IRS-type PTB domain-containing protein

Overview
NameIRS-type PTB domain-containing protein
Smed IDSMED30009131
Length (bp)2685
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of IRS-type PTB domain-containing protein (SMED30009131) t-SNE clustered cells

Violin plots show distribution of expression levels for IRS-type PTB domain-containing protein (SMED30009131) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of IRS-type PTB domain-containing protein (SMED30009131) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for IRS-type PTB domain-containing protein (SMED30009131) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30009131

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30009131SMESG000055009.1 dd_Smed_v4_4462_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30009131SMESG000055009.1 dd_Smed_v4_4462_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
zeta neoblastSMED30009131SMESG000055009.1 dd_Smed_v4_4462_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of IRS-type PTB domain-containing protein vs. Ensembl Human
Match: DOK5 (docking protein 5 [Source:HGNC Symbol;Acc:HGNC:16173])

HSP 1 Score: 61.6178 bits (148), Expect = 4.486e-10
Identity = 41/113 (36.28%), Postives = 59/113 (52.21%), Query Frame = 2
Query:  653 LNMRGNYIMKLGNDTLELMDV-NTRELIHRFPFASIRRFGAKNDLFKLEAGRHCTTGMGHFIFKVRD--AIY---------IAE-------TLKNSTRQIKMSQSTLSNSCMT 934
            L++ G   +++  + + L DV N R  +  +P +++RR+G     F  EAGR C TG G FIF+ RD  AIY         IAE       ++KNS  Q+KMS+   S S M 
Sbjct:   41 LDVHGECALQITYEYICLWDVQNPRVKLISWPLSALRRYGRDTTWFTFEAGRMCETGEGLFIFQTRDGEAIYQKVHSAALAIAEQHERLLQSVKNSMLQMKMSERAASLSTMV 153          
BLAST of IRS-type PTB domain-containing protein vs. Ensembl Human
Match: DOK5 (docking protein 5 [Source:HGNC Symbol;Acc:HGNC:16173])

HSP 1 Score: 62.003 bits (149), Expect = 1.579e-9
Identity = 41/113 (36.28%), Postives = 59/113 (52.21%), Query Frame = 2
Query:  653 LNMRGNYIMKLGNDTLELMDV-NTRELIHRFPFASIRRFGAKNDLFKLEAGRHCTTGMGHFIFKVRD--AIY---------IAE-------TLKNSTRQIKMSQSTLSNSCMT 934
            L++ G   +++  + + L DV N R  +  +P +++RR+G     F  EAGR C TG G FIF+ RD  AIY         IAE       ++KNS  Q+KMS+   S S M 
Sbjct:  149 LDVHGECALQITYEYICLWDVQNPRVKLISWPLSALRRYGRDTTWFTFEAGRMCETGEGLFIFQTRDGEAIYQKVHSAALAIAEQHERLLQSVKNSMLQMKMSERAASLSTMV 261          
BLAST of IRS-type PTB domain-containing protein vs. Ensembl Human
Match: DOK2 (docking protein 2 [Source:HGNC Symbol;Acc:HGNC:2991])

HSP 1 Score: 62.3882 bits (150), Expect = 1.753e-9
Identity = 35/106 (33.02%), Postives = 56/106 (52.83%), Query Frame = 2
Query:  569 LDDNDAYEST----SHDEFHLVTVEMTTDSVKLNMRGNYIMKLGNDTLELMD-VNTRELIHRFPFASIRRFGAKNDLFKLEAGRHCTTGMGHFIFKVRDA--IYIA 865
            +++N+ Y S      H EF  VT+  T  S + ++RG+Y ++ G   LEL         ++ +P+  +RRFG     F  EAGR C +G G+F F+ R    I++A
Sbjct:  133 MEENELYSSAVTVGPHKEF-AVTMRPTEASERCHLRGSYTLRAGESALELWGGPEPGTQLYDWPYRFLRRFGRDKVTFSFEAGRRCVSGEGNFEFETRQGNEIFLA 237          
BLAST of IRS-type PTB domain-containing protein vs. Ensembl Human
Match: DOK3 (docking protein 3 [Source:HGNC Symbol;Acc:HGNC:24583])

HSP 1 Score: 61.6178 bits (148), Expect = 4.109e-9
Identity = 30/124 (24.19%), Postives = 60/124 (48.39%), Query Frame = 2
Query:  563 ISLDDNDAYESTSHDEFHLVTVEMTTDSVKLNMRGNYIMKLGNDTLELMDVNTRELIHRFPFASIRRFGAKNDLFKLEAGRHCTTGMGHFIFKVRDAIYIAETLKNS-TRQI-KMSQSTLSNSC 928
            + +++N  Y S        V V+ T  + +  ++G  ++ LG D ++L +    + ++ +P+  +R+FG+   +F  EAGR C +G G F F    A  +   +  +  RQ  ++ + T    C
Sbjct:  144 VPMEENSIYSSWQEVGEFPVVVQRTEAATRCQLKGPALLVLGPDAIQLREAKGTQALYSWPYHFLRKFGSDKGVFSFEAGRRCHSGEGLFAFSTPCAPDLCRAVAGAIARQRERLPELTRPQPC 267          
BLAST of IRS-type PTB domain-containing protein vs. Ensembl Human
Match: DOK3 (docking protein 3 [Source:HGNC Symbol;Acc:HGNC:24583])

HSP 1 Score: 61.6178 bits (148), Expect = 4.109e-9
Identity = 30/124 (24.19%), Postives = 60/124 (48.39%), Query Frame = 2
Query:  563 ISLDDNDAYESTSHDEFHLVTVEMTTDSVKLNMRGNYIMKLGNDTLELMDVNTRELIHRFPFASIRRFGAKNDLFKLEAGRHCTTGMGHFIFKVRDAIYIAETLKNS-TRQI-KMSQSTLSNSC 928
            + +++N  Y S        V V+ T  + +  ++G  ++ LG D ++L +    + ++ +P+  +R+FG+   +F  EAGR C +G G F F    A  +   +  +  RQ  ++ + T    C
Sbjct:  144 VPMEENSIYSSWQEVGEFPVVVQRTEAATRCQLKGPALLVLGPDAIQLREAKGTQALYSWPYHFLRKFGSDKGVFSFEAGRRCHSGEGLFAFSTPCAPDLCRAVAGAIARQRERLPELTRPQPC 267          
BLAST of IRS-type PTB domain-containing protein vs. Ensembl Zebrafish
Match: CABZ01072950.1 (pep scaffold:GRCz11:KN150642.1:16216:27684:-1 gene:ENSDARG00000114879.1 transcript:ENSDART00000180226.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CABZ01072950.1)

HSP 1 Score: 82.0333 bits (201), Expect = 9.795e-16
Identity = 37/111 (33.33%), Postives = 62/111 (55.86%), Query Frame = 2
Query:  551 QDLYISLDDNDAYESTSHDEFHLVTVEMTTDSVKLNMRGNYIMKLGNDTLELMDVNTRELIHRFPFASIRRFGAKNDLFKLEAGRHCTTGMGHFIFKVRDAIYIAETLKNS 883
            +D Y+ L DN+ Y +    +F  V V+ T  S +L + G Y++    +T+ L+D+ T E I R+P+  +RRFG       +EAGR C +G G FIF+ +    I   ++++
Sbjct:   84 KDKYLPLADNELYSTWGTGQFQ-VCVQSTESSQRLRLSGYYLLSADKETVSLLDLRTGEPIQRWPYRLLRRFGPVKGGIMIEAGRRCPSGEGQFIFQSKQGSQIHRAIEDA 193          
BLAST of IRS-type PTB domain-containing protein vs. Ensembl Zebrafish
Match: dok1a (docking protein 1a [Source:ZFIN;Acc:ZDB-GENE-080721-2])

HSP 1 Score: 75.485 bits (184), Expect = 1.218e-13
Identity = 36/111 (32.43%), Postives = 64/111 (57.66%), Query Frame = 2
Query:  569 LDDNDAYESTSH-DEFHLVTVEMTTDSVKLNMRGNYIMKLGNDTLELMDVNTRELIHRFPFASIRRFGAKNDLFKLEAGRHCTTGMGHFIFKVRDAIYIAETLKNSTRQIK 898
            ++DN  Y S     EF +V ++ +  SV+  ++G Y ++ G D L + D++TR  +  +P+  +RR+G    LF +EAGR C +G G F F+ + +  I   ++++ RQ K
Sbjct:  132 MEDNQIYMSREQLSEFKVVVLQ-SDASVRCGLKGQYWLQTGEDMLLIQDLDTRRTVMEWPYKLLRRYGRDKMLFSIEAGRRCESGPGTFNFETQQSEEILRLIESAIRQQK 241          
BLAST of IRS-type PTB domain-containing protein vs. Ensembl Zebrafish
Match: dok1b (docking protein 1b [Source:ZFIN;Acc:ZDB-GENE-040426-2063])

HSP 1 Score: 72.0182 bits (175), Expect = 1.965e-12
Identity = 40/131 (30.53%), Postives = 66/131 (50.38%), Query Frame = 2
Query:  587 YESTSHDEFHLVTVEMTTDSVKLNMRGNYIMKLGNDTLELMDVNTRELIHRFPFASIRRFGAKNDLFKLEAGRHCTTGMGHFIFKVRDAIYIAETLKNSTRQIKMSQSTLSNSCMTINK--PSTSQISLQV 973
            Y     +EF LVTV+ T  S +  + GNY ++   D L L D  T++ +  +P+  +RR+G    +F  EAGR C +G G+F F+ +    I   ++ S R+ K        SC +++   P+  QI   +
Sbjct:  143 YSREEVNEF-LVTVQRTEASERCGLSGNYWLRANMDNLILKDPKTKKDLLIWPYKLLRRYGRDRVMFSFEAGRRCESGPGNFTFETKQGNEIFHIVEESIREQKAQAEERHQSCPSLDSDCPALQQIRAAI 272          
BLAST of IRS-type PTB domain-containing protein vs. Ensembl Zebrafish
Match: DOK2 (docking protein 2-like [Source:NCBI gene;Acc:101882881])

