CCDC66 domain-containing protein

Overview
NameCCDC66 domain-containing protein
Smed IDSMED30009144
Uniprot Best hitCoiled-coil domain-containing protein 66 OS=Homo sapiens OX=9606 GN=CCDC66 PE=1 SV=4 (E=8.17532e-06)
Length (bp)3032
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of CCDC66 domain-containing protein (SMED30009144) t-SNE clustered cells

Violin plots show distribution of expression levels for CCDC66 domain-containing protein (SMED30009144) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of CCDC66 domain-containing protein (SMED30009144) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for CCDC66 domain-containing protein (SMED30009144) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30009144

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30009144SMESG000019367.1 SmedASXL_016064SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30009144SMESG000019367.1 dd_Smed_v4_11800_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30009144SMESG000019367.1 dd_Smed_v4_11800_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30009144SMESG000019367.1 dd_Smed_v4_11800_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30009144SMESG000019367.1 dd_Smed_v4_11800_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
epidermal cellSMED30009144SMESG000019367.1 dd_Smed_v4_11800_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30009144SMESG000019367.1 dd_Smed_v6_11800_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30009144SMESG000019367.1 dd_Smed_v4_11800_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30009144SMESG000019367.1 dd_Smed_v4_11800_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of CCDC66 domain-containing protein vs. Ensembl Human
Match: CCDC66 (coiled-coil domain containing 66 [Source:HGNC Symbol;Acc:HGNC:27709])

HSP 1 Score: 54.6842 bits (130), Expect = 1.092e-6
Identity = 151/535 (28.22%), Postives = 242/535 (45.23%), Query Frame = 3
Query: 1236 GLADLSQMSQEEIIQKRSKQMEQQEAIRKQIXXXXXXXXXXXXXNAQLDQEEENRILREKLKLDTQYLSETARIKQKDDESGKRLAQQRLQLETAERAALMDKKLKRLQRL-ELA--GHDTRQLRAGLIAEQMSGRLGDSLELRSEDNSFRQPNFEKPTYEIIPSPRSYFQHPIT-EDQGVQTDN-----YVLRENRSRPFEEHN-PYIGPPSHRHQVVDSTKLIKHNKSATETNNRKPLKPSNKQRPSSSASNKSQLTKKVKKLEPVEARRPWGMKKNSKKYVPQSKRDPFYAVSQETREVHKQQRVNRILAQVKANMDRIPENEVNDGRLSQ-RHKKCENQHISDQDKEN----YEVNHDTYELKENSYRDDDRVQGQVTYKDTYRQSTK-----PY-NSSRQVAIVQEASKSPEISNDWWTDTNHEI--IRTTDILNPALADQILPFSRENTGRERARQGYYKNQNPAQYGELLKSQSNNPNSHNAEPNKRDPFYQIPSHPT--QRQNTILKQLSDIREGLLMKQKEIETSL 2765
             L D +Q+  EE  ++R KQ+E Q+AI  Q+EEK  KK+LE E+  + +QEEE R+ +E+ ++  QY  E   +KQK  E    L    L  +T +RA  + ++LK+ QR+ ELA  GHDT +L   L          D++++  E N+    N    + EI     +Y     + +D GVQTD+     +   E+      E +      P    +++      K+ +  T+       K +N  R +   +  +++ K+ K ++    R  W + K  K+Y+P S++ P     Q+ RE  K +R   +L  V+ N         N G LSQ R    E  H S Q+ E+    + V  +   L  +S+  +      V       Q T+     P  NSS +   +   S   E+S+   ++++H I  +RT +I      D   P S  +T   +    Y  +Q+  Q  +L  S              RDP    P+      RQ  ILK LS++R+GLL KQKE+E+SL
Sbjct:  413 ALLDPAQI--EERDRRRQKQLEHQKAITAQVEEKRRKKQLEEEQRKKEEQEEELRLAQEREEMQKQY--EEDILKQKQKEEIMTLKTNEL-FQTMQRAQELAQRLKQEQRIRELAQKGHDTSRLIKNLGV--------DTIQM--EYNASNISNSRHDSDEISGKMNTYMNSTTSKKDTGVQTDDLNIGIFTNAESHCGSLMERDITNCSSPEISAELIGQFSTKKNKQELTQDKGASLEKENN--RCNDQCNQFTRIEKQTKHMKKYPKRPDWNINKPPKRYIPASEKYPKQL--QKQREEKKVRRQMELLHLVEKN---------NPGHLSQNRGISPEIFHSSHQETESKLRWHLVKKEEEPLNIHSFSKERSPSSPVPVVKNRTQQTQNTLHLPLKNSSYERENLISGSNQTELSSG-ISESSHFIPYVRTNEIY---YLDPDAPLSGPSTQDPQ----YQNSQDCGQKRQLFDSDC-----------VRDPLLN-PNMVKNRDRQQAILKGLSELRQGLLQKQKELESSL 899          
