYLVYDTGDVSSKVATPIWLLLYGGVGICVGLWVWGRRVIQTMGKDLTPITPSSGFSIELASALTVVIASNIGLPISTTHCKVGSVVSVGWLRSKKAVDWRLFRNIFMAWFVTVPISGVISAAIMAIFRYVI 676          

HSP 2 Score: 143.665 bits (361), Expect = 1.620e-54
Identity = 89/211 (42.18%), Postives = 127/211 (60.19%), Query Frame = 1
Query:  259 GAKVSDTIRKGVISPDALAAQNLTNLPQVMMIGQLSSLSGRSLFICCMKFNFYLGGCLWLLVATFLKLPVSGSHSIVGAMVGFALIIQGPAGIAWKKLGMIVASWFVSPLLSGLVSAFVFFIFDKFILKKSESREPALNFLPFIYAITIFINFFSIFLTGPTLLKFDKIPLYGNFXXXXXXXXXXXXXXRFALVPYLRKII---LKSEPIE 882
            GAKVS+TIRKG+I       +   +   ++M G +S++                G  +W LVA+FLKLP+SG+H IVGA +GF+L+ +G  G+ W +L  IV SWFVSPLLSG++S  +FF+   FIL K++     L  LP  YA T+ IN FSI  TG  LL FDK+PL+G  +IS+G +V   ++V F + P +++ I   +K  P E
Sbjct:   78 GAKVSETIRKGLID-----VEMYNSTQGLLMAGSVSAM---------------FGSAVWQLVASFLKLPISGTHCIVGATIGFSLVAKGQEGVKWSELIKIVMSWFVSPLLSGIMSGILFFLVRAFILHKADPVPNGLRALPVFYACTVGINLFSIMYTGAPLLGFDKLPLWGTILISVGCAVFCALIVWFFVCPRMKRKIEREIKCSPSE 268          

HSP 3 Score: 90.5077 bits (223), Expect = 1.620e-54
Identity = 40/59 (67.80%), Postives = 55/59 (93.22%), Query Frame = 3
Query:   39 DQIWIVVVGFLIAFILAFGIGANDVANSFGTSVGSKVISLRKACILASIFEVLGSILLG 215
            D +W++++GF+IAF+LAF +GANDVANSFGT+VGS V++L++ACILASIFE +GS+LLG
Sbjct:   20 DYLWMLILGFIIAFVLAFSVGANDVANSFGTAVGSGVVTLKQACILASIFETVGSVLLG 78          

HSP 4 Score: 58.5362 bits (140), Expect = 2.635e-8
Identity = 48/160 (30.00%), Postives = 75/160 (46.88%), Query Frame = 1
Query: 1198 SFAHGGNDVSNAIGPLVGLWIIAITQDVYSTEAVPIWVLVYGGLGITVGLWVWGRRVMKTIGD---DLTTITPTSG------VSIELGAAVTVLIASNIGIPISTTHCKVGSIVAVGRY-RSNDNVDWSIFRNICFAWLVTVPVSAGISALTMFLLRMLI 1647
            +F+ G NDV+N+ G  VG  ++ + Q             +   +  TVG  + G +V +TI     D+     T G      VS   G+AV  L+AS + +PIS THC VG+ +      +  + V WS    I  +W V+  +S  +S +  FL+R  I
Sbjct:   36 AFSVGANDVANSFGTAVGSGVVTLKQ-----------ACILASIFETVGSVLLGAKVSETIRKGLIDVEMYNSTQGLLMAGSVSAMFGSAVWQLVASFLKLPISGTHCIVGATIGFSLVAKGQEGVKWSELIKIVMSWFVSPLLSGIMSGILFFLVRAFI 184          
BLAST of slc20a-2 vs. Ensembl Human
Match: SLC20A2 (solute carrier family 20 member 2 [Source:HGNC Symbol;Acc:HGNC:10947])

HSP 1 Score: 213.001 bits (541), Expect = 2.154e-60
Identity = 104/159 (65.41%), Postives = 123/159 (77.36%), Query Frame = 1
Query: 1159 IFSWVQVLTAIFGSFAHGGNDVSNAIGPLVGLWIIAITQDVYSTEAVPIWVLVYGGLGITVGLWVWGRRVMKTIGDDLTTITPTSGVSIELGAAVTVLIASNIGIPISTTHCKVGSIVAVGRYRSNDNVDWSIFRNICFAWLVTVPVSAGISALTMFLL 1635
            +F ++QVLTA FGSFAHGGNDVSNAIGPLV LW+I     V    A P+W+L YGG+GI  GLWVWGRRV++T+G DLT ITP+SG +IEL +A TV+IASNIG+P+STTHCKVGS+VAVG  RS   VDW +FRNI  AW VTVPV+   SA  M LL
Sbjct:  486 LFHFLQVLTACFGSFAHGGNDVSNAIGPLVALWLIYKQGGVTQEAATPVWLLFYGGVGICTGLWVWGRRVIQTMGKDLTPITPSSGFTIELASAFTVVIASNIGLPVSTTHCKVGSVVAVGWIRSRKAVDWRLFRNIFVAWFVTVPVAGLFSAAVMALL 644          

HSP 2 Score: 122.094 bits (305), Expect = 2.126e-48
Identity = 71/165 (43.03%), Postives = 98/165 (59.39%), Query Frame = 1
Query:  259 GAKVSDTIRKGVISPDALAAQNLTNLP-QVMMIGQLSSLSGRSLFICCMKFNFYLGGCLWLLVATFLKLPVSGSHSIVGAMVGFALIIQGPAGIAWKKLGMIVASWFVSPLLSGLVSAFVFFIFDKFILKKSESREPALNFLPFIYAITIFINFFSIFLTGPTLL 750
            GAKV +TIRKG+I        NL N   + +M G++S++               +G  +W L+A+FL+LP+SG+H IVG+ +GF+L+  G  G+ W +L  IVASWF+SPLLSG +S  +F +   FILKK +     L  LP  YA TI IN FSI  TG  +L
Sbjct:   63 GAKVGETIRKGIID------VNLYNETVETLMAGEVSAM---------------VGSAVWQLIASFLRLPISGTHCIVGSTIGFSLVAIGTKGVQWMELVKIVASWFISPLLSGFMSGLLFVLIRIFILKKEDPVPNGLRALPVFYAATIAINVFSIMYTGAPVL 206          

HSP 3 Score: 91.6633 bits (226), Expect = 2.126e-48
Identity = 42/59 (71.19%), Postives = 54/59 (91.53%), Query Frame = 3
Query:   39 DQIWIVVVGFLIAFILAFGIGANDVANSFGTSVGSKVISLRKACILASIFEVLGSILLG 215
            + +W+V++GF+IAFILAF +GANDVANSFGT+VGS V++LR+ACILASIFE  GS+LLG
Sbjct:    5 EYLWMVILGFIIAFILAFSVGANDVANSFGTAVGSGVVTLRQACILASIFETTGSVLLG 63          
BLAST of slc20a-2 vs. Ensembl Human
Match: SLC20A2 (solute carrier family 20 member 2 [Source:HGNC Symbol;Acc:HGNC:10947])

HSP 1 Score: 213.001 bits (541), Expect = 2.154e-60
Identity = 104/159 (65.41%), Postives = 123/159 (77.36%), Query Frame = 1
Query: 1159 IFSWVQVLTAIFGSFAHGGNDVSNAIGPLVGLWIIAITQDVYSTEAVPIWVLVYGGLGITVGLWVWGRRVMKTIGDDLTTITPTSGVSIELGAAVTVLIASNIGIPISTTHCKVGSIVAVGRYRSNDNVDWSIFRNICFAWLVTVPVSAGISALTMFLL 1635
            +F ++QVLTA FGSFAHGGNDVSNAIGPLV LW+I     V    A P+W+L YGG+GI  GLWVWGRRV++T+G DLT ITP+SG +IEL +A TV+IASNIG+P+STTHCKVGS+VAVG  RS   VDW +FRNI  AW VTVPV+   SA  M LL
Sbjct:  486 LFHFLQVLTACFGSFAHGGNDVSNAIGPLVALWLIYKQGGVTQEAATPVWLLFYGGVGICTGLWVWGRRVIQTMGKDLTPITPSSGFTIELASAFTVVIASNIGLPVSTTHCKVGSVVAVGWIRSRKAVDWRLFRNIFVAWFVTVPVAGLFSAAVMALL 644          

HSP 2 Score: 122.094 bits (305), Expect = 2.126e-48
Identity = 71/165 (43.03%), Postives = 98/165 (59.39%), Query Frame = 1
Query:  259 GAKVSDTIRKGVISPDALAAQNLTNLP-QVMMIGQLSSLSGRSLFICCMKFNFYLGGCLWLLVATFLKLPVSGSHSIVGAMVGFALIIQGPAGIAWKKLGMIVASWFVSPLLSGLVSAFVFFIFDKFILKKSESREPALNFLPFIYAITIFINFFSIFLTGPTLL 750
            GAKV +TIRKG+I        NL N   + +M G++S++               +G  +W L+A+FL+LP+SG+H IVG+ +GF+L+  G  G+ W +L  IVASWF+SPLLSG +S  +F +   FILKK +     L  LP  YA TI IN FSI  TG  +L
Sbjct:   63 GAKVGETIRKGIID------VNLYNETVETLMAGEVSAM---------------VGSAVWQLIASFLRLPISGTHCIVGSTIGFSLVAIGTKGVQWMELVKIVASWFISPLLSGFMSGLLFVLIRIFILKKEDPVPNGLRALPVFYAATIAINVFSIMYTGAPVL 206          

HSP 3 Score: 91.6633 bits (226), Expect = 2.126e-48
Identity = 42/59 (71.19%), Postives = 54/59 (91.53%), Query Frame = 3
Query:   39 DQIWIVVVGFLIAFILAFGIGANDVANSFGTSVGSKVISLRKACILASIFEVLGSILLG 215
            + +W+V++GF+IAFILAF +GANDVANSFGT+VGS V++LR+ACILASIFE  GS+LLG
Sbjct:    5 EYLWMVILGFIIAFILAFSVGANDVANSFGTAVGSGVVTLRQACILASIFETTGSVLLG 63          
BLAST of slc20a-2 vs. Ensembl Human
Match: SLC20A2 (solute carrier family 20 member 2 [Source:HGNC Symbol;Acc:HGNC:10947])

HSP 1 Score: 213.001 bits (541), Expect = 2.154e-60
Identity = 104/159 (65.41%), Postives = 123/159 (77.36%), Query Frame = 1
Query: 1159 IFSWVQVLTAIFGSFAHGGNDVSNAIGPLVGLWIIAITQDVYSTEAVPIWVLVYGGLGITVGLWVWGRRVMKTIGDDLTTITPTSGVSIELGAAVTVLIASNIGIPISTTHCKVGSIVAVGRYRSNDNVDWSIFRNICFAWLVTVPVSAGISALTMFLL 1635
            +F ++QVLTA FGSFAHGGNDVSNAIGPLV LW+I     V    A P+W+L YGG+GI  GLWVWGRRV++T+G DLT ITP+SG +IEL +A TV+IASNIG+P+STTHCKVGS+VAVG  RS   VDW +FRNI  AW VTVPV+   SA  M LL
Sbjct:  486 LFHFLQVLTACFGSFAHGGNDVSNAIGPLVALWLIYKQGGVTQEAATPVWLLFYGGVGICTGLWVWGRRVIQTMGKDLTPITPSSGFTIELASAFTVVIASNIGLPVSTTHCKVGSVVAVGWIRSRKAVDWRLFRNIFVAWFVTVPVAGLFSAAVMALL 644          

HSP 2 Score: 122.094 bits (305), Expect = 2.126e-48
Identity = 71/165 (43.03%), Postives = 98/165 (59.39%), Query Frame = 1
Query:  259 GAKVSDTIRKGVISPDALAAQNLTNLP-QVMMIGQLSSLSGRSLFICCMKFNFYLGGCLWLLVATFLKLPVSGSHSIVGAMVGFALIIQGPAGIAWKKLGMIVASWFVSPLLSGLVSAFVFFIFDKFILKKSESREPALNFLPFIYAITIFINFFSIFLTGPTLL 750
            GAKV +TIRKG+I        NL N   + +M G++S++               +G  +W L+A+FL+LP+SG+H IVG+ +GF+L+  G  G+ W +L  IVASWF+SPLLSG +S  +F +   FILKK +     L  LP  YA TI IN FSI  TG  +L
Sbjct:   63 GAKVGETIRKGIID------VNLYNETVETLMAGEVSAM---------------VGSAVWQLIASFLRLPISGTHCIVGSTIGFSLVAIGTKGVQWMELVKIVASWFISPLLSGFMSGLLFVLIRIFILKKEDPVPNGLRALPVFYAATIAINVFSIMYTGAPVL 206          

HSP 3 Score: 91.6633 bits (226), Expect = 2.126e-48
Identity = 42/59 (71.19%), Postives = 54/59 (91.53%), Query Frame = 3
Query:   39 DQIWIVVVGFLIAFILAFGIGANDVANSFGTSVGSKVISLRKACILASIFEVLGSILLG 215
            + +W+V++GF+IAFILAF +GANDVANSFGT+VGS V++LR+ACILASIFE  GS+LLG
Sbjct:    5 EYLWMVILGFIIAFILAFSVGANDVANSFGTAVGSGVVTLRQACILASIFETTGSVLLG 63          
BLAST of slc20a-2 vs. Ensembl Human
Match: SLC20A2 (solute carrier family 20 member 2 [Source:HGNC Symbol;Acc:HGNC:10947])

HSP 1 Score: 91.6633 bits (226), Expect = 3.678e-22
Identity = 42/60 (70.00%), Postives = 54/60 (90.00%), Query Frame = 3
Query:   36 PDQIWIVVVGFLIAFILAFGIGANDVANSFGTSVGSKVISLRKACILASIFEVLGSILLG 215
             + +W+V++GF+IAFILAF +GANDVANSFGT+VGS V++LR+ACILASIFE  GS+LLG
Sbjct:    4 DEYLWMVILGFIIAFILAFSVGANDVANSFGTAVGSGVVTLRQACILASIFETTGSVLLG 63          
BLAST of slc20a-2 vs. Ensembl Celegans
Match: pitr-2 (Phosphate transporter [Source:UniProtKB/TrEMBL;Acc:Q17454])

HSP 1 Score: 251.906 bits (642), Expect = 5.956e-77
Identity = 174/487 (35.73%), Postives = 267/487 (54.83%), Query Frame = 1
Query:  202 QSYWVGSIYFNYYLFELYKGAKVSDTIRKGVISPDALAAQNLTNLPQVMMIGQLSSLSGRSLFICCMKFNFYLGGCL-WLLVATFLKLPVSGSHSIVGAMVGFALIIQGPAGIAWKKLGMIVASWFVSPLLSGLVSAFVFFIFDKFILKKSESREPALNFLPFIYAITIFINFFSIFLTGPTLLKFDKIPLYGNFXXXXXXXXXXXXXXRFALVPYLRKIILKSEPIEGXXXXXXXXXXXXXXXXLDINIDEDTQTNKLNXXXXXXXXXXXXXXXXXXXXXXXXXXMCEVSLEDIKENST---EVECKTV----EKTVIKDKPELVTIFSWVQVLTAIFGSFAHGGNDVSNAIGPLVGLWIIAITQDVYSTEAVPIWVLVYGGLGITVGLWVWGRRVMKTIGDDLTTITPTSGVSIELGAAVTVLIASNIGIPISTTHCKVGSIVAVGRYRSNDNVDWSIFRNICFAWLVTVPVSAGISALTMFLLR 1638
            Q+Y + SI+    L  +  G  V+DT+RKGV+     A       P+ +++GQ++                 LGGC  WLL+AT L +PVS +HS+VGA +GF+++++G  GI W  +  IV SWF+SP+LSG++S+ ++ I D  +L+  +  +  L  LP  Y + +  N   +F  G  LL F++IP +G   I IG+  +   +  F L P ++  I K   ++      +           D+    D++  K                            + E  L+++++  T   ++    V    ++T + D   +  +FS +QV TA F  FAHG NDVSNAI PL  +  I  T+ V  TE+VPI+VL+YG   I VGLW++G  V+KT+G +++ I P SG +IE GAA+T L+AS +G+P+STTHC VGS+VAVG  RS + V WSIFR+I  +W+VT+PVS  ISA  MF+++
Sbjct:   67 QAYILASIF--EALGSILVGWSVADTMRKGVVDTSQYADD-----PKELLLGQVA----------------ILGGCAAWLLIATVLHMPVSTTHSLVGATIGFSIVLRGLEGIQWMTIVRIVCSWFLSPILSGIISSIIYMIVDHTVLRTGDPLKNGLRALPVFYFVCMAFNALVVFWDGSKLLHFNEIPAWGIAAIVIGVGCVAAALAHFVLKPRIKSNI-KGSKVQSTPSRFS-----------DVESANDSEKLK---------------------------GLPEQKLQNVQQRKTPSGKIRKFYVWLLPDRTRV-DGRNITKLFSTIQVFTACFAGFAHGANDVSNAIAPLAAIISIYRTKSVEQTESVPIYVLLYGVFAICVGLWLFGHYVIKTVGTNMSEINPASGFTIEFGAAMTSLLASKVGLPLSTTHCLVGSVVAVGMIRSENGVKWSIFRDIAISWVVTLPVSGLISAGIMFVIK 490          

HSP 2 Score: 72.4034 bits (176), Expect = 2.716e-13
Identity = 35/57 (61.40%), Postives = 49/57 (85.96%), Query Frame = 3
Query:   45 IWIVVVGFLIAFILAFGIGANDVANSFGTSVGSKVISLRKACILASIFEVLGSILLG 215
            +W ++VG ++AF+L  G+GANDV+N+FGTSVGS V+++ +A ILASIFE LGSIL+G
Sbjct:   28 LWALIVGIILAFLLGNGMGANDVSNAFGTSVGSGVLTMVQAYILASIFEALGSILVG 84          
BLAST of slc20a-2 vs. Ensembl Celegans
Match: pitr-5 (Phosphate transporter [Source:UniProtKB/TrEMBL;Acc:O17404])

HSP 1 Score: 248.054 bits (632), Expect = 2.222e-75
Identity = 179/488 (36.68%), Postives = 257/488 (52.66%), Query Frame = 1
Query:  202 QSYWVGSIYFNYYLFELYKGAKVSDTIRKGVISPDALAAQNLTNLPQVMMIGQLSSLSGRSLFICCMKFNFYLGGCLWLLVATFLKLPVSGSHSIVGAMVGFALIIQGPAGIAWKKLGMIVASWFVSPLLSGLVSAFVFFIFDKFILKKSESREPALNFLPFIYAITIFINFFSIFLTGPTLLKFDKIPLYGNFXXXXXXXXXXXXXXRFALVPYLRKIILKSEPIEGXXXXXXXXXXXXXXXXLDINI-DEDTQTNKLNXXXXXXXXXXXXXXXXXXXXXXXXXXMCEVSLEDIKENSTEVECKTVEKTVIKDKPEL-----VTIFSWVQVLTAIFGSFAHGGNDVSNAIGPLVGLWIIAITQDVYSTEAVPIWVLVYGGLGITVGLWVWGRRVMKTIGDDLTTITPTSGVSIELGAAVTVLIASNIGIPISTTHCKVGSIVAVGRYRSNDNVDWSIFRNICFAWLVTVPVSAGISALTMFLLRMLI 1647
            Q+Y + +I+    L  +  G  V DT+R+GV+    +A  N  N     M+GQ++ L G +                WLL+AT L+LPVS +H++VGA +GF++  +G  GI W K+  IVASWF+SP+ +G VS  ++   D  IL+ S      L +LP  Y   +  N F I   G  +L    +PL+   ++S+G  +I   V  F + P +RK I K +        S V SV    E   + I  E T TN  NS                          C+ SL+    +  + + +   K +  DK  +     + +F+ VQVLTA F  FAHG NDV NAI PLV L  +    DVY  +  PI VL+YG   I VGLW  G +V++T+G +++ + P SG  IE GAAVT L+AS +G+PISTTHC VG++VAVG  +     DWS+FRN+ F+W+VT+PV+   +AL M+LL   I
Sbjct:   66 QAYCLATIFET--LGAVLVGYNVIDTMRRGVVD---VAVYN--NSAGDFMVGQVAVLGGTAT---------------WLLIATCLQLPVSTTHAVVGATLGFSIACKGFQGIQWMKVVNIVASWFISPIFAGTVSLILYLFVDHVILRTSNPVANGLMWLPIFYFACLTFNMFMISYQGSKVLHLSNVPLWAAIVVSLGAGIIAAAVCYFLVNPRIRKYIAKGKEARESPTSSVVISVTGDPELDKVAIRSESTTTNASNS--------------------------CD-SLQTPSPSEPQGKIRKFFKWLFPDKSRVESEDTLRMFTSVQVLTACFAGFAHGANDVCNAIAPLVALIAVYRDFDVYQKKETPITVLLYGVFAICVGLWCLGHKVIRTVGTNMSEVNPASGFCIEFGAAVTALLASKMGLPISTTHCLVGAVVAVGSVKGGKETDWSLFRNVAFSWVVTLPVAGLFAALYMWLLHFTI 504          

HSP 2 Score: 73.9442 bits (180), Expect = 9.993e-14
Identity = 34/57 (59.65%), Postives = 48/57 (84.21%), Query Frame = 3
Query:   45 IWIVVVGFLIAFILAFGIGANDVANSFGTSVGSKVISLRKACILASIFEVLGSILLG 215
            +W ++VG  +AF+L FG+GANDVAN+FGTSVGSK ++L +A  LA+IFE LG++L+G
Sbjct:   27 LWALIVGICLAFLLGFGMGANDVANAFGTSVGSKALTLFQAYCLATIFETLGAVLVG 83          
BLAST of slc20a-2 vs. Ensembl Celegans
Match: pitr-1 (Phosphate transporter [Source:UniProtKB/TrEMBL;Acc:Q18697])

HSP 1 Score: 186.808 bits (473), Expect = 8.235e-53
Identity = 89/174 (51.15%), Postives = 123/174 (70.69%), Query Frame = 1
Query: 1123 KTVIKDKPELVTIFSWVQVLTAIFGSFAHGGNDVSNAIGPLVGLWIIAITQDVYSTEAVPIWVLVYGGLGITVGLWVWGRRVMKTIGDDLTTITPTSGVSIELGAAVTVLIASNIGIPISTTHCKVGSIVAVGRYRSNDNVDWSIFRNICFAWLVTVPVSAGISALTMFLLRML 1644
            ++   + P+   +FS +QV+TA FG FAHGGNDVSNAI PLV L++IA      +    P ++L+YG  G+ +GLWV G RV+ T+G++LT ITP SG ++E GAAVTVLIAS +G+PIS+T CKVGS+VAVG  +S   V W +FRNI  +W+VT+PV+  +S  TM +L + 
Sbjct:  272 RSCKPEDPQASRLFSLLQVMTACFGGFAHGGNDVSNAIAPLVSLYLIANDGMKSADMETPWYLLLYGSFGMCLGLWVLGHRVIYTVGENLTKITPASGFAVEFGAAVTVLIASKLGLPISSTQCKVGSVVAVGLVQSRHQVHWGVFRNISLSWIVTLPVAGLLSGGTMMILHLF 445          

HSP 2 Score: 119.013 bits (297), Expect = 1.270e-28
Identity = 75/209 (35.89%), Postives = 110/209 (52.63%), Query Frame = 1
Query:  280 IRKGVISPDALAAQ-------NLTNLPQVMMIGQLSSLSGRSLFICCMKFNFYLGGC-LWLLVATFLKLPVSGSHSIVGAMVGFALIIQGPAGIAWKKLGMIVASWFVSPLLSGLVSAFVFFIFDKFILKKSESREPALNFLPFIYAITIFINFFSIFLTGPTLLKFDKIPLYGNFXXXXXXXXXXXXXXRFALVPYLRKIILKSEPIE 882
            +RKGVI               +  +L   +M+GQ++ L+G                C +W+L+AT  KLPVS +HSIVGA +GFAL+ QG   I W+K+  I  SW +SPLLSG+VS F++   D  +L++ +     +  LP +Y I    N F+I   GP+ L FD++ L    IIS    +   ++  F L PYL+  IL  E +E
Sbjct:    1 MRKGVIDFSEFGKHENGTVLMSENDLGHTIMLGQIAILTG----------------CGVWMLLATAFKLPVSTTHSIVGATIGFALVAQGSRVIVWEKIYRIFFSWIISPLLSGIVSVFIYLSLDHLVLRREQPLHSGIRVLPALYFICFAFNVFAIVYKGPSFLYFDRLSLTQCLIISGVFGLAVALIFAFFLAPYLKDHILSKELLE 193          
BLAST of slc20a-2 vs. Ensembl Celegans
Match: pitr-1 (Phosphate transporter [Source:UniProtKB/TrEMBL;Acc:Q18697])

HSP 1 Score: 186.808 bits (473), Expect = 2.970e-52
Identity = 89/174 (51.15%), Postives = 123/174 (70.69%), Query Frame = 1
Query: 1123 KTVIKDKPELVTIFSWVQVLTAIFGSFAHGGNDVSNAIGPLVGLWIIAITQDVYSTEAVPIWVLVYGGLGITVGLWVWGRRVMKTIGDDLTTITPTSGVSIELGAAVTVLIASNIGIPISTTHCKVGSIVAVGRYRSNDNVDWSIFRNICFAWLVTVPVSAGISALTMFLLRML 1644
            ++   + P+   +FS +QV+TA FG FAHGGNDVSNAI PLV L++IA      +    P ++L+YG  G+ +GLWV G RV+ T+G++LT ITP SG ++E GAAVTVLIAS +G+PIS+T CKVGS+VAVG  +S   V W +FRNI  +W+VT+PV+  +S  TM +L + 
Sbjct:  340 RSCKPEDPQASRLFSLLQVMTACFGGFAHGGNDVSNAIAPLVSLYLIANDGMKSADMETPWYLLLYGSFGMCLGLWVLGHRVIYTVGENLTKITPASGFAVEFGAAVTVLIASKLGLPISSTQCKVGSVVAVGLVQSRHQVHWGVFRNISLSWIVTLPVAGLLSGGTMMILHLF 513          

HSP 2 Score: 129.413 bits (324), Expect = 8.683e-32
Identity = 84/236 (35.59%), Postives = 125/236 (52.97%), Query Frame = 1
Query:  199 DQSYWVGSIYFNYYLFELYKGAKVSDTIRKGVI-------SPDALAAQNLTNLPQVMMIGQLSSLSGRSLFICCMKFNFYLGGC-LWLLVATFLKLPVSGSHSIVGAMVGFALIIQGPAGIAWKKLGMIVASWFVSPLLSGLVSAFVFFIFDKFILKKSESREPALNFLPFIYAITIFINFFSIFLTGPTLLKFDKIPLYGNFXXXXXXXXXXXXXXRFALVPYLRKIILKSEPIE 882
             Q+Y + SI+    L     G +V+DT+RKGVI         +     +  +L   +M+GQ++ L+G                C +W+L+AT  KLPVS +HSIVGA +GFAL+ QG   I W+K+  I  SW +SPLLSG+VS F++   D  +L++ +     +  LP +Y I    N F+I   GP+ L FD++ L    IIS    +   ++  F L PYL+  IL  E +E
Sbjct:   44 HQAYVLASIFET--LGACLLGHQVTDTMRKGVIDFSEFGKHENGTVLMSENDLGHTIMLGQIAILTG----------------CGVWMLLATAFKLPVSTTHSIVGATIGFALVAQGSRVIVWEKIYRIFFSWIISPLLSGIVSVFIYLSLDHLVLRREQPLHSGIRVLPALYFICFAFNVFAIVYKGPSFLYFDRLSLTQCLIISGVFGLAVALIFAFFLAPYLKDHILSKELLE 261          