HSP 1 Score: 64.3142 bits (155), Expect = 4.409e-10
Identity = 63/264 (23.86%), Postives = 110/264 (41.67%), Query Frame = 2
Query:  341 AGFL--RSKKLYLLPDLEDSLTEWCGLITGFISKTNTNSPSDYNAENKXXXXXXXXXXXXXXXXXXPQPSNYQDLYISLDDNDAYESTSHDEFHLVTVEMTTDSVKLNMRGNYIMKLGNDTLELMDVNTRELIHRFPFASIRRFGAKNDLFKLEAGRHCTTGMGHFIFKVRDAIYIAETLKNSTRQIKMSQSTLSNSCMTINKPS-TSQISLQVEPKVYANLNSR-------NRQSMEVISQNSLRSPNKISTSKRTSFKGNFI 1102
            A FL   S KLY+   L+  + +W       IS     +  D  AE +S         +       P  S+ +++     DN  Y++  +    LV    T  +V+  + G Y++    D + L D+ +++++ ++P+  +R+FG     F  EAGR C +G G+F F    A +  E L N+          +S +   + +PS T  ISL    +  A   +          Q  + + +   + P+K+    R SF  N I
Sbjct:   86 AAFLLETSDKLYVFAGLQSEVKDW-------ISSLCQQAFRDVEAEQRSQRERCVCSEA-------PGTSHVREM----QDNSLYDTAENVRDVLVIAVSTEAAVRCGLYGEYVLTPLQDCIVLKDLKSKQVLFKWPYCYVRKFGQDTLSFSFEAGRRCESGEGNFEF----ATHQGERLFNA----------VSAAIQNLPRPSETKPISLDQAEQTRAQETTAGTYNDTIGSQPYDFLLEGKTQKPSKMLNPARRSFSLNSI 317          
BLAST of IRS-type PTB domain-containing protein vs. Ensembl Zebrafish
Match: dok2 (docking protein 2 [Source:ZFIN;Acc:ZDB-GENE-080721-4])

HSP 1 Score: 61.6178 bits (148), Expect = 2.753e-9
Identity = 40/141 (28.37%), Postives = 73/141 (51.77%), Query Frame = 2
Query:  566 SLDDNDAYES--TSHDEFHLVTVEMTTDSVKLNMRGNYIMKLGNDTLELMDVNTRELIHRFPFASIRRFGAKNDLFKLEAGRHCTTGMGHFIFKVRDAIYIAETLKNST--RQIKMSQSTLSNSCMTINKPSTSQISLQVE 976
            ++ DN  Y S  T+  +F  VTV  +  S + +++G  +++   D+L L D  T E+++ +P+  +RRFG     F  EAGR C +G G F F  +    I ++++ +    ++ +    +SNS   +  PS  ++   VE
Sbjct:   75 TMADNTLYCSRETTMKDFK-VTVRRSEASERCSLKGVVLLRTDTDSLLLKDPKTGEVLYSWPYRFLRRFGRDKATFSFEAGRRCDSGEGSFEFDTKQGNAIFQSVEAAINLHRVNIPAKQMSNSDRDL-MPSPPRMRAPVE 213          
BLAST of IRS-type PTB domain-containing protein vs. Ensembl Xenopus
Match: fchsd1 (FCH and double SH3 domains 1 [Source:Xenbase;Acc:XB-GENE-6257860])

HSP 1 Score: 65.855 bits (159), Expect = 1.273e-10
Identity = 32/94 (34.04%), Postives = 49/94 (52.13%), Query Frame = 2
Query:  563 ISLDDNDAYESTSHDEFHLVTVEMTTDSVKLNMRGNYIMKLGNDTLELMDVNTRELIHRFPFASIRRFGAKNDLFKLEAGRHCTTGMGHFIFKV 844
            + L +N+ Y +T    F +V +  T  SV+  + G Y +   N  L L D  T   ++ +P+  +RRFG    +F  EAGR CT+G G F F+ 
Sbjct:  134 LHLQENELYSTTRETGF-VVRIRPTEASVRCGLNGIYTLSTENSCLSLRDRQTGSSLYNWPYPYLRRFGRDKSMFSFEAGRRCTSGEGSFEFET 226          
BLAST of IRS-type PTB domain-containing protein vs. Ensembl Xenopus
Match: DOK5 (docking protein 5 [Source:NCBI gene;Acc:100496159])

HSP 1 Score: 58.9214 bits (141), Expect = 1.187e-8
Identity = 39/113 (34.51%), Postives = 61/113 (53.98%), Query Frame = 2
Query:  653 LNMRGNYIMKLGNDTLELMDV-NTRELIHRFPFASIRRFGAKNDLFKLEAGRHCTTGMGHFIFKVR--DAIY---------IAE-------TLKNSTRQIKMSQSTLSNSCMT 934
            L++ G   +++  + + L D+ N R  +  +P +S+RR+G     F  EAGR C TG G FIF+ R  +AIY         IAE       ++KNS  Q++MS+ T+S + M 
Sbjct:  149 LDIHGECTLQITFENICLWDIQNPRMKLVSWPLSSLRRYGRDPAWFTFEAGRMCDTGEGLFIFQTREGEAIYHKVHSAALAIAEQHERLLQSVKNSMLQMRMSERTVSLNTMV 261          
BLAST of IRS-type PTB domain-containing protein vs. Ensembl Xenopus
Match: DOK5 (docking protein 5 [Source:NCBI gene;Acc:100496159])

HSP 1 Score: 58.5362 bits (140), Expect = 1.525e-8
Identity = 39/113 (34.51%), Postives = 61/113 (53.98%), Query Frame = 2
Query:  653 LNMRGNYIMKLGNDTLELMDV-NTRELIHRFPFASIRRFGAKNDLFKLEAGRHCTTGMGHFIFKVR--DAIY---------IAE-------TLKNSTRQIKMSQSTLSNSCMT 934
            L++ G   +++  + + L D+ N R  +  +P +S+RR+G     F  EAGR C TG G FIF+ R  +AIY         IAE       ++KNS  Q++MS+ T+S + M 
Sbjct:  149 LDIHGECTLQITFENICLWDIQNPRMKLVSWPLSSLRRYGRDPAWFTFEAGRMCDTGEGLFIFQTREGEAIYHKVHSAALAIAEQHERLLQSVKNSMLQMRMSERTVSLNTMV 261          
BLAST of IRS-type PTB domain-containing protein vs. Ensembl Xenopus
Match: DOK6 (docking protein 6 [Source:NCBI gene;Acc:100494237])

HSP 1 Score: 55.0694 bits (131), Expect = 1.741e-7
Identity = 36/146 (24.66%), Postives = 67/146 (45.89%), Query Frame = 2
Query:  641 DSVKLNMRGNYIMKLGNDTLELMDV-NTRELIHRFPFASIRRFGAKNDLFKLEAGRHCTTGMGHFIFKVRDAIYIAETLKNSTRQIKMSQSTL-------SNSCMTINKPSTSQISLQVEPKVYANLNSRNRQSMEVISQNSLRSP 1054
            + + L + G   M++ ++ + L D+ N +  +  +P +S+RR+G  +  F  E+GR C TG G F F+ R+   I + + ++T  I      L       S    T+ +P T   S+ +    Y +  +R     E+ S   +  P
Sbjct:   98 NQIDLYIYGECTMQITHENIYLWDIHNAKVKLVMWPLSSLRRYGRDSTWFTFESGRMCDTGEGLFTFQTREGEKIYQKVHSATLAIAEQHERLMLELEKKSRLQTTLTEPMTLSKSISLPRSAYWHHITRQNSVGEIYSLQDIGWP 243          
BLAST of IRS-type PTB domain-containing protein vs. Ensembl Xenopus
Match: DOK6 (docking protein 6 [Source:NCBI gene;Acc:100494237])

HSP 1 Score: 53.1434 bits (126), Expect = 7.081e-7
Identity = 35/139 (25.18%), Postives = 65/139 (46.76%), Query Frame = 2
Query:  641 DSVKLNMRGNYIMKLGNDTLELMDV-NTRELIHRFPFASIRRFGAKNDLFKLEAGRHCTTGMGHFIFKVRDAIYIAETLKNSTRQIKMSQSTL-------SNSCMTINKPSTSQISLQVEPKVYANLNSRNRQSMEVIS 1033
            + + L + G   M++ ++ + L D+ N +  +  +P +S+RR+G  +  F  E+GR C TG G F F+ R+   I + + ++T  I      L       S    T+ +P T   S+ +    Y +  +R     E+ S
Sbjct:   98 NQIDLYIYGECTMQITHENIYLWDIHNAKVKLVMWPLSSLRRYGRDSTWFTFESGRMCDTGEGLFTFQTREGEKIYQKVHSATLAIAEQHERLMLELEKKSRLQTTLTEPMTLSKSISLPRSAYWHHITRQNSVGEIYS 236          
BLAST of IRS-type PTB domain-containing protein vs. Ensembl Mouse
Match: Dok3 (docking protein 3 [Source:MGI Symbol;Acc:MGI:1351490])

HSP 1 Score: 62.3882 bits (150), Expect = 1.324e-9
Identity = 31/125 (24.80%), Postives = 62/125 (49.60%), Query Frame = 2
Query:  560 YISLDDNDAYESTSHDEFHLVTVEMTTDSVKLNMRGNYIMKLGNDTLELMDVNTRELIHRFPFASIRRFGAKNDLFKLEAGRHCTTGMGHFIFKVRDAIYIAETLKNS-TRQI-KMSQSTLSNSC 928
            ++ +++N  Y S        V V+ T  + +  ++G Y++ LG D ++L + +  +    +P+  +R++G+   +F  EAGR C +G G F F    A  I   +  +  RQ  ++ +  +S  C
Sbjct:  143 FVPMEENSIYSSWQEVTEFPVIVQRTEATSRCQLKGPYLLVLGQDDIQLRETSKPQACFSWPYRFLRKYGSDKGVFSFEAGRRCDSGEGLFAFSSPRAPDICGVVAAAIARQRERLPELAMSPPC 267          
BLAST of IRS-type PTB domain-containing protein vs. Ensembl Mouse
Match: Dok3 (docking protein 3 [Source:MGI Symbol;Acc:MGI:1351490])

HSP 1 Score: 62.3882 bits (150), Expect = 1.324e-9
Identity = 31/125 (24.80%), Postives = 62/125 (49.60%), Query Frame = 2
Query:  560 YISLDDNDAYESTSHDEFHLVTVEMTTDSVKLNMRGNYIMKLGNDTLELMDVNTRELIHRFPFASIRRFGAKNDLFKLEAGRHCTTGMGHFIFKVRDAIYIAETLKNS-TRQI-KMSQSTLSNSC 928
            ++ +++N  Y S        V V+ T  + +  ++G Y++ LG D ++L + +  +    +P+  +R++G+   +F  EAGR C +G G F F    A  I   +  +  RQ  ++ +  +S  C
Sbjct:  143 FVPMEENSIYSSWQEVTEFPVIVQRTEATSRCQLKGPYLLVLGQDDIQLRETSKPQACFSWPYRFLRKYGSDKGVFSFEAGRRCDSGEGLFAFSSPRAPDICGVVAAAIARQRERLPELAMSPPC 267          
BLAST of IRS-type PTB domain-containing protein vs. Ensembl Mouse
Match: Dok2 (docking protein 2 [Source:MGI Symbol;Acc:MGI:1332623])