BLAST of CCDC66 domain-containing protein vs. Ensembl Human
Match: CCDC66 (coiled-coil domain containing 66 [Source:HGNC Symbol;Acc:HGNC:27709])

HSP 1 Score: 53.9138 bits (128), Expect = 1.702e-6
Identity = 151/535 (28.22%), Postives = 242/535 (45.23%), Query Frame = 3
Query: 1236 GLADLSQMSQEEIIQKRSKQMEQQEAIRKQIXXXXXXXXXXXXXNAQLDQEEENRILREKLKLDTQYLSETARIKQKDDESGKRLAQQRLQLETAERAALMDKKLKRLQRL-ELA--GHDTRQLRAGLIAEQMSGRLGDSLELRSEDNSFRQPNFEKPTYEIIPSPRSYFQHPIT-EDQGVQTDN-----YVLRENRSRPFEEHN-PYIGPPSHRHQVVDSTKLIKHNKSATETNNRKPLKPSNKQRPSSSASNKSQLTKKVKKLEPVEARRPWGMKKNSKKYVPQSKRDPFYAVSQETREVHKQQRVNRILAQVKANMDRIPENEVNDGRLSQ-RHKKCENQHISDQDKEN----YEVNHDTYELKENSYRDDDRVQGQVTYKDTYRQSTK-----PY-NSSRQVAIVQEASKSPEISNDWWTDTNHEI--IRTTDILNPALADQILPFSRENTGRERARQGYYKNQNPAQYGELLKSQSNNPNSHNAEPNKRDPFYQIPSHPT--QRQNTILKQLSDIREGLLMKQKEIETSL 2765
             L D +Q+  EE  ++R KQ+E Q+AI  Q+EEK  KK+LE E+  + +QEEE R+ +E+ ++  QY  E   +KQK  E    L    L  +T +RA  + ++LK+ QR+ ELA  GHDT +L   L          D++++  E N+    N    + EI     +Y     + +D GVQTD+     +   E+      E +      P    +++      K+ +  T+       K +N  R +   +  +++ K+ K ++    R  W + K  K+Y+P S++ P     Q+ RE  K +R   +L  V+ N         N G LSQ R    E  H S Q+ E+    + V  +   L  +S+  +      V       Q T+     P  NSS +   +   S   E+S+   ++++H I  +RT +I      D   P S  +T   +    Y  +Q+  Q  +L  S              RDP    P+      RQ  ILK LS++R+GLL KQKE+E+SL
Sbjct:  447 ALLDPAQI--EERDRRRQKQLEHQKAITAQVEEKRRKKQLEEEQRKKEEQEEELRLAQEREEMQKQY--EEDILKQKQKEEIMTLKTNEL-FQTMQRAQELAQRLKQEQRIRELAQKGHDTSRLIKNLGV--------DTIQM--EYNASNISNSRHDSDEISGKMNTYMNSTTSKKDTGVQTDDLNIGIFTNAESHCGSLMERDITNCSSPEISAELIGQFSTKKNKQELTQDKGASLEKENN--RCNDQCNQFTRIEKQTKHMKKYPKRPDWNINKPPKRYIPASEKYPKQL--QKQREEKKVRRQMELLHLVEKN---------NPGHLSQNRGISPEIFHSSHQETESKLRWHLVKKEEEPLNIHSFSKERSPSSPVPVVKNRTQQTQNTLHLPLKNSSYERENLISGSNQTELSSG-ISESSHFIPYVRTNEIY---YLDPDAPLSGPSTQDPQ----YQNSQDCGQKRQLFDSDC-----------VRDPLLN-PNMVKNRDRQQAILKGLSELRQGLLQKQKELESSL 933          
BLAST of CCDC66 domain-containing protein vs. Ensembl Mouse
Match: Ccdc66 (coiled-coil domain containing 66 [Source:MGI Symbol;Acc:MGI:2443639])

HSP 1 Score: 52.373 bits (124), Expect = 3.825e-6
Identity = 153/533 (28.71%), Postives = 238/533 (44.65%), Query Frame = 3
Query: 1236 GLADLSQMSQEEIIQKRSKQMEQQEAIRKQIXXXXXXXXXXXXXNAQLDQEEENRILREKLKLDTQYLSETARIKQKDDESGKRLAQQRLQLETAERAALMDKKLKRLQRL-ELA--GHDTRQLRAGLIAEQMSGRLGDSLELRSEDNSFRQPNFEKPTYEIIPSPRSYFQHPITEDQGVQTDNYVLR-ENRSRP-----FEEHNPYIGPPSHRHQVVDSTKLIKHNKSATETNNRKPLKPSNKQRPSSSASNKSQLTKKVKKLEPVEARRP-WGMKKNSKKYVPQSKRDPFYAVSQETREVHKQQRVNRILAQVKANMDRIPEN-EVNDGR--LSQRHKKCENQ---HISDQDKENYEVNHDTYELKENSYRDDDRVQGQVTYKDTYRQSTKPYNSSRQVAIVQEASKSPEISNDWWTDTNHEI--IRTTDILNPALADQILPFSRENTGRERARQGYYKNQNPAQYGELLKSQSNNPNSHNAEPNKRDPFYQIPSHPT-----QRQNTILKQLSDIREGLLMKQKEIETSL 2765
             L D +Q+ + E  ++R KQ+E Q+AI  Q+EE   KKRLE E+  + +QE E R+ RE+ ++  QY  E   +KQ+  E    L    L   T +RA  + ++LK+ QR+ ELA  GHDT +L   L      G   D     +  +S   P  E+       SP+        +D GVQTD+  L   N + P      E+    I  P    +    T + K N+  +  N    L   N     +   N+ + T+K  KL     ++P W + K  KKYVP S + P +   Q+ +E  K QR   +L  V+ N    PEN   N G   L+  H++ E++   H+  + +E  +    + E  + S    +R Q   T  +      K  +  ++   + +        +D  ++ +H I  +RT +I      D   P SR +T   +    Y K+ + A+  EL  S            + RDP      +P       RQ  ILK LS++R+GLL KQKE+ET+L