HSP 3 Score: 82.4185 bits (202), Expect = 2.473e-16
Identity = 40/61 (65.57%), Postives = 50/61 (81.97%), Query Frame = 3
Query:   36 PDQIWIVVVGFLIAFILAFGIGANDVANSFGTSVGSKVISLRKACILASIFEVLGSILLGR 218
            PD   ++++G +IAFILAF IGAND ANSFGTSVGSKV++L +A +LASIFE LG+ LLG 
Sbjct:    3 PDPTVLLIIGAVIAFILAFAIGANDTANSFGTSVGSKVLTLHQAYVLASIFETLGACLLGH 63          
BLAST of slc20a-2 vs. Ensembl Celegans
Match: pitr-1 (Phosphate transporter [Source:UniProtKB/TrEMBL;Acc:Q18697])

HSP 1 Score: 186.808 bits (473), Expect = 2.970e-52
Identity = 89/174 (51.15%), Postives = 123/174 (70.69%), Query Frame = 1
Query: 1123 KTVIKDKPELVTIFSWVQVLTAIFGSFAHGGNDVSNAIGPLVGLWIIAITQDVYSTEAVPIWVLVYGGLGITVGLWVWGRRVMKTIGDDLTTITPTSGVSIELGAAVTVLIASNIGIPISTTHCKVGSIVAVGRYRSNDNVDWSIFRNICFAWLVTVPVSAGISALTMFLLRML 1644
            ++   + P+   +FS +QV+TA FG FAHGGNDVSNAI PLV L++IA      +    P ++L+YG  G+ +GLWV G RV+ T+G++LT ITP SG ++E GAAVTVLIAS +G+PIS+T CKVGS+VAVG  +S   V W +FRNI  +W+VT+PV+  +S  TM +L + 
Sbjct:  340 RSCKPEDPQASRLFSLLQVMTACFGGFAHGGNDVSNAIAPLVSLYLIANDGMKSADMETPWYLLLYGSFGMCLGLWVLGHRVIYTVGENLTKITPASGFAVEFGAAVTVLIASKLGLPISSTQCKVGSVVAVGLVQSRHQVHWGVFRNISLSWIVTLPVAGLLSGGTMMILHLF 513          

HSP 2 Score: 129.413 bits (324), Expect = 8.683e-32
Identity = 84/236 (35.59%), Postives = 125/236 (52.97%), Query Frame = 1
Query:  199 DQSYWVGSIYFNYYLFELYKGAKVSDTIRKGVI-------SPDALAAQNLTNLPQVMMIGQLSSLSGRSLFICCMKFNFYLGGC-LWLLVATFLKLPVSGSHSIVGAMVGFALIIQGPAGIAWKKLGMIVASWFVSPLLSGLVSAFVFFIFDKFILKKSESREPALNFLPFIYAITIFINFFSIFLTGPTLLKFDKIPLYGNFXXXXXXXXXXXXXXRFALVPYLRKIILKSEPIE 882
             Q+Y + SI+    L     G +V+DT+RKGVI         +     +  +L   +M+GQ++ L+G                C +W+L+AT  KLPVS +HSIVGA +GFAL+ QG   I W+K+  I  SW +SPLLSG+VS F++   D  +L++ +     +  LP +Y I    N F+I   GP+ L FD++ L    IIS    +   ++  F L PYL+  IL  E +E
Sbjct:   44 HQAYVLASIFET--LGACLLGHQVTDTMRKGVIDFSEFGKHENGTVLMSENDLGHTIMLGQIAILTG----------------CGVWMLLATAFKLPVSTTHSIVGATIGFALVAQGSRVIVWEKIYRIFFSWIISPLLSGIVSVFIYLSLDHLVLRREQPLHSGIRVLPALYFICFAFNVFAIVYKGPSFLYFDRLSLTQCLIISGVFGLAVALIFAFFLAPYLKDHILSKELLE 261          

HSP 3 Score: 82.4185 bits (202), Expect = 2.473e-16
Identity = 40/61 (65.57%), Postives = 50/61 (81.97%), Query Frame = 3
Query:   36 PDQIWIVVVGFLIAFILAFGIGANDVANSFGTSVGSKVISLRKACILASIFEVLGSILLGR 218
            PD   ++++G +IAFILAF IGAND ANSFGTSVGSKV++L +A +LASIFE LG+ LLG 
Sbjct:    3 PDPTVLLIIGAVIAFILAFAIGANDTANSFGTSVGSKVLTLHQAYVLASIFETLGACLLGH 63          
BLAST of slc20a-2 vs. Ensembl Fly
Match: NaPi-III (gene:FBgn0260795 transcript:FBtr0301438)

HSP 1 Score: 207.994 bits (528), Expect = 7.721e-59
Identity = 107/217 (49.31%), Postives = 148/217 (68.20%), Query Frame = 1
Query: 1069 SLEDIKENSTEVECKT---VEKTVIKDKPELVTIFSWVQVLTAIFGSFAHGGNDVSNAIGPLVGLWIIAITQDVYSTEAVPIWVLVYGGLGITVGLWVWGRRVMKTIGDDLTTITPTSGVSIELGAAVTVLIASNIGIPISTTHCKVGSIVAVG---------RYRSND----------------NVDWSIFRNICFAWLVTVPVSAGISALTMFLL 1635
            S E + E   E++  T      +  ++ PE+  +FS++Q+LTA FGSFAHGGNDVSNAIGPL+ L++I     V      PI++L+YGG+GI+VGLW+WGRRV++TIG+DLT IT ++G +IE+GAA+TVL+AS IG+PISTTHCKVGS+V VG         + + ND                +VDW +FRNI +AW+VTVPV+A +SA  M++L
Sbjct:  440 SKEALNEQEEELKRTTGGGRRTSGAEETPEISMLFSFLQILTATFGSFAHGGNDVSNAIGPLIALYMIYREGSVMQQAESPIYILIYGGIGISVGLWLWGRRVIETIGNDLTKITSSTGFTIEVGAAITVLLASKIGLPISTTHCKVGSVVFVGHVSASGRKKKSQPNDQTDKETHNEVAPMDDGSVDWHLFRNIAYAWIVTVPVTALLSAGMMYVL 656          

HSP 2 Score: 139.813 bits (351), Expect = 4.137e-54
Identity = 81/203 (39.90%), Postives = 118/203 (58.13%), Query Frame = 1
Query:  259 GAKVSDTIRKGVISPDALAAQNLTNLPQVMMIGQLSSLSGRSLFICCMKFNFYLGGCLWLLVATFLKLPVSGSHSIVGAMVGFALIIQGPAGIAWKKLGMIVASWFVSPLLSGLVSAFVFFIFDKFILKKSESREPALNFLPFIYAITIFINFFSIFLTGPTLLKFDKIPLYGNFXXXXXXXXXXXXXXRFALVPYLRKIILK 867
            G KVSDT+RKG++              +V+M+G +++L+  ++               WLLVATFLKLP+SG+HSIVG+ +GF+L+ +G  G+ W  LG IV SWF+SP+LSG+VS  +F    +FIL+  E  +     LP  Y +T FIN  S+ L GP LL  D IP +     S GLS++  ++ +  +VP  R+ I K
Sbjct:   65 GYKVSDTMRKGILEVGLYEGAE-----EVLMLGCVAALASSAV---------------WLLVATFLKLPISGTHSIVGSTIGFSLVARGVQGLKWSTLGTIVGSWFISPVLSGIVSILLFLAIRRFILRAQEPLKAGFRSLPIFYGVTFFINVISVVLDGPKLLYMDNIPTWIALTASFGLSLLVALLTQLVVVPLQRRKIAK 247          

HSP 3 Score: 92.4337 bits (228), Expect = 4.137e-54
Identity = 41/60 (68.33%), Postives = 56/60 (93.33%), Query Frame = 3
Query:   36 PDQIWIVVVGFLIAFILAFGIGANDVANSFGTSVGSKVISLRKACILASIFEVLGSILLG 215
            P+ +W+VV+GFLIAF+LAFGIGANDVANSFGTSVGS V+++R+AC+LA+I E+ G++L+G
Sbjct:    6 PELLWMVVIGFLIAFVLAFGIGANDVANSFGTSVGSGVLTIRQACVLATICEISGAVLIG 65          
BLAST of slc20a-2 vs. Ensembl Fly
Match: NaPi-III (gene:FBgn0260795 transcript:FBtr0332705)

HSP 1 Score: 207.994 bits (528), Expect = 7.721e-59
Identity = 107/217 (49.31%), Postives = 148/217 (68.20%), Query Frame = 1
Query: 1069 SLEDIKENSTEVECKT---VEKTVIKDKPELVTIFSWVQVLTAIFGSFAHGGNDVSNAIGPLVGLWIIAITQDVYSTEAVPIWVLVYGGLGITVGLWVWGRRVMKTIGDDLTTITPTSGVSIELGAAVTVLIASNIGIPISTTHCKVGSIVAVG---------RYRSND----------------NVDWSIFRNICFAWLVTVPVSAGISALTMFLL 1635
            S E + E   E++  T      +  ++ PE+  +FS++Q+LTA FGSFAHGGNDVSNAIGPL+ L++I     V      PI++L+YGG+GI+VGLW+WGRRV++TIG+DLT IT ++G +IE+GAA+TVL+AS IG+PISTTHCKVGS+V VG         + + ND                +VDW +FRNI +AW+VTVPV+A +SA  M++L
Sbjct:  440 SKEALNEQEEELKRTTGGGRRTSGAEETPEISMLFSFLQILTATFGSFAHGGNDVSNAIGPLIALYMIYREGSVMQQAESPIYILIYGGIGISVGLWLWGRRVIETIGNDLTKITSSTGFTIEVGAAITVLLASKIGLPISTTHCKVGSVVFVGHVSASGRKKKSQPNDQTDKETHNEVAPMDDGSVDWHLFRNIAYAWIVTVPVTALLSAGMMYVL 656          

HSP 2 Score: 139.813 bits (351), Expect = 4.137e-54
Identity = 81/203 (39.90%), Postives = 118/203 (58.13%), Query Frame = 1
Query:  259 GAKVSDTIRKGVISPDALAAQNLTNLPQVMMIGQLSSLSGRSLFICCMKFNFYLGGCLWLLVATFLKLPVSGSHSIVGAMVGFALIIQGPAGIAWKKLGMIVASWFVSPLLSGLVSAFVFFIFDKFILKKSESREPALNFLPFIYAITIFINFFSIFLTGPTLLKFDKIPLYGNFXXXXXXXXXXXXXXRFALVPYLRKIILK 867
            G KVSDT+RKG++              +V+M+G +++L+  ++               WLLVATFLKLP+SG+HSIVG+ +GF+L+ +G  G+ W  LG IV SWF+SP+LSG+VS  +F    +FIL+  E  +     LP  Y +T FIN  S+ L GP LL  D IP +     S GLS++  ++ +  +VP  R+ I K
Sbjct:   65 GYKVSDTMRKGILEVGLYEGAE-----EVLMLGCVAALASSAV---------------WLLVATFLKLPISGTHSIVGSTIGFSLVARGVQGLKWSTLGTIVGSWFISPVLSGIVSILLFLAIRRFILRAQEPLKAGFRSLPIFYGVTFFINVISVVLDGPKLLYMDNIPTWIALTASFGLSLLVALLTQLVVVPLQRRKIAK 247          

HSP 3 Score: 92.4337 bits (228), Expect = 4.137e-54
Identity = 41/60 (68.33%), Postives = 56/60 (93.33%), Query Frame = 3
Query:   36 PDQIWIVVVGFLIAFILAFGIGANDVANSFGTSVGSKVISLRKACILASIFEVLGSILLG 215
            P+ +W+VV+GFLIAF+LAFGIGANDVANSFGTSVGS V+++R+AC+LA+I E+ G++L+G
Sbjct:    6 PELLWMVVIGFLIAFVLAFGIGANDVANSFGTSVGSGVLTIRQACVLATICEISGAVLIG 65          
BLAST of slc20a-2 vs. Ensembl Zebrafish
Match: slc20a1b (solute carrier family 20 member 1b [Source:NCBI gene;Acc:321541])

HSP 1 Score: 237.654 bits (605), Expect = 1.017e-69
Identity = 116/195 (59.49%), Postives = 145/195 (74.36%), Query Frame = 1
Query: 1063 EVSLEDIKENSTEVECKTVEKTVIKDKPELVTIFSWVQVLTAIFGSFAHGGNDVSNAIGPLVGLWIIAITQDVYSTEAVPIWVLVYGGLGITVGLWVWGRRVMKTIGDDLTTITPTSGVSIELGAAVTVLIASNIGIPISTTHCKVGSIVAVGRYRSNDNVDWSIFRNICFAWLVTVPVSAGISALTMFLLRMLI 1647
            EV+LE + E++        E     DKPE+  +F ++Q+LTA FGSFAHGGNDVSNAIGPLV LW++  +  V S+   PIW+L+YGG+GI VGLWVWGRRV++T+G DLT ITP+SG SIEL +AVTV++ASNIG+P+STTHCKVGS+VAVG  RS   VDW +FRNI  AW VTVP+S  ISA  M L   +I
Sbjct:  470 EVTLEMVDEDAGSSRSSLEEDRTDADKPEVSMLFQFLQILTACFGSFAHGGNDVSNAIGPLVALWLVYESGSVISSAPTPIWLLLYGGVGICVGLWVWGRRVIQTMGRDLTPITPSSGFSIELASAVTVVVASNIGLPVSTTHCKVGSVVAVGWLRSRKAVDWRLFRNIFMAWFVTVPISGLISAAIMALFTYVI 664          

HSP 2 Score: 146.747 bits (369), Expect = 3.268e-56
Identity = 89/201 (44.28%), Postives = 125/201 (62.19%), Query Frame = 1
Query:  259 GAKVSDTIRKGVISPDALAAQNLTNLPQVMMIGQLSSLSGRSLFICCMKFNFYLGGCLWLLVATFLKLPVSGSHSIVGAMVGFALIIQGPAGIAWKKLGMIVASWFVSPLLSGLVSAFVFFIFDKFILKKSESREPALNFLPFIYAITIFINFFSIFLTGPTLLKFDKIPLYGNFXXXXXXXXXXXXXXRFALVPYLRKII 861
            GAKVS+TIRKG+I           +   V+M G +S++                G  +W L A+FLKLP+SG+H IVGA +GF+L+ +G  G+ W +L  I+ASWF+SPLLSG++SA +F+    FIL+K +     L  LPF YA+T+ IN FSI  TG  +L FDK+P +G  +ISIG  +IT ++V FA+ P L+K I
Sbjct:   83 GAKVSETIRKGIID-----VTMYNDYEHVLMAGSVSAM---------------FGSAVWQLAASFLKLPISGTHCIVGATIGFSLVAKGQQGVKWLELLRIIASWFLSPLLSGVMSAVLFYFVRMFILQKKDPVPNGLRALPFFYAVTMGINLFSIMFTGAPMLGFDKLPWWGVLLISIGFGIITALIVWFAVCPRLKKKI 263          

HSP 3 Score: 92.8189 bits (229), Expect = 3.268e-56
Identity = 42/57 (73.68%), Postives = 54/57 (94.74%), Query Frame = 3
Query:   45 IWIVVVGFLIAFILAFGIGANDVANSFGTSVGSKVISLRKACILASIFEVLGSILLG 215
            +W+++VGF+IAF+LAF +GANDVANSFGT+VGS V++LR+ACILASIFE LGS+LLG
Sbjct:   27 MWLLIVGFIIAFVLAFSVGANDVANSFGTAVGSGVVTLRQACILASIFETLGSVLLG 83          

HSP 4 Score: 53.5286 bits (127), Expect = 5.488e-7
Identity = 50/198 (25.25%), Postives = 88/198 (44.44%), Query Frame = 1
Query: 1093 STEVECKTVEKTVIKDKPELVTIFSWVQVLTAIFG---SFAHGGNDVSNAIGPLVGLWIIAITQDVYSTEAVPIWVLVYGGLGITVGLWVWGRRVMKTIG---------DDLTTITPTSGVSIELGAAVTVLIASNIGIPISTTHCKVGSIVAVGRY-RSNDNVDWSIFRNICFAWLVTVPVSAGISALTMFLLRMLI 1647
            ST +   T+  T++      +T + W+ ++  I     +F+ G NDV+N+ G  VG  ++ + Q             +   +  T+G  + G +V +TI          +D   +     VS   G+AV  L AS + +PIS THC VG+ +      +    V W     I  +W ++  +S  +SA+  + +RM I
Sbjct:    3 STTLATITIMSTLVGYTTGHLTAYMWLLIVGFIIAFVLAFSVGANDVANSFGTAVGSGVVTLRQ-----------ACILASIFETLGSVLLGAKVSETIRKGIIDVTMYNDYEHVLMAGSVSAMFGSAVWQLAASFLKLPISGTHCIVGATIGFSLVAKGQQGVKWLELLRIIASWFLSPLLSGVMSAVLFYFVRMFI 189          
BLAST of slc20a-2 vs. Ensembl Zebrafish
Match: slc20a1b (solute carrier family 20 member 1b [Source:NCBI gene;Acc:321541])

HSP 1 Score: 237.654 bits (605), Expect = 1.017e-69
Identity = 116/195 (59.49%), Postives = 145/195 (74.36%), Query Frame = 1
Query: 1063 EVSLEDIKENSTEVECKTVEKTVIKDKPELVTIFSWVQVLTAIFGSFAHGGNDVSNAIGPLVGLWIIAITQDVYSTEAVPIWVLVYGGLGITVGLWVWGRRVMKTIGDDLTTITPTSGVSIELGAAVTVLIASNIGIPISTTHCKVGSIVAVGRYRSNDNVDWSIFRNICFAWLVTVPVSAGISALTMFLLRMLI 1647
            EV+LE + E++        E     DKPE+  +F ++Q+LTA FGSFAHGGNDVSNAIGPLV LW++  +  V S+   PIW+L+YGG+GI VGLWVWGRRV++T+G DLT ITP+SG SIEL +AVTV++ASNIG+P+STTHCKVGS+VAVG  RS   VDW +FRNI  AW VTVP+S  ISA  M L   +I
Sbjct:  470 EVTLEMVDEDAGSSRSSLEEDRTDADKPEVSMLFQFLQILTACFGSFAHGGNDVSNAIGPLVALWLVYESGSVISSAPTPIWLLLYGGVGICVGLWVWGRRVIQTMGRDLTPITPSSGFSIELASAVTVVVASNIGLPVSTTHCKVGSVVAVGWLRSRKAVDWRLFRNIFMAWFVTVPISGLISAAIMALFTYVI 664          

HSP 2 Score: 146.747 bits (369), Expect = 3.268e-56
Identity = 89/201 (44.28%), Postives = 125/201 (62.19%), Query Frame = 1
Query:  259 GAKVSDTIRKGVISPDALAAQNLTNLPQVMMIGQLSSLSGRSLFICCMKFNFYLGGCLWLLVATFLKLPVSGSHSIVGAMVGFALIIQGPAGIAWKKLGMIVASWFVSPLLSGLVSAFVFFIFDKFILKKSESREPALNFLPFIYAITIFINFFSIFLTGPTLLKFDKIPLYGNFXXXXXXXXXXXXXXRFALVPYLRKII 861
            GAKVS+TIRKG+I           +   V+M G +S++                G  +W L A+FLKLP+SG+H IVGA +GF+L+ +G  G+ W +L  I+ASWF+SPLLSG++SA +F+    FIL+K +     L  LPF YA+T+ IN FSI  TG  +L FDK+P +G  +ISIG  +IT ++V FA+ P L+K I
Sbjct:   83 GAKVSETIRKGIID-----VTMYNDYEHVLMAGSVSAM---------------FGSAVWQLAASFLKLPISGTHCIVGATIGFSLVAKGQQGVKWLELLRIIASWFLSPLLSGVMSAVLFYFVRMFILQKKDPVPNGLRALPFFYAVTMGINLFSIMFTGAPMLGFDKLPWWGVLLISIGFGIITALIVWFAVCPRLKKKI 263          

HSP 3 Score: 92.8189 bits (229), Expect = 3.268e-56
Identity = 42/57 (73.68%), Postives = 54/57 (94.74%), Query Frame = 3
Query:   45 IWIVVVGFLIAFILAFGIGANDVANSFGTSVGSKVISLRKACILASIFEVLGSILLG 215
            +W+++VGF+IAF+LAF +GANDVANSFGT+VGS V++LR+ACILASIFE LGS+LLG
Sbjct:   27 MWLLIVGFIIAFVLAFSVGANDVANSFGTAVGSGVVTLRQACILASIFETLGSVLLG 83          

HSP 4 Score: 53.5286 bits (127), Expect = 5.488e-7
Identity = 50/198 (25.25%), Postives = 88/198 (44.44%), Query Frame = 1
Query: 1093 STEVECKTVEKTVIKDKPELVTIFSWVQVLTAIFG---SFAHGGNDVSNAIGPLVGLWIIAITQDVYSTEAVPIWVLVYGGLGITVGLWVWGRRVMKTIG---------DDLTTITPTSGVSIELGAAVTVLIASNIGIPISTTHCKVGSIVAVGRY-RSNDNVDWSIFRNICFAWLVTVPVSAGISALTMFLLRMLI 1647
            ST +   T+  T++      +T + W+ ++  I     +F+ G NDV+N+ G  VG  ++ + Q             +   +  T+G  + G +V +TI          +D   +     VS   G+AV  L AS + +PIS THC VG+ +      +    V W     I  +W ++  +S  +SA+  + +RM I
Sbjct:    3 STTLATITIMSTLVGYTTGHLTAYMWLLIVGFIIAFVLAFSVGANDVANSFGTAVGSGVVTLRQ-----------ACILASIFETLGSVLLGAKVSETIRKGIIDVTMYNDYEHVLMAGSVSAMFGSAVWQLAASFLKLPISGTHCIVGATIGFSLVAKGQQGVKWLELLRIIASWFLSPLLSGVMSAVLFYFVRMFI 189          
BLAST of slc20a-2 vs. Ensembl Zebrafish
Match: slc20a1a (solute carrier family 20 member 1a [Source:NCBI gene;Acc:406458])

HSP 1 Score: 225.328 bits (573), Expect = 2.928e-65
Identity = 107/170 (62.94%), Postives = 134/170 (78.82%), Query Frame = 1
Query: 1138 DKPELVTIFSWVQVLTAIFGSFAHGGNDVSNAIGPLVGLWIIAITQDVYSTEAVPIWVLVYGGLGITVGLWVWGRRVMKTIGDDLTTITPTSGVSIELGAAVTVLIASNIGIPISTTHCKVGSIVAVGRYRSNDNVDWSIFRNICFAWLVTVPVSAGISALTMFLLRMLI 1647
            DKPE+ T+F ++Q+LTA FGSFAHGGNDVSNAIGPLV LW+I  +  V  +   PIW+L+YGG+GI  GLW+WGRRV++T+G DLT ITP+SG SIEL +A+TV++ASNIG+P+STTHCKVGS+V+VG  RS   VDW +FRNI  AW VTVP+S  ISA  M L   +I
Sbjct:  479 DKPEVSTLFQFLQILTACFGSFAHGGNDVSNAIGPLVALWLIYDSASVAPSAPTPIWLLLYGGVGICTGLWIWGRRVIQTMGKDLTPITPSSGFSIELASAITVVVASNIGLPVSTTHCKVGSVVSVGWLRSRKAVDWHLFRNIFIAWFVTVPISGLISAAIMALFYYVI 648          

HSP 2 Score: 140.969 bits (354), Expect = 1.959e-53
Identity = 85/199 (42.71%), Postives = 121/199 (60.80%), Query Frame = 1
Query:  259 GAKVSDTIRKGVISPDALAAQNLTNLPQVMMIGQLSSLSGRSLFICCMKFNFYLGGCLWLLVATFLKLPVSGSHSIVGAMVGFALIIQGPAGIAWKKLGMIVASWFVSPLLSGLVSAFVFFIFDKFILKKSESREPALNFLPFIYAITIFINFFSIFLTGPTLLKFDKIPLYGNFXXXXXXXXXXXXXXRFALVPYLRK 855
            GAKVS+TIR G+I               V+M G +S++                G  +W L A+FLKLP+SG+H IVGA +GF+++ +G  G+ W +L  IVASWF+SPLLSG++SA +F+   KFIL K +     L  LP  YA+T+ IN FSI  TG  +L FD+IP +G  +IS+G +++T +VV F + P L+K
Sbjct:   83 GAKVSETIRSGIID-----VHMYNGSEAVLMAGSISAM---------------FGSAVWQLAASFLKLPISGTHCIVGATIGFSMVARGHQGVKWLELLRIVASWFLSPLLSGIMSAVLFYFVRKFILNKDDPVPNGLRALPVFYAVTMGINLFSIMFTGAPMLGFDRIPWWGTLLISLGCAILTALVVWFIVCPRLKK 261          

HSP 3 Score: 88.9669 bits (219), Expect = 1.959e-53
Identity = 40/59 (67.80%), Postives = 55/59 (93.22%), Query Frame = 3
Query:   39 DQIWIVVVGFLIAFILAFGIGANDVANSFGTSVGSKVISLRKACILASIFEVLGSILLG 215
            D +W++++GF+IAFILAF +GANDVANSFGT+VGS V++LR+ACILA+IFE +G++LLG
Sbjct:   25 DVLWLLILGFVIAFILAFSVGANDVANSFGTAVGSGVVTLRQACILATIFETVGAMLLG 83          

HSP 4 Score: 50.8322 bits (120), Expect = 4.063e-6
Identity = 43/160 (26.88%), Postives = 73/160 (45.62%), Query Frame = 1
Query: 1198 SFAHGGNDVSNAIGPLVGLWIIAITQDVYSTEAVPIWVLVYGGLGITVGLWVWGRRVMKTIGDDLTTITPTSG---------VSIELGAAVTVLIASNIGIPISTTHCKVGSIVAVGRY-RSNDNVDWSIFRNICFAWLVTVPVSAGISALTMFLLRMLI 1647
            +F+ G NDV+N+ G  VG  ++ + Q             +   +  TVG  + G +V +TI   +  +   +G         +S   G+AV  L AS + +PIS THC VG+ +      R +  V W     I  +W ++  +S  +SA+  + +R  I
Sbjct:   41 AFSVGANDVANSFGTAVGSGVVTLRQ-----------ACILATIFETVGAMLLGAKVSETIRSGIIDVHMYNGSEAVLMAGSISAMFGSAVWQLAASFLKLPISGTHCIVGATIGFSMVARGHQGVKWLELLRIVASWFLSPLLSGIMSAVLFYFVRKFI 189          
BLAST of slc20a-2 vs. Ensembl Zebrafish
Match: slc20a1a (solute carrier family 20 member 1a [Source:NCBI gene;Acc:406458])

HSP 1 Score: 225.328 bits (573), Expect = 2.928e-65
Identity = 107/170 (62.94%), Postives = 134/170 (78.82%), Query Frame = 1
Query: 1138 DKPELVTIFSWVQVLTAIFGSFAHGGNDVSNAIGPLVGLWIIAITQDVYSTEAVPIWVLVYGGLGITVGLWVWGRRVMKTIGDDLTTITPTSGVSIELGAAVTVLIASNIGIPISTTHCKVGSIVAVGRYRSNDNVDWSIFRNICFAWLVTVPVSAGISALTMFLLRMLI 1647
            DKPE+ T+F ++Q+LTA FGSFAHGGNDVSNAIGPLV LW+I  +  V  +   PIW+L+YGG+GI  GLW+WGRRV++T+G DLT ITP+SG SIEL +A+TV++ASNIG+P+STTHCKVGS+V+VG  RS   VDW +FRNI  AW VTVP+S  ISA  M L   +I
Sbjct:  479 DKPEVSTLFQFLQILTACFGSFAHGGNDVSNAIGPLVALWLIYDSASVAPSAPTPIWLLLYGGVGICTGLWIWGRRVIQTMGKDLTPITPSSGFSIELASAITVVVASNIGLPVSTTHCKVGSVVSVGWLRSRKAVDWHLFRNIFIAWFVTVPISGLISAAIMALFYYVI 648          