HSP 1 Score: 60.4622 bits (145), Expect = 5.345e-9
Identity = 32/107 (29.91%), Postives = 57/107 (53.27%), Query Frame = 2
Query:  569 LDDNDAYESTSHD--EFHLVTVEMTTDSVKLNMRGNYIMKLGNDTLELMD-VNTRELIHRFPFASIRRFGAKNDLFKLEAGRHCTTGMGHFIFKVRDAIYIAETLKN 880
            +++N+ Y S++    + ++VT+  T  S +  +RG+Y ++ G   LEL         ++ +P+  +RRFG     F  EAGR C +G G+F F+ R    I + L+ 
Sbjct:  136 MEENELYSSSTTGLCKEYMVTIRPTEASERCRLRGSYTLRTGVSALELWGGPEPGTQLYDWPYRFLRRFGRDKATFSFEAGRRCLSGEGNFEFETRHGNEIFQALEK 242          
BLAST of IRS-type PTB domain-containing protein vs. Ensembl Mouse
Match: Dok1 (docking protein 1 [Source:MGI Symbol;Acc:MGI:893587])

HSP 1 Score: 58.151 bits (139), Expect = 3.732e-8
Identity = 40/156 (25.64%), Postives = 69/156 (44.23%), Query Frame = 2
Query:  575 DNDAYESTSHDEFHLVTVEMTTDSVKLNMRGNYIMKLGNDTLELMDVNTRELIHR----FPFASIRRFGAKNDLFKLEAGRHCTTGMGHFIFKVRDAIYIAETLKNSTRQ------IKMSQSTL---SNSCMTINK---PSTSQISLQVEPKVYAN 994
            +N  Y  T       VT + T  S +  ++G+YI+++  + L L+ +  +  I      +P+  +RR+G    +F  EAGR C +G G F F+      I + ++ + +Q      +  +Q  L   S+   T  K   P   Q  L   P +YA 
Sbjct:  142 ENSLYSPTWEGSQFWVTSQKTEASERCGLQGSYILRVEAEKLTLLTLGAQSQILEPLLFWPYTLLRRYGRDKVMFSFEAGRRCPSGPGTFTFQTSQGNDIFQAVEAAIQQQKAQGKVGQAQDILRTDSHDGETEGKTVPPPVPQDPLGSPPALYAE 297          
BLAST of IRS-type PTB domain-containing protein vs. Ensembl Mouse
Match: Dok5 (docking protein 5 [Source:MGI Symbol;Acc:MGI:1924079])

HSP 1 Score: 56.9954 bits (136), Expect = 3.732e-8
Identity = 39/110 (35.45%), Postives = 57/110 (51.82%), Query Frame = 2
Query:  653 LNMRGNYIMKLGNDTLELMDV-NTRELIHRFPFASIRRFGAKNDLFKLEAGRHCTTGMGHFIFKVRD--AIY---------IAE-------TLKNSTRQIKMSQSTLSNS 925
            L++ G   +++  + + L DV N R  +  +P +++RR+G     F  EAGR C TG G FIF+ RD  AIY         IAE       ++KNS  Q+K S+   S S
Sbjct:  149 LDVHGECALQITYEYICLWDVQNPRVKLISWPLSALRRYGRDTTWFTFEAGRMCETGEGLFIFQTRDGEAIYQKVHSAALAIAEQHERLLQSVKNSMLQMKKSERAASLS 258          
BLAST of IRS-type PTB domain-containing protein vs. UniProt/SwissProt
Match: sp|B2RYG7|DOK3_RAT (Docking protein 3 OS=Rattus norvegicus OX=10116 GN=Dok3 PE=1 SV=1)

HSP 1 Score: 66.6254 bits (161), Expect = 4.868e-10
Identity = 32/125 (25.60%), Postives = 63/125 (50.40%), Query Frame = 2
Query:  560 YISLDDNDAYESTSHDEFHLVTVEMTTDSVKLNMRGNYIMKLGNDTLELMDVNTRELIHRFPFASIRRFGAKNDLFKLEAGRHCTTGMGHFIFKVRDAIYIAETLKNS-TRQI-KMSQSTLSNSC 928
            ++ +++N  Y S        V V+ T  + +  ++G Y++ LG D ++L + +  +  + +P+  +R+FG+   +F  EAGR C +G G F F    A  I   +  +  RQ  ++ +  +S  C
Sbjct:  143 FVPMEENSIYSSWQEVAEFPVVVQRTEATTRCQLKGPYLLVLGQDDIQLRETSKPQACYSWPYRFLRKFGSDKGVFSFEAGRRCDSGEGLFAFSSPRAPDICGAVAAAIARQRERLPELAMSPPC 267          
BLAST of IRS-type PTB domain-containing protein vs. UniProt/SwissProt
Match: sp|A7MBB8|DOK2_BOVIN (Docking protein 2 OS=Bos taurus OX=9913 GN=DOK2 PE=2 SV=1)

HSP 1 Score: 63.929 bits (154), Expect = 3.132e-9
Identity = 36/106 (33.96%), Postives = 58/106 (54.72%), Query Frame = 2
Query:  569 LDDNDAYESTS----HDEFHLVTVEMTTDSVKLNMRGNYIMKLGNDTLELMD-VNTRELIHRFPFASIRRFGAKNDLFKLEAGRHCTTGMGHFIFKVRDA--IYIA 865
            +++N+ Y ST+      EF  VTV  T  S +  +RG+Y +++G   LEL     +   ++ +P+  +RRFG     F  EAGR C +G G+F F+ R    I++A
Sbjct:  133 MEENELYSSTTAGTPQKEF-AVTVRPTEVSERCRLRGSYTLRVGESALELWGGPESGTQLYEWPYRFLRRFGRDKVTFSFEAGRRCVSGEGNFEFETRQGNEIFLA 237          
BLAST of IRS-type PTB domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9P104|DOK5_HUMAN (Docking protein 5 OS=Homo sapiens OX=9606 GN=DOK5 PE=1 SV=2)

HSP 1 Score: 62.003 bits (149), Expect = 7.585e-9
Identity = 41/113 (36.28%), Postives = 59/113 (52.21%), Query Frame = 2
Query:  653 LNMRGNYIMKLGNDTLELMDV-NTRELIHRFPFASIRRFGAKNDLFKLEAGRHCTTGMGHFIFKVRD--AIY---------IAE-------TLKNSTRQIKMSQSTLSNSCMT 934
            L++ G   +++  + + L DV N R  +  +P +++RR+G     F  EAGR C TG G FIF+ RD  AIY         IAE       ++KNS  Q+KMS+   S S M 
Sbjct:  149 LDVHGECALQITYEYICLWDVQNPRVKLISWPLSALRRYGRDTTWFTFEAGRMCETGEGLFIFQTRDGEAIYQKVHSAALAIAEQHERLLQSVKNSMLQMKMSERAASLSTMV 261          
BLAST of IRS-type PTB domain-containing protein vs. UniProt/SwissProt
Match: sp|O60496|DOK2_HUMAN (Docking protein 2 OS=Homo sapiens OX=9606 GN=DOK2 PE=1 SV=2)

HSP 1 Score: 62.3882 bits (150), Expect = 8.420e-9
Identity = 35/106 (33.02%), Postives = 56/106 (52.83%), Query Frame = 2
Query:  569 LDDNDAYEST----SHDEFHLVTVEMTTDSVKLNMRGNYIMKLGNDTLELMD-VNTRELIHRFPFASIRRFGAKNDLFKLEAGRHCTTGMGHFIFKVRDA--IYIA 865
            +++N+ Y S      H EF  VT+  T  S + ++RG+Y ++ G   LEL         ++ +P+  +RRFG     F  EAGR C +G G+F F+ R    I++A
Sbjct:  133 MEENELYSSAVTVGPHKEF-AVTMRPTEASERCHLRGSYTLRAGESALELWGGPEPGTQLYDWPYRFLRRFGRDKVTFSFEAGRRCVSGEGNFEFETRQGNEIFLA 237          
BLAST of IRS-type PTB domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9QZK7|DOK3_MOUSE (Docking protein 3 OS=Mus musculus OX=10090 GN=Dok3 PE=1 SV=1)

HSP 1 Score: 62.3882 bits (150), Expect = 9.261e-9
Identity = 31/125 (24.80%), Postives = 62/125 (49.60%), Query Frame = 2
Query:  560 YISLDDNDAYESTSHDEFHLVTVEMTTDSVKLNMRGNYIMKLGNDTLELMDVNTRELIHRFPFASIRRFGAKNDLFKLEAGRHCTTGMGHFIFKVRDAIYIAETLKNS-TRQI-KMSQSTLSNSC 928
            ++ +++N  Y S        V V+ T  + +  ++G Y++ LG D ++L + +  +    +P+  +R++G+   +F  EAGR C +G G F F    A  I   +  +  RQ  ++ +  +S  C
Sbjct:  143 FVPMEENSIYSSWQEVTEFPVIVQRTEATSRCQLKGPYLLVLGQDDIQLRETSKPQACFSWPYRFLRKYGSDKGVFSFEAGRRCDSGEGLFAFSSPRAPDICGVVAAAIARQRERLPELAMSPPC 267          
BLAST of IRS-type PTB domain-containing protein vs. TrEMBL
Match: A0A5K3ERE2 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 151.754 bits (382), Expect = 4.755e-34
Identity = 121/388 (31.19%), Postives = 181/388 (46.65%), Query Frame = 2
Query:   35 FIKSNYIKNTKNDWILCYGKLLYHQNITFLHLKSENFERNPGDSASESD--STYSGFATLSQIYQSKISNQ---------RLNALCNLSQFKSCEIKSVRFENVFKFAIKLVPAGFLRSKKLYLLPDLEDSLTEWCGLITGFISKTNTNSPSDYNAENKXXXXXXXXXXXXXXXXXXPQPS--NYQDLYISLDDNDAYESTSHDEFHLVTVEMTTDSVKLNM-RGNYIMKLGNDTLELMDVNTRELIHRFPFASIRRFGAKNDLFKLEAGRHCTTGMGHFIFKVR-------DAIY-----IAETLKNSTRQIKMSQSTLSNS--CMTINKPSTSQISLQVEP---KVYANLNSRNRQSMEVISQNSLRSPNKISTSKRTS--FKGNF 1099
            ++K+N+IK  K +W+ C  +LL     TFL +KS    R  G   +E D  S +SG +    I  S  S Q            ALCNLS++KSC + +V       FA+KLVPAG   +K+LYL    E   T W  +I   + K   +S +       S      +  S    +  P  +     DL I   DN+ YE  S  +     V+   D  KL + + +  ++L +D LEL+D N   ++H FP+  IRRFGA   + +++AGR C+TG GHF F          DAI      +A   K   RQ + ++  L  +    T    S+   S++  P   K  A+  S + +S+  +S+   RSP+  +TSK +S    GNF
Sbjct:    8 YVKANFIKAAKENWVPCEVRLLTDDVDTFLCIKS----RAVGLGQTEEDLKSIFSGLSATGTISSSNASPQPPSGGQVPRSFTALCNLSEYKSCTVVTVSVNETGHFALKLVPAGIFGNKRLYLAMSSETEATTWMSMIKAGLGKKKKSSRNPLTQSRDSLSGALRTSSSQDTLRADPTTNSDGRYDLDIDTIDNEVYEPCSSQDLIPAVVQQRGDWDKLRLSKLDCFLRLSDDRLELLDSNGERVLHWFPYLLIRRFGAVGGVLRVDAGRRCSTGDGHFFFTCSPNNGQPVDAIVSQIRQLALEAKQRLRQEQAARQHLQQNRHSFTSETASSGATSMRPPPIPAKGSADSGSGSAKSLTKLSE---RSPSPKNTSKSSSNDAGGNF 388          
BLAST of IRS-type PTB domain-containing protein vs. TrEMBL
Match: A0A0X3QFK6 (IRS-type PTB domain-containing protein (Fragment) OS=Schistocephalus solidus OX=70667 GN=TR167023 PE=4 SV=1)