Sbjct:  444 ALLDPAQIEERE--RRRQKQLEHQKAIMAQVEENRRKKRLEEEQRKKEEQELELRLAREREEMQRQY--EEDILKQRQREEIMTLKTNEL-FHTMQRAQELAQRLKQEQRIRELAQKGHDTSRLIQNL------GAQVDYKAFTTISSSHSDP--EETADTSTASPK--------KDTGVQTDDVNLGIFNDALPPCGSVTEKGIRNISSPEISAEFSGQTDIRKENQELS-MNKGTNLDKENSWH--NGQCNQYRRTEKQTKLMKKCPKKPAWNINKPLKKYVPASAKYPAHL--QKEKEEKKVQRQMELLHLVERNN---PENLSQNRGISPLATSHRETESESRLHLIKKVEEPLKTPSVSKERFQTSPAVKNRTQQ--TQSNVLHLPLKNNDYEKETLTLGDGHTK---LSDEMSEPSHFIPYVRTNEIY---YLDPDAPLSRPSTQDNQ----YQKSHDCAREQELFDSD-----------HIRDPLL----NPKLVKNRDRQQAILKGLSELRQGLLQKQKELETNL 920          
BLAST of CCDC66 domain-containing protein vs. Ensembl Mouse
Match: Ccdc66 (coiled-coil domain containing 66 [Source:MGI Symbol;Acc:MGI:2443639])

HSP 1 Score: 51.6026 bits (122), Expect = 5.484e-6
Identity = 151/534 (28.28%), Postives = 236/534 (44.19%), Query Frame = 3
Query: 1236 GLADLSQMSQEEIIQKRSKQMEQQEAIRKQIXXXXXXXXXXXXXNAQLDQEEENRILREKLKLDTQYLSETARIKQKDDESGKRLAQQRLQLETAERAALMDKKLKRLQRL-ELA--GHDTRQLRAGLIAEQMSGRLGDSLELRSEDNSFRQPNFEKPTYEIIPSPRSYFQHPITEDQGVQTDNYVLR-ENRSRP-----FEEHNPYIGPPSHRHQVVDSTKLIKHNKSATETNNRKPLKPSNKQRPSSSASNKSQLTKKVKKLEPVEARRP-WGMKKNSKKYVPQSKRDPFYAVSQETREVHKQQRVNRILAQVKANMDRIPENEVNDGR----LSQRHKKCENQ---HISDQDKENYEVNHDTYELKENSYRDDDRVQGQVTYKDTYRQSTKPYNSSRQVAIVQEASKSPEISNDWWTDTNHEI--IRTTDILNPALADQILPFSRENTGRERARQGYYKNQNPAQYGELLKSQSNNPNSHNAEPNKRDPFYQIPSHPT-----QRQNTILKQLSDIREGLLMKQKEIETSL 2765
             L D +Q+ + E  ++R KQ+E Q+AI  Q+EE   KKRLE E+  + +QE E R+ RE+ ++  QY  E   +KQ+  E    L    L   T +RA  + ++LK+ QR+ ELA  GHDT +L   L      G   D     +  +S   P     T    P           +D GVQTD+  L   N + P      E+    I  P    +    T + K N+  +  N    L   N     +   N+ + T+K  KL     ++P W + K  KKYVP S + P +   Q+ +E  K QR   +L  V+ N    PEN ++  R    L+  H++ E++   H+  + +E  +    + E  + S    +R Q   T  +      K  +  ++   + +        +D  ++ +H I  +RT +I      D   P SR +T   +    Y K+ + A+  EL  S            + RDP      +P       RQ  ILK LS++R+GLL KQKE+ET+L
Sbjct:  288 ALLDPAQIEERE--RRRQKQLEHQKAIMAQVEENRRKKRLEEEQRKKEEQELELRLAREREEMQRQY--EEDILKQRQREEIMTLKTNEL-FHTMQRAQELAQRLKQEQRIRELAQKGHDTSRLIQNL------GAQVDYKAFTTISSSHSDPEETADTSTASPK----------KDTGVQTDDVNLGIFNDALPPCGSVTEKGIRNISSPEISAEFSGQTDIRKENQELS-MNKGTNLDKENSWH--NGQCNQYRRTEKQTKLMKKCPKKPAWNINKPLKKYVPASAKYPAHL--QKEKEEKKVQRQMELLHLVERNN---PEN-LSQNRGISPLATSHRETESESRLHLIKKVEEPLKTPSVSKERFQTSPAVKNRTQQ--TQSNVLHLPLKNNDYEKETLTLGDGHTK---LSDEMSEPSHFIPYVRTNEIY---YLDPDAPLSRPSTQDNQ----YQKSHDCAREQELFDSD-----------HIRDPLL----NPKLVKNRDRQQAILKGLSELRQGLLQKQKELETNL 764          
BLAST of CCDC66 domain-containing protein vs. UniProt
Match: sp|A2RUB6|CCD66_HUMAN (Coiled-coil domain-containing protein 66 OS=Homo sapiens OX=9606 GN=CCDC66 PE=1 SV=4)

HSP 1 Score: 53.9138 bits (128), Expect = 8.175e-6
Identity = 151/535 (28.22%), Postives = 242/535 (45.23%), Query Frame = 3
Query: 1236 GLADLSQMSQEEIIQKRSKQMEQQEAIRKQIXXXXXXXXXXXXXNAQLDQEEENRILREKLKLDTQYLSETARIKQKDDESGKRLAQQRLQLETAERAALMDKKLKRLQRL-ELA--GHDTRQLRAGLIAEQMSGRLGDSLELRSEDNSFRQPNFEKPTYEIIPSPRSYFQHPIT-EDQGVQTDN-----YVLRENRSRPFEEHN-PYIGPPSHRHQVVDSTKLIKHNKSATETNNRKPLKPSNKQRPSSSASNKSQLTKKVKKLEPVEARRPWGMKKNSKKYVPQSKRDPFYAVSQETREVHKQQRVNRILAQVKANMDRIPENEVNDGRLSQ-RHKKCENQHISDQDKEN----YEVNHDTYELKENSYRDDDRVQGQVTYKDTYRQSTK-----PY-NSSRQVAIVQEASKSPEISNDWWTDTNHEI--IRTTDILNPALADQILPFSRENTGRERARQGYYKNQNPAQYGELLKSQSNNPNSHNAEPNKRDPFYQIPSHPT--QRQNTILKQLSDIREGLLMKQKEIETSL 2765