HSP 2 Score: 140.969 bits (354), Expect = 1.959e-53
Identity = 85/199 (42.71%), Postives = 121/199 (60.80%), Query Frame = 1
Query:  259 GAKVSDTIRKGVISPDALAAQNLTNLPQVMMIGQLSSLSGRSLFICCMKFNFYLGGCLWLLVATFLKLPVSGSHSIVGAMVGFALIIQGPAGIAWKKLGMIVASWFVSPLLSGLVSAFVFFIFDKFILKKSESREPALNFLPFIYAITIFINFFSIFLTGPTLLKFDKIPLYGNFXXXXXXXXXXXXXXRFALVPYLRK 855
            GAKVS+TIR G+I               V+M G +S++                G  +W L A+FLKLP+SG+H IVGA +GF+++ +G  G+ W +L  IVASWF+SPLLSG++SA +F+   KFIL K +     L  LP  YA+T+ IN FSI  TG  +L FD+IP +G  +IS+G +++T +VV F + P L+K
Sbjct:   83 GAKVSETIRSGIID-----VHMYNGSEAVLMAGSISAM---------------FGSAVWQLAASFLKLPISGTHCIVGATIGFSMVARGHQGVKWLELLRIVASWFLSPLLSGIMSAVLFYFVRKFILNKDDPVPNGLRALPVFYAVTMGINLFSIMFTGAPMLGFDRIPWWGTLLISLGCAILTALVVWFIVCPRLKK 261          

HSP 3 Score: 88.9669 bits (219), Expect = 1.959e-53
Identity = 40/59 (67.80%), Postives = 55/59 (93.22%), Query Frame = 3
Query:   39 DQIWIVVVGFLIAFILAFGIGANDVANSFGTSVGSKVISLRKACILASIFEVLGSILLG 215
            D +W++++GF+IAFILAF +GANDVANSFGT+VGS V++LR+ACILA+IFE +G++LLG
Sbjct:   25 DVLWLLILGFVIAFILAFSVGANDVANSFGTAVGSGVVTLRQACILATIFETVGAMLLG 83          

HSP 4 Score: 50.8322 bits (120), Expect = 4.063e-6
Identity = 43/160 (26.88%), Postives = 73/160 (45.62%), Query Frame = 1
Query: 1198 SFAHGGNDVSNAIGPLVGLWIIAITQDVYSTEAVPIWVLVYGGLGITVGLWVWGRRVMKTIGDDLTTITPTSG---------VSIELGAAVTVLIASNIGIPISTTHCKVGSIVAVGRY-RSNDNVDWSIFRNICFAWLVTVPVSAGISALTMFLLRMLI 1647
            +F+ G NDV+N+ G  VG  ++ + Q             +   +  TVG  + G +V +TI   +  +   +G         +S   G+AV  L AS + +PIS THC VG+ +      R +  V W     I  +W ++  +S  +SA+  + +R  I
Sbjct:   41 AFSVGANDVANSFGTAVGSGVVTLRQ-----------ACILATIFETVGAMLLGAKVSETIRSGIIDVHMYNGSEAVLMAGSISAMFGSAVWQLAASFLKLPISGTHCIVGATIGFSMVARGHQGVKWLELLRIVASWFLSPLLSGIMSAVLFYFVRKFI 189          
BLAST of slc20a-2 vs. Ensembl Zebrafish
Match: slc20a2 (solute carrier family 20 member 2 [Source:ZFIN;Acc:ZDB-GENE-060929-828])

HSP 1 Score: 218.009 bits (554), Expect = 2.212e-62
Identity = 106/172 (61.63%), Postives = 128/172 (74.42%), Query Frame = 1
Query: 1120 EKTVIKDKPELVTIFSWVQVLTAIFGSFAHGGNDVSNAIGPLVGLWIIAITQDVYSTEAVPIWVLVYGGLGITVGLWVWGRRVMKTIGDDLTTITPTSGVSIELGAAVTVLIASNIGIPISTTHCKVGSIVAVGRYRSNDNVDWSIFRNICFAWLVTVPVSAGISALTMFLL 1635
            E    KD  ++  +F ++Q+LTA FGSFAHGGNDVSNAIGPLV LW+I     V    A P+W+L YGG+GI  GLWVWGRRV++T+G DLT ITP+SG +IEL +AVTV++ASNIG+PISTTHCKVGS+VAVG  RS   VDW +FRNI  AW VTVPV+   SA  M L 
Sbjct:  483 EDKAEKDNSQVFLLFHFLQILTACFGSFAHGGNDVSNAIGPLVALWMIYDQGGVMQDAATPVWLLFYGGVGICAGLWVWGRRVIQTMGKDLTPITPSSGFTIELASAVTVVLASNIGLPISTTHCKVGSVVAVGWIRSRKAVDWRLFRNIFLAWFVTVPVAGLFSAAVMALF 654          

HSP 2 Score: 114.39 bits (285), Expect = 7.215e-47
Identity = 73/172 (42.44%), Postives = 107/172 (62.21%), Query Frame = 1
Query:  259 GAKVSDTIRKGVISPDALAAQNLTNLPQVMMIGQLSSLSGRSLFICCMKFNFYLGGCLWLLVATFLKLPVSGSHSIVGAMVGFALIIQGPAGIAWKKLGMIVASWFVSPLLSGLVSAFVFFIFDKFILKKSESREPALNFLPFIYAITIFINFFSIFLTGPTLLKFDKIPLY 774
            GAKV +TIRKG+I    ++  N T +P ++M G++S++               +G  +W L+A+FLKLP+SG+H IVG+ +GF+++  G  G+ W +L  IV+SWF+SPLLSGL+S  +FF+   FIL K +     L  LP  YA TI IN FSI  TG  LL  + +P++
Sbjct:   63 GAKVGETIRKGIID---VSLYNDT-VP-ILMAGEVSAM---------------VGSAVWQLIASFLKLPISGTHCIVGSTIGFSMVAIGTKGVQWMQLVKIVSSWFISPLLSGLMSGLLFFVIRYFILSKDDPVPNGLRALPLFYASTIGINTFSIMYTGAPLLGLEMLPVW 214          

HSP 3 Score: 93.5893 bits (231), Expect = 7.215e-47
Identity = 44/57 (77.19%), Postives = 54/57 (94.74%), Query Frame = 3
Query:   45 IWIVVVGFLIAFILAFGIGANDVANSFGTSVGSKVISLRKACILASIFEVLGSILLG 215
            +W+VV+GF+IAFILAF +GANDVANSFGT+VGS V++LR+ACILASIFE LGS+LLG
Sbjct:    7 LWMVVIGFIIAFILAFSVGANDVANSFGTAVGSGVVTLRQACILASIFETLGSMLLG 63          
BLAST of slc20a-2 vs. Ensembl Xenopus
Match: slc20a1 (solute carrier family 20 member 1 [Source:NCBI gene;Acc:594956])

HSP 1 Score: 232.646 bits (592), Expect = 3.963e-69
Identity = 112/195 (57.44%), Postives = 148/195 (75.90%), Query Frame = 1
Query: 1063 EVSLEDIKENSTEVECKTVEKTVIKDKPELVTIFSWVQVLTAIFGSFAHGGNDVSNAIGPLVGLWIIAITQDVYSTEAVPIWVLVYGGLGITVGLWVWGRRVMKTIGDDLTTITPTSGVSIELGAAVTVLIASNIGIPISTTHCKVGSIVAVGRYRSNDNVDWSIFRNICFAWLVTVPVSAGISALTMFLLRMLI 1647
            E S+ED+  +       ++E+   +DKPE+  +F ++Q+LTA FGSFAHGGNDVSNAIGPLV L+++  + DV +  A PIW+L+YGG+GI +GLWVWGRRV++T+G DLT ITP+SG SIEL +A+TV+IASN+G+PISTTHCKVGS+V+VG  RS   VDW +FRNI  AW VTVP+S  ISA  M + +  I
Sbjct:  316 EGSIEDVATDRKS-SSSSLEERHDQDKPEVSLLFQFLQILTACFGSFAHGGNDVSNAIGPLVALYLVYESGDVTTKAATPIWLLLYGGVGICIGLWVWGRRVIQTMGKDLTPITPSSGFSIELASALTVVIASNVGLPISTTHCKVGSVVSVGWLRSKKAVDWRLFRNIFLAWFVTVPISGLISAAIMAVFKYAI 509          

HSP 2 Score: 128.257 bits (321), Expect = 4.461e-31
Identity = 62/120 (51.67%), Postives = 82/120 (68.33%), Query Frame = 1
Query:  418 LGGCLWLLVATFLKLPVSGSHSIVGAMVGFALIIQGPAGIAWKKLGMIVASWFVSPLLSGLVSAFVFFIFDKFILKKSESREPALNFLPFIYAITIFINFFSIFLTGPTLLKFDKIPLYG 777
             G  +W L A+FLKLP+SG+H IVGA +GF+L+ +G   I W +L  IV SWF+SPLLSG++SA +F+    FIL+K++     L  LP  YA TI +N FSI  +G  LL FDKIPL+G
Sbjct:    9 FGSAVWQLAASFLKLPISGTHCIVGATIGFSLVAKGQQAIQWYELLRIVLSWFISPLLSGIMSALLFYFVRMFILRKADPVPNGLRALPIFYACTIGVNLFSIMYSGAPLLGFDKIPLWG 128          
BLAST of slc20a-2 vs. Ensembl Xenopus
Match: slc20a1 (solute carrier family 20 member 1 [Source:NCBI gene;Acc:594956])

HSP 1 Score: 233.032 bits (593), Expect = 7.160e-68
Identity = 112/195 (57.44%), Postives = 149/195 (76.41%), Query Frame = 1
Query: 1063 EVSLEDIKENSTEVECKTVEKTVIKDKPELVTIFSWVQVLTAIFGSFAHGGNDVSNAIGPLVGLWIIAITQDVYSTEAVPIWVLVYGGLGITVGLWVWGRRVMKTIGDDLTTITPTSGVSIELGAAVTVLIASNIGIPISTTHCKVGSIVAVGRYRSNDNVDWSIFRNICFAWLVTVPVSAGISALTMFLLRMLI 1647
            E S+ED+  +  +    ++E+   +DKPE+  +F ++Q+LTA FGSFAHGGNDVSNAIGPLV L+++  + DV +  A PIW+L+YGG+GI +GLWVWGRRV++T+G DLT ITP+SG SIEL +A+TV+IASN+G+PISTTHCKVGS+V+VG  RS   VDW +FRNI  AW VTVP+S  ISA  M + +  I
Sbjct:  453 EGSIEDVATDR-KSSSSSLEERHDQDKPEVSLLFQFLQILTACFGSFAHGGNDVSNAIGPLVALYLVYESGDVTTKAATPIWLLLYGGVGICIGLWVWGRRVIQTMGKDLTPITPSSGFSIELASALTVVIASNVGLPISTTHCKVGSVVSVGWLRSKKAVDWRLFRNIFLAWFVTVPISGLISAAIMAVFKYAI 646          

HSP 2 Score: 142.51 bits (358), Expect = 4.219e-54
Identity = 91/211 (43.13%), Postives = 129/211 (61.14%), Query Frame = 1
Query:  259 GAKVSDTIRKGVISPDALAAQNLTNLPQVMMIGQLSSLSGRSLFICCMKFNFYLGGCLWLLVATFLKLPVSGSHSIVGAMVGFALIIQGPAGIAWKKLGMIVASWFVSPLLSGLVSAFVFFIFDKFILKKSESREPALNFLPFIYAITIFINFFSIFLTGPTLLKFDKIPLYGNFXXXXXXXXXXXXXXRFALVPYLRKII---LKSEPIE 882
            GAKVS+TIRKG+I    +   N T   +++M G +S++                G  +W L A+FLKLP+SG+H IVGA +GF+L+ +G   I W +L  IV SWF+SPLLSG++SA +F+    FIL+K++     L  LP  YA TI +N FSI  +G  LL FDKIPL+G  +IS+G +V+  +VV F + P +++ I    KS P E
Sbjct:   82 GAKVSETIRKGLID---VNTYNTTQ--ELLMAGSISAM---------------FGSAVWQLAASFLKLPISGTHCIVGATIGFSLVAKGQQAIQWYELLRIVLSWFISPLLSGIMSALLFYFVRMFILRKADPVPNGLRALPIFYACTIGVNLFSIMYSGAPLLGFDKIPLWGIILISVGCAVLCALVVWFFVCPRMKRKIECEFKSSPSE 272          

HSP 3 Score: 90.5077 bits (223), Expect = 4.219e-54
Identity = 41/57 (71.93%), Postives = 54/57 (94.74%), Query Frame = 3
Query:   45 IWIVVVGFLIAFILAFGIGANDVANSFGTSVGSKVISLRKACILASIFEVLGSILLG 215
            +W++V+GF+IAF+LAF +GANDVANSFGT+VGS V++LR+ACILASIFE +GS+LLG
Sbjct:   26 LWMLVLGFVIAFVLAFSVGANDVANSFGTAVGSGVVTLRQACILASIFETVGSVLLG 82          

HSP 4 Score: 56.6102 bits (135), Expect = 9.396e-8
Identity = 53/179 (29.61%), Postives = 82/179 (45.81%), Query Frame = 1
Query: 1162 FSWVQVLTAIFG---SFAHGGNDVSNAIGPLVGLWIIAITQDVYSTEAVPIWVLVYGGLGITVGLWVWGRRVMKTIGD---DLTTITPTS------GVSIELGAAVTVLIASNIGIPISTTHCKVG-----SIVAVGRYRSNDNVDWSIFRNICFAWLVTVPVSAGISALTMFLLRMLI 1647
            F W+ VL  +     +F+ G NDV+N+ G  VG  ++ + Q             +   +  TVG  + G +V +TI     D+ T   T        +S   G+AV  L AS + +PIS THC VG     S+VA G+      + W     I  +W ++  +S  +SAL  + +RM I
Sbjct:   25 FLWMLVLGFVIAFVLAFSVGANDVANSFGTAVGSGVVTLRQ-----------ACILASIFETVGSVLLGAKVSETIRKGLIDVNTYNTTQELLMAGSISAMFGSAVWQLAASFLKLPISGTHCIVGATIGFSLVAKGQ----QAIQWYELLRIVLSWFISPLLSGIMSALLFYFVRMFI 188          
BLAST of slc20a-2 vs. Ensembl Xenopus
Match: slc20a1 (solute carrier family 20 member 1 [Source:NCBI gene;Acc:594956])

HSP 1 Score: 232.646 bits (592), Expect = 1.263e-67
Identity = 112/195 (57.44%), Postives = 149/195 (76.41%), Query Frame = 1
Query: 1063 EVSLEDIKENSTEVECKTVEKTVIKDKPELVTIFSWVQVLTAIFGSFAHGGNDVSNAIGPLVGLWIIAITQDVYSTEAVPIWVLVYGGLGITVGLWVWGRRVMKTIGDDLTTITPTSGVSIELGAAVTVLIASNIGIPISTTHCKVGSIVAVGRYRSNDNVDWSIFRNICFAWLVTVPVSAGISALTMFLLRMLI 1647
            E S+ED+  +  +    ++E+   +DKPE+  +F ++Q+LTA FGSFAHGGNDVSNAIGPLV L+++  + DV +  A PIW+L+YGG+GI +GLWVWGRRV++T+G DLT ITP+SG SIEL +A+TV+IASN+G+PISTTHCKVGS+V+VG  RS   VDW +FRNI  AW VTVP+S  ISA  M + +  I
Sbjct:  473 EGSIEDVATDR-KSSSSSLEERHDQDKPEVSLLFQFLQILTACFGSFAHGGNDVSNAIGPLVALYLVYESGDVTTKAATPIWLLLYGGVGICIGLWVWGRRVIQTMGKDLTPITPSSGFSIELASALTVVIASNVGLPISTTHCKVGSVVSVGWLRSKKAVDWRLFRNIFLAWFVTVPISGLISAAIMAVFKYAI 666          

HSP 2 Score: 142.51 bits (358), Expect = 3.915e-51
Identity = 91/211 (43.13%), Postives = 129/211 (61.14%), Query Frame = 1
Query:  259 GAKVSDTIRKGVISPDALAAQNLTNLPQVMMIGQLSSLSGRSLFICCMKFNFYLGGCLWLLVATFLKLPVSGSHSIVGAMVGFALIIQGPAGIAWKKLGMIVASWFVSPLLSGLVSAFVFFIFDKFILKKSESREPALNFLPFIYAITIFINFFSIFLTGPTLLKFDKIPLYGNFXXXXXXXXXXXXXXRFALVPYLRKII---LKSEPIE 882
            GAKVS+TIRKG+I    +   N T   +++M G +S++                G  +W L A+FLKLP+SG+H IVGA +GF+L+ +G   I W +L  IV SWF+SPLLSG++SA +F+    FIL+K++     L  LP  YA TI +N FSI  +G  LL FDKIPL+G  +IS+G +V+  +VV F + P +++ I    KS P E
Sbjct:   66 GAKVSETIRKGLID---VNTYNTTQ--ELLMAGSISAM---------------FGSAVWQLAASFLKLPISGTHCIVGATIGFSLVAKGQQAIQWYELLRIVLSWFISPLLSGIMSALLFYFVRMFILRKADPVPNGLRALPIFYACTIGVNLFSIMYSGAPLLGFDKIPLWGIILISVGCAVLCALVVWFFVCPRMKRKIECEFKSSPSE 256          

HSP 3 Score: 80.4925 bits (197), Expect = 3.915e-51
Identity = 41/66 (62.12%), Postives = 54/66 (81.82%), Query Frame = 3
Query:   21 MVYVPPD-QIWIVVVGFLIAFILAFGIGANDVANSFGTSVGSKVISLRKACILASIFEVLGSILLG 215
            M++V P   I  ++   +IAF+LAF +GANDVANSFGT+VGS V++LR+ACILASIFE +GS+LLG
Sbjct:    1 MIWVTPSPNIHALINVQIIAFVLAFSVGANDVANSFGTAVGSGVVTLRQACILASIFETVGSVLLG 66          

HSP 4 Score: 55.8398 bits (133), Expect = 1.716e-7
Identity = 51/173 (29.48%), Postives = 81/173 (46.82%), Query Frame = 1
Query: 1171 VQVLTAIFGSFAHGGNDVSNAIGPLVGLWIIAITQDVYSTEAVPIWVLVYGGLGITVGLWVWGRRVMKTIGD---DLTTITPTS------GVSIELGAAVTVLIASNIGIPISTTHCKVG-----SIVAVGRYRSNDNVDWSIFRNICFAWLVTVPVSAGISALTMFLLRMLI 1647
            VQ++  +  +F+ G NDV+N+ G  VG  ++ + Q             +   +  TVG  + G +V +TI     D+ T   T        +S   G+AV  L AS + +PIS THC VG     S+VA G+      + W     I  +W ++  +S  +SAL  + +RM I
Sbjct:   16 VQIIAFVL-AFSVGANDVANSFGTAVGSGVVTLRQ-----------ACILASIFETVGSVLLGAKVSETIRKGLIDVNTYNTTQELLMAGSISAMFGSAVWQLAASFLKLPISGTHCIVGATIGFSLVAKGQ----QAIQWYELLRIVLSWFISPLLSGIMSALLFYFVRMFI 172          
BLAST of slc20a-2 vs. Ensembl Xenopus
Match: slc20a1 (solute carrier family 20 member 1 [Source:NCBI gene;Acc:594956])

HSP 1 Score: 233.032 bits (593), Expect = 1.288e-67
Identity = 112/195 (57.44%), Postives = 149/195 (76.41%), Query Frame = 1
Query: 1063 EVSLEDIKENSTEVECKTVEKTVIKDKPELVTIFSWVQVLTAIFGSFAHGGNDVSNAIGPLVGLWIIAITQDVYSTEAVPIWVLVYGGLGITVGLWVWGRRVMKTIGDDLTTITPTSGVSIELGAAVTVLIASNIGIPISTTHCKVGSIVAVGRYRSNDNVDWSIFRNICFAWLVTVPVSAGISALTMFLLRMLI 1647
            E S+ED+  +  +    ++E+   +DKPE+  +F ++Q+LTA FGSFAHGGNDVSNAIGPLV L+++  + DV +  A PIW+L+YGG+GI +GLWVWGRRV++T+G DLT ITP+SG SIEL +A+TV+IASN+G+PISTTHCKVGS+V+VG  RS   VDW +FRNI  AW VTVP+S  ISA  M + +  I
Sbjct:  489 EGSIEDVATDR-KSSSSSLEERHDQDKPEVSLLFQFLQILTACFGSFAHGGNDVSNAIGPLVALYLVYESGDVTTKAATPIWLLLYGGVGICIGLWVWGRRVIQTMGKDLTPITPSSGFSIELASALTVVIASNVGLPISTTHCKVGSVVSVGWLRSKKAVDWRLFRNIFLAWFVTVPISGLISAAIMAVFKYAI 682          

HSP 2 Score: 142.51 bits (358), Expect = 3.289e-54
Identity = 91/211 (43.13%), Postives = 129/211 (61.14%), Query Frame = 1
Query:  259 GAKVSDTIRKGVISPDALAAQNLTNLPQVMMIGQLSSLSGRSLFICCMKFNFYLGGCLWLLVATFLKLPVSGSHSIVGAMVGFALIIQGPAGIAWKKLGMIVASWFVSPLLSGLVSAFVFFIFDKFILKKSESREPALNFLPFIYAITIFINFFSIFLTGPTLLKFDKIPLYGNFXXXXXXXXXXXXXXRFALVPYLRKII---LKSEPIE 882
            GAKVS+TIRKG+I    +   N T   +++M G +S++                G  +W L A+FLKLP+SG+H IVGA +GF+L+ +G   I W +L  IV SWF+SPLLSG++SA +F+    FIL+K++     L  LP  YA TI +N FSI  +G  LL FDKIPL+G  +IS+G +V+  +VV F + P +++ I    KS P E
Sbjct:   82 GAKVSETIRKGLID---VNTYNTTQ--ELLMAGSISAM---------------FGSAVWQLAASFLKLPISGTHCIVGATIGFSLVAKGQQAIQWYELLRIVLSWFISPLLSGIMSALLFYFVRMFILRKADPVPNGLRALPIFYACTIGVNLFSIMYSGAPLLGFDKIPLWGIILISVGCAVLCALVVWFFVCPRMKRKIECEFKSSPSE 272          

HSP 3 Score: 90.8929 bits (224), Expect = 3.289e-54
Identity = 41/57 (71.93%), Postives = 54/57 (94.74%), Query Frame = 3
Query:   45 IWIVVVGFLIAFILAFGIGANDVANSFGTSVGSKVISLRKACILASIFEVLGSILLG 215
            +W++V+GF+IAF+LAF +GANDVANSFGT+VGS V++LR+ACILASIFE +GS+LLG
Sbjct:   26 LWMLVLGFVIAFVLAFSVGANDVANSFGTAVGSGVVTLRQACILASIFETVGSVLLG 82          

HSP 4 Score: 56.6102 bits (135), Expect = 9.639e-8
Identity = 53/179 (29.61%), Postives = 82/179 (45.81%), Query Frame = 1
Query: 1162 FSWVQVLTAIFG---SFAHGGNDVSNAIGPLVGLWIIAITQDVYSTEAVPIWVLVYGGLGITVGLWVWGRRVMKTIGD---DLTTITPTS------GVSIELGAAVTVLIASNIGIPISTTHCKVG-----SIVAVGRYRSNDNVDWSIFRNICFAWLVTVPVSAGISALTMFLLRMLI 1647
            F W+ VL  +     +F+ G NDV+N+ G  VG  ++ + Q             +   +  TVG  + G +V +TI     D+ T   T        +S   G+AV  L AS + +PIS THC VG     S+VA G+      + W     I  +W ++  +S  +SAL  + +RM I
Sbjct:   25 FLWMLVLGFVIAFVLAFSVGANDVANSFGTAVGSGVVTLRQ-----------ACILASIFETVGSVLLGAKVSETIRKGLIDVNTYNTTQELLMAGSISAMFGSAVWQLAASFLKLPISGTHCIVGATIGFSLVAKGQ----QAIQWYELLRIVLSWFISPLLSGIMSALLFYFVRMFI 188          
BLAST of slc20a-2 vs. Ensembl Xenopus
Match: slc20a1 (solute carrier family 20 member 1 [Source:NCBI gene;Acc:594956])

HSP 1 Score: 232.646 bits (592), Expect = 1.858e-67
Identity = 112/195 (57.44%), Postives = 149/195 (76.41%), Query Frame = 1
Query: 1063 EVSLEDIKENSTEVECKTVEKTVIKDKPELVTIFSWVQVLTAIFGSFAHGGNDVSNAIGPLVGLWIIAITQDVYSTEAVPIWVLVYGGLGITVGLWVWGRRVMKTIGDDLTTITPTSGVSIELGAAVTVLIASNIGIPISTTHCKVGSIVAVGRYRSNDNVDWSIFRNICFAWLVTVPVSAGISALTMFLLRMLI 1647
            E S+ED+  +  +    ++E+   +DKPE+  +F ++Q+LTA FGSFAHGGNDVSNAIGPLV L+++  + DV +  A PIW+L+YGG+GI +GLWVWGRRV++T+G DLT ITP+SG SIEL +A+TV+IASN+G+PISTTHCKVGS+V+VG  RS   VDW +FRNI  AW VTVP+S  ISA  M + +  I
Sbjct:  490 EGSIEDVATDR-KSSSSSLEERHDQDKPEVSLLFQFLQILTACFGSFAHGGNDVSNAIGPLVALYLVYESGDVTTKAATPIWLLLYGGVGICIGLWVWGRRVIQTMGKDLTPITPSSGFSIELASALTVVIASNVGLPISTTHCKVGSVVSVGWLRSKKAVDWRLFRNIFLAWFVTVPISGLISAAIMAVFKYAI 683          

HSP 2 Score: 142.51 bits (358), Expect = 4.395e-54
Identity = 91/211 (43.13%), Postives = 129/211 (61.14%), Query Frame = 1
Query:  259 GAKVSDTIRKGVISPDALAAQNLTNLPQVMMIGQLSSLSGRSLFICCMKFNFYLGGCLWLLVATFLKLPVSGSHSIVGAMVGFALIIQGPAGIAWKKLGMIVASWFVSPLLSGLVSAFVFFIFDKFILKKSESREPALNFLPFIYAITIFINFFSIFLTGPTLLKFDKIPLYGNFXXXXXXXXXXXXXXRFALVPYLRKII---LKSEPIE 882
            GAKVS+TIRKG+I    +   N T   +++M G +S++                G  +W L A+FLKLP+SG+H IVGA +GF+L+ +G   I W +L  IV SWF+SPLLSG++SA +F+    FIL+K++     L  LP  YA TI +N FSI  +G  LL FDKIPL+G  +IS+G +V+  +VV F + P +++ I    KS P E
Sbjct:   83 GAKVSETIRKGLID---VNTYNTTQ--ELLMAGSISAM---------------FGSAVWQLAASFLKLPISGTHCIVGATIGFSLVAKGQQAIQWYELLRIVLSWFISPLLSGIMSALLFYFVRMFILRKADPVPNGLRALPIFYACTIGVNLFSIMYSGAPLLGFDKIPLWGIILISVGCAVLCALVVWFFVCPRMKRKIECEFKSSPSE 273          