HSP 1 Score: 144.05 bits (362), Expect = 1.661e-31
Identity = 94/282 (33.33%), Postives = 147/282 (52.13%), Query Frame = 2
Query:   26 AKFFIKSNYIKNTKNDWILCYGKLLYHQNITFLHLKSENFERNPGDSASESD--STYSGFATLSQIYQSKISN---QRLNALCNLSQFKSCEIKSVRFENVFKFAIKLVPAGFLRSKKLYLLPDLEDSLTEWCGLIT---GFISKTNTNSPSDYNAENKXXXXXXXXXXXXXXXXXXPQPSNYQDLYISLDDNDAYESTSHDEFHLVTVEMTTDSVKLNM-RGNYIMKLGNDTLELMDVNTRELIHRFPFASIRRFGAKNDLFKLEAGRHCTTGMGHFIFKV 844
             +F++K+NYI+  K+DW+ C  +LL     TFL +KS+      G   +E D  S +S  + LS I    I     +   ALCNLS++KSC + ++  + V  FA+KL+PAG   +K+L+L  + E  +T W  +I    G   +TN+N          S +   S  +++    L     +  DL I   DN+ YE  S  +     VE T D  KL + R +  ++L  D LEL+D  ++ ++H FP+  IRRFG    + +++AGR C+TG G F F+ 
Sbjct:   30 GRFYVKANYIRAAKDDWVPCEVRLLTDDVDTFLCIKSKPL----GFITNEEDMKSIFSEASMLSSISSRNIPATCPRPFTALCNLSEYKSCTVLAISVDGVAHFALKLIPAGLFGNKRLFLAMENEQEVTRWLAVIKLCLGKKRRTNSN----LMQSRDSLIFNGSLRKTASQDTLKSNSGSRVDLDIETMDNEVYEPYSPHDVIPAVVEQTGDWEKLRLSRLDCYLRLTEDRLELLDGGSQRVLHWFPYLLIRRFGCVGGVLRVDAGRRCSTGDGKFFFRC 303          
BLAST of IRS-type PTB domain-containing protein vs. TrEMBL
Match: A0A068YF77 (Docking protein 3 OS=Echinococcus multilocularis OX=6211 GN=EmuJ_000848300 PE=4 SV=1)

HSP 1 Score: 142.895 bits (359), Expect = 4.019e-31
Identity = 93/281 (33.10%), Postives = 139/281 (49.47%), Query Frame = 2
Query:   38 IKSNYIKNTKNDWILCYGKLLYHQNITFLHLKSENFERNPGDSASESD--STYSGFATLSQIYQSKISNQ---------RLNALCNLSQFKSCEIKSVRFENVFKFAIKLVPAGFLRSKKLYLLPDLEDSLTEWCGLITGFISKTNTNS--PSDYNAENKXXXXXXXXXXXXXXXXXXPQPSNYQDLYISLDDNDAYESTSHDEFHLVTVEMTTDSVKLNM-RGNYIMKLGNDTLELMDVNTRELIHRFPFASIRRFGAKNDLFKLEAGRHCTTGMGHFIF 838
            +K+N+IK  K+ W+ C  +LL     TFL +KS    R  G   +E D  S +SG +    I  +    Q            ALCNLS++KSC + +V   +V  FA+KLVPAG   +K+LYL    E   T W  +I   + K    S  P   + ++       S  + +     S   +N  DL I   DN+ YE  S  +     ++   D  KL + + +  ++L +D LEL+D N   ++H FP+  IRRFGA   + +++AGR C+TG GHF F
Sbjct:    9 VKANFIKAAKDHWVPCEVRLLTDDTDTFLCIKS----RPLGFGQTEEDIKSIFSGVSATGTISSTNNPTQLSSVTPVTRAFTALCNLSEYKSCTVVTVSINDVGHFALKLVPAGIFGNKRLYLAMSGETEATTWMSMIKANLGKRKKASKNPLTQSRDSLVGTLRPSDSQDTLRGDSSANVNNRYDLDIDTIDNEVYEPCSAQDLIPAIIQQRGDWEKLRLSKMDCFLRLTDDRLELLDHNGERVLHWFPYLLIRRFGAVGGVLRIDAGRRCSTGDGHFFF 285          
BLAST of IRS-type PTB domain-containing protein vs. TrEMBL
Match: A0A4Z2CV41 (Mucin-like protein OS=Schistosoma japonicum OX=6182 GN=EWB00_007371 PE=4 SV=1)

HSP 1 Score: 142.895 bits (359), Expect = 5.424e-31
Identity = 89/277 (32.13%), Postives = 152/277 (54.87%), Query Frame = 2
Query:   23 SAKFFIKSNYIKNTKNDWILCYGKLLYHQNITFLHLKSENFERNPGDSASESDSTYSGFATLSQIYQSKISNQRLNALCNLSQFKSCEIKSVRFENVFKFAIKLVPAGFLRSKKLYLLPDLEDSLTEWCGLITGFISKTNTNSPSDYN--AENKXXXXXXXXXXXXXXXXXXPQPSNYQDLYISLDDNDAYESTSHDEFHLVTVEMTTDSVKLNM-RGNYIMKLGNDTLELMDVNTRELIHRFPFASIRRFGAKNDLFKLEAGRHCTTGMGHFIFKV 844
            S +FF+KSNYI+  K+DWI+C  +LL     TFL +KS        ++ + +D+  S F   S       + +   ALCNLS++KSC +++    +   FA+KLVP+    +KKL +  + E+ +T W  +    I K + N  + +   A N   +S S S  S +    + + S ++D+ +   DN+ YE+ S ++     +E   D +KL++ + +  ++L  D LE++D  + + +H FP+  IRRFGA N + +++AGR C+TG G F F+ 
Sbjct:    4 SGRFFVKSNYIRAAKDDWIICDVRLLTDDTDTFLCIKSLPSSVLLSETTNCTDNEVSKFPEKSSYRPENFAARPFTALCNLSEYKSCSMRTEAVNSSASFALKLVPSSVFGNKKLLIATEDENEITAWLAICKTCIGKKSKNGSTTHRDLACNLGTLSKSGSFMSLKPNSQACE-SEFEDVLM---DNEVYEAYSSEDKIPALLEEAGDWMKLHLCQPDCYLRLTTDRLEVLDFYSHKPVHWFPYLLIRRFGASNGVLRVDAGRRCSTGDGKFFFRC 276          
BLAST of IRS-type PTB domain-containing protein vs. TrEMBL
Match: A0A158QUT3 (Uncharacterized protein OS=Mesocestoides corti OX=53468 GN=MCOS_LOCUS6720 PE=4 SV=1)

HSP 1 Score: 139.813 bits (351), Expect = 2.702e-30
Identity = 117/379 (30.87%), Postives = 173/379 (45.65%), Query Frame = 2
Query:   62 TKNDWILCYGKLLYHQNITFLHLKSENFERNPGDSASESD--STYSGFATLSQIYQSKISNQ---------RLNALCNLSQFKSCEIKSVRFENVFKFAIKLVPAGFLRSKKLYLLPDLEDSLTEWCGLITGFISKTNTNSPSDYNAENKXXXXXXXXXXXXXXXXXXPQPS--NYQDLYISLDDNDAYESTSHDEFHLVTVEMTTDSVKLNM-RGNYIMKLGNDTLELMDVNTRELIHRFPFASIRRFGAKNDLFKLEAGRHCTTGMGHFIFKVR-------DAIY-----IAETLKNSTRQIKMSQSTLSNS--CMTINKPSTSQISLQVEP---KVYANLNSRNRQSMEVISQNSLRSPNKISTSKRTS--FKGNF 1099
             K +W+ C  +LL     TFL +KS    R  G   +E D  S +SG +    I  S  S Q            ALCNLS++KSC + +V       FA+KLVPAG   +K+LYL    E   T W  +I   + K   +S +       S      +  S    +  P  +     DL I   DN+ YE  S  +     V+   D  KL + + +  ++L +D LEL+D N   ++H FP+  IRRFGA   + +++AGR C+TG GHF F          DAI      +A   K   RQ + ++  L  +    T    S+   S++  P   K  A+  S + +S+  +S+   RSP+  +TSK +S    GNF
Sbjct:    8 AKENWVPCEVRLLTDDVDTFLCIKS----RAVGLGQTEEDLKSIFSGLSATGTISSSNASPQPPSGGQVPRSFTALCNLSEYKSCTVVTVSVNETGHFALKLVPAGIFGNKRLYLAMSSETEATTWMSMIKAGLGKKKKSSRNPLTQSRDSLSGALRTSSSQDTLRADPTTNSDGRYDLDIDTIDNEVYEPCSSQDLIPAVVQQRGDWDKLRLSKLDCFLRLSDDRLELLDSNGERVLHWFPYLLIRRFGAVGGVLRVDAGRRCSTGDGHFFFTCSPNNGQPVDAIVSQIRQLALEAKQRLRQEQAARQHLQQNRHSFTSETASSGATSMRPPPIPAKGSADSGSGSAKSLTKLSE---RSPSPKNTSKSSSNDAGGNF 379          
BLAST of IRS-type PTB domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000033117.1 (docking protein 3 [Source:NCBI gene;Acc:103036151])