             L D +Q+  EE  ++R KQ+E Q+AI  Q+EEK  KK+LE E+  + +QEEE R+ +E+ ++  QY  E   +KQK  E    L    L  +T +RA  + ++LK+ QR+ ELA  GHDT +L   L          D++++  E N+    N    + EI     +Y     + +D GVQTD+     +   E+      E +      P    +++      K+ +  T+       K +N  R +   +  +++ K+ K ++    R  W + K  K+Y+P S++ P     Q+ RE  K +R   +L  V+ N         N G LSQ R    E  H S Q+ E+    + V  +   L  +S+  +      V       Q T+     P  NSS +   +   S   E+S+   ++++H I  +RT +I      D   P S  +T   +    Y  +Q+  Q  +L  S              RDP    P+      RQ  ILK LS++R+GLL KQKE+E+SL
Sbjct:  447 ALLDPAQI--EERDRRRQKQLEHQKAITAQVEEKRRKKQLEEEQRKKEEQEEELRLAQEREEMQKQY--EEDILKQKQKEEIMTLKTNEL-FQTMQRAQELAQRLKQEQRIRELAQKGHDTSRLIKNLGV--------DTIQM--EYNASNISNSRHDSDEISGKMNTYMNSTTSKKDTGVQTDDLNIGIFTNAESHCGSLMERDITNCSSPEISAELIGQFSTKKNKQELTQDKGASLEKENN--RCNDQCNQFTRIEKQTKHMKKYPKRPDWNINKPPKRYIPASEKYPKQL--QKQREEKKVRRQMELLHLVEKN---------NPGHLSQNRGISPEIFHSSHQETESKLRWHLVKKEEEPLNIHSFSKERSPSSPVPVVKNRTQQTQNTLHLPLKNSSYERENLISGSNQTELSSG-ISESSHFIPYVRTNEIY---YLDPDAPLSGPSTQDPQ----YQNSQDCGQKRQLFDSDC-----------VRDPLLN-PNMVKNRDRQQAILKGLSELRQGLLQKQKELESSL 933          
BLAST of CCDC66 domain-containing protein vs. TrEMBL
Match: gnl|BL_ORD_ID|18325306 (tr|A0A1I8IT59|A0A1I8IT59_9PLAT Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 95.9005 bits (237), Expect = 3.156e-19
Identity = 53/115 (46.09%), Postives = 71/115 (61.74%), Query Frame = 3
Query: 2454 HEIIRTTDILNPALADQILPFSRENTGRERARQGYYKNQNPAQYGELLKSQSNNPNSHNAEPNKR-----DPFYQ---IPSHPTQRQNTILKQLSDIREGLLMKQKEIETSLSFN 2774
            H ++RT+ +LNPA A + LP SRE T RE AR+ Y +  NP+ YG    +  N  ++ +A+P  R     DP +    +   PT RQ+ IL QLS IR+GLL KQKEIETSLS +
Sbjct:   42 HGLVRTSAVLNPATAGKPLPISRETTARELARRAYMRGLNPSHYG---VAMDNFEDAFDADPVARRPEPPDPIFHPGLVKDSPTSRQDAILLQLSTIRQGLLDKQKEIETSLSVS 153          
BLAST of CCDC66 domain-containing protein vs. TrEMBL
Match: gnl|BL_ORD_ID|18189307 (tr|A0A1I8IDA8|A0A1I8IDA8_9PLAT Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 92.4337 bits (228), Expect = 8.702e-18
Identity = 52/122 (42.62%), Postives = 70/122 (57.38%), Query Frame = 3
Query: 2454 HEIIRTTDILNPALADQILPFSRENTGRERARQGYYKNQNPAQYGELL----KSQSNNPNSHNAEP--------NKRDPFYQ---IPSHPTQRQNTILKQLSDIREGLLMKQKEIETSLSFN 2774
            H ++RT+ +LNPA A + LP SRE T RE AR+ Y +  NP+ YG  +     +   +P +   EP          +DP +    +   PT RQ+ IL QLS IR+GLL KQKEIETSLS +
Sbjct:   42 HGLVRTSAVLNPATAGKPLPISRETTARELARRAYMRGLNPSHYGVAMDNFEDAFDADPVARRPEPPVVEQPTKGGKDPIFHPGLVKDSPTSRQDAILLQLSTIRQGLLDKQKEIETSLSVS 163          
BLAST of CCDC66 domain-containing protein vs. TrEMBL
Match: gnl|BL_ORD_ID|15726996 (tr|R7TN75|R7TN75_CAPTE CCDC66 domain-containing protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_217825 PE=4 SV=1)

HSP 1 Score: 99.3673 bits (246), Expect = 2.636e-17
Identity = 172/623 (27.61%), Postives = 271/623 (43.50%), Query Frame = 3
Query: 1065 VSQSEIKRQQWLTELNEQVAEKERRKLMENLSGNPSE---------SYRTK-MSSNDDI----------------------------NLTHGRGKGLADLSQMSQEEIIQKRSKQMEQQEAIRKQIXXXXXXXXXXXXXNAQLDQEEENRILREKLKLDTQYLSETARIKQKDDESGKRLAQQRLQLETAERAALMDKKLKRLQRLELAGHD-----TRQLRAGLIAEQMSGRLGDSLELRSEDNSFRQPNFEKPTYEIIPSPRSYFQHPITEDQGVQTDNYVLRENRSRPFEEHNPYIGPPSHRHQVVDSTKLIKHNKSATETNNRKPLKPSNKQRPSSSASNKSQLTKKVKKLEPVEARRPWGMKKNSKK-YVPQSKRDPFYAVSQETREVHKQQRVNRILAQVKANMDRIPENEVNDGRLSQRHKKCENQHISDQDKENYEVNHDTYELKENSYRDDDRVQGQVT-----------YKDTYRQSTKPYN-SSRQVAIVQEASKSPEISNDWWTDTNHEIIRTTDILNPALADQILPFSRENTGRERARQGYYKNQNPAQYGELLKSQSNNPNSHNAEPNKRDPFYQ---IPSHPTQRQNTILKQLSDIREGLLMKQKEIE 2756