HSP 3 Score: 90.5077 bits (223), Expect = 4.395e-54
Identity = 41/57 (71.93%), Postives = 54/57 (94.74%), Query Frame = 3
Query:   45 IWIVVVGFLIAFILAFGIGANDVANSFGTSVGSKVISLRKACILASIFEVLGSILLG 215
            +W++V+GF+IAF+LAF +GANDVANSFGT+VGS V++LR+ACILASIFE +GS+LLG
Sbjct:   27 LWMLVLGFVIAFVLAFSVGANDVANSFGTAVGSGVVTLRQACILASIFETVGSVLLG 83          

HSP 4 Score: 56.225 bits (134), Expect = 1.166e-7
Identity = 53/179 (29.61%), Postives = 82/179 (45.81%), Query Frame = 1
Query: 1162 FSWVQVLTAIFG---SFAHGGNDVSNAIGPLVGLWIIAITQDVYSTEAVPIWVLVYGGLGITVGLWVWGRRVMKTIGD---DLTTITPTS------GVSIELGAAVTVLIASNIGIPISTTHCKVG-----SIVAVGRYRSNDNVDWSIFRNICFAWLVTVPVSAGISALTMFLLRMLI 1647
            F W+ VL  +     +F+ G NDV+N+ G  VG  ++ + Q             +   +  TVG  + G +V +TI     D+ T   T        +S   G+AV  L AS + +PIS THC VG     S+VA G+      + W     I  +W ++  +S  +SAL  + +RM I
Sbjct:   26 FLWMLVLGFVIAFVLAFSVGANDVANSFGTAVGSGVVTLRQ-----------ACILASIFETVGSVLLGAKVSETIRKGLIDVNTYNTTQELLMAGSISAMFGSAVWQLAASFLKLPISGTHCIVGATIGFSLVAKGQ----QAIQWYELLRIVLSWFISPLLSGIMSALLFYFVRMFI 189          
BLAST of slc20a-2 vs. Ensembl Mouse
Match: Slc20a1 (solute carrier family 20, member 1 [Source:MGI Symbol;Acc:MGI:108392])

HSP 1 Score: 226.483 bits (576), Expect = 2.293e-65
Identity = 113/195 (57.95%), Postives = 148/195 (75.90%), Query Frame = 1
Query: 1063 EVSLEDIKENSTEVECKTVEKTVIKDKPELVTIFSWVQVLTAIFGSFAHGGNDVSNAIGPLVGLWIIAITQDVYSTEAVPIWVLVYGGLGITVGLWVWGRRVMKTIGDDLTTITPTSGVSIELGAAVTVLIASNIGIPISTTHCKVGSIVAVGRYRSNDNVDWSIFRNICFAWLVTVPVSAGISALTMFLLRMLI 1647
            E+ L D K +S      ++E+   +DKPE+  +F ++Q+LTA FGSFAHGGNDVSNAIGPLV L+++   Q+  +  A PIW+L+YGG+GI +GLWVWGRRV++T+G DLT ITP+SG SIEL +A+TV+IASNIG+PISTTHCKVGS+V+VG  RS   VDW +FRNI  AW VTVP+S  ISA  M + + +I
Sbjct:  490 EMGLGDRKGSS-----GSLEEWYDQDKPEVSLLFQFLQILTACFGSFAHGGNDVSNAIGPLVALYLV-YKQEASTKAATPIWLLLYGGVGICMGLWVWGRRVIQTMGKDLTPITPSSGFSIELASALTVVIASNIGLPISTTHCKVGSVVSVGWLRSKKAVDWRLFRNIFMAWFVTVPISGVISAAIMAVFKYII 678          

HSP 2 Score: 145.591 bits (366), Expect = 1.439e-55
Identity = 93/212 (43.87%), Postives = 129/212 (60.85%), Query Frame = 1
Query:  259 GAKVSDTIRKGVISPDALAAQNLTNLPQ-VMMIGQLSSLSGRSLFICCMKFNFYLGGCLWLLVATFLKLPVSGSHSIVGAMVGFALIIQGPAGIAWKKLGMIVASWFVSPLLSGLVSAFVFFIFDKFILKKSESREPALNFLPFIYAITIFINFFSIFLTGPTLLKFDKIPLYGNFXXXXXXXXXXXXXXRFALVPYLRKII---LKSEPIE 882
            GAKVS+TIR G+I  +      L N  Q ++M G +S++                G  +W LVA+FLKLP+SG+H IVGA +GF+L+  G  G+ W +L  IV SWFVSPLLSG++S  +FF+   FIL+K++     L  LP  YA TI IN FSI  TG  LL FDK+PL+G  +IS+G +V   ++V F + P +++ I   +KS P E
Sbjct:   82 GAKVSETIRNGLIDVE------LYNETQDLLMAGSVSAM---------------FGSAVWQLVASFLKLPISGTHCIVGATIGFSLVANGQKGVKWSELIKIVMSWFVSPLLSGIMSGILFFLVRAFILRKADPVPNGLRALPIFYACTIGINLFSIMYTGAPLLGFDKLPLWGTILISVGCAVFCALIVWFFVCPRMKRKIEREVKSSPSE 272          

HSP 3 Score: 91.6633 bits (226), Expect = 1.439e-55
Identity = 42/63 (66.67%), Postives = 56/63 (88.89%), Query Frame = 3
Query:   33 PP--DQIWIVVVGFLIAFILAFGIGANDVANSFGTSVGSKVISLRKACILASIFEVLGSILLG 215
            PP  D +W++++GF+IAF+LAF +GANDVANSFGT+VGS V++L++ACILASIFE +GS LLG
Sbjct:   20 PPKYDNLWMLILGFIIAFVLAFSVGANDVANSFGTAVGSGVVTLKQACILASIFETVGSALLG 82          

HSP 4 Score: 56.6102 bits (135), Expect = 6.621e-8
Identity = 50/164 (30.49%), Postives = 76/164 (46.34%), Query Frame = 1
Query: 1198 SFAHGGNDVSNAIGPLVGLWIIAITQDVYSTEAVPIWVLVYGGLGITVGLWVWGRRVMKTIGDDLTTIT---------PTSGVSIELGAAVTVLIASNIGIPISTTHCKVG-----SIVAVGRYRSNDNVDWSIFRNICFAWLVTVPVSAGISALTMFLLRMLI 1647
            +F+ G NDV+N+ G  VG  ++ + Q             +   +  TVG  + G +V +TI + L  +              VS   G+AV  L+AS + +PIS THC VG     S+VA G+      V WS    I  +W V+  +S  +S +  FL+R  I
Sbjct:   40 AFSVGANDVANSFGTAVGSGVVTLKQ-----------ACILASIFETVGSALLGAKVSETIRNGLIDVELYNETQDLLMAGSVSAMFGSAVWQLVASFLKLPISGTHCIVGATIGFSLVANGQ----KGVKWSELIKIVMSWFVSPLLSGIMSGILFFLVRAFI 188          
BLAST of slc20a-2 vs. Ensembl Mouse
Match: Slc20a1 (solute carrier family 20, member 1 [Source:MGI Symbol;Acc:MGI:108392])

HSP 1 Score: 226.483 bits (576), Expect = 2.293e-65
Identity = 113/195 (57.95%), Postives = 148/195 (75.90%), Query Frame = 1
Query: 1063 EVSLEDIKENSTEVECKTVEKTVIKDKPELVTIFSWVQVLTAIFGSFAHGGNDVSNAIGPLVGLWIIAITQDVYSTEAVPIWVLVYGGLGITVGLWVWGRRVMKTIGDDLTTITPTSGVSIELGAAVTVLIASNIGIPISTTHCKVGSIVAVGRYRSNDNVDWSIFRNICFAWLVTVPVSAGISALTMFLLRMLI 1647
            E+ L D K +S      ++E+   +DKPE+  +F ++Q+LTA FGSFAHGGNDVSNAIGPLV L+++   Q+  +  A PIW+L+YGG+GI +GLWVWGRRV++T+G DLT ITP+SG SIEL +A+TV+IASNIG+PISTTHCKVGS+V+VG  RS   VDW +FRNI  AW VTVP+S  ISA  M + + +I
Sbjct:  490 EMGLGDRKGSS-----GSLEEWYDQDKPEVSLLFQFLQILTACFGSFAHGGNDVSNAIGPLVALYLV-YKQEASTKAATPIWLLLYGGVGICMGLWVWGRRVIQTMGKDLTPITPSSGFSIELASALTVVIASNIGLPISTTHCKVGSVVSVGWLRSKKAVDWRLFRNIFMAWFVTVPISGVISAAIMAVFKYII 678          

HSP 2 Score: 145.591 bits (366), Expect = 1.439e-55
Identity = 93/212 (43.87%), Postives = 129/212 (60.85%), Query Frame = 1
Query:  259 GAKVSDTIRKGVISPDALAAQNLTNLPQ-VMMIGQLSSLSGRSLFICCMKFNFYLGGCLWLLVATFLKLPVSGSHSIVGAMVGFALIIQGPAGIAWKKLGMIVASWFVSPLLSGLVSAFVFFIFDKFILKKSESREPALNFLPFIYAITIFINFFSIFLTGPTLLKFDKIPLYGNFXXXXXXXXXXXXXXRFALVPYLRKII---LKSEPIE 882
            GAKVS+TIR G+I  +      L N  Q ++M G +S++                G  +W LVA+FLKLP+SG+H IVGA +GF+L+  G  G+ W +L  IV SWFVSPLLSG++S  +FF+   FIL+K++     L  LP  YA TI IN FSI  TG  LL FDK+PL+G  +IS+G +V   ++V F + P +++ I   +KS P E
Sbjct:   82 GAKVSETIRNGLIDVE------LYNETQDLLMAGSVSAM---------------FGSAVWQLVASFLKLPISGTHCIVGATIGFSLVANGQKGVKWSELIKIVMSWFVSPLLSGIMSGILFFLVRAFILRKADPVPNGLRALPIFYACTIGINLFSIMYTGAPLLGFDKLPLWGTILISVGCAVFCALIVWFFVCPRMKRKIEREVKSSPSE 272          

HSP 3 Score: 91.6633 bits (226), Expect = 1.439e-55
Identity = 42/63 (66.67%), Postives = 56/63 (88.89%), Query Frame = 3
Query:   33 PP--DQIWIVVVGFLIAFILAFGIGANDVANSFGTSVGSKVISLRKACILASIFEVLGSILLG 215
            PP  D +W++++GF+IAF+LAF +GANDVANSFGT+VGS V++L++ACILASIFE +GS LLG
Sbjct:   20 PPKYDNLWMLILGFIIAFVLAFSVGANDVANSFGTAVGSGVVTLKQACILASIFETVGSALLG 82          

HSP 4 Score: 56.6102 bits (135), Expect = 6.621e-8
Identity = 50/164 (30.49%), Postives = 76/164 (46.34%), Query Frame = 1
Query: 1198 SFAHGGNDVSNAIGPLVGLWIIAITQDVYSTEAVPIWVLVYGGLGITVGLWVWGRRVMKTIGDDLTTIT---------PTSGVSIELGAAVTVLIASNIGIPISTTHCKVG-----SIVAVGRYRSNDNVDWSIFRNICFAWLVTVPVSAGISALTMFLLRMLI 1647
            +F+ G NDV+N+ G  VG  ++ + Q             +   +  TVG  + G +V +TI + L  +              VS   G+AV  L+AS + +PIS THC VG     S+VA G+      V WS    I  +W V+  +S  +S +  FL+R  I
Sbjct:   40 AFSVGANDVANSFGTAVGSGVVTLKQ-----------ACILASIFETVGSALLGAKVSETIRNGLIDVELYNETQDLLMAGSVSAMFGSAVWQLVASFLKLPISGTHCIVGATIGFSLVANGQ----KGVKWSELIKIVMSWFVSPLLSGIMSGILFFLVRAFI 188          
BLAST of slc20a-2 vs. Ensembl Mouse
Match: Slc20a2 (solute carrier family 20, member 2 [Source:MGI Symbol;Acc:MGI:97851])

HSP 1 Score: 216.468 bits (550), Expect = 6.978e-62
Identity = 110/177 (62.15%), Postives = 131/177 (74.01%), Query Frame = 1
Query: 1105 ECKTVEKTVIKDKPELVTIFSWVQVLTAIFGSFAHGGNDVSNAIGPLVGLWIIAITQDVYSTEAVPIWVLVYGGLGITVGLWVWGRRVMKTIGDDLTTITPTSGVSIELGAAVTVLIASNIGIPISTTHCKVGSIVAVGRYRSNDNVDWSIFRNICFAWLVTVPVSAGISALTMFLL 1635
            E  T E+   KD  E+  +F ++QVLTA FGSFAHGGNDVSNAIGPLV LW+I     V    A P+W+L YGG+GI  GLWVWGRRV++T+G DLT ITP+SG +IEL +A TV+IASNIG+P+STTHCKVGS+VAVG  RS   VDW +FRNI  AW VTVPV+   SA  M LL
Sbjct:  469 EDPTEEEKEEKDSAEVHLLFHFLQVLTACFGSFAHGGNDVSNAIGPLVALWLIYQQGGVTQEAATPVWLLFYGGVGICTGLWVWGRRVIQTMGKDLTPITPSSGFTIELASAFTVVIASNIGLPVSTTHCKVGSVVAVGWIRSRKAVDWRLFRNIFVAWFVTVPVAGLFSAAIMALL 645          

HSP 2 Score: 124.405 bits (311), Expect = 4.257e-49
Identity = 71/165 (43.03%), Postives = 98/165 (59.39%), Query Frame = 1
Query:  259 GAKVSDTIRKGVISPDALAAQNLTNLP-QVMMIGQLSSLSGRSLFICCMKFNFYLGGCLWLLVATFLKLPVSGSHSIVGAMVGFALIIQGPAGIAWKKLGMIVASWFVSPLLSGLVSAFVFFIFDKFILKKSESREPALNFLPFIYAITIFINFFSIFLTGPTLL 750
            GAKV +TIRKG+I        NL N   + +M G++S++               +G  +W L+A+FL+LP+SG+H IVG+ +GF+L+  GP G+ W +L  IVASWF+SPLLSG +S  +F +   FIL K +     L  LP  YA TI IN FSI  TG  +L
Sbjct:   63 GAKVGETIRKGIID------VNLYNETVETLMAGEVSAM---------------VGSAVWQLIASFLRLPISGTHCIVGSTIGFSLVAIGPKGVQWMELVKIVASWFISPLLSGFMSGVLFILIRMFILTKEDPVPNGLQALPLFYAATIAINVFSIMYTGAPVL 206          

HSP 3 Score: 91.2781 bits (225), Expect = 4.257e-49
Identity = 42/57 (73.68%), Postives = 53/57 (92.98%), Query Frame = 3
Query:   45 IWIVVVGFLIAFILAFGIGANDVANSFGTSVGSKVISLRKACILASIFEVLGSILLG 215
            +W+V++GF+IAFILAF +GANDVANSFGT+VGS V++LR+ACILASIFE  GS+LLG
Sbjct:    7 LWMVILGFIIAFILAFSVGANDVANSFGTAVGSGVVTLRQACILASIFETTGSVLLG 63          

HSP 4 Score: 50.0618 bits (118), Expect = 7.902e-6
Identity = 50/164 (30.49%), Postives = 77/164 (46.95%), Query Frame = 1
Query: 1198 SFAHGGNDVSNAIGPLVGLWIIAITQDVYSTEAVPIWVLVYGGLGITVGLWVWGRRVMKTIGDDL--------TTITPTSG-VSIELGAAVTVLIASNIGIPISTTHCKVG-----SIVAVGRYRSNDNVDWSIFRNICFAWLVTVPVSAGISALTMFLLRMLI 1647
            +F+ G NDV+N+ G  VG  ++ + Q             +   +  T G  + G +V +TI   +        T  T  +G VS  +G+AV  LIAS + +PIS THC VG     S+VA+G       V W     I  +W ++  +S  +S +   L+RM I
Sbjct:   21 AFSVGANDVANSFGTAVGSGVVTLRQ-----------ACILASIFETTGSVLLGAKVGETIRKGIIDVNLYNETVETLMAGEVSAMVGSAVWQLIASFLRLPISGTHCIVGSTIGFSLVAIG----PKGVQWMELVKIVASWFISPLLSGFMSGVLFILIRMFI 169          
BLAST of slc20a-2 vs. UniProt/SwissProt
Match: sp|Q6PFM1|S20AB_DANRE (Sodium-dependent phosphate transporter 1-B OS=Danio rerio OX=7955 GN=slc20a1b PE=2 SV=1)

HSP 1 Score: 237.654 bits (605), Expect = 7.219e-69
Identity = 116/195 (59.49%), Postives = 145/195 (74.36%), Query Frame = 1
Query: 1063 EVSLEDIKENSTEVECKTVEKTVIKDKPELVTIFSWVQVLTAIFGSFAHGGNDVSNAIGPLVGLWIIAITQDVYSTEAVPIWVLVYGGLGITVGLWVWGRRVMKTIGDDLTTITPTSGVSIELGAAVTVLIASNIGIPISTTHCKVGSIVAVGRYRSNDNVDWSIFRNICFAWLVTVPVSAGISALTMFLLRMLI 1647
            EV+LE + E++        E     DKPE+  +F ++Q+LTA FGSFAHGGNDVSNAIGPLV LW++  +  V S+   PIW+L+YGG+GI VGLWVWGRRV++T+G DLT ITP+SG SIEL +AVTV++ASNIG+P+STTHCKVGS+VAVG  RS   VDW +FRNI  AW VTVP+S  ISA  M L   +I
Sbjct:  470 EVTLEMVDEDAGSSRSSLEEDRTDADKPEVSMLFQFLQILTACFGSFAHGGNDVSNAIGPLVALWLVYESGSVISSAPTPIWLLLYGGVGICVGLWVWGRRVIQTMGRDLTPITPSSGFSIELASAVTVVVASNIGLPVSTTHCKVGSVVAVGWLRSRKAVDWRLFRNIFMAWFVTVPISGLISAAIMALFNYVI 664          

HSP 2 Score: 147.517 bits (371), Expect = 2.910e-56
Identity = 90/201 (44.78%), Postives = 126/201 (62.69%), Query Frame = 1
Query:  259 GAKVSDTIRKGVISPDALAAQNLTNLPQVMMIGQLSSLSGRSLFICCMKFNFYLGGCLWLLVATFLKLPVSGSHSIVGAMVGFALIIQGPAGIAWKKLGMIVASWFVSPLLSGLVSAFVFFIFDKFILKKSESREPALNFLPFIYAITIFINFFSIFLTGPTLLKFDKIPLYGNFXXXXXXXXXXXXXXRFALVPYLRKII 861
            GAKVS+TIRKG+I           ++  V+M G +S++                G  +W L A+FLKLP+SG+H IVGA +GF+L+ +G  G+ W +L  IVASWF+SPLLSG++SA +F+    FIL+K +     L  LPF YA+T+ IN FSI  TG  +L FDK+P +G  +ISIG  +IT ++V FA+ P L+K I
Sbjct:   83 GAKVSETIRKGIID-----VTMYKDIEHVLMAGSVSAM---------------FGSAVWQLAASFLKLPISGTHCIVGATIGFSLVAKGQQGVKWLELLRIVASWFLSPLLSGVMSAVLFYFVRMFILQKKDPVPNGLRALPFFYAVTMGINLFSIMFTGAPMLGFDKLPWWGVLLISIGFGIITALIVWFAVCPRLKKKI 263          

HSP 3 Score: 94.7449 bits (234), Expect = 2.910e-56
Identity = 43/59 (72.88%), Postives = 55/59 (93.22%), Query Frame = 3
Query:   39 DQIWIVVVGFLIAFILAFGIGANDVANSFGTSVGSKVISLRKACILASIFEVLGSILLG 215
            D +W+++VGF+IAF+LAF +GANDVANSFGT+VGS V++LR+ACILASIFE LGS+LLG
Sbjct:   25 DYMWLLIVGFIIAFVLAFSVGANDVANSFGTAVGSGVVTLRQACILASIFETLGSVLLG 83          

HSP 4 Score: 52.373 bits (124), Expect = 8.334e-6
Identity = 50/198 (25.25%), Postives = 88/198 (44.44%), Query Frame = 1
Query: 1093 STEVECKTVEKTVIKDKPELVTIFSWVQVLTAIFG---SFAHGGNDVSNAIGPLVGLWIIAITQDVYSTEAVPIWVLVYGGLGITVGLWVWGRRVMKTIGD---------DLTTITPTSGVSIELGAAVTVLIASNIGIPISTTHCKVGSIVAVGR-YRSNDNVDWSIFRNICFAWLVTVPVSAGISALTMFLLRMLI 1647
            ST +   T+  T++      +T + W+ ++  I     +F+ G NDV+N+ G  VG  ++ + Q             +   +  T+G  + G +V +TI           D+  +     VS   G+AV  L AS + +PIS THC VG+ +      +    V W     I  +W ++  +S  +SA+  + +RM I
Sbjct:    3 STTLATITIMSTLVGYTTGPLTDYMWLLIVGFIIAFVLAFSVGANDVANSFGTAVGSGVVTLRQ-----------ACILASIFETLGSVLLGAKVSETIRKGIIDVTMYKDIEHVLMAGSVSAMFGSAVWQLAASFLKLPISGTHCIVGATIGFSLVAKGQQGVKWLELLRIVASWFLSPLLSGVMSAVLFYFVRMFI 189          
BLAST of slc20a-2 vs. UniProt/SwissProt
Match: sp|Q68F35|S20AA_XENLA (Sodium-dependent phosphate transporter 1-A OS=Xenopus laevis OX=8355 GN=slc20a1-a PE=2 SV=1)

HSP 1 Score: 236.498 bits (602), Expect = 3.454e-68
Identity = 115/195 (58.97%), Postives = 149/195 (76.41%), Query Frame = 1
Query: 1063 EVSLEDIKENSTEVECKTVEKTVIKDKPELVTIFSWVQVLTAIFGSFAHGGNDVSNAIGPLVGLWIIAITQDVYSTEAVPIWVLVYGGLGITVGLWVWGRRVMKTIGDDLTTITPTSGVSIELGAAVTVLIASNIGIPISTTHCKVGSIVAVGRYRSNDNVDWSIFRNICFAWLVTVPVSAGISALTMFLLRMLI 1647
            E S+ED+ E   +    ++E+   +DKPE+  +F ++Q+LTA FGSFAHGGNDVSNAIGPLV L+++  T DV +  A PIW+L+YGG+GI +GLWVWGRRV++T+G DLT ITP+SG SIEL +A+TV+IASN+G+PISTTHCKVGS+V+VG  RS   VDW +FRNI  AW VTVP+S  ISA  M L +  I
Sbjct:  489 EGSVEDV-ETDRKSSSSSLEERHDQDKPEVSLLFQFLQILTACFGSFAHGGNDVSNAIGPLVALYLVYETGDVTTKAATPIWLLLYGGIGICIGLWVWGRRVIQTMGKDLTPITPSSGFSIELASALTVVIASNVGLPISTTHCKVGSVVSVGWLRSKKAVDWRLFRNIFLAWFVTVPISGLISAGIMALFKYAI 682          

HSP 2 Score: 143.665 bits (361), Expect = 5.426e-54
Identity = 90/211 (42.65%), Postives = 129/211 (61.14%), Query Frame = 1
Query:  259 GAKVSDTIRKGVISPDALAAQNLTNLPQVMMIGQLSSLSGRSLFICCMKFNFYLGGCLWLLVATFLKLPVSGSHSIVGAMVGFALIIQGPAGIAWKKLGMIVASWFVSPLLSGLVSAFVFFIFDKFILKKSESREPALNFLPFIYAITIFINFFSIFLTGPTLLKFDKIPLYGNFXXXXXXXXXXXXXXRFALVPYLRKII---LKSEPIE 882
            GAKVS+TIRKG+I    +   N T   +++M G +S++                G  +W L A+F+KLP+SG+H IVGA +GF+L+ +G  G+ W +L  IV SWF+SPLLSG++SA +F     FIL+K++     L  LP  YA TI IN FSI  TG  LL FDK+PL+G  +IS+G +V+  ++V F + P +++ I    KS P E
Sbjct:   82 GAKVSETIRKGLID---VTMYNSTQ--ELLMAGSISAM---------------FGSAVWQLAASFMKLPISGTHCIVGATIGFSLVAKGQQGVKWIELLRIVLSWFISPLLSGIMSALLFLFVRMFILRKADPVPNGLRALPVFYACTIGINLFSIMFTGAPLLGFDKVPLWGIILISVGCAVLCALIVWFVVCPRMKRKIECEFKSSPSE 272          

HSP 3 Score: 90.8929 bits (224), Expect = 5.426e-54
Identity = 42/64 (65.62%), Postives = 57/64 (89.06%), Query Frame = 3
Query:   24 VYVPPDQIWIVVVGFLIAFILAFGIGANDVANSFGTSVGSKVISLRKACILASIFEVLGSILLG 215
            V++    +W++V+GF+IAF+LAF +GANDVANSFGT+VGS V++LR+ACILASIFE +GS+LLG
Sbjct:   19 VHIMAPYLWMLVLGFVIAFVLAFSVGANDVANSFGTAVGSGVVTLRQACILASIFETVGSVLLG 82          

HSP 4 Score: 54.299 bits (129), Expect = 2.457e-6
Identity = 45/160 (28.12%), Postives = 71/160 (44.38%), Query Frame = 1
Query: 1198 SFAHGGNDVSNAIGPLVGLWIIAITQDVYSTEAVPIWVLVYGGLGITVGLWVWGRRVMKTIGDDLTTITP---------TSGVSIELGAAVTVLIASNIGIPISTTHCKVGSIVAVGRY-RSNDNVDWSIFRNICFAWLVTVPVSAGISALTMFLLRMLI 1647
            +F+ G NDV+N+ G  VG  ++ + Q             +   +  TVG  + G +V +TI   L  +T             +S   G+AV  L AS + +PIS THC VG+ +      +    V W     I  +W ++  +S  +SAL    +RM I
Sbjct:   40 AFSVGANDVANSFGTAVGSGVVTLRQ-----------ACILASIFETVGSVLLGAKVSETIRKGLIDVTMYNSTQELLMAGSISAMFGSAVWQLAASFMKLPISGTHCIVGATIGFSLVAKGQQGVKWIELLRIVLSWFISPLLSGIMSALLFLFVRMFI 188          
BLAST of slc20a-2 vs. UniProt/SwissProt
Match: sp|Q9JJP0|S20A1_RAT (Sodium-dependent phosphate transporter 1 OS=Rattus norvegicus OX=10116 GN=Slc20a1 PE=1 SV=1)