HSP 1 Score: 75.8702 bits (185), Expect = 9.854e-14
Identity = 43/140 (30.71%), Postives = 73/140 (52.14%), Query Frame = 2
Query:  566 SLDDNDAYESTSHDEFHLVTVEMTTDSVKLNMRGNYIMKLGNDTLELMDVNTRELIHRFPFASIRRFGAKNDLFKLEAGRHCTTGMGHFIFKVRDAIYIAETLKNSTRQIKMSQSTLSNSCMTINKPSTSQISLQVEPKV 985
            S+ +ND Y + S  +F  VTV+ +  SV+  M G+Y++    + L L+D+ T + +  +P+  +RRFG   +   +EAGR C TG GHF F  +    I   ++ +     + Q  LS +   + + +T Q  L V P +
Sbjct:  135 SMSENDLYSTWSPGKFQ-VTVQKSDASVRCCMSGSYLLSPEKEALCLLDLRTGKTVFYWPYRFLRRFGQIKEGVTIEAGRRCQTGEGHFAFLSKQGTQIYRAIEEAIMHQSV-QDLLSKATAEVKELTTQQ--LPVRPAI 270          
BLAST of IRS-type PTB domain-containing protein vs. Ensembl Cavefish
Match: dok1a (docking protein 2-like [Source:NCBI gene;Acc:103039100])

HSP 1 Score: 73.1738 bits (178), Expect = 5.607e-13
Identity = 32/120 (26.67%), Postives = 67/120 (55.83%), Query Frame = 2
Query:  569 LDDNDAYESTSHDEFHLVTVEMTTDSVKLNMRGNYIMKLGNDTLELMDVNTRELIHRFPFASIRRFGAKNDLFKLEAGRHCTTGMGHFIFKVRDAIYIAETLKNSTRQIKMSQSTLSNSC 928
            +++N  Y S        VT++ +  +V+  ++G Y ++ G ++L + D  +R+ +  +P+  +RR+G    +F +EAGR C +G G F+F+ + +  I   ++ + +Q K + S  + SC
Sbjct:  132 MEENQIYASREEVFDFWVTLQQSEAAVRCGLQGAYWLQTGEESLIIQDTESRQRVIEWPYKLLRRYGGDKTVFSIEAGRRCESGPGTFVFETKQSEEILRRVEQAIQQQK-TLSVSAGSC 250          
BLAST of IRS-type PTB domain-containing protein vs. Ensembl Cavefish
Match: dok1b (docking protein 1 [Source:NCBI gene;Acc:103027364])

HSP 1 Score: 68.1662 bits (165), Expect = 2.746e-11
Identity = 42/142 (29.58%), Postives = 68/142 (47.89%), Query Frame = 2
Query:  587 YESTSHDEFHLVTVEMTTDSVKLNMRGNYIMKLGNDTLELMDVNTRELIHRFPFASIRRFGAKNDLFKLEAGRHCTTGMGHFIFKVRDAIYIAETLKNSTRQIKMSQSTLSNSCMTINK--PSTSQISLQVEPKVYANLNSR 1006
            Y     +EF  V+V+ T  S +  + GNY +K   + L L D  T+     +P+  +RR+G    +F  EAGR C +G G+F F+ +    I + ++N+ R+ K        SC + +   P+  QI   +     A  NSR
Sbjct:  143 YSREEVNEF-WVSVQKTEASERCGLLGNYWLKADGENLILKDPKTKRNQLVWPYKLLRRYGRDRVMFSFEAGRRCESGPGNFTFETKQGNEIFQIVENAIREQKAQAEERHQSCPSFDGDCPALQQIRAAI-----AEGNSR 278          
BLAST of IRS-type PTB domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000038723.1 (docking protein 3-like [Source:NCBI gene;Acc:103043435])

HSP 1 Score: 62.3882 bits (150), Expect = 1.330e-9
Identity = 38/154 (24.68%), Postives = 71/154 (46.10%), Query Frame = 2
Query:  563 ISLDDNDAYESTSHDEFHLVTVEMTTDSVKLNMRGNYIMKLGNDTLELMDVNTRELIHRFPFASIRRFGAKNDLFKLEAGRHCTTGMGHFIFKVRDAIYIAETLKNSTRQIKMSQSTLSNSCMTINKPSTSQISLQVEPKVYANLNSRNRQSME 1024
            + + +N  YE  +  +F LV    T  +++  + G YI+   +D + L D  T++++  +P+  IR+FG     F  EAGR C +G G+F F          T     R  K+    +       N P + +   +++P+    +++   QSM+
Sbjct:  131 VEMKENSLYEPAAMRDF-LVIAMGTEAALRCKLYGEYILTPHDDRILLKDHKTKQVLFSWPYCFIRKFGQDRLSFSFEAGRRCESGEGNFEF----------TTNQGDRIFKIVSGYIQ------NLPQSEKPGREIKPRPVEKVDTPPPQSMD 267          
BLAST of IRS-type PTB domain-containing protein vs. Ensembl Cavefish
Match: dok2 (docking protein 2 [Source:NCBI gene;Acc:103024435])

HSP 1 Score: 62.3882 bits (150), Expect = 1.633e-9
Identity = 36/136 (26.47%), Postives = 64/136 (47.06%), Query Frame = 2
Query:  566 SLDDNDAY-----ESTSHDEFHLVTVEMTTDSVKLNMRGNYIMKLGNDTLELMDVNTRELIHRFPFASIRRFGAKNDLFKLEAGRHCTTGMGHFIFKVRDAIYIAETLKNSTRQIKMSQSTLSNSCMTINKPSTSQ 958
            ++ DN  Y      STS  +   V++  T  + +  +RG Y+++   D+L L +    E++  +P+  +RRFG     F  EAGR C +G G+F F  +    I + ++ +    K   S    SC  +++    Q
Sbjct:  139 AMSDNSLYGGRETASTSTMKDFKVSMRRTDAAERCGLRGQYLLRTDFDSLLLKEPKIGEVLFTWPYRYLRRFGRDKTTFSFEAGRRCDSGEGNFEFDTKQGNAIFQYVETAISLQKAGLSQRQGSCGALDREPIPQ 274          
BLAST of IRS-type PTB domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010596.1 (pep scaffold:Pmarinus_7.0:GL476339:448786:450942:-1 gene:ENSPMAG00000009596.1 transcript:ENSPMAT00000010596.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 60.077 bits (144), Expect = 1.099e-9
Identity = 31/103 (30.10%), Postives = 55/103 (53.40%), Query Frame = 2
Query:  605 DEFHLVTVEMTTDSVKLNMRGNYIMKLGNDTLELMDVNTRELIHRFPFASIRRFGAKNDLFKLEAGRHCTTGMGHFIFKVRDAIYIAETLKNSTRQIKMSQST 913
            +EF  V++  T  S +  + G+Y +K   + L L D  +   I+ +P+  +RRFG     F  EAGR C +G G F+F  ++   I   ++ S  Q K+++++
Sbjct:    1 NEF-WVSIHKTEASERCGLVGSYKLKGDQEDLTLKDPASGNAIYVWPYKLLRRFGRDKTSFTFEAGRRCNSGPGTFMFDTKNGNDIFNIIEKSINQTKLNRNS 102          
BLAST of IRS-type PTB domain-containing protein vs. Ensembl Sea Lamprey
Match: dok6 (docking protein 6 [Source:ZFIN;Acc:ZDB-GENE-070410-50])

HSP 1 Score: 50.447 bits (119), Expect = 7.104e-7
Identity = 27/82 (32.93%), Postives = 44/82 (53.66%), Query Frame = 2
Query:  653 LNMRGNYIMKLGNDTLELMDV-NTRELIHRFPFASIRRFGAKNDLFKLEAGRHCTTGMGHFIFKVRDAIYIAETLKNSTRQI 895
            L + G   M++ ++ + L DV N R  +  +P +S+RR+G     F  E+GR C TG G F F+ R+   I + +  +T  I
Sbjct:  127 LEIFGECTMQVTHENIYLWDVHNPRVRLVSWPLSSLRRYGRDPTRFTFESGRMCDTGEGLFTFQTREGEAIYQKVHTATLAI 208          
BLAST of IRS-type PTB domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000035735.1 (docking protein 3 [Source:NCBI gene;Acc:110014047])

HSP 1 Score: 72.4034 bits (176), Expect = 9.108e-13
Identity = 39/163 (23.93%), Postives = 79/163 (48.47%), Query Frame = 2
Query:  545 NYQDLYISLDDNDAYESTSHDEFHLVTVEMTTDSVKLNMRGNYIMKLGNDTLELMDVNTRELIHRFPFASIRRFGAKNDLFKLEAGRHCTTGMGHFIFKVRDAIYIAETLKNSTRQIKMSQSTLSNSCMTINK---PSTSQISLQVEPKVYANLNSRNRQSME 1024
            N  +++  L++N  Y S        V V+ T  + +  + G+Y +++G  +L L +   ++L+  +P+  +RR+G+   +  +EAGR C +G G F F+   A  I   +++S +Q     + L+       +   P T  ++  +E K+   +  R   S+E
Sbjct:  138 NSGNVHAHLEENQIYASAGEARQFWVAVQKTEAATRCGLEGSYWLEVGGASLLLREAQKKKLVGEWPYEQLRRYGSHQSVLTIEAGRRCGSGPGIFNFESSQAEKIFSLIQSSIKQRAPPSAPLTQEAPLQPRSPHPKTPNMAAALEAKL--KIQDRKSPSLE 298          
BLAST of IRS-type PTB domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000043898.1 (docking protein 3 [Source:NCBI gene;Acc:105354926])

HSP 1 Score: 66.6254 bits (161), Expect = 5.841e-11
Identity = 33/110 (30.00%), Postives = 60/110 (54.55%), Query Frame = 2
Query:  563 ISLDDNDAYESTSHD------EFHLVTVEMTTDSVKLNMRGNYIMKLGNDTLELMDVNTRELIHRFPFASIRRFGAKNDLFKLEAGRHCTTGMGHFIFKVRDAIYIAETL 874
            ++++DN+ Y + + D      +F  V ++ T  S +  + G Y+M    + L L  ++  + I R+P+  +RRFG     F +EAGR C +G G FIF  R A+++ + +
Sbjct:  137 LAMEDNELYSTWNKDPTLPPKQFK-VKIKSTIASKRCKLAGEYLMSSETEALVLFSLDASDAIFRWPYRLLRRFGKVEGGFSIEAGRRCESGEGLFIFLTRHALHVFQAI 245          
BLAST of IRS-type PTB domain-containing protein vs. Ensembl Medaka
Match: dok2 (docking protein 2 [Source:NCBI gene;Acc:101174926])