            VS  E KR  WL EL +Q  E  +RK  E   G   E         +Y+ K + + D I                            + T+ RG+    +  ++  E+  KR K+ + Q+ IR+QIEEK   KR ERE+  + + EEE ++ +E+    T    E A+ K+KD+   KR  ++   +E A+ AA MDK  KRL +L+  GHD     T+  R  L A+  +G + +   +   D+S R  + E                  T +QG  T+N VL     R   +     G       V   + +   N+  T+   + P   S K R  S   +      + KK   +  R  WG +  +KK  V QS RDP Y   ++  E+ KQ+R   +L +++    R    E    R S+ H+         QD + Y   +    LK+ S++         T            K   R+    Y  +S +V   + A   P  +N  +       +RTTD+L+P+ AD+ +P SRE +  +R R+ Y +  NPA+YG+ + +  +   S+      +DP  Q   +  HPT RQ  IL+QLS +R GL++KQ+E+E
Sbjct:  396 VSAKERKRLLWLQELEQQREEDRQRKAKEKSYGRQDEETHWADKFSNYQPKGLPAQDSIAPPPPNDTAARISSAPVQTMDSTSNKLEDATYLRGQN-TRIDPVTLRELEDKRKKEQQHQDFIRQQIEEKARLKREERERRVREELEEEKQLQKERTHGLTH--REDAKQKEKDEAERKRALEE--AIERAQEAAEMDKHQKRLLKLQQGGHDVSNFETKTPRNMLPAQFNTGTIVEPSHVPGLDSSPR--DVE------------------TRNQGCYTENRVLTPTDQRTARKE---FG-------VQTESDITLGNREETDIEYQGPF--SKKVRIKSGPKDG-----RPKKPVKINERPKWGYQNAAKKKAVKQSARDPHYEQKKQRAEIMKQERQQAML-KMQQEQRRTVTRETAASR-SRSHEPKSPMIPKHQDYDQYARQN----LKDTSHKSQTPPPSVPTKHRSPSPPVPTIKHMIRECDDQYKQTSSRVGGSKYADMDPTYNNSDFI----PFVRTTDLLDPSKADESVPVSREQSAVQRGRKVYQQELNPAKYGKKMANIKDKNESYT-----KDPILQPNLVTEHPTSRQGQILQQLSSLRRGLMLKQRELE 961          
BLAST of CCDC66 domain-containing protein vs. TrEMBL
Match: gnl|BL_ORD_ID|15750639 (tr|R7TCF8|R7TCF8_CAPTE CCDC66 domain-containing protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_188864 PE=4 SV=1)

HSP 1 Score: 98.2117 bits (243), Expect = 3.575e-17
Identity = 127/459 (27.67%), Postives = 203/459 (44.23%), Query Frame = 3
Query: 1443 ETARIKQKDDESGKRLAQQRLQLETAERAALMDKKLKRLQRLELAGHD-----TRQLRAGLIAEQMSGRLGDSLELRSEDNSFRQPNFEKPTYEIIPSPRSYFQHPITEDQGVQTDNYVLRENRSRPFEEHNPYIGPPSHRHQVVDSTKLIKHNKSATETNNRKPLKPSNKQRPSSSASNKSQLTKKVKKLEPVEARRPWGMKKNSKK-YVPQSKRDPFYAVSQETREVHKQQRVNRILAQVKANMDRIPENEVNDGRLSQRHKKCENQHISDQDKENYEVNHDTYELKENSYRDDDRVQGQVT-----------YKDTYRQSTKPYN-SSRQVAIVQEASKSPEISNDWWTDTNHEIIRTTDILNPALADQILPFSRENTGRERARQGYYKNQNPAQYGELLKSQSNNPNSHNAEPNKRDPFYQ---IPSHPTQRQNTILKQLSDIREGLLMKQKEIE 2756
            E A+ K+KD+   KR  ++   +E A+ AA MDK  KRL +L+  GHD     T+  R  L A+  +G + +   +   D+S R  + E                  T++QG  T+N VL     R   +     G       V   + +   N+  T+   + P   S K R  S   +      + KK   +  R  WG +  +KK  V QS RDP Y   ++  E+ KQ+R   +L +++    R    E    R S+ H+         QD + Y   +    LK+ S++         T            K   R+    Y  +S +V   + A   P  +N  +       +RTTD+L+P+ AD+ +P SRE +  +R R+ Y +  NPA+YG+ + +  +   S+      +DP  Q   +  HPT RQ  IL+QLS +R GL++KQ+E+E
Sbjct:  251 EDAKQKEKDEAERKRALEE--AIERAQEAAEMDKHQKRLLKLQQGGHDVSNFETKTPRNMLPAQFNTGTIVEPSHVPGLDSSPR--DVE------------------TQNQGYYTENRVLTPTDQRTARKE---FG-------VQTESDITLGNREETDIEYQGPF--SKKVRIKSGPKDG-----RPKKPVKINERPKWGYQNAAKKKAVKQSARDPHYEQKKQRAEIMKQERQQAML-KMQQEQRRTVTRETAASR-SRSHEPKSPMIPKHQDYDQYARQN----LKDTSHKSQTPPPSVPTKHRSPSPPVPTIKHMIRECDDQYKQTSSRVGGSKYADMDPTYNNSDFI----PFVRTTDLLDPSKADESVPVSREQSAVQRGRKVYQQELNPAKYGKKMANIKDKNESYT-----KDPILQPNLVTEHPTSRQGQILQQLSSLRRGLMLKQRELE 655          
BLAST of CCDC66 domain-containing protein vs. TrEMBL
Match: gnl|BL_ORD_ID|18272959 (tr|A0A267GCM5|A0A267GCM5_9PLAT Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig009772g1 PE=4 SV=1)

HSP 1 Score: 93.5893 bits (231), Expect = 1.845e-15
Identity = 52/122 (42.62%), Postives = 71/122 (58.20%), Query Frame = 3
Query: 2454 HEIIRTTDILNPALADQILPFSRENTGRERARQGYYKNQNPAQYGELLKSQSN----NPNSHNAEP--------NKRDPFYQ---IPSHPTQRQNTILKQLSDIREGLLMKQKEIETSLSFN 2774
            H ++RT+ +LNPA A + LP SRE T RE AR+ Y +  NP+ YG  + +  +    +P +   EP          +DP +    +   PT RQ+ IL QLS IR+GLL KQKEIETSLS +