HSP 1 Score: 234.187 bits (596), Expect = 2.441e-67
Identity = 115/195 (58.97%), Postives = 150/195 (76.92%), Query Frame = 1
Query: 1063 EVSLEDIKENSTEVECKTVEKTVIKDKPELVTIFSWVQVLTAIFGSFAHGGNDVSNAIGPLVGLWIIAITQDVYSTEAVPIWVLVYGGLGITVGLWVWGRRVMKTIGDDLTTITPTSGVSIELGAAVTVLIASNIGIPISTTHCKVGSIVAVGRYRSNDNVDWSIFRNICFAWLVTVPVSAGISALTMFLLRMLI 1647
            E+ L D K +S      ++E+   +DKPE+  +F ++Q+LTA FGSFAHGGNDVSNAIGPLV L+++  T+DV + EA PIW+L+YGG+GI +GLWVWGRRV++T+G DLT ITP+SG SIEL +A TV++ASNIG+PISTTHCKVGS+V+VG  RS   VDW +FRNI  AW VTVP+S  ISA  M + + +I
Sbjct:  489 EMGLGDRKGSS-----GSLEEWYDQDKPEVSLLFQFLQILTACFGSFAHGGNDVSNAIGPLVALYLVYETRDVTTKEATPIWLLLYGGVGICMGLWVWGRRVIQTMGKDLTPITPSSGFSIELASAFTVVVASNIGLPISTTHCKVGSVVSVGWLRSKKAVDWRLFRNIFMAWFVTVPISGVISAAIMAVFKHII 678          

HSP 2 Score: 149.443 bits (376), Expect = 5.693e-56
Identity = 93/211 (44.08%), Postives = 129/211 (61.14%), Query Frame = 1
Query:  259 GAKVSDTIRKGVISPDALAAQNLTNLPQVMMIGQLSSLSGRSLFICCMKFNFYLGGCLWLLVATFLKLPVSGSHSIVGAMVGFALIIQGPAGIAWKKLGMIVASWFVSPLLSGLVSAFVFFIFDKFILKKSESREPALNFLPFIYAITIFINFFSIFLTGPTLLKFDKIPLYGNFXXXXXXXXXXXXXXRFALVPYLRKII---LKSEPIE 882
            GAKVS+TIRKG+I  +   A        ++M G +S++                G  +W LVA+FLKLP+SG+H IVGA +GF+L+ +G  GI W +L  IV SWFVSPLLSG++S  +FF+   FIL+K++     L  LP  YA TI IN FSI  TG  LL FDK+PL+G  +IS+G +V   ++V F + P +++ I   +KS P E
Sbjct:   82 GAKVSETIRKGLIDVEKYNATQ-----DLLMAGSVSAM---------------FGSAVWQLVASFLKLPISGTHCIVGATIGFSLVAKGQEGIKWSELIKIVMSWFVSPLLSGIMSGILFFLVRAFILRKADPVPNGLRALPIFYACTIGINLFSIMYTGAPLLGFDKLPLWGTILISVGCAVFCALIVWFFVCPRMKRKIEREVKSSPSE 272          

HSP 3 Score: 91.6633 bits (226), Expect = 5.693e-56
Identity = 42/63 (66.67%), Postives = 56/63 (88.89%), Query Frame = 3
Query:   33 PP--DQIWIVVVGFLIAFILAFGIGANDVANSFGTSVGSKVISLRKACILASIFEVLGSILLG 215
            PP  D +W++++GF+IAF+LAF +GANDVANSFGT+VGS V++L++ACILASIFE +GS LLG
Sbjct:   20 PPKYDNLWMLILGFIIAFVLAFSVGANDVANSFGTAVGSGVVTLKQACILASIFETVGSALLG 82          

HSP 4 Score: 57.3806 bits (137), Expect = 3.007e-7
Identity = 49/164 (29.88%), Postives = 77/164 (46.95%), Query Frame = 1
Query: 1198 SFAHGGNDVSNAIGPLVGLWIIAITQDVYSTEAVPIWVLVYGGLGITVGLWVWGRRVMKTIGDDLTTITPTSG---------VSIELGAAVTVLIASNIGIPISTTHCKVG-----SIVAVGRYRSNDNVDWSIFRNICFAWLVTVPVSAGISALTMFLLRMLI 1647
            +F+ G NDV+N+ G  VG  ++ + Q             +   +  TVG  + G +V +TI   L  +   +          VS   G+AV  L+AS + +PIS THC VG     S+VA G+    + + WS    I  +W V+  +S  +S +  FL+R  I
Sbjct:   40 AFSVGANDVANSFGTAVGSGVVTLKQ-----------ACILASIFETVGSALLGAKVSETIRKGLIDVEKYNATQDLLMAGSVSAMFGSAVWQLVASFLKLPISGTHCIVGATIGFSLVAKGQ----EGIKWSELIKIVMSWFVSPLLSGIMSGILFFLVRAFI 188          
BLAST of slc20a-2 vs. UniProt/SwissProt
Match: sp|O97596|S20A1_FELCA (Sodium-dependent phosphate transporter 1 OS=Felis catus OX=9685 GN=Slc20a1 PE=2 SV=2)

HSP 1 Score: 233.417 bits (594), Expect = 4.343e-67
Identity = 116/195 (59.49%), Postives = 150/195 (76.92%), Query Frame = 1
Query: 1063 EVSLEDIKENSTEVECKTVEKTVIKDKPELVTIFSWVQVLTAIFGSFAHGGNDVSNAIGPLVGLWIIAITQDVYSTEAVPIWVLVYGGLGITVGLWVWGRRVMKTIGDDLTTITPTSGVSIELGAAVTVLIASNIGIPISTTHCKVGSIVAVGRYRSNDNVDWSIFRNICFAWLVTVPVSAGISALTMFLLRMLI 1647
            E+ L D K +S+     ++E+   +DKPE+  +F ++Q+LTA FGSFAHGGNDVSNAIGPLV L+++  T DV S  A PIW+L+YGG+GI +GLWVWGRRV++T+G DLT ITP+SG SIEL +A+TV+IASNIG+PISTTHCKVGS+V+VG  RS   VDW +FRNI  AW VTVP+S  ISA  M + + +I
Sbjct:  491 EMGLGDRKGSSS-----SLEEWYDQDKPEVSLLFQFLQILTACFGSFAHGGNDVSNAIGPLVALYLVYDTGDVSSKVATPIWLLLYGGVGICIGLWVWGRRVIQTMGKDLTPITPSSGFSIELASALTVVIASNIGLPISTTHCKVGSVVSVGWLRSKKAVDWRLFRNIFMAWFVTVPISGVISAAIMAVFKYVI 680          

HSP 2 Score: 149.058 bits (375), Expect = 1.801e-55
Identity = 92/211 (43.60%), Postives = 131/211 (62.09%), Query Frame = 1
Query:  259 GAKVSDTIRKGVISPDALAAQNLTNLPQVMMIGQLSSLSGRSLFICCMKFNFYLGGCLWLLVATFLKLPVSGSHSIVGAMVGFALIIQGPAGIAWKKLGMIVASWFVSPLLSGLVSAFVFFIFDKFILKKSESREPALNFLPFIYAITIFINFFSIFLTGPTLLKFDKIPLYGNFXXXXXXXXXXXXXXRFALVPYLRKII---LKSEPIE 882
            GAKVS+TIRKG+I    +   N T   Q++M G +S++                G  +W LVA+FLKLP+SG+H IVGA +GF+L+ +G  G+ W +L  IV SWF+SPLLSG++S  +FF+   FIL+K++     L  LP  YA T+ IN FSI  TG  LL FDK+PL+G  +IS+G +V   ++V F + P +++ I   +KS P E
Sbjct:   82 GAKVSETIRKGLID---VEMYNTTQ--QLLMAGSVSAM---------------FGSAVWQLVASFLKLPISGTHCIVGATIGFSLVAKGQEGVKWSELIKIVMSWFISPLLSGIMSGILFFLVRAFILRKTDPVPNGLRALPVFYACTVGINLFSIMYTGAPLLGFDKLPLWGTILISVGCAVFCALIVWFFVCPRMKRKIEREIKSSPSE 272          

HSP 3 Score: 90.5077 bits (223), Expect = 1.801e-55
Identity = 40/59 (67.80%), Postives = 55/59 (93.22%), Query Frame = 3
Query:   39 DQIWIVVVGFLIAFILAFGIGANDVANSFGTSVGSKVISLRKACILASIFEVLGSILLG 215
            D +W++++GF+IAF+LAF +GANDVANSFGT+VGS V++L++ACILASIFE +GS+LLG
Sbjct:   24 DYLWMLILGFIIAFVLAFSVGANDVANSFGTAVGSGVVTLKQACILASIFETVGSVLLG 82          

HSP 4 Score: 56.225 bits (134), Expect = 6.375e-7
Identity = 49/164 (29.88%), Postives = 76/164 (46.34%), Query Frame = 1
Query: 1198 SFAHGGNDVSNAIGPLVGLWIIAITQDVYSTEAVPIWVLVYGGLGITVGLWVWGRRVMKTIGDDLTTITP---------TSGVSIELGAAVTVLIASNIGIPISTTHCKVG-----SIVAVGRYRSNDNVDWSIFRNICFAWLVTVPVSAGISALTMFLLRMLI 1647
            +F+ G NDV+N+ G  VG  ++ + Q             +   +  TVG  + G +V +TI   L  +              VS   G+AV  L+AS + +PIS THC VG     S+VA G+    + V WS    I  +W ++  +S  +S +  FL+R  I
Sbjct:   40 AFSVGANDVANSFGTAVGSGVVTLKQ-----------ACILASIFETVGSVLLGAKVSETIRKGLIDVEMYNTTQQLLMAGSVSAMFGSAVWQLVASFLKLPISGTHCIVGATIGFSLVAKGQ----EGVKWSELIKIVMSWFISPLLSGIMSGILFFLVRAFI 188          
BLAST of slc20a-2 vs. UniProt/SwissProt
Match: sp|Q8WUM9|S20A1_HUMAN (Sodium-dependent phosphate transporter 1 OS=Homo sapiens OX=9606 GN=SLC20A1 PE=1 SV=1)

HSP 1 Score: 233.417 bits (594), Expect = 4.457e-67
Identity = 113/178 (63.48%), Postives = 142/178 (79.78%), Query Frame = 1
Query: 1114 TVEKTVIKDKPELVTIFSWVQVLTAIFGSFAHGGNDVSNAIGPLVGLWIIAITQDVYSTEAVPIWVLVYGGLGITVGLWVWGRRVMKTIGDDLTTITPTSGVSIELGAAVTVLIASNIGIPISTTHCKVGSIVAVGRYRSNDNVDWSIFRNICFAWLVTVPVSAGISALTMFLLRMLI 1647
            ++E+   +DKPE+  +F ++Q+LTA FGSFAHGGNDVSNAIGPLV L+++  T DV S  A PIW+L+YGG+GI VGLWVWGRRV++T+G DLT ITP+SG SIEL +A+TV+IASNIG+PISTTHCKVGS+V+VG  RS   VDW +FRNI  AW VTVP+S  ISA  M + R +I
Sbjct:  499 SLEEWYDQDKPEVSLLFQFLQILTACFGSFAHGGNDVSNAIGPLVALYLVYDTGDVSSKVATPIWLLLYGGVGICVGLWVWGRRVIQTMGKDLTPITPSSGFSIELASALTVVIASNIGLPISTTHCKVGSVVSVGWLRSKKAVDWRLFRNIFMAWFVTVPISGVISAAIMAIFRYVI 676          

HSP 2 Score: 143.665 bits (361), Expect = 7.132e-54
Identity = 89/211 (42.18%), Postives = 127/211 (60.19%), Query Frame = 1
Query:  259 GAKVSDTIRKGVISPDALAAQNLTNLPQVMMIGQLSSLSGRSLFICCMKFNFYLGGCLWLLVATFLKLPVSGSHSIVGAMVGFALIIQGPAGIAWKKLGMIVASWFVSPLLSGLVSAFVFFIFDKFILKKSESREPALNFLPFIYAITIFINFFSIFLTGPTLLKFDKIPLYGNFXXXXXXXXXXXXXXRFALVPYLRKII---LKSEPIE 882
            GAKVS+TIRKG+I       +   +   ++M G +S++                G  +W LVA+FLKLP+SG+H IVGA +GF+L+ +G  G+ W +L  IV SWFVSPLLSG++S  +FF+   FIL K++     L  LP  YA T+ IN FSI  TG  LL FDK+PL+G  +IS+G +V   ++V F + P +++ I   +K  P E
Sbjct:   78 GAKVSETIRKGLID-----VEMYNSTQGLLMAGSVSAM---------------FGSAVWQLVASFLKLPISGTHCIVGATIGFSLVAKGQEGVKWSELIKIVMSWFVSPLLSGIMSGILFFLVRAFILHKADPVPNGLRALPVFYACTVGINLFSIMYTGAPLLGFDKLPLWGTILISVGCAVFCALIVWFFVCPRMKRKIEREIKCSPSE 268          

HSP 3 Score: 90.5077 bits (223), Expect = 7.132e-54
Identity = 40/59 (67.80%), Postives = 55/59 (93.22%), Query Frame = 3
Query:   39 DQIWIVVVGFLIAFILAFGIGANDVANSFGTSVGSKVISLRKACILASIFEVLGSILLG 215
            D +W++++GF+IAF+LAF +GANDVANSFGT+VGS V++L++ACILASIFE +GS+LLG
Sbjct:   20 DYLWMLILGFIIAFVLAFSVGANDVANSFGTAVGSGVVTLKQACILASIFETVGSVLLG 78          

HSP 4 Score: 58.5362 bits (140), Expect = 1.265e-7
Identity = 48/160 (30.00%), Postives = 75/160 (46.88%), Query Frame = 1
Query: 1198 SFAHGGNDVSNAIGPLVGLWIIAITQDVYSTEAVPIWVLVYGGLGITVGLWVWGRRVMKTIGD---DLTTITPTSG------VSIELGAAVTVLIASNIGIPISTTHCKVGSIVAVGRY-RSNDNVDWSIFRNICFAWLVTVPVSAGISALTMFLLRMLI 1647
            +F+ G NDV+N+ G  VG  ++ + Q             +   +  TVG  + G +V +TI     D+     T G      VS   G+AV  L+AS + +PIS THC VG+ +      +  + V WS    I  +W V+  +S  +S +  FL+R  I
Sbjct:   36 AFSVGANDVANSFGTAVGSGVVTLKQ-----------ACILASIFETVGSVLLGAKVSETIRKGLIDVEMYNSTQGLLMAGSVSAMFGSAVWQLVASFLKLPISGTHCIVGATIGFSLVAKGQEGVKWSELIKIVMSWFVSPLLSGIMSGILFFLVRAFI 184          
BLAST of slc20a-2 vs. TrEMBL
Match: A0A0H3YF29 (Phosphate transporter OS=Schmidtea mediterranea OX=79327 GN=slc20a-2 PE=2 SV=1)

HSP 1 Score: 744.577 bits (1921), Expect = 0.000e+0
Identity = 434/434 (100.00%), Postives = 434/434 (100.00%), Query Frame = 1
Query:  346 MMIGQLSSLSGRSLFICCMKFNFYLGGCLWLLVATFLKLPVSGSHSIVGAMVGFALIIQGPAGIAWKKLGMIVASWFVSPLLSGLVSAFVFFIFDKFILKKSESREPALNFLPFIYAITIFINFFSIFLTGPTLLKFDKIPLYGNFXXXXXXXXXXXXXXRFALVPYLRKIILKSEPIEGXXXXXXXXXXXXXXXXLDINIDEDTQTNKLNXXXXXXXXXXXXXXXXXXXXXXXXXXMCEVSLEDIKENSTEVECKTVEKTVIKDKPELVTIFSWVQVLTAIFGSFAHGGNDVSNAIGPLVGLWIIAITQDVYSTEAVPIWVLVYGGLGITVGLWVWGRRVMKTIGDDLTTITPTSGVSIELGAAVTVLIASNIGIPISTTHCKVGSIVAVGRYRSNDNVDWSIFRNICFAWLVTVPVSAGISALTMFLLRMLI 1647
            MMIGQLSSLSGRSLFICCMKFNFYLGGCLWLLVATFLKLPVSGSHSIVGAMVGFALIIQGPAGIAWKKLGMIVASWFVSPLLSGLVSAFVFFIFDKFILKKSESREPALNFLPFIYAITIFINFFSIFLTGPTLLKFDKIPLYGNFIISIGLSVITIIVVRFALVPYLRKIILKSEPIEGVTVVSNVPSVEEVNENLDINIDEDTQTNKLNSEEETITIKISEDKETETETDLTKKEMCEVSLEDIKENSTEVECKTVEKTVIKDKPELVTIFSWVQVLTAIFGSFAHGGNDVSNAIGPLVGLWIIAITQDVYSTEAVPIWVLVYGGLGITVGLWVWGRRVMKTIGDDLTTITPTSGVSIELGAAVTVLIASNIGIPISTTHCKVGSIVAVGRYRSNDNVDWSIFRNICFAWLVTVPVSAGISALTMFLLRMLI
Sbjct:    1 MMIGQLSSLSGRSLFICCMKFNFYLGGCLWLLVATFLKLPVSGSHSIVGAMVGFALIIQGPAGIAWKKLGMIVASWFVSPLLSGLVSAFVFFIFDKFILKKSESREPALNFLPFIYAITIFINFFSIFLTGPTLLKFDKIPLYGNFIISIGLSVITIIVVRFALVPYLRKIILKSEPIEGVTVVSNVPSVEEVNENLDINIDEDTQTNKLNSEEETITIKISEDKETETETDLTKKEMCEVSLEDIKENSTEVECKTVEKTVIKDKPELVTIFSWVQVLTAIFGSFAHGGNDVSNAIGPLVGLWIIAITQDVYSTEAVPIWVLVYGGLGITVGLWVWGRRVMKTIGDDLTTITPTSGVSIELGAAVTVLIASNIGIPISTTHCKVGSIVAVGRYRSNDNVDWSIFRNICFAWLVTVPVSAGISALTMFLLRMLI 434          
BLAST of slc20a-2 vs. TrEMBL
Match: A0A1I8GFH2 (Phosphate transporter OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig001071g2 PE=3 SV=1)

HSP 1 Score: 409.453 bits (1051), Expect = 3.617e-134
Identity = 234/470 (49.79%), Postives = 297/470 (63.19%), Query Frame = 1
Query:  259 GAKVSDTIRKGVISPDALAAQN----LTNLPQVMMIGQLSSLSGRSLFICCMKFNFYLGGCLWLLVATFLKLPVSGSHSIVGAMVGFALIIQGPAGIAWKKLGMIVASWFVSPLLSGLVSAFVFFIFDKFILKKSESREPALNFLPFIYAITIFINFFSIFLTGPTLLKFDKIPLYGNFXXXXXXXXXXXXXXRFALVPYLRKII---LKSEPIEGXXXXXXXXXXXXXXXXLDINIDEDTQTNKLNXXXXXXXXXXXXXXXXXXXXXXXXXXMCEVSLEDIKENSTEVECKTVEKTVIKDKPELVTIFSWVQVLTAIFGSFAHGGNDVSNAIGPLVGLWIIAITQDVYSTEAVPIWVLVYGGLGITVGLWVWGRRVMKTIGDDLTTITPTSGVSIELGAAVTVLIASNIGIPISTTHCKVGSIVAVGRYRSNDNVDWSIFRNICFAWLVTVPVSAGISALTMFLLRMLI 1647
            GAKVS+TIRKG+I  D     N     T   Q++MIGQLSSLSG                C+WLLVATF ++PVSG+HSIVGA VGFAL+     G+ W +LG+IVASWF+SPLLSG +S  +F+    FIL K ++ EP L FLP IY++TI IN FS    GP  L F  IPL+G  + S G+ +I  I+V+  L+P+ RK I   L+  P E    V++ PS    +  L  + D  TQ  K   +                          E    + ++ +   +     K  I D+PE   IF+W+Q+LTAIFG+FAHGGNDVSNAIGPL+GLW++A T D+    A PIW+LVYGG GI++GLW+WGRRV++T+G+DLTTITP+SG  IELGAA+ VLIASNIGIPISTTHCKVGS+V VG +RS DNV+WSIFRNI  AWLVT+P S  ISA  M  L  L+
Sbjct:   70 GAKVSETIRKGIIDTDYYVELNNNGTSTTGSQLLMIGQLSSLSGT---------------CIWLLVATFFRVPVSGTHSIVGATVGFALVANAQTGVDWARLGLIVASWFISPLLSGGISIALFYFIKVFILTKPDALEPGLRFLPLIYSVTIAINVFSTVYEGPESLYFHVIPLWGAILASFGVGIICSILVKLVLIPWQRKRIIAELRDNPPE--ESVADAPSEAGSSVALSSHSDSTTQQRKAKYKPIESAEDE------------------EPIQSEQQQGAKGGKADNKSKKAIVDRPEQARIFAWLQILTAIFGAFAHGGNDVSNAIGPLIGLWVVATTGDIAGKVASPIWILVYGGFGISIGLWIWGRRVIQTLGEDLTTITPSSGFCIELGAAMAVLIASNIGIPISTTHCKVGSVVLVGFFRSRDNVEWSIFRNIIIAWLVTLPASGAISAALMAGLSRLV 504          

HSP 2 Score: 98.2117 bits (243), Expect = 5.959e-18
Identity = 45/62 (72.58%), Postives = 58/62 (93.55%), Query Frame = 3
Query:   30 VPPDQIWIVVVGFLIAFILAFGIGANDVANSFGTSVGSKVISLRKACILASIFEVLGSILLG 215
            +P + +WIVV+GF+IAF+LAFGIGANDVANSFGTSVGSKV++L++ACILA+IFE  G++LLG
Sbjct:    9 IPEEYLWIVVLGFIIAFVLAFGIGANDVANSFGTSVGSKVLTLKQACILATIFETAGAVLLG 70          
BLAST of slc20a-2 vs. TrEMBL
Match: A0A2T7PFC6 (Phosphate transporter OS=Pomacea canaliculata OX=400727 GN=C0Q70_07535 PE=3 SV=1)

HSP 1 Score: 390.578 bits (1002), Expect = 2.092e-127
Identity = 225/464 (48.49%), Postives = 288/464 (62.07%), Query Frame = 1
Query:  259 GAKVSDTIRKGVISPDALAAQNLTNLPQVMMIGQLSSLSGRSLFICCMKFNFYLGGCLWLLVATFLKLPVSGSHSIVGAMVGFALIIQGPAGIAWKKLGMIVASWFVSPLLSGLVSAFVFFIFDKFILKKSESREPALNFLPFIYAITIFINFFSIFLTGPTLLKFDKIPLYGNFXXXXXXXXXXXXXXRFALVPYLRKIILKSEPIEGXXXXXXXXXXXXXXXXLDINIDEDTQTNKLNXXXXXXXXXXXXXXXXXXXXXXXXXXMCEVSLED-IKENSTEVECKTVEKTVIKDKPELVTIFSWVQVLTAIFGSFAHGGNDVSNAIGPLVGLWIIAITQDVYSTEAVPIWVLVYGGLGITVGLWVWGRRVMKTIGDDLTTITPTSGVSIELGAAVTVLIASNIGIPISTTHCKVGSIVAVGRYRSNDNVDWSIFRNICFAWLVTVPVSAGISALTMFLLRMLI 1647
            G +VSDTIRKG+I                     +   +G    +     +   G C+WLL+ATFL+LPVS +HSIVGA +GF L+ +G  G+ W KLG+IVASWF+SP+ SG+VS  +F +  K +LKK    +  L  LPF Y+ TIFIN FS+F  G TLL+FDKIP+YG  I+S+G+S+IT ++VR  +VP+ RK I             +             +   + Q N      +     +      +       K   +   ED +  + TE  C   EK  I+DKPE   +FS++QVLTA+FGSFAHGGNDVSNAIGPLVGLWIIA  Q V      PIWVLVYGG+GI+VGLWVWGRRV+KT+G+DL+ ITPTSG  IE+GAA+TVL+ASNIG+PISTTHCKVGSIV VGR RS+DNVDW +FRNI  AWLVT+P S   SA  M + +  I
Sbjct:   63 GYRVSDTIRKGII--------------------DVQPYNGTERLLLLGNLSALSGSCIWLLLATFLRLPVSATHSIVGATIGFTLVAKGSQGVGWMKLGLIVASWFISPISSGIVSVLLFLLIQKLVLKKVNQLDIGLFLLPFFYSATIFINVFSVFHDGSTLLQFDKIPIYGVVILSVGISIITGVIVRVFVVPWQRKKITGKWHARKDENNQHRN-----------HWRHEKQNNTRLLTVKEEEKVVFTSISNKEHCVFAAKLEEDARAEDHVTPDKTEENCALTEKE-IQDKPETAHLFSFLQVLTAVFGSFAHGGNDVSNAIGPLVGLWIIAQEQSVAQKAPTPIWVLVYGGVGISVGLWVWGRRVIKTMGEDLSKITPTSGFCIEVGAALTVLVASNIGLPISTTHCKVGSIVFVGRLRSHDNVDWLLFRNIFIAWLVTLPASGAFSAALMAIFKYAI 494          

HSP 2 Score: 97.0561 bits (240), Expect = 2.092e-127
Identity = 44/62 (70.97%), Postives = 59/62 (95.16%), Query Frame = 3
Query:   30 VPPDQIWIVVVGFLIAFILAFGIGANDVANSFGTSVGSKVISLRKACILASIFEVLGSILLG 215
            +P + +WIVVVGF+++FILAFGIGANDVANSFGTSVG+KV++L +ACILA+IFE+LG++L+G
Sbjct:    2 IPEEWLWIVVVGFIVSFILAFGIGANDVANSFGTSVGAKVLTLVQACILATIFEILGAVLIG 63          
BLAST of slc20a-2 vs. TrEMBL
Match: V4APQ8 (Phosphate transporter OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_239412 PE=3 SV=1)

HSP 1 Score: 382.874 bits (982), Expect = 2.132e-125
Identity = 218/470 (46.38%), Postives = 299/470 (63.62%), Query Frame = 1
Query:  259 GAKVSDTIRKGVISPDALAAQNLTNLPQVMMIGQLSSLSGRSLFICCMKFNFYLGGCLWLLVATFLKLPVSGSHSIVGAMVGFALIIQGPAGIAWKKLGMIVASWFVSPLLSGLVSAFVFFIFDKFILKKSESREPALNFLPFIYAITIFINFFSIFLTGPTLLKFDKIPLYGNFXXXXXXXXXXXXXXRFALVPYLRKIILKSEPIEGXXXXXXXXXXXXXXXXLDIN--IDEDTQTNKLNXXXXXXXXXXXXXXXXXXXXXXXXXXMCEVSLEDIKEN-----STEVECKTVEKTVIKDKPELVTIFSWVQVLTAIFGSFAHGGNDVSNAIGPLVGLWIIAITQDVYSTEAVPIWVLVYGGLGITVGLWVWGRRVMKTIGDDLTTITPTSGVSIELGAAVTVLIASNIGIPISTTHCKVGSIVAVGRYRSNDNVDWSIFRNICFAWLVTVPVSAGISALTMFLLRMLI 1647
            G++VSDTIRKG+I          +     +++G +++L G                C+WLL AT ++LPVS +HSIVGA +GF+L+ QG  GI W KLGMI+ SWF+SPLLSGLVS  +F +  + +L K +  EP L  LP  Y +T+ IN FS+F  G  +L FDKIPLYG FI+S+GL +I  +VV+F +VP+ RK IL+                ++  +  +    + +D   N+ N +       I ++ +         + + +     I E       T ++ K +++   +DKPE   +FS++Q+LTA+FGSFAHGGNDVSNAIGP+V LW+I+    V      P+W+L+YGG+GI++GL VWGRRVMKT+G+DL+ ITP+SG SIE+G+A+TVLIASNIGIPISTTHCKVGSIV VGR RSN+NVDWS+FRNI  AWLVT+PVS G+SA     LR  I
Sbjct:   64 GSRVSDTIRKGIIDVSPYNGSESS-----LIMGNVAALGGT---------------CVWLLTATAIRLPVSATHSIVGATLGFSLVAQGAKGIGWVKLGMIIGSWFISPLLSGLVSMLLFILLRRLVLSKEKPLEPGLRLLPIFYGVTVVINSFSVFYDGSRMLHFDKIPLYGVFILSLGLGIIIAVVVKFVVVPWQRKRILEYSEFLNCRKNEVNQDQKKKLDYSECRSLLHQDDNGNQNNQKLPEDNSPIVKNSKIYNPFKKVLRSISKDEAPKIDEEVTADAETPLKSKDLDEKTQEDKPEAARLFSFLQILTAVFGSFAHGGNDVSNAIGPVVALWMISNEGSVMQKAPTPVWILLYGGVGISLGLCVWGRRVMKTMGEDLSKITPSSGFSIEIGSALTVLIASNIGIPISTTHCKVGSIVFVGRARSNENVDWSLFRNIIIAWLVTLPVSGGLSAAIFAGLRETI 513          