HSP 1 Score: 61.6178 bits (148), Expect = 2.420e-9
Identity = 33/115 (28.70%), Postives = 61/115 (53.04%), Query Frame = 2
Query:  566 SLDDNDAYES--TSHDEFHLVTVEMTTDSVKLNMRGNYIMKLGNDTLELMDVNTRELIHRFPFASIRRFGAKNDLFKLEAGRHCTTGMGHFIFKVRDAIYIAETLKNSTRQIKMS 904
             ++DN  Y    T HD    V+V  T  S +  ++G+ +++   D L L+D    ++++ +P+  +RRFG     F  EAGR C +G G+F F  ++   + + ++ +  Q K+S
Sbjct:  146 GMEDNSLYSGRETVHD--FRVSVRKTDASDRCRLKGDGVLRADMDALHLLD-RAGDVVYSWPYRYLRRFGRDKCTFSFEAGRRCDSGEGNFEFDTKEGNSLFQAVEAAINQQKIS 257          
BLAST of IRS-type PTB domain-containing protein vs. Ensembl Medaka
Match: dok1b (docking protein 1 [Source:NCBI gene;Acc:101173260])

HSP 1 Score: 61.2326 bits (147), Expect = 3.448e-9
Identity = 30/97 (30.93%), Postives = 49/97 (50.52%), Query Frame = 2
Query:  563 ISLDDNDAYESTSHDEFHLVTVEMTTDSVKLNMRGNYIMKLGNDTLELMDVNTRELIHRFPFASIRRFGAKNDLFKLEAGRHCTTGMGHFIFKVRDA 853
            + + DN  Y S        VTV+ +  S +  + GNY +K  +D L L +  T+  +  +P+  +RR+G    +F  EAGR C +G G+F F  +  
Sbjct:  146 LQMADNLIYYSREEVNEFWVTVQRSEASERCGLSGNYWLKAESDVLILKEPKTKRRVLVWPYKLLRRYGRDRVMFSFEAGRRCESGPGNFTFDTKQG 242          
BLAST of IRS-type PTB domain-containing protein vs. Ensembl Medaka
Match: dok1b (docking protein 1 [Source:NCBI gene;Acc:101173260])

HSP 1 Score: 61.2326 bits (147), Expect = 4.136e-9
Identity = 30/97 (30.93%), Postives = 49/97 (50.52%), Query Frame = 2
Query:  563 ISLDDNDAYESTSHDEFHLVTVEMTTDSVKLNMRGNYIMKLGNDTLELMDVNTRELIHRFPFASIRRFGAKNDLFKLEAGRHCTTGMGHFIFKVRDA 853
            + + DN  Y S        VTV+ +  S +  + GNY +K  +D L L +  T+  +  +P+  +RR+G    +F  EAGR C +G G+F F  +  
Sbjct:  146 LQMADNLIYYSREEVNEFWVTVQRSEASERCGLSGNYWLKAESDVLILKEPKTKRRVLVWPYKLLRRYGRDRVMFSFEAGRRCESGPGNFTFDTKQG 242          
BLAST of IRS-type PTB domain-containing protein vs. Planmine SMEST
Match: SMESG000055009.1 (SMESG000055009.1)

HSP 1 Score: 1366.29 bits (3535), Expect = 0.000e+0
Identity = 750/756 (99.21%), Postives = 753/756 (99.60%), Query Frame = 2
Query:   17 MKSAKFFIKSNYIKNTKNDWILCYGKLLYHQNITFLHLKSENFERNPGDSASESDSTYSGFATLSQIYQSKISNQRLNALCNLSQFKSCEIKSVRFENVFKFAIKLVPAGFLRSKKLYLLPDLEDSLTEWCGLITGFISKTNTNSPSDYNAENKXXXXXXXXXXXXXXXXXXPQPSNYQDLYISLDDNDAYESTSHDEFHLVTVEMTTDSVKLNMRGNYIMKLGNDTLELMDVNTRELIHRFPFASIRRFGAKNDLFKLEAGRHCTTGMGHFIFKVRDAIYIAETLKNSTRQIKMSQSTLSNSCMTINKPSTSQISLQVEPKVYANLNSRNRQSMEVISQNSLRSPNKISTSKRTSFKGNFIAKDSNRYFYNHENEVPNFNKNITSKRSSTMELPXXXXXXXXXXXXXXXXXXXXYRLSDRNLFMKETNIDQVTLPKSENTLHNVIERKPSLAKTERPFIFNISPEIADRYKGLKKLEPAPKMNSESSISASIPNEVVPDNKFTFNTDLKDNVPEVIVDTEVKESQIIGDEKEIVNSTENDVFEEVKETSLLDSTDISDKKAESSESEGFLLPSDPNETINGNNSVQNDFELSIINPTNVQLDIVDIKSDESNKSFIVPGGDQRPSSLFEXXXXXXXXXXXXXXXXXXXXXXLPFPVKTTTAGYRVSESTFFKYRRLPKPPIRTTPPLNYNTRATSFSESQTVSPTVXXXXXXXXXXXXPPPILPKPKFKSALNNQDEMSFREFDQMLKNLNLSYC 2284
            MKSAKFFIKSNYIKNTKNDWILCYGKLLYHQNITFLHLKSENFERNPGDSASESDSTYSGFATLSQIYQSKISNQRLNALCNLSQFKSCEIKSVRFENVFKFAIKLVPAGFLRSKKLYLLPDLEDSLTEWCGLITGFISKTNTNSPSDYNAENKSAMSISSSLRSSRMTQLSPQPSNYQDLYISLDDNDAYESTSHDEFHLVTVEMTTDSVKLNMRGNYIMKLGND LELMDVNTRELIHRFPFASIRRFGAKNDLFKLEAGRHCTTGMGHFIFKVRDAIYIAETLKNSTRQIKMSQSTLSNSCMTINKPSTSQISLQVEPKVYANLNSRNRQSMEVISQNSLRSPNKISTSKRTSFKGNFIAKDSNRYFYNHENEVP+FNKNITSKRSSTMELPSETTTRLRSRSSSISKHDTSYRLSDRNLFMKETNIDQVTLPKSENTLHNVIERKPSLAKTERPFIFNISPEIADRYKGL KLEPAPKMNSESSISASIPNEVVPD+KFTFNTDLKDNV EVIVDTEVKESQIIGDEKEIVNSTENDVFEEVKETSLLDSTDISDKKAESSESEGFLLPSDPNETINGNNSVQNDFELSIINPTNVQLDIVDIKSDESNKSFIVPGGDQRPSSLFESSTTPISSCSTSVSTDSPSFNSLPFPVKTTTAGYRVSESTFFKYRRLPKPP+RTTPPLNYNTRATSFSESQTVSPTVSRSESIGSSKRSPPPILPKPKFKSALNNQDEMSFREFDQMLKNLNLSYC
Sbjct:    1 MKSAKFFIKSNYIKNTKNDWILCYGKLLYHQNITFLHLKSENFERNPGDSASESDSTYSGFATLSQIYQSKISNQRLNALCNLSQFKSCEIKSVRFENVFKFAIKLVPAGFLRSKKLYLLPDLEDSLTEWCGLITGFISKTNTNSPSDYNAENKSAMSISSSLRSSRMTQLSPQPSNYQDLYISLDDNDAYESTSHDEFHLVTVEMTTDSVKLNMRGNYIMKLGNDILELMDVNTRELIHRFPFASIRRFGAKNDLFKLEAGRHCTTGMGHFIFKVRDAIYIAETLKNSTRQIKMSQSTLSNSCMTINKPSTSQISLQVEPKVYANLNSRNRQSMEVISQNSLRSPNKISTSKRTSFKGNFIAKDSNRYFYNHENEVPSFNKNITSKRSSTMELPSETTTRLRSRSSSISKHDTSYRLSDRNLFMKETNIDQVTLPKSENTLHNVIERKPSLAKTERPFIFNISPEIADRYKGLTKLEPAPKMNSESSISASIPNEVVPDDKFTFNTDLKDNVSEVIVDTEVKESQIIGDEKEIVNSTENDVFEEVKETSLLDSTDISDKKAESSESEGFLLPSDPNETINGNNSVQNDFELSIINPTNVQLDIVDIKSDESNKSFIVPGGDQRPSSLFESSTTPISSCSTSVSTDSPSFNSLPFPVKTTTAGYRVSESTFFKYRRLPKPPVRTTPPLNYNTRATSFSESQTVSPTVSRSESIGSSKRSPPPILPKPKFKSALNNQDEMSFREFDQMLKNLNLSYC 756          
BLAST of IRS-type PTB domain-containing protein vs. Planmine SMEST
Match: SMESG000027222.1 (SMESG000027222.1)

HSP 1 Score: 211.46 bits (537), Expect = 8.296e-59
Identity = 126/336 (37.50%), Postives = 180/336 (53.57%), Query Frame = 2
Query:   17 MKSAKFFIKSNYIKNTKNDWILCYGKLLYHQNITFLHLKSENFERNPGDSASESDSTYSGFATLSQIYQSKISNQ-RLNALCNLSQFKSCEIKSVRFENVFKFAIKLVPAGFLRSKKLYLLPDLEDSLTEWCGLITGFISKT------------NTNSPSDYNAE-NKXXXXXXXXXXXXXXXXXXPQPSNYQD-----------------LYISLDDNDAY---------ESTSHDEFHLVTVEMTTDSVKLNMRGNYIMKLGNDTLELMDVNTRELIHRFPFASIRRFGAKNDLFKLEAGRHCTTGMGHFIFKVRDAIYIAETLKNSTRQIKMS 904
            MKS++ +IK+NYIK  K DWI C  ++L    I+ L L S +   N  D   ++ S  S F+ +S IY+SK++    L  LCNLS+FKS EIK V F N  KFAIKL+P+G L SKKL+ +P+ E+ LT+WC L+   I K             N +  S    E NK          S  +     + SN  D                  Y+S   ++ Y         ESTS D  + V +E + DS ++ ++G+YIMKL  + +EL D+   E +H FP+  IRRFGAKNDL +LEAGR C+TG G+F+F+ +DA     T+K   +++K +
Sbjct:    1 MKSSRVYIKANYIKKAKIDWIYCDAQILKQNQISMLKLSSIS---NSNDDKDDNQSRISNFSNVSTIYRSKLTQSIGLKVLCNLSEFKSSEIKPVNFYNTEKFAIKLIPSGILNSKKLFFIPEYEEDLTKWCSLLGEHIYKNKDNEIKSTKLTDNVDKDSTIKRENNKQIKDSHEKKESDDIMSTLTKKSNATDSNKYCDENSSIIPNSPQSYLSYKSDEIYFAMDDNEVYESTSSDNVYTVCIEESEDSRRMGIKGSYIMKLNPEGIELCDIKRNEALHEFPYIFIRRFGAKNDLLRLEAGRKCSTGEGYFVFRFKDAGKAVTTIKELVKELKTT 333          
BLAST of IRS-type PTB domain-containing protein vs. Planmine SMEST
Match: SMESG000027222.1 (SMESG000027222.1)