Sbjct:  890 HGLVRTSAVLNPATAGKPLPISRETTARELARRAYMRGLNPSHYGVAMDNFEDAFDADPVARRPEPPVVEQPTKGGKDPIFHPGLVKDSPTSRQDAILLQLSTIRQGLLDKQKEIETSLSVS 1011          
BLAST of CCDC66 domain-containing protein vs. Planmine SMEST
Match: SMESG000019367.1 (SMESG000019367.1)

HSP 1 Score: 1655.19 bits (4285), Expect = 0.000e+0
Identity = 823/831 (99.04%), Postives = 824/831 (99.16%), Query Frame = 3
Query:   72 MPVLKFETKIINGKPNISFGSEQPKVPLKKSDYKFKNQKFPLRANSSTNTVPNETQLKNQPKISYENELFSRKKSSDHIIKPQKISENSEIPSDRNSNDKINNIHNYRRSLKQTATKESLFNFLKDDAKNEKFSQRKPDSSDEYARNNLHVKPDSLTEDDIDEVMKQIVLENKHLLSEEQLVDVLAKLYLDAKISKKQKVEIHQIPNNVVDRKPQKSTEQHFELPKQEENHSIYSKLEEKQNIDRLPNNYPPAASGLTALQKKQLQWDKERKEMAEISSYNPWGKPGCGAPTKTSVETRQTDNIYSPKPVSQTITNSQLEPQKNYFIPQENVSQSEIKRQQWLTELNEQVAEKERRKLMENLSGNPSESYRTKMSSNDDINLTHGRGKGLADLSQMSQEEIIQKRSKQMEQQEAIRKQIXXXXXXXXXXXXXNAQLDQEEENRILREKLKLDTQYLSETARIKQKDDESGKRLAQQRLQLETAERAALMDKKLKRLQRLELAGHDTRQLRAGLIAEQMSGRLGDSLELRSEDNSFRQPNFEKPTYEIIPSPRSYFQHPITEDQGVQTDNYVLRENRSRPFEEHNPYIGPPSHRHQVVDSTKLIKHNKSATETNNRKPLKPSNKQRPSSSASNKSQLTKKVKKLEPVEARRPWGMKKNSKKYVPQSKRDPFYAVSQETREVHKQQRVNRILAQVKANMDRIPENEVNDGRLSQRHKKCENQHISDQDKENYEVNHDTYELKENSYRDDDRVQGQVTYKDTYRQSTKPYNSSRQVAIVQEASKSPEISNDWWTDTNHEIIRTTDILNPALADQILPFSRENTGRERARQGYYK 2564
            MPVLKFETKIINGKPNISFGSEQPKVPLKKSDYKFKNQKFPLRANSSTN VPNETQLKNQPKISYENELFSRKKSSDHIIK QKISENSEIPSDRNSNDKINNIHNYRRSLKQTATKESLFNFLKDDAKNEKFS RKPDSSDEYARNNLHVK DSLTEDDIDEVMKQIVLENKHLLSEEQLVDVLAKLYLDAKISKKQKVEIHQIPNNVVDRKPQKSTEQHFELPKQEENHSIYSKLEEKQNIDRLPNNYP AASGLTALQKKQLQWDKERKEMAEISSYNPWGKPGCGAPTKTSVETRQTDNIYSPKPVSQTITNSQLEPQKNYFIPQENVSQSEI+RQQWLTELNEQVAEKERRKLMENLSGNPSESYRTKMSSNDDINLTHGRGKGLADLSQMSQEEIIQKRSKQMEQQEAIRKQIEEKEFKKRLEREKNAQLD EEENRILREKLKLDTQYLSETARIKQKDDESGKRLAQQRLQLETAERAALMDKKLKRLQRLELAGHDTRQLRAGLIAEQMSGRLGDSLELRSEDNSFRQPNFEKPTYEIIPSPRSYFQHPITEDQGVQTDNYVLRENRSRPFEEHNPYIGPPSHRHQVVDSTKLIKHNKSATETNNRKPLKPSNKQRPSSSASNKSQLTKKVKKLEPVEARRPWGMKKNSKKYVPQSKRDPFYAVSQETREVHKQQRVNRILAQVKANMDRIPENEVNDGRLSQRHKKCENQHISDQDKENYEVNHDTYELKENSYRDDDRVQGQVTYKDTYRQSTKPYNSSRQVAIVQEA KSPEISNDWWTDTNHEIIRTTDILNPALADQILPFSRENTGRERARQGYYK
Sbjct:    1 MPVLKFETKIINGKPNISFGSEQPKVPLKKSDYKFKNQKFPLRANSSTNAVPNETQLKNQPKISYENELFSRKKSSDHIIKTQKISENSEIPSDRNSNDKINNIHNYRRSLKQTATKESLFNFLKDDAKNEKFSHRKPDSSDEYARNNLHVKQDSLTEDDIDEVMKQIVLENKHLLSEEQLVDVLAKLYLDAKISKKQKVEIHQIPNNVVDRKPQKSTEQHFELPKQEENHSIYSKLEEKQNIDRLPNNYPAAASGLTALQKKQLQWDKERKEMAEISSYNPWGKPGCGAPTKTSVETRQTDNIYSPKPVSQTITNSQLEPQKNYFIPQENVSQSEIERQQWLTELNEQVAEKERRKLMENLSGNPSESYRTKMSSNDDINLTHGRGKGLADLSQMSQEEIIQKRSKQMEQQEAIRKQIEEKEFKKRLEREKNAQLDHEEENRILREKLKLDTQYLSETARIKQKDDESGKRLAQQRLQLETAERAALMDKKLKRLQRLELAGHDTRQLRAGLIAEQMSGRLGDSLELRSEDNSFRQPNFEKPTYEIIPSPRSYFQHPITEDQGVQTDNYVLRENRSRPFEEHNPYIGPPSHRHQVVDSTKLIKHNKSATETNNRKPLKPSNKQRPSSSASNKSQLTKKVKKLEPVEARRPWGMKKNSKKYVPQSKRDPFYAVSQETREVHKQQRVNRILAQVKANMDRIPENEVNDGRLSQRHKKCENQHISDQDKENYEVNHDTYELKENSYRDDDRVQGQVTYKDTYRQSTKPYNSSRQVAIVQEARKSPEISNDWWTDTNHEIIRTTDILNPALADQILPFSRENTGRERARQGYYK 831          
The following BLAST results are available for this feature:
BLAST of CCDC66 domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 2
Match NameE-valueIdentityDescription
CCDC661.092e-628.22coiled-coil domain containing 66 [Source:HGNC Symb... [more]
CCDC661.702e-628.22coiled-coil domain containing 66 [Source:HGNC Symb... [more]
back to top