HSP 2 Score: 97.8265 bits (242), Expect = 2.132e-125
Identity = 45/62 (72.58%), Postives = 58/62 (93.55%), Query Frame = 3
Query:   30 VPPDQIWIVVVGFLIAFILAFGIGANDVANSFGTSVGSKVISLRKACILASIFEVLGSILLG 215
            +P + +W V+VGF+IAF+LAFGIGANDVANSFGTSVG+KV+SLR+ACILA+IFE+ G+IL+G
Sbjct:    3 IPEEWLWPVIVGFIIAFVLAFGIGANDVANSFGTSVGAKVLSLRQACILATIFEIAGAILIG 64          
BLAST of slc20a-2 vs. TrEMBL
Match: A0A210QKP1 (Phosphate transporter OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT24012 PE=3 SV=1)

HSP 1 Score: 385.956 bits (990), Expect = 4.332e-125
Identity = 225/490 (45.92%), Postives = 297/490 (60.61%), Query Frame = 1
Query:  202 QSYWVGSIYFNYYLFELYKGAKVSDTIRKGVISPDALAAQNLTNLPQVMMIGQLSSLSGRSLFICCMKFNFYLGGCLWLLVATFLKLPVSGSHSIVGAMVGFALIIQGPAGIAWKKLGMIVASWFVSPLLSGLVSAFVFFIFDKFILKKSESREPALNFLPFIYAITIFINFFSIFLTGPTLLKFDKIPLYGNFXXXXXXXXXXXXXXRFALVPYLRKIILKSEPIEGXXXXXXXXXXXXXXXXLDINIDEDTQTNKLNXXXXXXXXXXXXXXXXXXXXXXXXXXMCEVSLEDIKENS--------TEVECKTVEKTVIKDKPELVTIFSWVQVLTAIFGSFAHGGNDVSNAIGPLVGLWIIAITQDVYSTEAVPIWVLVYGGLGITVGLWVWGRRVMKTIGDDLTTITPTSGVSIELGAAVTVLIASNIGIPISTTHCKVGSIVAVGRYRSNDNVDWSIFRNICFAWLVTVPVSAGISALTMFLLRMLI 1647
            Q+  +GSI+    L  +  G +VSDTIRKG+I  D     N +   +V+M G +++L+G                C+WL+ AT +  PVS +HSIVGA +GF+L+ +G +GI W K+G IV SWF SP+LSG+VS   F   +K +L+K +S E  L  LPF Y +T  IN FSIF  G  LL+FDKIPLYG F+I+ GLS++  I VR  +VP+ R+ I                         +  IDE  Q  +                                 LE + +N          EV  K + ++ IKDKPE+V +FS++Q+LTA+FGSFAHGGNDVSN+IGPLV +W+IA         + P+W+LVYGG+GI +GLW+WGRRV+KT+GDDLT ITP+SG  IELG+A+TVLIASNIGIPISTTHCK+GS+V VGR RS +NVDW +FRNI  AW+VT+PVS  ISAL M  L+ LI
Sbjct:   81 QACILGSIF--EMLGAILIGYRVSDTIRKGII--DVEMYNNGSE--KVLMAGNIATLTGS---------------CVWLIAATIMCFPVSTTHSIVGAAIGFSLVAKGASGIKWIKIGFIVGSWFFSPILSGVVSLLTFMFINKMVLQKEKSLESGLMLLPFFYGLTAAINLFSIFYEGSNLLQFDKIPLYGVFVITCGLSLLVAIGVRVFVVPWSRRKITDE---------------------CNQKIDEKNQEVE-----------------------------NATELEQLNDNEDLPDIVFENEVPSKKIRES-IKDKPEVVKLFSFLQILTAVFGSFAHGGNDVSNSIGPLVAIWMIAKEGTAMQASSTPLWILVYGGVGIVIGLWIWGRRVIKTVGDDLTKITPSSGFCIELGSALTVLIASNIGIPISTTHCKIGSVVFVGRVRSKENVDWKLFRNIIIAWVVTLPVSGAISALAMLGLQELI 498          

HSP 2 Score: 95.9005 bits (237), Expect = 3.451e-17
Identity = 44/62 (70.97%), Postives = 58/62 (93.55%), Query Frame = 3
Query:   30 VPPDQIWIVVVGFLIAFILAFGIGANDVANSFGTSVGSKVISLRKACILASIFEVLGSILLG 215
            +P + +W+V+VGF+IAFIL+ GIGANDVANSFGTSVGS+V++LR+ACIL SIFE+LG+IL+G
Sbjct:   37 IPEEYLWMVIVGFIIAFILSCGIGANDVANSFGTSVGSRVLTLRQACILGSIFEMLGAILIG 98          
BLAST of slc20a-2 vs. Ensembl Cavefish
Match: slc20a1b (solute carrier family 20 member 1 [Source:NCBI gene;Acc:103043057])

HSP 1 Score: 234.187 bits (596), Expect = 1.649e-68
Identity = 115/195 (58.97%), Postives = 142/195 (72.82%), Query Frame = 1
Query: 1063 EVSLEDIKENSTEVECKTVEKTVIKDKPELVTIFSWVQVLTAIFGSFAHGGNDVSNAIGPLVGLWIIAITQDVYSTEAVPIWVLVYGGLGITVGLWVWGRRVMKTIGDDLTTITPTSGVSIELGAAVTVLIASNIGIPISTTHCKVGSIVAVGRYRSNDNVDWSIFRNICFAWLVTVPVSAGISALTMFLLRMLI 1647
            EV+LE  +E+         E     DKPE+  +F ++Q+LTA FGSFAHGGNDVSNAIGPLV LW++  +  V S    PIW+L+YGG+GI  GLWVWGRRV++T+G DLT ITP+SG SIEL +AVTV++ASNIG+P+STTHCKVGS+VAVG  RS   VDW +FRNI  AW VTVP+S  ISA  M L   +I
Sbjct:  469 EVTLEVGEEDRESSRSSLEEDRAEADKPEVSMLFQFLQILTACFGSFAHGGNDVSNAIGPLVALWLVYESGSVESNAPTPIWLLLYGGVGICAGLWVWGRRVIQTMGKDLTPITPSSGFSIELASAVTVVVASNIGLPVSTTHCKVGSVVAVGWMRSRKAVDWRLFRNIFMAWFVTVPISGLISAAIMALFTYVI 663          

HSP 2 Score: 145.976 bits (367), Expect = 4.598e-55
Identity = 90/205 (43.90%), Postives = 130/205 (63.41%), Query Frame = 1
Query:  259 GAKVSDTIRKGVISPDALAAQNLTN-LPQVMMIGQLSSLSGRSLFICCMKFNFYLGGCLWLLVATFLKLPVSGSHSIVGAMVGFALIIQGPAGIAWKKLGMIVASWFVSPLLSGLVSAFVFFIFDKFILKKSESREPALNFLPFIYAITIFINFFSIFLTGPTLLKFDKIPLYGNFXXXXXXXXXXXXXXRFALVPYLRKIILKS 870
            GAKVS+TIRKG+I        N+ N    V+M G +S++               +G  +W LVA+FLKLP+SG+H IVGA +G++L+ +G  G+ W +L  IVASWF+SPLLSGL+SA +F+    FIL+K +     L  LP  YA+T+ IN FSI  TG  ++ FDK+P +G  +ISIG +++T I+V FA+ P L++ I + 
Sbjct:   83 GAKVSETIRKGIID------VNMYNGTEHVLMAGSVSAM---------------VGSAVWQLVASFLKLPISGTHCIVGATIGYSLVAKGQQGVQWFQLLRIVASWFLSPLLSGLMSAILFYFVRMFILQKKDPVPNGLKALPVFYAVTMGINLFSIMFTGAPVMGFDKLPWWGTLLISIGCAILTGIIVWFAVCPCLKRKIERE 266          

HSP 3 Score: 89.3521 bits (220), Expect = 4.598e-55
Identity = 39/59 (66.10%), Postives = 54/59 (91.53%), Query Frame = 3
Query:   39 DQIWIVVVGFLIAFILAFGIGANDVANSFGTSVGSKVISLRKACILASIFEVLGSILLG 215
            D +W+++VGF+IAFILAF +GANDVANSFGT+VGS V++L+ AC+LA++FE LGS++LG
Sbjct:   25 DYMWLLIVGFIIAFILAFSVGANDVANSFGTAVGSGVVTLKVACVLATVFETLGSVMLG 83          

HSP 4 Score: 49.6766 bits (117), Expect = 8.363e-6
Identity = 43/160 (26.88%), Postives = 74/160 (46.25%), Query Frame = 1
Query: 1198 SFAHGGNDVSNAIGPLVGLWIIAITQDVYSTEAVPIWVLVYGGLGITVGLWVWGRRVMKTIGDDLTTITPTSG---------VSIELGAAVTVLIASNIGIPISTTHCKVGSIVAVGR-YRSNDNVDWSIFRNICFAWLVTVPVSAGISALTMFLLRMLI 1647
            +F+ G NDV+N+ G  VG  ++ +               V   +  T+G  + G +V +TI   +  +   +G         VS  +G+AV  L+AS + +PIS THC VG+ +      +    V W     I  +W ++  +S  +SA+  + +RM I
Sbjct:   41 AFSVGANDVANSFGTAVGSGVVTLKV-----------ACVLATVFETLGSVMLGAKVSETIRKGIIDVNMYNGTEHVLMAGSVSAMVGSAVWQLVASFLKLPISGTHCIVGATIGYSLVAKGQQGVQWFQLLRIVASWFLSPLLSGLMSAILFYFVRMFI 189          
BLAST of slc20a-2 vs. Ensembl Cavefish
Match: slc20a1a (sodium-dependent phosphate transporter 1-A-like [Source:NCBI gene;Acc:103027865])

HSP 1 Score: 223.016 bits (567), Expect = 1.246e-64
Identity = 106/162 (65.43%), Postives = 129/162 (79.63%), Query Frame = 1
Query: 1141 KPELVTIFSWVQVLTAIFGSFAHGGNDVSNAIGPLVGLWIIAITQDVYSTEAVPIWVLVYGGLGITVGLWVWGRRVMKTIGDDLTTITPTSGVSIELGAAVTVLIASNIGIPISTTHCKVGSIVAVGRYRSNDNVDWSIFRNICFAWLVTVPVSAGISALTM 1626
            KPE+  +F ++Q+LTA FGSFAHGGNDVSNAIGPL+ LW++     V S    PIW+L+YGGLGI +GLWVWGRRV++T+G DLT ITP+SG SIEL +AVTV++ASNIG+P+STTHCKVGS+VAVG  RS   VDW +FRNI  AW VTVP+S  ISA  M
Sbjct:  462 KPEVSMLFRFLQILTACFGSFAHGGNDVSNAIGPLIALWVVYKNASVTSNAPTPIWLLLYGGLGICMGLWVWGRRVIQTMGKDLTPITPSSGFSIELASAVTVVVASNIGLPVSTTHCKVGSVVAVGWLRSRKAVDWLLFRNIFIAWFVTVPISGLISAAVM 623          

HSP 2 Score: 140.584 bits (353), Expect = 1.978e-53
Identity = 85/200 (42.50%), Postives = 126/200 (63.00%), Query Frame = 1
Query:  259 GAKVSDTIRKGVISPDALAAQNLTNLPQ-VMMIGQLSSLSGRSLFICCMKFNFYLGGCLWLLVATFLKLPVSGSHSIVGAMVGFALIIQGPAGIAWKKLGMIVASWFVSPLLSGLVSAFVFFIFDKFILKKSESREPALNFLPFIYAITIFINFFSIFLTGPTLLKFDKIPLYGNFXXXXXXXXXXXXXXRFALVPYLRK 855
            GAKVS+TIR G+I        N+ N  + ++M G +S++                G  +W LVA+FLKLP+SG+H IVGA +GF+++ +G  G+ W +L  IVASWF+SPLLSG++SA +F+   KFIL K +     L  LP  YA+T+ IN FSI  TG  +L F+K+P +G  +IS+G +++T ++V F + P L+K
Sbjct:   83 GAKVSETIRSGIID------INMYNGSEPLLMAGSISAM---------------FGSAVWQLVASFLKLPISGTHCIVGATIGFSMVARGYQGVRWLELLRIVASWFLSPLLSGMMSAVLFYTVRKFILNKDDPMVNGLRALPIFYAVTMGINLFSIMFTGAPMLGFNKVPWWGTLLISLGCALLTAVLVWFVVCPRLKK 261          

HSP 3 Score: 89.3521 bits (220), Expect = 1.978e-53
Identity = 40/57 (70.18%), Postives = 54/57 (94.74%), Query Frame = 3
Query:   45 IWIVVVGFLIAFILAFGIGANDVANSFGTSVGSKVISLRKACILASIFEVLGSILLG 215
            +W++++GF+IAFILAF +GANDVANSFGT+VGS V++LR+ACILA+IFE +G+ILLG
Sbjct:   27 LWLLILGFIIAFILAFSVGANDVANSFGTAVGSGVVTLRQACILATIFETIGAILLG 83          

HSP 4 Score: 51.9878 bits (123), Expect = 1.499e-6
Identity = 52/200 (26.00%), Postives = 90/200 (45.00%), Query Frame = 1
Query: 1087 ENSTEVECKTVEKTVIKDKPELVTIFSWVQVLTAIFG---SFAHGGNDVSNAIGPLVGLWIIAITQDVYSTEAVPIWVLVYGGLGITVGLWVWGRRVMKTIGDDLTTITPTSG---------VSIELGAAVTVLIASNIGIPISTTHCKVGSIVAVGRY-RSNDNVDWSIFRNICFAWLVTVPVSAGISALTMFLLRMLI 1647
            E++T V   TV    +  +  L + + W+ +L  I     +F+ G NDV+N+ G  VG  ++ + Q             +   +  T+G  + G +V +TI   +  I   +G         +S   G+AV  L+AS + +PIS THC VG+ +      R    V W     I  +W ++  +S  +SA+  + +R  I
Sbjct:    2 ESTTPVSFITVTTEALPVESTL-SAYLWLLILGFIIAFILAFSVGANDVANSFGTAVGSGVVTLRQ-----------ACILATIFETIGAILLGAKVSETIRSGIIDINMYNGSEPLLMAGSISAMFGSAVWQLVASFLKLPISGTHCIVGATIGFSMVARGYQGVRWLELLRIVASWFLSPLLSGMMSAVLFYTVRKFI 189          
BLAST of slc20a-2 vs. Ensembl Cavefish
Match: slc20a2 (solute carrier family 20 member 2 [Source:NCBI gene;Acc:103032054])

HSP 1 Score: 221.09 bits (562), Expect = 1.412e-63
Identity = 106/172 (61.63%), Postives = 129/172 (75.00%), Query Frame = 1
Query: 1120 EKTVIKDKPELVTIFSWVQVLTAIFGSFAHGGNDVSNAIGPLVGLWIIAITQDVYSTEAVPIWVLVYGGLGITVGLWVWGRRVMKTIGDDLTTITPTSGVSIELGAAVTVLIASNIGIPISTTHCKVGSIVAVGRYRSNDNVDWSIFRNICFAWLVTVPVSAGISALTMFLL 1635
            E    +DKP++  +F ++Q+LTA FGSFAHGGNDVSNAIGPLV LW+I     V      P+W+L YGG+GI  GLWVWGRRV++T+G DLT ITP+SG +IEL +AVTV++ASNIG+PISTTHCKVGS+VAVG  RS   VDW +FRNI  AW VTVPV+   SA  M L 
Sbjct:  483 EDKEERDKPQVFLLFHFLQILTACFGSFAHGGNDVSNAIGPLVALWMIYEQGGVMQNSTTPVWLLFYGGVGICAGLWVWGRRVIQTMGKDLTPITPSSGFTIELASAVTVVLASNIGLPISTTHCKVGSVVAVGWLRSQKAVDWRLFRNIFLAWFVTVPVAGLFSAAVMALF 654          

HSP 2 Score: 126.716 bits (317), Expect = 2.662e-50
Identity = 71/172 (41.28%), Postives = 107/172 (62.21%), Query Frame = 1
Query:  259 GAKVSDTIRKGVISPDALAAQNLTNLPQVMMIGQLSSLSGRSLFICCMKFNFYLGGCLWLLVATFLKLPVSGSHSIVGAMVGFALIIQGPAGIAWKKLGMIVASWFVSPLLSGLVSAFVFFIFDKFILKKSESREPALNFLPFIYAITIFINFFSIFLTGPTLLKFDKIPLY 774
            GAKV +TIRKG+I    ++  N T +P ++M G++S++               +G  +W L+A+FLKLP+SG+H IVG+ +GF+++  G  G+ W +L  IVASWF+SPLLSG++S  +F++   FIL K +     L  LP  YA TI IN FSI  TG  +L  + +P++
Sbjct:   63 GAKVGETIRKGIID---VSLYNET-VP-ILMAGEVSAM---------------VGSAVWQLIASFLKLPISGTHCIVGSTIGFSMVAIGTKGVQWMQLVKIVASWFISPLLSGIMSGLLFYVIRYFILSKDDPVPNGLRALPLFYASTIGINTFSIMYTGAPMLGIEMLPVW 214          

HSP 3 Score: 92.4337 bits (228), Expect = 2.662e-50
Identity = 42/57 (73.68%), Postives = 54/57 (94.74%), Query Frame = 3
Query:   45 IWIVVVGFLIAFILAFGIGANDVANSFGTSVGSKVISLRKACILASIFEVLGSILLG 215
            +W+V++GF+IAF+LAF +GANDVANSFGT+VGS V++LR+ACILASIFE LGS+LLG
Sbjct:    7 LWMVIIGFIIAFVLAFSVGANDVANSFGTAVGSGVVTLRQACILASIFETLGSMLLG 63          

HSP 4 Score: 51.2174 bits (121), Expect = 2.607e-6
Identity = 47/164 (28.66%), Postives = 76/164 (46.34%), Query Frame = 1
Query: 1198 SFAHGGNDVSNAIGPLVGLWIIAITQDVYSTEAVPIWVLVYGGLGITVGLWVWGRRVMKTIG---------DDLTTITPTSGVSIELGAAVTVLIASNIGIPISTTHCKVG-----SIVAVGRYRSNDNVDWSIFRNICFAWLVTVPVSAGISALTMFLLRMLI 1647
            +F+ G NDV+N+ G  VG  ++ + Q             +   +  T+G  + G +V +TI          ++   I     VS  +G+AV  LIAS + +PIS THC VG     S+VA+G       V W     I  +W ++  +S  +S L  +++R  I
Sbjct:   21 AFSVGANDVANSFGTAVGSGVVTLRQ-----------ACILASIFETLGSMLLGAKVGETIRKGIIDVSLYNETVPILMAGEVSAMVGSAVWQLIASFLKLPISGTHCIVGSTIGFSMVAIG----TKGVQWMQLVKIVASWFISPLLSGIMSGLLFYVIRYFI 169          
BLAST of slc20a-2 vs. Ensembl Cavefish
Match: slc20a2 (solute carrier family 20 member 2 [Source:NCBI gene;Acc:103032054])

HSP 1 Score: 221.09 bits (562), Expect = 1.412e-63
Identity = 106/172 (61.63%), Postives = 129/172 (75.00%), Query Frame = 1
Query: 1120 EKTVIKDKPELVTIFSWVQVLTAIFGSFAHGGNDVSNAIGPLVGLWIIAITQDVYSTEAVPIWVLVYGGLGITVGLWVWGRRVMKTIGDDLTTITPTSGVSIELGAAVTVLIASNIGIPISTTHCKVGSIVAVGRYRSNDNVDWSIFRNICFAWLVTVPVSAGISALTMFLL 1635
            E    +DKP++  +F ++Q+LTA FGSFAHGGNDVSNAIGPLV LW+I     V      P+W+L YGG+GI  GLWVWGRRV++T+G DLT ITP+SG +IEL +AVTV++ASNIG+PISTTHCKVGS+VAVG  RS   VDW +FRNI  AW VTVPV+   SA  M L 
Sbjct:  483 EDKEERDKPQVFLLFHFLQILTACFGSFAHGGNDVSNAIGPLVALWMIYEQGGVMQNSTTPVWLLFYGGVGICAGLWVWGRRVIQTMGKDLTPITPSSGFTIELASAVTVVLASNIGLPISTTHCKVGSVVAVGWLRSQKAVDWRLFRNIFLAWFVTVPVAGLFSAAVMALF 654          

HSP 2 Score: 126.716 bits (317), Expect = 2.662e-50
Identity = 71/172 (41.28%), Postives = 107/172 (62.21%), Query Frame = 1
Query:  259 GAKVSDTIRKGVISPDALAAQNLTNLPQVMMIGQLSSLSGRSLFICCMKFNFYLGGCLWLLVATFLKLPVSGSHSIVGAMVGFALIIQGPAGIAWKKLGMIVASWFVSPLLSGLVSAFVFFIFDKFILKKSESREPALNFLPFIYAITIFINFFSIFLTGPTLLKFDKIPLY 774
            GAKV +TIRKG+I    ++  N T +P ++M G++S++               +G  +W L+A+FLKLP+SG+H IVG+ +GF+++  G  G+ W +L  IVASWF+SPLLSG++S  +F++   FIL K +     L  LP  YA TI IN FSI  TG  +L  + +P++
Sbjct:   63 GAKVGETIRKGIID---VSLYNET-VP-ILMAGEVSAM---------------VGSAVWQLIASFLKLPISGTHCIVGSTIGFSMVAIGTKGVQWMQLVKIVASWFISPLLSGIMSGLLFYVIRYFILSKDDPVPNGLRALPLFYASTIGINTFSIMYTGAPMLGIEMLPVW 214          

HSP 3 Score: 92.4337 bits (228), Expect = 2.662e-50
Identity = 42/57 (73.68%), Postives = 54/57 (94.74%), Query Frame = 3
Query:   45 IWIVVVGFLIAFILAFGIGANDVANSFGTSVGSKVISLRKACILASIFEVLGSILLG 215
            +W+V++GF+IAF+LAF +GANDVANSFGT+VGS V++LR+ACILASIFE LGS+LLG
Sbjct:    7 LWMVIIGFIIAFVLAFSVGANDVANSFGTAVGSGVVTLRQACILASIFETLGSMLLG 63          

HSP 4 Score: 51.2174 bits (121), Expect = 2.607e-6
Identity = 47/164 (28.66%), Postives = 76/164 (46.34%), Query Frame = 1
Query: 1198 SFAHGGNDVSNAIGPLVGLWIIAITQDVYSTEAVPIWVLVYGGLGITVGLWVWGRRVMKTIG---------DDLTTITPTSGVSIELGAAVTVLIASNIGIPISTTHCKVG-----SIVAVGRYRSNDNVDWSIFRNICFAWLVTVPVSAGISALTMFLLRMLI 1647
            +F+ G NDV+N+ G  VG  ++ + Q             +   +  T+G  + G +V +TI          ++   I     VS  +G+AV  LIAS + +PIS THC VG     S+VA+G       V W     I  +W ++  +S  +S L  +++R  I
Sbjct:   21 AFSVGANDVANSFGTAVGSGVVTLRQ-----------ACILASIFETLGSMLLGAKVGETIRKGIIDVSLYNETVPILMAGEVSAMVGSAVWQLIASFLKLPISGTHCIVGSTIGFSMVAIG----TKGVQWMQLVKIVASWFISPLLSGIMSGLLFYVIRYFI 169          
BLAST of slc20a-2 vs. Ensembl Cavefish
Match: slc20a2 (solute carrier family 20 member 2 [Source:NCBI gene;Acc:103032054])

HSP 1 Score: 221.09 bits (562), Expect = 1.412e-63
Identity = 106/172 (61.63%), Postives = 129/172 (75.00%), Query Frame = 1
Query: 1120 EKTVIKDKPELVTIFSWVQVLTAIFGSFAHGGNDVSNAIGPLVGLWIIAITQDVYSTEAVPIWVLVYGGLGITVGLWVWGRRVMKTIGDDLTTITPTSGVSIELGAAVTVLIASNIGIPISTTHCKVGSIVAVGRYRSNDNVDWSIFRNICFAWLVTVPVSAGISALTMFLL 1635
            E    +DKP++  +F ++Q+LTA FGSFAHGGNDVSNAIGPLV LW+I     V      P+W+L YGG+GI  GLWVWGRRV++T+G DLT ITP+SG +IEL +AVTV++ASNIG+PISTTHCKVGS+VAVG  RS   VDW +FRNI  AW VTVPV+   SA  M L 
Sbjct:  483 EDKEERDKPQVFLLFHFLQILTACFGSFAHGGNDVSNAIGPLVALWMIYEQGGVMQNSTTPVWLLFYGGVGICAGLWVWGRRVIQTMGKDLTPITPSSGFTIELASAVTVVLASNIGLPISTTHCKVGSVVAVGWLRSQKAVDWRLFRNIFLAWFVTVPVAGLFSAAVMALF 654          

HSP 2 Score: 126.716 bits (317), Expect = 2.662e-50
Identity = 71/172 (41.28%), Postives = 107/172 (62.21%), Query Frame = 1
Query:  259 GAKVSDTIRKGVISPDALAAQNLTNLPQVMMIGQLSSLSGRSLFICCMKFNFYLGGCLWLLVATFLKLPVSGSHSIVGAMVGFALIIQGPAGIAWKKLGMIVASWFVSPLLSGLVSAFVFFIFDKFILKKSESREPALNFLPFIYAITIFINFFSIFLTGPTLLKFDKIPLY 774
            GAKV +TIRKG+I    ++  N T +P ++M G++S++               +G  +W L+A+FLKLP+SG+H IVG+ +GF+++  G  G+ W +L  IVASWF+SPLLSG++S  +F++   FIL K +     L  LP  YA TI IN FSI  TG  +L  + +P++
Sbjct:   63 GAKVGETIRKGIID---VSLYNET-VP-ILMAGEVSAM---------------VGSAVWQLIASFLKLPISGTHCIVGSTIGFSMVAIGTKGVQWMQLVKIVASWFISPLLSGIMSGLLFYVIRYFILSKDDPVPNGLRALPLFYASTIGINTFSIMYTGAPMLGIEMLPVW 214          

HSP 3 Score: 92.4337 bits (228), Expect = 2.662e-50
Identity = 42/57 (73.68%), Postives = 54/57 (94.74%), Query Frame = 3
Query:   45 IWIVVVGFLIAFILAFGIGANDVANSFGTSVGSKVISLRKACILASIFEVLGSILLG 215
            +W+V++GF+IAF+LAF +GANDVANSFGT+VGS V++LR+ACILASIFE LGS+LLG
Sbjct:    7 LWMVIIGFIIAFVLAFSVGANDVANSFGTAVGSGVVTLRQACILASIFETLGSMLLG 63          