HSP 1 Score: 211.846 bits (538), Expect = 8.811e-59
Identity = 126/336 (37.50%), Postives = 180/336 (53.57%), Query Frame = 2
Query:   17 MKSAKFFIKSNYIKNTKNDWILCYGKLLYHQNITFLHLKSENFERNPGDSASESDSTYSGFATLSQIYQSKISNQ-RLNALCNLSQFKSCEIKSVRFENVFKFAIKLVPAGFLRSKKLYLLPDLEDSLTEWCGLITGFISKT------------NTNSPSDYNAE-NKXXXXXXXXXXXXXXXXXXPQPSNYQD-----------------LYISLDDNDAY---------ESTSHDEFHLVTVEMTTDSVKLNMRGNYIMKLGNDTLELMDVNTRELIHRFPFASIRRFGAKNDLFKLEAGRHCTTGMGHFIFKVRDAIYIAETLKNSTRQIKMS 904
            MKS++ +IK+NYIK  K DWI C  ++L    I+ L L S +   N  D   ++ S  S F+ +S IY+SK++    L  LCNLS+FKS EIK V F N  KFAIKL+P+G L SKKL+ +P+ E+ LT+WC L+   I K             N +  S    E NK          S  +     + SN  D                  Y+S   ++ Y         ESTS D  + V +E + DS ++ ++G+YIMKL  + +EL D+   E +H FP+  IRRFGAKNDL +LEAGR C+TG G+F+F+ +DA     T+K   +++K +
Sbjct:    1 MKSSRVYIKANYIKKAKIDWIYCDAQILKQNQISMLKLSSIS---NSNDDKDDNQSRISNFSNVSTIYRSKLTQSIGLKVLCNLSEFKSSEIKPVNFYNTEKFAIKLIPSGILNSKKLFFIPEYEEDLTKWCSLLGEHIYKNKDNEIKSTKLTDNVDKDSTIKRENNKQIKDSHEKKESDDIMSTLTKKSNATDSNKYCDENSSIIPNSPQSYLSYKSDEIYFAMDDNEVYESTSSDNVYTVCIEESEDSRRMGIKGSYIMKLNPEGIELCDIKRNEALHEFPYIFIRRFGAKNDLLRLEAGRKCSTGEGYFVFRFKDAGKAVTTIKELVKELKTT 333          
BLAST of IRS-type PTB domain-containing protein vs. Planmine SMEST
Match: SMESG000023429.1 (SMESG000023429.1)

HSP 1 Score: 62.3882 bits (150), Expect = 5.489e-10
Identity = 53/207 (25.60%), Postives = 89/207 (43.00%), Query Frame = 2
Query:  239 QRLNALCNLSQFKSCEIKSVR-FENVFKFAIKLVPAGFLRSKKLYLLPDLEDSLTEWCGLITGFIS-KTNTNSPSDYNAENKXXXXXXXXXXXXXXXXXXPQPSNYQDLYISLDDNDAYESTSHDEFHLVTVEMTTDSVKLNMRGNYIMKLGNDTLELMDVNTRELIHRFPFASIRRFGAKNDLFKLEAGRHCTTGMGHFIFKVRDA 853
            QR      LS +K+CE K  + F N   + + L P  F ++KK+ L    E++   W   +   +S K  + + S    +N                    + S+   +   + +ND YE +      L TV  T  S ++ ++G YI+ + +  LEL D  T  ++  +    IRRFG K+++F  E G+    G G   F+V   
Sbjct:   63 QRTPKKLKLSDYKTCEAKGFQNFNNSKIYLLSLNPKIFSKAKKVLLAFLTEENYHFWFENLEKILSHKFQSMNSSGSGTQN-------------------TESSSVASMEQFMIENDVYEGSLMPGEFLATVIETAKSKEIGIKGRYILVVTDGGLELKDEYTERIVKIWEIKIIRRFGEKDNVFSFELGKFSEDGPGALCFQVEKG 250          
BLAST of IRS-type PTB domain-containing protein vs. Planmine SMEST
Match: SMESG000023429.1 (SMESG000023429.1)