BLAST of CCDC66 domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of CCDC66 domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of CCDC66 domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of CCDC66 domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of CCDC66 domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Ccdc663.825e-628.71coiled-coil domain containing 66 [Source:MGI Symbo... [more]
Ccdc665.484e-628.28coiled-coil domain containing 66 [Source:MGI Symbo... [more]
back to top
BLAST of CCDC66 domain-containing protein vs. UniProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 1
Match NameE-valueIdentityDescription
sp|A2RUB6|CCD66_HUMAN8.175e-628.22Coiled-coil domain-containing protein 66 OS=Homo s... [more]
back to top
BLAST of CCDC66 domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
gnl|BL_ORD_ID|183253063.156e-1946.09tr|A0A1I8IT59|A0A1I8IT59_9PLAT Uncharacterized pro... [more]
gnl|BL_ORD_ID|181893078.702e-1842.62tr|A0A1I8IDA8|A0A1I8IDA8_9PLAT Uncharacterized pro... [more]
gnl|BL_ORD_ID|157269962.636e-1727.61tr|R7TN75|R7TN75_CAPTE CCDC66 domain-containing pr... [more]
gnl|BL_ORD_ID|157506393.575e-1727.67tr|R7TCF8|R7TCF8_CAPTE CCDC66 domain-containing pr... [more]
gnl|BL_ORD_ID|182729591.845e-1542.62tr|A0A267GCM5|A0A267GCM5_9PLAT Uncharacterized pro... [more]
back to top
BLAST of CCDC66 domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of CCDC66 domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of CCDC66 domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of CCDC66 domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of CCDC66 domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of CCDC66 domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000019367.10.000e+099.04SMESG000019367.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30009144 ID=SMED30009144|Name=CCDC66 domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=3032bp
TTTTTAAACAAGTAATAAATAAGTAAATTAAAATTTACTGTATTTATTGG
CATTAAATTACTTTTAACGAAATGCCTGTTTTAAAATTCGAAACAAAGAT
CATTAATGGAAAACCTAACATTTCTTTCGGTTCTGAACAGCCGAAGGTTC
CACTTAAAAAATCTGATTACAAATTCAAAAACCAAAAATTTCCTTTAAGA
GCTAACTCATCAACAAACACTGTTCCAAATGAAACCCAATTAAAAAACCA
ACCAAAAATTTCGTATGAAAATGAATTATTTAGTCGCAAAAAGTCAAGTG
ATCATATAATCAAGCCCCAGAAAATCAGTGAAAATTCTGAAATCCCTTCA
GACAGAAACTCAAACGACAAAATAAACAATATTCACAATTATCGCCGTTC
TTTAAAACAAACAGCTACCAAAGAATCACTGTTTAATTTTCTGAAGGATG
ATGCAAAAAACGAAAAATTTTCTCAAAGAAAACCCGATAGTTCCGATGAA
TATGCAAGGAATAATTTACACGTCAAACCGGATTCATTGACTGAAGACGA
TATCGATGAAGTCATGAAACAGATTGTACTGGAAAACAAACATTTACTAT
CAGAAGAACAATTGGTCGATGTGTTAGCAAAATTGTATTTGGATGCTAAA
ATTTCCAAAAAACAAAAAGTAGAAATTCATCAAATTCCAAACAATGTTGT
AGACAGAAAACCCCAGAAATCAACTGAGCAGCATTTTGAATTACCGAAAC
AAGAAGAAAACCATTCAATCTATTCAAAATTGGAAGAGAAACAGAATATC
GATCGATTACCAAACAATTACCCCCCTGCGGCGAGTGGTCTAACGGCGTT
GCAAAAGAAACAACTACAATGGGACAAAGAACGAAAAGAAATGGCGGAAA
TTTCCTCATACAATCCGTGGGGAAAACCCGGATGTGGAGCACCGACGAAA
ACCTCTGTAGAAACCCGGCAAACCGACAACATTTATTCCCCGAAGCCCGT
TAGCCAAACTATCACCAACAGTCAGCTGGAACCACAAAAGAACTATTTCA
TTCCTCAGGAAAATGTTTCCCAATCGGAAATAAAACGCCAACAATGGCTG
ACAGAACTCAATGAGCAAGTGGCAGAAAAGGAGCGACGAAAACTGATGGA
AAATTTATCAGGAAACCCCTCGGAATCCTATCGGACTAAAATGAGCTCAA
ATGACGATATCAATCTGACTCATGGACGAGGCAAAGGACTCGCTGATCTC
AGTCAAATGTCGCAGGAAGAAATCATTCAAAAACGAAGCAAACAAATGGA
ACAACAAGAAGCAATTCGAAAACAAATTGAAGAAAAAGAATTTAAAAAAA
GATTAGAAAGAGAAAAAAATGCTCAATTAGATCAAGAAGAAGAAAATAGA
ATATTGAGAGAAAAACTAAAACTTGATACTCAATATTTATCAGAAACTGC
AAGAATAAAACAAAAGGACGATGAATCTGGGAAACGGTTAGCTCAACAGA
GATTACAGCTAGAAACCGCTGAACGTGCTGCGTTAATGGATAAAAAACTT
AAACGGTTACAGCGGTTAGAATTAGCGGGTCACGATACTCGTCAACTAAG
AGCTGGATTGATTGCTGAACAAATGTCTGGAAGACTTGGAGATAGTTTAG
AGTTGCGATCAGAAGACAACAGTTTTAGACAGCCTAACTTTGAAAAACCC