HSP 4 Score: 51.2174 bits (121), Expect = 2.607e-6
Identity = 47/164 (28.66%), Postives = 76/164 (46.34%), Query Frame = 1
Query: 1198 SFAHGGNDVSNAIGPLVGLWIIAITQDVYSTEAVPIWVLVYGGLGITVGLWVWGRRVMKTIG---------DDLTTITPTSGVSIELGAAVTVLIASNIGIPISTTHCKVG-----SIVAVGRYRSNDNVDWSIFRNICFAWLVTVPVSAGISALTMFLLRMLI 1647
            +F+ G NDV+N+ G  VG  ++ + Q             +   +  T+G  + G +V +TI          ++   I     VS  +G+AV  LIAS + +PIS THC VG     S+VA+G       V W     I  +W ++  +S  +S L  +++R  I
Sbjct:   21 AFSVGANDVANSFGTAVGSGVVTLRQ-----------ACILASIFETLGSMLLGAKVGETIRKGIIDVSLYNETVPILMAGEVSAMVGSAVWQLIASFLKLPISGTHCIVGSTIGFSMVAIG----TKGVQWMQLVKIVASWFISPLLSGIMSGLLFYVIRYFI 169          
BLAST of slc20a-2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009357.1 (pep scaffold:Pmarinus_7.0:GL476813:1208:13102:-1 gene:ENSPMAG00000008446.1 transcript:ENSPMAT00000009357.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 224.172 bits (570), Expect = 3.423e-65
Identity = 108/167 (64.67%), Postives = 131/167 (78.44%), Query Frame = 1
Query: 1135 KDKPELVTIFSWVQVLTAIFGSFAHGGNDVSNAIGPLVGLWIIAITQDVYSTEAVPIWVLVYGGLGITVGLWVWGRRVMKTIGDDLTTITPTSGVSIELGAAVTVLIASNIGIPISTTHCKVGSIVAVGRYRSNDNVDWSIFRNICFAWLVTVPVSAGISALTMFLL 1635
            KD+PE+  +F ++Q+LTA FGSFAHGGNDVSNAIGPLV LWII  T  V    A P W+L++GG+GI +GLWVWGRRV++T+G DLT ITP+SG SIEL +A+TV+IASNIG+PISTTHCKVGS+V+VG  RS   VDW +FRNI  AW VTVP+S   SA  M L 
Sbjct:  517 KDRPEVYMLFHFLQILTACFGSFAHGGNDVSNAIGPLVALWIIYSTGSVNQEAATPAWLLLFGGVGICLGLWVWGRRVIQTMGKDLTPITPSSGFSIELASAMTVVIASNIGLPISTTHCKVGSVVSVGWLRSRKAVDWRLFRNIFMAWFVTVPISGLFSAGVMALF 683          

HSP 2 Score: 125.176 bits (313), Expect = 1.085e-49
Identity = 81/202 (40.10%), Postives = 117/202 (57.92%), Query Frame = 1
Query:  259 GAKVSDTIRKGVISPDALAAQNLTNLPQ-VMMIGQLSSLSGRSLFICCMKFNFYLGGCLWLLVATFLKLPVSGSHSIVGAMVGFALIIQGPAGIAWKKLGMIVASWFVSPLLSGLVSAFVFFIFDKFILKKSESREPALNFLPFIYAITIFINFFSIFLTGPTLLKFDKIPLYGNFXXXXXXXXXXXXXXRFALVPYLRKII 861
            GAKV  TIR G++        NL N  +  +M GQ+S++               +G   W L+A+FLKLP+SG+H IVGA +GF ++  G   + W KL  IVASWFVSPLLSG++SA  FF+   FIL K +     L  LP  Y + +++N FSI LTG  LL F+ +P++   ++S+  +V   +VV F + P +R+ I
Sbjct:   82 GAKVGQTIRNGIVD------VNLYNGSESTLMAGQVSAM---------------VGSAAWQLIASFLKLPISGTHCIVGATIGFTMVSMGAGSVQWTKLISIVASWFVSPLLSGIMSAIFFFMVRFFILNKDDPVPNGLRALPLFYGVVMWVNCFSIMLTGLPLLGFE-LPIWALVLVSLTFAVACGLVVWFIVCPRMRRKI 261          

HSP 3 Score: 89.7373 bits (221), Expect = 1.085e-49
Identity = 40/56 (71.43%), Postives = 53/56 (94.64%), Query Frame = 3
Query:   48 WIVVVGFLIAFILAFGIGANDVANSFGTSVGSKVISLRKACILASIFEVLGSILLG 215
            W+++VGF+IAF+LAF +GANDVANSFGT+VGS V++LR+ACILAS+FE +GS+LLG
Sbjct:   27 WMLIVGFIIAFVLAFSVGANDVANSFGTAVGSGVLTLRQACILASVFETVGSVLLG 82          

HSP 4 Score: 52.373 bits (124), Expect = 1.960e-7
Identity = 48/191 (25.13%), Postives = 89/191 (46.60%), Query Frame = 1
Query: 1114 TVEKTVIKDKPELVTIFSWVQVLTAIFG---SFAHGGNDVSNAIGPLVGLWIIAITQDVYSTEAVPIWVLVYGGLGITVGLWVWGRRVMKTIGDDLTTITPTSG---------VSIELGAAVTVLIASNIGIPISTTHCKVGSIVAVGRYR-SNDNVDWSIFRNICFAWLVTVPVSAGISALTMFLLRMLI 1647
            T   +++ +    +  + W+ ++  I     +F+ G NDV+N+ G  VG  ++ + Q             +   +  TVG  + G +V +TI + +  +   +G         VS  +G+A   LIAS + +PIS THC VG+ +          +V W+   +I  +W V+  +S  +SA+  F++R  I
Sbjct:    9 TAAVSIVAEASTSLEEYKWMLIVGFIIAFVLAFSVGANDVANSFGTAVGSGVLTLRQ-----------ACILASVFETVGSVLLGAKVGQTIRNGIVDVNLYNGSESTLMAGQVSAMVGSAAWQLIASFLKLPISGTHCIVGATIGFTMVSMGAGSVQWTKLISIVASWFVSPLLSGIMSAIFFFMVRFFI 188          
BLAST of slc20a-2 vs. Ensembl Sea Lamprey
Match: slc20a2 (solute carrier family 20 member 2 [Source:ZFIN;Acc:ZDB-GENE-060929-828])

HSP 1 Score: 219.55 bits (558), Expect = 8.044e-64
Identity = 108/183 (59.02%), Postives = 133/183 (72.68%), Query Frame = 1
Query: 1087 ENSTEVECKTVEKTVIKDKPELVTIFSWVQVLTAIFGSFAHGGNDVSNAIGPLVGLWIIAITQDVYSTEAVPIWVLVYGGLGITVGLWVWGRRVMKTIGDDLTTITPTSGVSIELGAAVTVLIASNIGIPISTTHCKVGSIVAVGRYRSNDNVDWSIFRNICFAWLVTVPVSAGISALTMFLL 1635
            ++S +      E+   KD  E   +F ++Q+LTA FGSFAHGGNDVSNAIGPLV LW+I     V    A P+W+L+YGGLGI +GLWVWGRRV++T+G DLT ITP+SG SIEL +A TV+IASNIG+PISTTHCKVGS+V+VG  R+   VDW +FRNI  AW VTVP+S   SA  M L 
Sbjct:  469 DSSQDGSSDGGEEDDEKDPLEASLLFHFLQILTACFGSFAHGGNDVSNAIGPLVALWLIYTEGSVMQKAATPVWLLLYGGLGICIGLWVWGRRVIQTMGKDLTPITPSSGFSIELASAFTVVIASNIGLPISTTHCKVGSVVSVGWLRARKAVDWRLFRNIFMAWFVTVPISGLFSAAIMALF 651          

HSP 2 Score: 121.324 bits (303), Expect = 1.683e-49
Identity = 67/160 (41.88%), Postives = 95/160 (59.38%), Query Frame = 1
Query:  259 GAKVSDTIRKGVISPDALAAQNLTNLPQVMMIGQLSSLSGRSLFICCMKFNFYLGGCLWLLVATFLKLPVSGSHSIVGAMVGFALIIQGPAGIAWKKLGMIVASWFVSPLLSGLVSAFVFFIFDKFILKKSESREPALNFLPFIYAITIFINFFSIFLTG 738
            GAKV +TIRKG++  D           +V+M G++S++               +G   W L+A+FLKLP+SG+H IVGA +GF+L+  G   + W +L  IV+SWF+SPLLSG++SA +F++   FIL K +     L  LP  YA T+ IN FSI  TG
Sbjct:   63 GAKVGETIRKGIVDVDLY-----NETAEVLMAGEVSAM---------------VGSAAWQLIASFLKLPISGTHCIVGATIGFSLVAIGTHSVQWFQLIKIVSSWFISPLLSGIMSALLFYLVRYFILNKEDPLPNGLRALPVFYAATMGINIFSIMYTG 202          

HSP 3 Score: 92.8189 bits (229), Expect = 1.683e-49
Identity = 43/59 (72.88%), Postives = 55/59 (93.22%), Query Frame = 3
Query:   39 DQIWIVVVGFLIAFILAFGIGANDVANSFGTSVGSKVISLRKACILASIFEVLGSILLG 215
            + +W+V+VGF+IAFILAF +GANDVANSFGT+VGS V++L++ACILASIFE LGSI+LG
Sbjct:    5 EYMWMVIVGFIIAFILAFSVGANDVANSFGTAVGSGVVTLKQACILASIFETLGSIMLG 63          

HSP 4 Score: 53.5286 bits (127), Expect = 8.472e-8
Identity = 57/180 (31.67%), Postives = 89/180 (49.44%), Query Frame = 1
Query: 1150 LVTIFSWVQVLTAIFG---SFAHGGNDVSNAIGPLVGLWIIAITQDVYSTEAVPIWVLVYGGLG-ITVGLWVWGRRVMKTIGD-DLTTITP----TSGVSIELGAAVTVLIASNIGIPISTTHCKVG-----SIVAVGRYRSNDNVDWSIFRNICFAWLVTVPVSAGISALTMFLLRMLI 1647
            ++T + W+ ++  I     +F+ G NDV+N+ G  VG  ++ + Q         I   ++  LG I +G  V G  + K I D DL   T        VS  +G+A   LIAS + +PIS THC VG     S+VA+G +    +V W     I  +W ++  +S  +SAL  +L+R  I
Sbjct:    2 ILTEYMWMVIVGFIIAFILAFSVGANDVANSFGTAVGSGVVTLKQAC-------ILASIFETLGSIMLGAKV-GETIRKGIVDVDLYNETAEVLMAGEVSAMVGSAAWQLIASFLKLPISGTHCIVGATIGFSLVAIGTH----SVQWFQLIKIVSSWFISPLLSGIMSALLFYLVRYFI 169          
BLAST of slc20a-2 vs. Ensembl Yeast
Match: PHO89 (Plasma membrane Na+/Pi cotransporter; active in early growth phase; similar to phosphate transporters of Neurospora crassa; transcription regulated by inorganic phosphate concentrations and Pho4p; mutations in related human transporter genes hPit1 and hPit2 are associated with hyperphosphatemia-induced calcification of vascular tissue and familial idiopathic basal ganglia calcification [Source:SGD;Acc:S000000500])

HSP 1 Score: 123.25 bits (308), Expect = 2.736e-30
Identity = 61/155 (39.35%), Postives = 97/155 (62.58%), Query Frame = 1
Query: 1159 IFSWVQVLTAIFGSFAHGGNDVSNAIGPLVGLWIIAITQDVYSTEAVPIWVLVYGGLGITVGLWVWGRRVMKTIGDDLTTITPTSGVSIELGAAVTVLIASNIGIPISTTHCKVGSIVAVGRYRSN-DNVDWSIFRNICFAWLVTVPVSAGISAL 1620
            I+S +Q +TA   SFAHG NDV+NA GPL  +++I  T  + +   VP+WVL YGG+ + +G W +G  ++K +G+ +   +P+ G SIEL  A+T ++A+ +GIP STT   VG IVAVG    +  +V+W +       W +T+P++  I+ +
Sbjct:  402 IYSVLQAITAATMSFAHGANDVANATGPLSAVYVIWKTNTIGAKSEVPVWVLAYGGVALVIGCWTYGYNIIKNLGNKMILQSPSRGFSIELAVAITTVMATQLGIPTSTTQIAVGGIVAVGLCNKDLKSVNWRMVAWCYSGWFLTLPIAGLIAGI 556          

HSP 2 Score: 59.6918 bits (143), Expect = 9.078e-16
Identity = 49/162 (30.25%), Postives = 81/162 (50.00%), Query Frame = 1
Query:  238 YLFELYKGAKVSDTIRKGVISPDALAAQNLTNLPQVMMIGQLSSLSGRSLFICCMKFNFYLGGCLWLLVATFLKLPVSGSHSIVGAMVGFALIIQGPAGI--AWKKLGMIVASWFVSPLLSGLVSAFVFFIFDKFILKKSESREPALNFLPFIYAITIFINF 717
            +L  +  GA+VS TI+  +I          TN P V+M+   S+L               +G   WL  AT + +PVS +HSIVG  +G  +   G  G+   W  +  I+ASWF++P+L+G ++A VF I  +F + + +S E ++     +  + +F  F
Sbjct:   56 FLGAVLAGARVSGTIKNNIIDSSIF-----TNDPAVLMLTMTSAL---------------IGSSCWLTFATAIGMPVSTTHSIVGGTIGAGIAAGGANGVVWGWSGVSQIIASWFIAPILAGAIAAIVFSI-SRFSVLEVKSLERSIKNALLLVGVLVFATF 196          

HSP 3 Score: 40.4318 bits (93), Expect = 9.078e-16
Identity = 26/56 (46.43%), Postives = 38/56 (67.86%), Query Frame = 3
Query:   48 WIVVVGFLIAFILAFGIGANDVANSFGTSVGSKVISLRKACILASIFEVLGSILLG 215
            +I  +  L AF+ AF IGANDVANSF +S+ S+ +   +A +LA + E LG++L G
Sbjct:    8 YIFAIAMLFAFLDAFNIGANDVANSFASSISSRSLKYWQAMVLAGLCEFLGAVLAG 63          
BLAST of slc20a-2 vs. Ensembl Nematostella
Match: EDO34470 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SPA5])

HSP 1 Score: 120.553 bits (301), Expect = 6.198e-49
Identity = 75/160 (46.88%), Postives = 98/160 (61.25%), Query Frame = 1
Query:  259 GAKVSDTIRKGVISPDALAAQNLTNLPQVMMIGQLSSLSGRSLFICCMKFNFYLGGCLWLLVATFLKLPVSGSHSIVGAMVGFALIIQGPAGIAWKKLGMIVASWFVSPLLSGLVSAFVFFIFDKFILKKSESREPALNFLPFIYAITIFINFFSIFLTG 738
            GA+VSDT+RKG+I  ++          +  M+G LS+L+G S+               WLLVATF  LPVSG+HS+VGA +GFAL+ Q   G+ WK  G I  SW VSPLLSGL+S+ +F +  + IL+K E  E  L FLP  YA TI +NFFS+F  G
Sbjct:   66 GARVSDTVRKGIIDINSFNGTE-----EYAMVGSLSALTGTSV---------------WLLVATFFNLPVSGTHSVVGATMGFALVAQSLHGVQWKTFGKIAGSWVVSPLLSGLISSLLFMLVRRIILRKPEPFEAGLKFLPLFYAFTITVNFFSVFYKG 205          

HSP 2 Score: 92.4337 bits (228), Expect = 6.198e-49
Identity = 44/63 (69.84%), Postives = 57/63 (90.48%), Query Frame = 3
Query:   33 PPDQ--IWIVVVGFLIAFILAFGIGANDVANSFGTSVGSKVISLRKACILASIFEVLGSILLG 215
            P D   +WIV+VGF++AF+LAFGIGANDVANSFGTSVGSKV++L++AC +ASIFEV G++L+G
Sbjct:    4 PQDSEYLWIVIVGFILAFVLAFGIGANDVANSFGTSVGSKVLTLKQACFIASIFEVAGAVLIG 66          

HSP 3 Score: 129.028 bits (323), Expect = 1.836e-33
Identity = 55/96 (57.29%), Postives = 79/96 (82.29%), Query Frame = 1
Query: 1123 KTVIKDKPELVTIFSWVQVLTAIFGSFAHGGNDVSNAIGPLVGLWIIAITQDVYSTEAVPIWVLVYGGLGITVGLWVWGRRVMKTIGDDLTTITPT 1410
            + +I D+P+   +F+++Q+LTA FG+FAHGGNDVSN IGPL+ LW I  T ++    A+P+W+L+YGG+GI++GLWVWGRRV+KT+G+DLT ITP+
Sbjct:  209 RCLITDEPKTGRLFAFLQILTASFGAFAHGGNDVSNCIGPLISLWTIYWTGEIAQKVAIPVWILLYGGVGISIGLWVWGRRVIKTVGEDLTPITPS 304          
BLAST of slc20a-2 vs. Ensembl Medaka
Match: slc20a1b (sodium-dependent phosphate transporter 1-B [Source:NCBI gene;Acc:101173722])

HSP 1 Score: 237.269 bits (604), Expect = 2.263e-69
Identity = 112/171 (65.50%), Postives = 140/171 (81.87%), Query Frame = 1
Query: 1114 TVEKTVIKDKPELVTIFSWVQVLTAIFGSFAHGGNDVSNAIGPLVGLWIIAITQDVYSTEAVPIWVLVYGGLGITVGLWVWGRRVMKTIGDDLTTITPTSGVSIELGAAVTVLIASNIGIPISTTHCKVGSIVAVGRYRSNDNVDWSIFRNICFAWLVTVPVSAGISALTM 1626
            ++E  + +DKPE+ T+F ++Q+LTA FGSFAHGGNDVSNAIGPLV LW++  T DV ST+  PIW+L+YGG+GI VGLWVWGRRV++T+G DLT ITP+SG SIEL +A+TV++ASNIG+P+STTHCKVGS+VAVG  RS   VDW +FRNI  AW VTVP+S  ISA  M
Sbjct:  521 SLEDKLDEDKPEVSTLFQFLQILTACFGSFAHGGNDVSNAIGPLVALWLVYSTGDVMSTQPTPIWLLLYGGVGICVGLWVWGRRVIQTMGKDLTPITPSSGFSIELASALTVVVASNIGLPVSTTHCKVGSVVAVGWLRSKKAVDWRLFRNIFMAWFVTVPISGLISAAIM 691          

HSP 2 Score: 142.124 bits (357), Expect = 1.571e-54
Identity = 89/212 (41.98%), Postives = 126/212 (59.43%), Query Frame = 1
Query:  259 GAKVSDTIRKGVISPDALAAQNLTNLPQVMMIGQLSSLSGRSLFICCMKFNFYLGGCLWLLVATFLKLPVSGSHSIVGAMVGFALIIQGPAGIAWKKLGMIVASWFVSPLLSGLVSAFVFFIFDKFILKKSESREPALNFLPFIYAITIFINFFSIFLTGPTLLKFDKIPLYGNFXXXXXXXXXXXXXXRFALVPYLRKIILK----SEPIE 882
            GAKVS+TIRKG+I             P+ +M G +S++               +G  +W L A+FLKLP+SG+H IVGA +GF+LI +G  G+ W +L  IV SWF+SPLLSG++SA VF+   KFIL K +     L  LP  YAIT+ IN FSI  TG  +L  DKIP +G  +IS+  +++  ++V F + P+L++ I +    S P E
Sbjct:   83 GAKVSETIRKGIIDVSMYNGSE----PE-LMAGSVSAM---------------VGSAVWQLAASFLKLPISGTHCIVGATIGFSLIAKGQQGVRWLELLRIVGSWFLSPLLSGMMSAIVFWFVSKFILNKKDPVPNGLKALPVFYAITMGINLFSIMFTGAPMLGLDKIPWWGILLISLTCALLVGVLVWFVVCPHLKRKIERDMKSSSPSE 274          

HSP 3 Score: 91.2781 bits (225), Expect = 1.571e-54
Identity = 40/58 (68.97%), Postives = 54/58 (93.10%), Query Frame = 3
Query:   42 QIWIVVVGFLIAFILAFGIGANDVANSFGTSVGSKVISLRKACILASIFEVLGSILLG 215
             +W++++GF+IAFILAF +GANDVANSFGT+VGS V++LR+ACILA++FE LGS+LLG
Sbjct:   26 HMWLLILGFIIAFILAFSVGANDVANSFGTAVGSGVVTLRQACILATVFETLGSVLLG 83          
BLAST of slc20a-2 vs. Ensembl Medaka
Match: slc20a1a (sodium-dependent phosphate transporter 1-A [Source:NCBI gene;Acc:101158859])

HSP 1 Score: 220.705 bits (561), Expect = 1.092e-63
Identity = 108/176 (61.36%), Postives = 134/176 (76.14%), Query Frame = 1
Query: 1120 EKTVIKDKPELVTIFSWVQVLTAIFGSFAHGGNDVSNAIGPLVGLWIIAITQDVYSTEAVPIWVLVYGGLGITVGLWVWGRRVMKTIGDDLTTITPTSGVSIELGAAVTVLIASNIGIPISTTHCKVGSIVAVGRYRSNDNVDWSIFRNICFAWLVTVPVSAGISALTMFLLRMLI 1647
            E  +  D P    +F ++Q+LTA FGSFAHGGNDVSNAIGPLV LW++  +  V S    PIW+L+YGG+GI VGLWVWGRRV++T+G DLT ITP+SG SIEL +AVTV++ASN+G+P+STTHCKVGS+VAVG  RS  +VDW +FRNI  AW VTVP+S  ISA  M L   +I
Sbjct:  454 EDELEVDPPAASLLFQFLQILTACFGSFAHGGNDVSNAIGPLVALWLLYDSGSVVSDAPTPIWLLLYGGVGICVGLWVWGRRVIQTMGKDLTPITPSSGFSIELASAVTVVVASNVGLPVSTTHCKVGSVVAVGWLRSRKSVDWRLFRNIFIAWFVTVPISGLISAAIMALFIYVI 629          

HSP 2 Score: 137.887 bits (346), Expect = 2.361e-53
Identity = 86/201 (42.79%), Postives = 121/201 (60.20%), Query Frame = 1
Query:  259 GAKVSDTIRKGVISPDALAAQNLTNLPQVMMIGQLSSLSGRSLFICCMKFNFYLGGCLWLLVATFLKLPVSGSHSIVGAMVGFALIIQGPAGIAWKKLGMIVASWFVSPLLSGLVSAFVFFIFDKFILKKSESREPALNFLPFIYAITIFINFFSIFLTGPTLLKFDKIPLYGNFXXXXXXXXXXXXXXRFALVPYLRKII 861
            GAKVS TIR+G+I       +       ++M G +S++ G ++               W L A+FLKLP+SG+H IVGA +GF+++ +G  G+ W +L  IVASWF+SP+LSGL+S  +F+   KFIL K       L  LP  YAITI IN FSI  TG  +L FD++P +G   IS+G +V+T +VV F + P L+K I
Sbjct:   83 GAKVSKTIREGIID-----VRMYNGSEHILMGGSISAMCGSAV---------------WQLFASFLKLPISGTHCIVGATIGFSMVARGYQGVKWLELLRIVASWFLSPVLSGLMSGILFYFVRKFILNKPNPGSNGLKALPIFYAITIGINLFSIMYTGAPMLGFDRVPWWGTLCISLGCAVVTGLVVWFFVCPRLKKKI 263          

HSP 3 Score: 91.6633 bits (226), Expect = 2.361e-53
Identity = 42/57 (73.68%), Postives = 54/57 (94.74%), Query Frame = 3
Query:   45 IWIVVVGFLIAFILAFGIGANDVANSFGTSVGSKVISLRKACILASIFEVLGSILLG 215
            +W+V+VGF+IAFILAF +GANDVANSFGT+VGS V++LR+ACILA+IFE +GS+LLG
Sbjct:   27 LWLVIVGFIIAFILAFSVGANDVANSFGTAVGSGVVTLRQACILATIFETVGSVLLG 83          

HSP 4 Score: 49.6766 bits (117), Expect = 7.792e-6
Identity = 43/160 (26.88%), Postives = 72/160 (45.00%), Query Frame = 1
Query: 1198 SFAHGGNDVSNAIGPLVGLWIIAITQDVYSTEAVPIWVLVYGGLGITVGLWVWGRRVMKTIGDDLTTITPTSG---------VSIELGAAVTVLIASNIGIPISTTHCKVGSIVAVGR-YRSNDNVDWSIFRNICFAWLVTVPVSAGISALTMFLLRMLI 1647
            +F+ G NDV+N+ G  VG  ++ + Q             +   +  TVG  + G +V KTI + +  +   +G         +S   G+AV  L AS + +PIS THC VG+ +      R    V W     I  +W ++  +S  +S +  + +R  I
Sbjct:   41 AFSVGANDVANSFGTAVGSGVVTLRQ-----------ACILATIFETVGSVLLGAKVSKTIREGIIDVRMYNGSEHILMGGSISAMCGSAVWQLFASFLKLPISGTHCIVGATIGFSMVARGYQGVKWLELLRIVASWFLSPVLSGLMSGILFYFVRKFI 189          
BLAST of slc20a-2 vs. Ensembl Medaka
Match: slc20a2 (solute carrier family 20 member 2 [Source:NCBI gene;Acc:101166389])

HSP 1 Score: 219.935 bits (559), Expect = 4.899e-63
Identity = 107/167 (64.07%), Postives = 128/167 (76.65%), Query Frame = 1
Query: 1135 KDKPELVTIFSWVQVLTAIFGSFAHGGNDVSNAIGPLVGLWIIAITQDVYSTEAVPIWVLVYGGLGITVGLWVWGRRVMKTIGDDLTTITPTSGVSIELGAAVTVLIASNIGIPISTTHCKVGSIVAVGRYRSNDNVDWSIFRNICFAWLVTVPVSAGISALTMFLL 1635
            KDK E+  +F ++Q+LTA FGSFAHGGNDVSNAIGPLV LW+I     V    A PIW+L YGG+GI  GLWVWGRRV++T+G DLT ITP+SG +IEL +A+TV++ASNIGIP+STTHCKVGS+VAVG  RS   VDW +FRNI  AW VTVPV+   SA  M L 
Sbjct:  504 KDKSEVFLLFHFLQILTACFGSFAHGGNDVSNAIGPLVALWMIYEQGGVMQDAATPIWLLFYGGVGICAGLWVWGRRVIQTMGKDLTPITPSSGFTIELASALTVVLASNIGIPVSTTHCKVGSVVAVGWIRSKKAVDWHLFRNIFLAWFVTVPVAGLFSAAVMALF 670          

HSP 2 Score: 116.701 bits (291), Expect = 5.465e-47
Identity = 83/208 (39.90%), Postives = 122/208 (58.65%), Query Frame = 1
Query:  259 GAKVSDTIRKGVISPDALAAQNLTNLPQVMMIGQLSSLSGRSLFICCMKFNFYLGGCLWLLVATFLKLPVSGSHSIVGAMVGFALIIQGPAGIAWKKLGMIVASWFVSPLLSGLVSAFVFFIFDKFILKKSESREPALNFLPFIYAITIFINFFSIFLTGPTLLKFDKIPLYGNFXXXXXXXXXXXXXXRFALVPYLRKII---LKSE 873
            GAKV +TIRKG+I           +   ++M G++S++               +G  +W L+A+FLKLP+SG+H IVGA +GF+++  G  G+ W +L  IVASWF+SPLLSGL+S  +F +   FIL K +S    L  LP  YA TI IN FSI  TG  LL  + +P++  F+I++  S++   +V   + P++RK I   LK E
Sbjct:   63 GAKVGETIRKGIID-----VSFYNDTVPILMAGEVSAM---------------VGSAVWQLIASFLKLPISGTHCIVGATIGFSMVAIGTKGVQWMQLVKIVASWFISPLLSGLMSGLLFLLIRYFILSKEDSVPNGLRALPVFYASTIGINTFSIMYTGAPLLGLEMLPVWAIFLITLAGSLVCAGLVWKFVCPWMRKKIASRLKKE 250          