HSP 1 Score: 62.3882 bits (150), Expect = 5.865e-10
Identity = 53/207 (25.60%), Postives = 89/207 (43.00%), Query Frame = 2
Query:  239 QRLNALCNLSQFKSCEIKSVR-FENVFKFAIKLVPAGFLRSKKLYLLPDLEDSLTEWCGLITGFIS-KTNTNSPSDYNAENKXXXXXXXXXXXXXXXXXXPQPSNYQDLYISLDDNDAYESTSHDEFHLVTVEMTTDSVKLNMRGNYIMKLGNDTLELMDVNTRELIHRFPFASIRRFGAKNDLFKLEAGRHCTTGMGHFIFKVRDA 853
            QR      LS +K+CE K  + F N   + + L P  F ++KK+ L    E++   W   +   +S K  + + S    +N                    + S+   +   + +ND YE +      L TV  T  S ++ ++G YI+ + +  LEL D  T  ++  +    IRRFG K+++F  E G+    G G   F+V   
Sbjct:   63 QRTPKKLKLSDYKTCEAKGFQNFNNSKIYLLSLNPKIFSKAKKVLLAFLTEENYHFWFENLEKILSHKFQSMNSSGSGTQN-------------------TESSSVASMEQFMIENDVYEGSLMPGEFLATVIETAKSKEIGIKGRYILVVTDGGLELKDEYTERIVKIWEIKIIRRFGEKDNVFSFELGKFSEDGPGALCFQVEKG 250          
The following BLAST results are available for this feature:
BLAST of IRS-type PTB domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DOK54.486e-1036.28docking protein 5 [Source:HGNC Symbol;Acc:HGNC:161... [more]
DOK51.579e-936.28docking protein 5 [Source:HGNC Symbol;Acc:HGNC:161... [more]
DOK21.753e-933.02docking protein 2 [Source:HGNC Symbol;Acc:HGNC:299... [more]
DOK34.109e-924.19docking protein 3 [Source:HGNC Symbol;Acc:HGNC:245... [more]
DOK34.109e-924.19docking protein 3 [Source:HGNC Symbol;Acc:HGNC:245... [more]
back to top
BLAST of IRS-type PTB domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of IRS-type PTB domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of IRS-type PTB domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CABZ01072950.19.795e-1633.33pep scaffold:GRCz11:KN150642.1:16216:27684:-1 gene... [more]
dok1a1.218e-1332.43docking protein 1a [Source:ZFIN;Acc:ZDB-GENE-08072... [more]
dok1b1.965e-1230.53docking protein 1b [Source:ZFIN;Acc:ZDB-GENE-04042... [more]
DOK24.409e-1023.86docking protein 2-like [Source:NCBI gene;Acc:10188... [more]
dok22.753e-928.37docking protein 2 [Source:ZFIN;Acc:ZDB-GENE-080721... [more]
back to top
BLAST of IRS-type PTB domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fchsd11.273e-1034.04FCH and double SH3 domains 1 [Source:Xenbase;Acc:X... [more]
DOK51.187e-834.51docking protein 5 [Source:NCBI gene;Acc:100496159][more]
DOK51.525e-834.51docking protein 5 [Source:NCBI gene;Acc:100496159][more]
DOK61.741e-724.66docking protein 6 [Source:NCBI gene;Acc:100494237][more]
DOK67.081e-725.18docking protein 6 [Source:NCBI gene;Acc:100494237][more]
back to top
BLAST of IRS-type PTB domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Dok31.324e-924.80docking protein 3 [Source:MGI Symbol;Acc:MGI:13514... [more]
Dok31.324e-924.80docking protein 3 [Source:MGI Symbol;Acc:MGI:13514... [more]
Dok25.345e-929.91docking protein 2 [Source:MGI Symbol;Acc:MGI:13326... [more]
Dok13.732e-825.64docking protein 1 [Source:MGI Symbol;Acc:MGI:89358... [more]
Dok53.732e-835.45docking protein 5 [Source:MGI Symbol;Acc:MGI:19240... [more]
back to top
BLAST of IRS-type PTB domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|B2RYG7|DOK3_RAT4.868e-1025.60Docking protein 3 OS=Rattus norvegicus OX=10116 GN... [more]
sp|A7MBB8|DOK2_BOVIN3.132e-933.96Docking protein 2 OS=Bos taurus OX=9913 GN=DOK2 PE... [more]
sp|Q9P104|DOK5_HUMAN7.585e-936.28Docking protein 5 OS=Homo sapiens OX=9606 GN=DOK5 ... [more]
sp|O60496|DOK2_HUMAN8.420e-933.02Docking protein 2 OS=Homo sapiens OX=9606 GN=DOK2 ... [more]
sp|Q9QZK7|DOK3_MOUSE9.261e-924.80Docking protein 3 OS=Mus musculus OX=10090 GN=Dok3... [more]
back to top
BLAST of IRS-type PTB domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A5K3ERE24.755e-3431.19Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A0X3QFK61.661e-3133.33IRS-type PTB domain-containing protein (Fragment) ... [more]
A0A068YF774.019e-3133.10Docking protein 3 OS=Echinococcus multilocularis O... [more]
A0A4Z2CV415.424e-3132.13Mucin-like protein OS=Schistosoma japonicum OX=618... [more]
A0A158QUT32.702e-3030.87Uncharacterized protein OS=Mesocestoides corti OX=... [more]
back to top
BLAST of IRS-type PTB domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000033117.19.854e-1430.71docking protein 3 [Source:NCBI gene;Acc:103036151][more]
dok1a5.607e-1326.67docking protein 2-like [Source:NCBI gene;Acc:10303... [more]
dok1b2.746e-1129.58docking protein 1 [Source:NCBI gene;Acc:103027364][more]
ENSAMXT00000038723.11.330e-924.68docking protein 3-like [Source:NCBI gene;Acc:10304... [more]
dok21.633e-926.47docking protein 2 [Source:NCBI gene;Acc:103024435][more]
back to top
BLAST of IRS-type PTB domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSPMAT00000010596.11.099e-930.10pep scaffold:Pmarinus_7.0:GL476339:448786:450942:-... [more]
dok67.104e-732.93docking protein 6 [Source:ZFIN;Acc:ZDB-GENE-070410... [more]
back to top
BLAST of IRS-type PTB domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of IRS-type PTB domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of IRS-type PTB domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000035735.19.108e-1323.93docking protein 3 [Source:NCBI gene;Acc:110014047][more]
ENSORLT00000043898.15.841e-1130.00docking protein 3 [Source:NCBI gene;Acc:105354926][more]
dok22.420e-928.70docking protein 2 [Source:NCBI gene;Acc:101174926][more]
dok1b3.448e-930.93docking protein 1 [Source:NCBI gene;Acc:101173260][more]
dok1b4.136e-930.93docking protein 1 [Source:NCBI gene;Acc:101173260][more]
back to top
BLAST of IRS-type PTB domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000055009.10.000e+099.21SMESG000055009.1[more]
SMESG000027222.18.296e-5937.50SMESG000027222.1[more]
SMESG000027222.18.811e-5937.50SMESG000027222.1[more]
SMESG000023429.15.489e-1025.60SMESG000023429.1[more]
SMESG000023429.15.865e-1025.60SMESG000023429.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30009131 ID=SMED30009131|Name=IRS-type PTB domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2685bp
CTATTTCTGATTTTCAATGAAATCTGCTAAATTTTTTATTAAATCCAATT
ATATAAAAAATACTAAAAATGACTGGATTCTTTGCTATGGTAAATTGCTC
TATCATCAAAACATAACATTCCTTCATCTAAAATCTGAAAATTTTGAACG
AAATCCTGGTGACAGTGCATCAGAATCTGATAGTACTTATAGTGGCTTTG
CTACACTGTCTCAAATTTATCAATCAAAAATAAGCAATCAACGTCTCAAT
GCATTATGCAATCTCAGTCAATTTAAGTCATGCGAAATCAAATCAGTTAG
ATTTGAAAACGTTTTCAAATTCGCAATAAAACTTGTTCCAGCAGGATTTT
TAAGATCGAAAAAACTTTATCTACTGCCTGATCTGGAAGATAGTCTTACC
GAATGGTGCGGTCTAATCACTGGATTCATCAGTAAGACTAACACAAATTC
ACCATCCGACTACAATGCGGAAAATAAAAGTGCAATGTCGATTTCATCTA
GTTTACGATCATCTAGGATGACTCAATTAAGCCCCCAACCGTCGAATTAT
CAAGATCTTTATATTTCACTTGATGACAATGATGCTTATGAGTCCACTTC
ACATGATGAATTTCACCTGGTTACTGTGGAAATGACAACAGATTCAGTGA
AGTTGAACATGAGAGGGAATTATATCATGAAATTAGGAAACGACACATTA
GAATTAATGGACGTCAATACTAGAGAATTGATTCATAGATTCCCATTTGC
GTCCATTCGCAGATTCGGAGCTAAAAACGATCTATTTAAATTAGAAGCCG
GAAGACATTGTACCACTGGTATGGGTCATTTTATATTTAAAGTAAGAGAT
GCTATCTATATTGCCGAAACATTGAAAAACAGTACAAGACAAATTAAGAT
GTCACAGAGCACTTTGAGCAATTCTTGTATGACAATAAATAAACCGTCTA
CTTCTCAAATTTCTCTACAAGTGGAACCGAAAGTCTACGCGAACTTGAAT
TCTAGAAATCGTCAAAGCATGGAAGTTATATCCCAAAATTCATTAAGATC
CCCAAATAAAATTTCAACTTCAAAACGAACTTCTTTTAAAGGAAATTTTA
TAGCAAAGGATTCAAATAGATATTTTTATAATCACGAAAATGAAGTACCA
AATTTCAATAAAAATATAACTTCAAAAAGATCTTCAACAATGGAATTACC
ATCTGAAACAACAACAAGACTAAGAAGTCGATCAAGTAGTATTTCAAAAC
ATGATACTTCATATAGATTATCTGATCGGAATTTATTTATGAAAGAGACA
AATATTGACCAAGTAACTTTACCAAAAAGTGAAAATACATTACATAATGT
AATTGAACGAAAACCTTCTTTGGCAAAAACTGAAAGGCCATTTATTTTCA
ACATTTCCCCGGAAATAGCAGATAGATATAAAGGGCTCAAGAAATTGGAA
CCTGCCCCAAAAATGAATTCGGAATCGTCTATTTCAGCATCGATTCCAAA
CGAAGTTGTGCCTGATAACAAATTTACTTTCAATACAGATTTAAAAGATA
ATGTGCCTGAAGTCATTGTTGATACAGAAGTCAAAGAGTCTCAAATTATT
GGCGACGAAAAAGAAATAGTTAATTCAACTGAAAACGATGTTTTTGAAGA
AGTCAAGGAAACAAGTTTGCTGGATTCAACCGATATTAGTGATAAAAAAG
CTGAATCGAGTGAAAGTGAAGGATTTCTTTTACCCAGTGATCCTAATGAA
ACCATAAATGGAAATAATTCCGTTCAAAATGATTTTGAACTTTCAATAAT
TAATCCAACTAATGTTCAGTTGGATATTGTTGATATTAAATCTGATGAAT
CAAATAAATCTTTTATTGTTCCTGGTGGAGATCAGAGACCATCGAGCCTG
TTTGAAAGCTCAACGACTCCAATTTCATCCTGCTCAACATCAGTTTCTAC
TGATTCTCCATCATTCAACTCCTTGCCATTTCCAGTAAAGACAACAACAG
CGGGCTACCGAGTGTCAGAGTCGACATTTTTCAAATACCGTCGACTGCCA
AAGCCGCCCATACGAACCACTCCTCCATTGAACTACAATACACGCGCAAC
TTCTTTTTCCGAATCCCAAACCGTGTCACCTACAGTCAGCCGATCGGAAT
CAATCGGATCATCGAAGAGATCCCCTCCCCCAATTTTACCGAAACCCAAA
TTCAAATCGGCACTAAACAATCAAGACGAGATGAGTTTTCGGGAATTTGA
TCAAATGTTAAAAAATTTAAACTTGTCTTATTGTTAATTTTAGTATTGAT
ATTAATTTAATTGGCTAAACTGAACTATTGAACCGATCAATATTTTATGT
TTTCTTTATTCTTATGCATTTTAATCGAGAATTTGAAAAATAGTTTTTCA
ATCTAGATCATACGCTACATTTCGGATGTTGTCTATTTGTGTGTGTGTGT
GTGTCATGGTTTTGATTGTATCTGTGTGTGTGTGTGTGTGTGGTGAAATC
GCATGCATTCTATGATCCATTCTGAGAAAATCGGTGTTGAAATTGTTTGT
CATTGTATATTATATATTTAAGTATCAATTTTCTGGCAATATTTATTAAT
TGGTCATTATAAATGTTCTATGTCATAGATGTTGGCTTACGGACGGATTC
TGAGTAGACGTTGGATTTTTTATAATGAATGTTAT
back to top

protein sequence of SMED30009131-orf-1

>SMED30009131-orf-1 ID=SMED30009131-orf-1|Name=SMED30009131-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=757bp
MKSAKFFIKSNYIKNTKNDWILCYGKLLYHQNITFLHLKSENFERNPGDS
ASESDSTYSGFATLSQIYQSKISNQRLNALCNLSQFKSCEIKSVRFENVF
KFAIKLVPAGFLRSKKLYLLPDLEDSLTEWCGLITGFISKTNTNSPSDYN
AENKSAMSISSSLRSSRMTQLSPQPSNYQDLYISLDDNDAYESTSHDEFH
LVTVEMTTDSVKLNMRGNYIMKLGNDTLELMDVNTRELIHRFPFASIRRF
GAKNDLFKLEAGRHCTTGMGHFIFKVRDAIYIAETLKNSTRQIKMSQSTL
SNSCMTINKPSTSQISLQVEPKVYANLNSRNRQSMEVISQNSLRSPNKIS
TSKRTSFKGNFIAKDSNRYFYNHENEVPNFNKNITSKRSSTMELPSETTT
RLRSRSSSISKHDTSYRLSDRNLFMKETNIDQVTLPKSENTLHNVIERKP
SLAKTERPFIFNISPEIADRYKGLKKLEPAPKMNSESSISASIPNEVVPD
NKFTFNTDLKDNVPEVIVDTEVKESQIIGDEKEIVNSTENDVFEEVKETS
LLDSTDISDKKAESSESEGFLLPSDPNETINGNNSVQNDFELSIINPTNV
QLDIVDIKSDESNKSFIVPGGDQRPSSLFESSTTPISSCSTSVSTDSPSF
NSLPFPVKTTTAGYRVSESTFFKYRRLPKPPIRTTPPLNYNTRATSFSES
QTVSPTVSRSESIGSSKRSPPPILPKPKFKSALNNQDEMSFREFDQMLKN
LNLSYC*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000034epidermis
PLANA:0000099neuron
Vocabulary: INTERPRO
TermDefinition
IPR002404IRS_PTB
IPR011993PH-like_dom_sf
Vocabulary: molecular function
TermDefinition
GO:0005158insulin receptor binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002404IRS-type PTB domainSMARTSM00310PTBI_2coord: 196..295
e-value: 3.7E-8
score: 43.1
IPR002404IRS-type PTB domainPFAMPF02174IRScoord: 200..293
e-value: 6.0E-18
score: 64.6
IPR002404IRS-type PTB domainPROSITEPS51064IRS_PTBcoord: 196..300
score: 22.776
NoneNo IPR availableSMARTSM01244IRS_2coord: 195..295
e-value: 6.5E-15
score: 65.6
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 388..413
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 692..717
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 388..405
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 692..731
NoneNo IPR availablePANTHERPTHR21258DOCKING PROTEIN RELATEDcoord: 172..342
NoneNo IPR availablePANTHERPTHR21258:SF46DOCKING PROTEIN 1coord: 172..342
NoneNo IPR availableSUPERFAMILYSSF50729PH domain-likecoord: 187..305
IPR011993PH-like domain superfamilyGENE3DG3DSA:2.30.29.30coord: 191..300
e-value: 2.9E-21
score: 76.9