ACATATGAGATCATTCCTTCCCCGAGATCATATTTTCAGCACCCGATTAC
CGAAGATCAAGGAGTACAAACCGACAATTACGTTCTTAGAGAAAATCGGT
CTCGGCCATTTGAAGAACACAATCCGTATATCGGACCTCCTAGTCACCGA
CATCAAGTAGTTGACTCTACAAAACTGATTAAACACAACAAAAGTGCAAC
TGAAACTAATAACCGTAAACCATTAAAACCTTCAAACAAGCAAAGACCAT
CTTCATCGGCTTCAAATAAAAGTCAACTGACAAAGAAAGTCAAAAAATTG
GAACCGGTTGAAGCTCGTAGACCTTGGGGAATGAAAAAGAATTCTAAAAA
ATATGTACCTCAATCAAAGCGAGATCCTTTTTATGCAGTATCTCAAGAGA
CACGAGAAGTTCATAAACAACAACGAGTCAATAGGATTTTAGCGCAAGTT
AAAGCTAATATGGATAGAATCCCTGAAAACGAAGTTAATGATGGCCGTTT
AAGTCAGCGACATAAGAAATGTGAAAATCAACACATATCTGACCAGGACA
AAGAAAATTATGAGGTGAACCACGATACATATGAATTGAAAGAAAACTCT
TATAGAGATGATGATCGAGTTCAAGGTCAAGTTACTTACAAAGACACTTA
TAGACAATCCACCAAACCCTATAATTCTTCACGGCAAGTAGCAATTGTTC
AAGAGGCTAGTAAGTCTCCAGAAATATCCAACGATTGGTGGACAGACACA
AATCATGAAATTATACGTACTACAGATATTCTCAATCCTGCTTTAGCTGA
TCAAATCTTACCATTCAGTAGAGAAAATACTGGCCGTGAAAGAGCGCGAC
AAGGATATTATAAAAATCAAAACCCTGCTCAATATGGTGAACTGCTAAAG
TCTCAATCTAATAATCCAAATTCCCACAATGCAGAGCCTAATAAGCGTGA
TCCATTTTATCAAATTCCTTCTCATCCTACTCAACGTCAAAATACTATTC
TGAAGCAACTTTCAGATATAAGAGAGGGTTTGCTGATGAAACAGAAGGAA
ATCGAGACCTCCCTCTCTTTTAATGCGGATATTTAATCGACAAATGTAGA
AATTGTAATAATAAATTCGAATATAATTTCATTTTTTCCTCATATATGTA
AAACTATTTTCTTCTGATTTTATGTTTCTTTGAATCTGGACAGTTTCCTA
CTTGTGATAAATGGAGCTGGACGCGGTCTGCTTTCCCCTCGGGAAATGTA
TTTTTCTTATAATTTCGTTTACAAAGTTGATTATCATAGGAATCTATGCG
ATGTATTGGCAACAAAGATTGTGAAAGTTAAC
back to top

protein sequence of SMED30009144-orf-1

>SMED30009144-orf-1 ID=SMED30009144-orf-1|Name=SMED30009144-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=905bp
MPVLKFETKIINGKPNISFGSEQPKVPLKKSDYKFKNQKFPLRANSSTNT
VPNETQLKNQPKISYENELFSRKKSSDHIIKPQKISENSEIPSDRNSNDK
INNIHNYRRSLKQTATKESLFNFLKDDAKNEKFSQRKPDSSDEYARNNLH
VKPDSLTEDDIDEVMKQIVLENKHLLSEEQLVDVLAKLYLDAKISKKQKV
EIHQIPNNVVDRKPQKSTEQHFELPKQEENHSIYSKLEEKQNIDRLPNNY
PPAASGLTALQKKQLQWDKERKEMAEISSYNPWGKPGCGAPTKTSVETRQ
TDNIYSPKPVSQTITNSQLEPQKNYFIPQENVSQSEIKRQQWLTELNEQV
AEKERRKLMENLSGNPSESYRTKMSSNDDINLTHGRGKGLADLSQMSQEE
IIQKRSKQMEQQEAIRKQIEEKEFKKRLEREKNAQLDQEEENRILREKLK
LDTQYLSETARIKQKDDESGKRLAQQRLQLETAERAALMDKKLKRLQRLE
LAGHDTRQLRAGLIAEQMSGRLGDSLELRSEDNSFRQPNFEKPTYEIIPS
PRSYFQHPITEDQGVQTDNYVLRENRSRPFEEHNPYIGPPSHRHQVVDST
KLIKHNKSATETNNRKPLKPSNKQRPSSSASNKSQLTKKVKKLEPVEARR
PWGMKKNSKKYVPQSKRDPFYAVSQETREVHKQQRVNRILAQVKANMDRI
PENEVNDGRLSQRHKKCENQHISDQDKENYEVNHDTYELKENSYRDDDRV
QGQVTYKDTYRQSTKPYNSSRQVAIVQEASKSPEISNDWWTDTNHEIIRT
TDILNPALADQILPFSRENTGRERARQGYYKNQNPAQYGELLKSQSNNPN
SHNAEPNKRDPFYQIPSHPTQRQNTILKQLSDIREGLLMKQKEIETSLSF
NADI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0005813centrosome
Vocabulary: molecular function
TermDefinition
GO:0008017microtubule binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000096ventral epidermis
PLANA:0000099neuron
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR040467CCDC66_dom
IPR039183CCD66
Vocabulary: biological process
TermDefinition
GO:0046548retinal rod cell development
GO:0050908detection of light stimulus involved in visual perception
GO:0060060post-embryonic retina morphogenesis in camera-type eye
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 402..448
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 605..666
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 613..636
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 704..728
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 637..654
IPR040467CCDC66 domainPFAMPF15236CCDC66coord: 382..507
e-value: 1.9E-13
score: 50.5
IPR039183Coiled-coil domain-containing protein 66PANTHERPTHR22736UNCHARACTERIZEDcoord: 397..899