HSP 3 Score: 91.6633 bits (226), Expect = 5.465e-47
Identity = 43/57 (75.44%), Postives = 54/57 (94.74%), Query Frame = 3
Query:   45 IWIVVVGFLIAFILAFGIGANDVANSFGTSVGSKVISLRKACILASIFEVLGSILLG 215
            +W+V++GF+IAFILAF +GANDVANSFGT+VGS V++L++ACILASIFE LGSILLG
Sbjct:    7 LWLVILGFVIAFILAFSVGANDVANSFGTAVGSGVVTLKQACILASIFETLGSILLG 63          
BLAST of slc20a-2 vs. Ensembl Medaka
Match: slc20a2 (solute carrier family 20 member 2 [Source:NCBI gene;Acc:101166389])

HSP 1 Score: 216.468 bits (550), Expect = 9.310e-62
Identity = 105/167 (62.87%), Postives = 127/167 (76.05%), Query Frame = 1
Query: 1135 KDKPELVTIFSWVQVLTAIFGSFAHGGNDVSNAIGPLVGLWIIAITQDVYSTEAVPIWVLVYGGLGITVGLWVWGRRVMKTIGDDLTTITPTSGVSIELGAAVTVLIASNIGIPISTTHCKVGSIVAVGRYRSNDNVDWSIFRNICFAWLVTVPVSAGISALTMFLL 1635
            KDK E+  +F ++Q+LTA FGSFAHGGNDVSNAIGPLV LW+I     V    A PIW+L YGG+GI  GLWVWGRRV++T+G DLT ITP+SG  IE+ +A+TVL+ASN+GIP+S+THCKVGS+VAVG  RS   VDW +FRNI  AW VTVPV+   SA  M L 
Sbjct:  504 KDKSEVFLLFHFLQILTACFGSFAHGGNDVSNAIGPLVALWMIYEQGGVMQDAATPIWLLFYGGVGICAGLWVWGRRVIQTMGKDLTPITPSSGFCIEVMSALTVLVASNVGIPVSSTHCKVGSVVAVGWIRSKKAVDWHLFRNIFLAWFVTVPVAGLFSAAVMALF 670          

HSP 2 Score: 116.701 bits (291), Expect = 5.158e-47
Identity = 83/208 (39.90%), Postives = 122/208 (58.65%), Query Frame = 1
Query:  259 GAKVSDTIRKGVISPDALAAQNLTNLPQVMMIGQLSSLSGRSLFICCMKFNFYLGGCLWLLVATFLKLPVSGSHSIVGAMVGFALIIQGPAGIAWKKLGMIVASWFVSPLLSGLVSAFVFFIFDKFILKKSESREPALNFLPFIYAITIFINFFSIFLTGPTLLKFDKIPLYGNFXXXXXXXXXXXXXXRFALVPYLRKII---LKSE 873
            GAKV +TIRKG+I           +   ++M G++S++               +G  +W L+A+FLKLP+SG+H IVGA +GF+++  G  G+ W +L  IVASWF+SPLLSGL+S  +F +   FIL K +S    L  LP  YA TI IN FSI  TG  LL  + +P++  F+I++  S++   +V   + P++RK I   LK E
Sbjct:   63 GAKVGETIRKGIID-----VSFYNDTVPILMAGEVSAM---------------VGSAVWQLIASFLKLPISGTHCIVGATIGFSMVAIGTKGVQWMQLVKIVASWFISPLLSGLMSGLLFLLIRYFILSKEDSVPNGLRALPVFYASTIGINTFSIMYTGAPLLGLEMLPVWAIFLITLAGSLVCAGLVWKFVCPWMRKKIASRLKKE 250          

HSP 3 Score: 91.6633 bits (226), Expect = 5.158e-47
Identity = 43/57 (75.44%), Postives = 54/57 (94.74%), Query Frame = 3
Query:   45 IWIVVVGFLIAFILAFGIGANDVANSFGTSVGSKVISLRKACILASIFEVLGSILLG 215
            +W+V++GF+IAFILAF +GANDVANSFGT+VGS V++L++ACILASIFE LGSILLG
Sbjct:    7 LWLVILGFVIAFILAFSVGANDVANSFGTAVGSGVVTLKQACILASIFETLGSILLG 63          
BLAST of slc20a-2 vs. Ensembl Medaka
Match: slc20a1b (sodium-dependent phosphate transporter 1-B [Source:NCBI gene;Acc:101173722])

HSP 1 Score: 141.739 bits (356), Expect = 1.722e-54
Identity = 89/212 (41.98%), Postives = 126/212 (59.43%), Query Frame = 1
Query:  259 GAKVSDTIRKGVISPDALAAQNLTNLPQVMMIGQLSSLSGRSLFICCMKFNFYLGGCLWLLVATFLKLPVSGSHSIVGAMVGFALIIQGPAGIAWKKLGMIVASWFVSPLLSGLVSAFVFFIFDKFILKKSESREPALNFLPFIYAITIFINFFSIFLTGPTLLKFDKIPLYGNFXXXXXXXXXXXXXXRFALVPYLRKIILK----SEPIE 882
            GAKVS+TIRKG+I             P+ +M G +S++               +G  +W L A+FLKLP+SG+H IVGA +GF+LI +G  G+ W +L  IV SWF+SPLLSG++SA VF+   KFIL K +     L  LP  YAIT+ IN FSI  TG  +L  DKIP +G  +IS+  +++  ++V F + P+L++ I +    S P E
Sbjct:   83 GAKVSETIRKGIIDVSMYNGSE----PE-LMAGSVSAM---------------VGSAVWQLAASFLKLPISGTHCIVGATIGFSLIAKGQQGVRWLELLRIVGSWFLSPLLSGMMSAIVFWFVSKFILNKKDPVPNGLKALPVFYAITMGINLFSIMFTGAPMLGLDKIPWWGILLISLTCALLVGVLVWFVVCPHLKRKIERDMKSSSPSE 274          

HSP 2 Score: 91.6633 bits (226), Expect = 1.722e-54
Identity = 40/58 (68.97%), Postives = 54/58 (93.10%), Query Frame = 3
Query:   42 QIWIVVVGFLIAFILAFGIGANDVANSFGTSVGSKVISLRKACILASIFEVLGSILLG 215
             +W++++GF+IAFILAF +GANDVANSFGT+VGS V++LR+ACILA++FE LGS+LLG
Sbjct:   26 HMWLLILGFIIAFILAFSVGANDVANSFGTAVGSGVVTLRQACILATVFETLGSVLLG 83          

HSP 3 Score: 189.889 bits (481), Expect = 3.829e-52
Identity = 86/129 (66.67%), Postives = 111/129 (86.05%), Query Frame = 1
Query: 1114 TVEKTVIKDKPELVTIFSWVQVLTAIFGSFAHGGNDVSNAIGPLVGLWIIAITQDVYSTEAVPIWVLVYGGLGITVGLWVWGRRVMKTIGDDLTTITPTSGVSIELGAAVTVLIASNIGIPISTTHCKV 1500
            ++E  + +DKPE+ T+F ++Q+LTA FGSFAHGGNDVSNAIGPLV LW++  T DV ST+  PIW+L+YGG+GI VGLWVWGRRV++T+G DLT ITP+SG SIEL +A+TV++ASNIG+P+STTHCKV
Sbjct:  521 SLEDKLDEDKPEVSTLFQFLQILTACFGSFAHGGNDVSNAIGPLVALWLVYSTGDVMSTQPTPIWLLLYGGVGICVGLWVWGRRVIQTMGKDLTPITPSSGFSIELASALTVVVASNIGLPVSTTHCKV 649          
BLAST of slc20a-2 vs. Planmine SMEST
Match: SMESG000029269.1 (SMESG000029269.1)

HSP 1 Score: 595.504 bits (1534), Expect = 0.000e+0
Identity = 351/480 (73.12%), Postives = 380/480 (79.17%), Query Frame = 1
Query:  259 GAKVSDTIRKGVISPDALAAQNLTNLPQVMMIGQLSSLSGRSLFICCMKFNFYLGGCLWLLVATFLKLPVSGSHSIVGAMVGFALIIQGPAGIAWKKLGMIVASWFVSPLLSGLVSAFVFFIFDKFILKKSESREPALNFLPFIYAITIFINFFSIFLTGPTLLKFDKIPLYGNFXXXXXXXXXXXXXXRFALVPYLRKIILKSEPIEGXXXXXXXXXXXXXXXXLDI---NIDEDTQ--------------TNKLNXXXXXXXXXXXXXXXXXXXXXXXXXXMCEVSLEDIKENSTEVECKTVEKTVIKDKPELVTIFSWVQVLTAIFGSFAHGGNDVSNAIGPLVGLWIIAITQDVYSTEAVPIWVLVYGGLGITVGLWVWGRRVMKTIGDDLTTITPTSGVSIELGAAVTVLIASNIGIPISTTHCKVGSIVAVGRYRSNDNVDWSIFRNICFAWLVTVPVSAGISALTMFLLRMLI 1647
            GAKVS+T+R+GVISPDALAAQNLTNLPQVMMIG LSSLSG               GCLWLLVATFLKLPVSGSHSIVGAMVGFALIIQGP     +++G             GLVSAF+FFIFDKFILKKSESREPALNFLPFIYAITIFINFFSIFLTGP LLKFDK+P+YGNF ISIGLSVITIIVVRFALVPYLRK ILK++         +  S       +D    N+ ED                  + +  + ++  ++   K  + E+ L   EMCEVS+E+  EN  +VECKTVEKTVIKDKPELVTIFSWVQVLTA FGSFAHGGNDVSNAIGPLVGLWIIA+TQDVYSTEAVPIW+L YGGLGITVGLWVWGRRVMKTIGDDLTTITPTSGVSIELGAAVTVL+ASNIGIPISTTHCKVGSIVAVGRYRSNDNVDWSIFRNICFAWLVTVPVSAGISALTMFLLRMLI
Sbjct:   65 GAKVSNTVREGVISPDALAAQNLTNLPQVMMIGHLSSLSG---------------GCLWLLVATFLKLPVSGSHSIVGAMVGFALIIQGPGWNCMEEIGNDC----------GLVSAFIFFIFDKFILKKSESREPALNFLPFIYAITIFINFFSIFLTGPALLKFDKVPIYGNFAISIGLSVITIIVVRFALVPYLRKTILKNKSTSNNAHDVSSGSSNPGPV-VDCKMKNLHEDVSCKVLLVKGKPKAKIQERFHPSKISLEGEVKIKKGRKIESQLPNMEMCEVSVENKNENCKDVECKTVEKTVIKDKPELVTIFSWVQVLTATFGSFAHGGNDVSNAIGPLVGLWIIAVTQDVYSTEAVPIWILFYGGLGITVGLWVWGRRVMKTIGDDLTTITPTSGVSIELGAAVTVLVASNIGIPISTTHCKVGSIVAVGRYRSNDNVDWSIFRNICFAWLVTVPVSAGISALTMFLLRMLI 518          

HSP 2 Score: 125.946 bits (315), Expect = 1.037e-30
Identity = 64/65 (98.46%), Postives = 65/65 (100.00%), Query Frame = 3
Query:   21 MVYVPPDQIWIVVVGFLIAFILAFGIGANDVANSFGTSVGSKVISLRKACILASIFEVLGSILLG 215
            MVYVPPDQIWIVVVGFLIAFILAFGIGANDVANSFGTSVGSKVISLRKACILASIF+VLGSILLG
Sbjct:    1 MVYVPPDQIWIVVVGFLIAFILAFGIGANDVANSFGTSVGSKVISLRKACILASIFDVLGSILLG 65          
BLAST of slc20a-2 vs. Planmine SMEST
Match: SMESG000012546.1 (SMESG000012546.1)

HSP 1 Score: 278.1 bits (710), Expect = 5.461e-87
Identity = 126/169 (74.56%), Postives = 152/169 (89.94%), Query Frame = 1
Query: 1132 IKDKPELVTIFSWVQVLTAIFGSFAHGGNDVSNAIGPLVGLWIIAITQDVYSTEAVPIWVLVYGGLGITVGLWVWGRRVMKTIGDDLTTITPTSGVSIELGAAVTVLIASNIGIPISTTHCKVGSIVAVGRYRSNDNVDWSIFRNICFAWLVTVPVSAGISALTMFLLR 1638
            IKDKPE   +FS +Q+LTA+FG FAHGGNDVSNAIGPLVGLWII +TQD+ S  A+PIW+L+YGG GIT+GLW+WGRRV+KT+GD+LTTITP+SGV IELG+A+TV +ASNIG+PISTTHCKVGSIVAVGRYRSN+NVDW IFR+ICFAW +T+PV+ G+SAL MF L+
Sbjct:  299 IKDKPEQCELFSGLQILTAVFGGFAHGGNDVSNAIGPLVGLWIIGLTQDLSSKMAIPIWILLYGGFGITIGLWIWGRRVIKTMGDELTTITPSSGVCIELGSAITVTVASNIGLPISTTHCKVGSIVAVGRYRSNENVDWKIFRHICFAWFITLPVTGGVSALIMFCLK 467          

HSP 2 Score: 233.802 bits (595), Expect = 6.051e-87
Identity = 131/201 (65.17%), Postives = 153/201 (76.12%), Query Frame = 1
Query:  259 GAKVSDTIRKGVISPDALAAQNLTNLPQVMMIGQLSSLSGRSLFICCMKFNFYLGGCLWLLVATFLKLPVSGSHSIVGAMVGFALIIQGPAGIAWKKLGMIVASWFVSPLLSGLVSAFVFFIFDKFILKKSESREPALNFLPFIYAITIFINFFSIFLTGPTLLKFDKIPLYGNFXXXXXXXXXXXXXXRFALVPYLRKII 861
            GAKVSDTIRKGVI P+    QN+T+  ++MM+GQLSSLSG                C+W+++ATF KLPVSGSHSIVGA+VGFALII G  GI W K+G IVASWF+SP+LSG VS   FFIFD+FILKKS+  EP L FLPFIY+ITI IN FSIF++GP LL FDKIPLYG FI S GL++ITI+VVRF  VPYLRK I
Sbjct:   64 GAKVSDTIRKGVILPEYYNTQNMTDGIRIMMMGQLSSLSG---------------ACVWMMIATFFKLPVSGSHSIVGAVVGFALIIHGVKGIDWVKVGFIVASWFISPILSGSVSVLTFFIFDRFILKKSDPLEPGLTFLPFIYSITILINAFSIFISGPPLLGFDKIPLYGTFIASFGLAIITILVVRFVAVPYLRKKI 249          

HSP 3 Score: 107.842 bits (268), Expect = 6.051e-87
Identity = 52/61 (85.25%), Postives = 60/61 (98.36%), Query Frame = 3
Query:   33 PPDQIWIVVVGFLIAFILAFGIGANDVANSFGTSVGSKVISLRKACILASIFEVLGSILLG 215
            P +QIWI+VVGFLIAFILAFGIGANDVANSFGTSVGSKV++L++AC+LASIFE+LGSILLG
Sbjct:    4 PDNQIWIIVVGFLIAFILAFGIGANDVANSFGTSVGSKVLTLKQACVLASIFEILGSILLG 64          
The following BLAST results are available for this feature:
BLAST of slc20a-2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SLC20A19.281e-6863.48solute carrier family 20 member 1 [Source:HGNC Sym... [more]
SLC20A22.154e-6065.41solute carrier family 20 member 2 [Source:HGNC Sym... [more]
SLC20A22.154e-6065.41solute carrier family 20 member 2 [Source:HGNC Sym... [more]
SLC20A22.154e-6065.41solute carrier family 20 member 2 [Source:HGNC Sym... [more]
SLC20A23.678e-2270.00solute carrier family 20 member 2 [Source:HGNC Sym... [more]
back to top
BLAST of slc20a-2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pitr-25.956e-7735.73Phosphate transporter [Source:UniProtKB/TrEMBL;Ac... [more]
pitr-52.222e-7536.68Phosphate transporter [Source:UniProtKB/TrEMBL;Ac... [more]
pitr-18.235e-5351.15Phosphate transporter [Source:UniProtKB/TrEMBL;Ac... [more]
pitr-12.970e-5251.15Phosphate transporter [Source:UniProtKB/TrEMBL;Ac... [more]
pitr-12.970e-5251.15Phosphate transporter [Source:UniProtKB/TrEMBL;Ac... [more]
back to top
BLAST of slc20a-2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
NaPi-III7.721e-5949.31gene:FBgn0260795 transcript:FBtr0301438[more]
NaPi-III7.721e-5949.31gene:FBgn0260795 transcript:FBtr0332705[more]
back to top
BLAST of slc20a-2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc20a1b1.017e-6959.49solute carrier family 20 member 1b [Source:NCBI ge... [more]
slc20a1b1.017e-6959.49solute carrier family 20 member 1b [Source:NCBI ge... [more]
slc20a1a2.928e-6562.94solute carrier family 20 member 1a [Source:NCBI ge... [more]
slc20a1a2.928e-6562.94solute carrier family 20 member 1a [Source:NCBI ge... [more]
slc20a22.212e-6261.63solute carrier family 20 member 2 [Source:ZFIN;Acc... [more]
back to top
BLAST of slc20a-2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc20a13.963e-6957.44solute carrier family 20 member 1 [Source:NCBI gen... [more]
slc20a17.160e-6857.44solute carrier family 20 member 1 [Source:NCBI gen... [more]
slc20a11.263e-6757.44solute carrier family 20 member 1 [Source:NCBI gen... [more]
slc20a11.288e-6757.44solute carrier family 20 member 1 [Source:NCBI gen... [more]
slc20a11.858e-6757.44solute carrier family 20 member 1 [Source:NCBI gen... [more]
back to top
BLAST of slc20a-2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Slc20a12.293e-6557.95solute carrier family 20, member 1 [Source:MGI Sym... [more]
Slc20a12.293e-6557.95solute carrier family 20, member 1 [Source:MGI Sym... [more]
Slc20a26.978e-6262.15solute carrier family 20, member 2 [Source:MGI Sym... [more]
back to top
BLAST of slc20a-2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6PFM1|S20AB_DANRE7.219e-6959.49Sodium-dependent phosphate transporter 1-B OS=Dani... [more]
sp|Q68F35|S20AA_XENLA3.454e-6858.97Sodium-dependent phosphate transporter 1-A OS=Xeno... [more]
sp|Q9JJP0|S20A1_RAT2.441e-6758.97Sodium-dependent phosphate transporter 1 OS=Rattus... [more]
sp|O97596|S20A1_FELCA4.343e-6759.49Sodium-dependent phosphate transporter 1 OS=Felis ... [more]
sp|Q8WUM9|S20A1_HUMAN4.457e-6763.48Sodium-dependent phosphate transporter 1 OS=Homo s... [more]
back to top
BLAST of slc20a-2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0H3YF290.000e+0100.00Phosphate transporter OS=Schmidtea mediterranea OX... [more]
A0A1I8GFH23.617e-13449.79Phosphate transporter OS=Macrostomum lignano OX=28... [more]
A0A2T7PFC62.092e-12748.49Phosphate transporter OS=Pomacea canaliculata OX=4... [more]
V4APQ82.132e-12546.38Phosphate transporter OS=Lottia gigantea OX=225164... [more]
A0A210QKP14.332e-12545.92Phosphate transporter OS=Mizuhopecten yessoensis O... [more]
back to top
BLAST of slc20a-2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc20a1b1.649e-6858.97solute carrier family 20 member 1 [Source:NCBI gen... [more]
slc20a1a1.246e-6465.43sodium-dependent phosphate transporter 1-A-like [S... [more]
slc20a21.412e-6361.63solute carrier family 20 member 2 [Source:NCBI gen... [more]
slc20a21.412e-6361.63solute carrier family 20 member 2 [Source:NCBI gen... [more]
slc20a21.412e-6361.63solute carrier family 20 member 2 [Source:NCBI gen... [more]
back to top
BLAST of slc20a-2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSPMAT00000009357.13.423e-6564.67pep scaffold:Pmarinus_7.0:GL476813:1208:13102:-1 g... [more]
slc20a28.044e-6459.02solute carrier family 20 member 2 [Source:ZFIN;Acc... [more]
back to top
BLAST of slc20a-2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
PHO892.736e-3039.35Plasma membrane Na+/Pi cotransporter; active in ea... [more]
back to top
BLAST of slc20a-2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO344706.198e-4946.88Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of slc20a-2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc20a1b2.263e-6965.50sodium-dependent phosphate transporter 1-B [Source... [more]
slc20a1a1.092e-6361.36sodium-dependent phosphate transporter 1-A [Source... [more]
slc20a24.899e-6364.07solute carrier family 20 member 2 [Source:NCBI gen... [more]
slc20a29.310e-6262.87solute carrier family 20 member 2 [Source:NCBI gen... [more]
slc20a1b1.722e-5441.98sodium-dependent phosphate transporter 1-B [Source... [more]
back to top
BLAST of slc20a-2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000029269.11.037e-3073.13SMESG000029269.1[more]
SMESG000012546.15.461e-8774.56SMESG000012546.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30009145
GenBankAKN21545.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30009145 ID=SMED30009145|Name=slc20a-2|organism=Schmidtea mediterranea sexual|type=transcript|length=1675bp
GTTATTTCAAATTAAGAAAAATGGTTTATGTACCACCAGATCAGATTTGG
ATTGTTGTTGTTGGTTTCCTAATCGCTTTTATATTGGCATTTGGAATCGG
GGCCAATGATGTGGCAAATTCTTTCGGAACAAGTGTCGGCTCAAAGGTTA
TTTCTTTAAGAAAGGCTTGCATTCTGGCATCGATTTTTGAAGTATTAGGA
TCAATCTTATTGGGTAGGATCAATTTATTTCAATTATTATTTATTTGAAT
TATATAAAGGCGCAAAAGTGTCTGACACGATACGGAAAGGTGTCATATCA
CCGGATGCACTGGCAGCTCAGAACCTTACAAATTTACCTCAAGTTATGAT
GATAGGCCAATTATCCTCACTATCAGGTCGGTCCTTATTCATTTGTTGCA
TGAAATTTAATTTCTATTTAGGTGGTTGTCTTTGGTTATTAGTGGCAACG
TTTTTGAAATTGCCAGTTTCGGGATCCCACAGTATTGTGGGGGCCATGGT
TGGTTTTGCATTGATTATTCAAGGCCCGGCTGGAATTGCATGGAAGAAAT
TGGGAATGATTGTTGCTTCGTGGTTCGTGTCTCCTCTTTTAAGTGGTCTG
GTTTCAGCATTCGTATTTTTTATTTTCGATAAATTCATCTTGAAGAAATC
CGAATCGAGAGAACCGGCGTTGAACTTTTTACCTTTTATTTATGCTATTA
CAATTTTTATTAATTTCTTCTCGATCTTTTTGACAGGTCCTACTTTACTA
AAGTTCGACAAAATTCCTCTTTATGGAAATTTTATTATTAGCATTGGACT
TTCCGTTATAACAATAATTGTCGTTCGATTCGCATTGGTTCCTTATTTAA
GGAAAATTATTTTAAAAAGCGAACCGATTGAAGGCGTGACAGTTGTGAGC
AATGTTCCCTCAGTGGAAGAGGTCAATGAAAATCTTGATATAAACATTGA
TGAAGATACACAAACAAACAAATTAAATTCGGAAGAAGAAACGATTACAA
TTAAAATATCCGAAGATAAAGAAACAGAAACTGAAACTGACTTAACTAAA
AAAGAAATGTGTGAAGTTTCACTTGAAGATATAAAAGAAAATTCTACAGA
AGTTGAATGTAAAACGGTGGAAAAAACTGTCATTAAAGATAAACCGGAAT
TGGTTACGATATTTTCTTGGGTTCAAGTCTTGACTGCAATATTTGGATCG
TTTGCTCATGGAGGAAATGACGTCAGTAATGCGATTGGCCCGCTCGTTGG
TTTATGGATAATTGCTATTACTCAAGATGTCTATAGTACTGAAGCTGTTC
CTATCTGGGTTCTTGTCTACGGTGGTCTGGGGATTACTGTTGGTTTGTGG
GTTTGGGGACGAAGGGTCATGAAAACTATTGGAGATGATTTAACAACAAT
TACACCAACAAGTGGAGTGAGCATAGAATTAGGAGCTGCTGTAACGGTTT
TGATTGCCTCTAACATTGGAATTCCAATCTCAACTACTCATTGCAAGGTC
GGTTCAATTGTAGCCGTTGGAAGATACAGATCGAATGACAACGTCGACTG
GTCTATTTTCAGAAATATATGCTTTGCATGGCTGGTCACGGTGCCAGTTT
CGGCAGGAATAAGCGCACTTACAATGTTCCTTTTAAGAATGCTCATTTAG
TTCAGCAAGAAATAGAAAAATTTTT
back to top

protein sequence of SMED30009145-orf-1

>SMED30009145-orf-1 ID=SMED30009145-orf-1|Name=SMED30009145-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=435bp
MMIGQLSSLSGRSLFICCMKFNFYLGGCLWLLVATFLKLPVSGSHSIVGA
MVGFALIIQGPAGIAWKKLGMIVASWFVSPLLSGLVSAFVFFIFDKFILK
KSESREPALNFLPFIYAITIFINFFSIFLTGPTLLKFDKIPLYGNFIISI
GLSVITIIVVRFALVPYLRKIILKSEPIEGVTVVSNVPSVEEVNENLDIN
IDEDTQTNKLNSEEETITIKISEDKETETETDLTKKEMCEVSLEDIKENS
TEVECKTVEKTVIKDKPELVTIFSWVQVLTAIFGSFAHGGNDVSNAIGPL
VGLWIIAITQDVYSTEAVPIWVLVYGGLGITVGLWVWGRRVMKTIGDDLT
TITPTSGVSIELGAAVTVLIASNIGIPISTTHCKVGSIVAVGRYRSNDNV
DWSIFRNICFAWLVTVPVSAGISALTMFLLRMLI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000087proximal tubule
Vocabulary: INTERPRO
TermDefinition
IPR016979DUF2129
IPR001204Phos_transporter
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: biological process
TermDefinition
GO:0006817phosphate ion transport
GO:0006810transport
GO:0055085transmembrane transport
Vocabulary: molecular function
TermDefinition
GO:0005315inorganic phosphate transmembrane transporter activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001204Phosphate transporterPFAMPF01384PHO4coord: 19..423
e-value: 1.1E-96
score: 323.9
IPR001204Phosphate transporterPANTHERPTHR11101PHOSPHATE TRANSPORTERcoord: 25..174
coord: 227..433
NoneNo IPR availablePANTHERPTHR11101:SF46SODIUM-DEPENDENT PHOSPHATE TRANSPORTER 1coord: 227..433
NoneNo IPR availablePANTHERPTHR11101:SF46SODIUM-DEPENDENT PHOSPHATE TRANSPORTER 1coord: 25..174
NoneNo IPR availableTMHMMTMhelixcoord: 15..37
NoneNo IPR availableTMHMMTMhelixcoord: 142..164
NoneNo IPR availableTMHMMTMhelixcoord: 317..339
NoneNo IPR availableTMHMMTMhelixcoord: 72..94
NoneNo IPR availableTMHMMTMhelixcoord: 269..291
NoneNo IPR availableTMHMMTMhelixcoord: 44..66
NoneNo IPR availableTMHMMTMhelixcoord: 408..430
NoneNo IPR availableTMHMMTMhelixcoord: 107..129