Galectin domain-containing protein

Overview
NameGalectin domain-containing protein
Smed IDSMED30009121
Length (bp)1407
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Galectin domain-containing protein (SMED30009121) t-SNE clustered cells

Violin plots show distribution of expression levels for Galectin domain-containing protein (SMED30009121) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Galectin domain-containing protein (SMED30009121) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Galectin domain-containing protein (SMED30009121) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30009121

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30009121SMESG000022399.1 dd_Smed_v4_10749_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30009121SMESG000022399.1 dd_Smed_v4_10749_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Category 4 cellSMED30009121SMESG000022399.1 dd_Smed_v4_10749_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30009121SMESG000022399.1 dd_Smed_v4_10749_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30009121SMESG000022399.1 dd_Smed_v4_10749_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30009121SMESG000022399.1 dd_Smed_v4_10749_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Galectin domain-containing protein vs. TrEMBL
Match: A0A1I8I3S1 (Galectin OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 85.1149 bits (209), Expect = 3.089e-14
Identity = 47/155 (30.32%), Postives = 86/155 (55.48%), Query Frame = 1
Query:   46 TMFSYEIPGGLQSNDCVEIRGIMSGNGIFIGLLSNEQK-VPDEIPLKLSLELGGYWNMTTWN--NGQESSREGTITNSIYMDLPFTIQIINLLHAFKIIVNNELLGLFDKPKQSYQLTNLTMDGDAEFHSVEFKDAANVEISSDETPDEVLLTEI 501
            T F+Y+IP GL   DCVEI+GI+SG+ + + L S +Q     +IPL++S+  GG++ +        ++  + G           FT+QI+     +++ +N+E+L   +       +  L +DG+AEF SVEF D  +++ SS+   +E+ + ++
Sbjct:  107 TQFTYDIPDGLIEGDCVEIKGILSGHRVVLELSSRQQTGARAQIPLRVSINRGGHFELLCQPEPGARDRLKTGKSKGEFRTGSSFTVQILVENERYEVRLNDEVLSTIEHGSLHSMIHMLMLDGEAEFTSVEFLDIEDIDASSESEQEEIGINQV 261          
BLAST of Galectin domain-containing protein vs. TrEMBL
Match: A0A1I8GPI7 (Galectin OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 84.7297 bits (208), Expect = 4.676e-14
Identity = 47/155 (30.32%), Postives = 86/155 (55.48%), Query Frame = 1
Query:   46 TMFSYEIPGGLQSNDCVEIRGIMSGNGIFIGLLSNEQKVPD-EIPLKLSLELGGYWNMTTWN--NGQESSREGTITNSIYMDLPFTIQIINLLHAFKIIVNNELLGLFDKPKQSYQLTNLTMDGDAEFHSVEFKDAANVEISSDETPDEVLLTEI 501
            T F+Y+IP GL   DCVEI+GI+SG+ + + L S +Q     +IPL++S+  GG++ +        ++  + G           FT+QI+     +++ +N+E+L   +       +  L +DG+AEF SVEF D  +++ SS+   +E+ + ++
Sbjct:  107 TQFTYDIPDGLIEGDCVEIKGILSGHRVVLELASRQQTGGRAQIPLRISINRGGHFELLCQPEPGARDRFKTGKSKGEFRTGSSFTVQILVENERYEVRLNDEVLSTIEHGSLHSMIHMLMLDGEAEFTSVEFLDIEDIDASSESEQEEIGINQV 261          
BLAST of Galectin domain-containing protein vs. TrEMBL
Match: A0A1I8J978 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 81.6481 bits (200), Expect = 1.932e-12
Identity = 47/158 (29.75%), Postives = 87/158 (55.06%), Query Frame = 1
Query:   37 RADTMFSYEIPGGLQSNDCVEIRGIMSGNGIFIGLLSNEQKVPD-EIPLKLSLELGGYWNMTTWNN--GQESSREGTITNSIYMDLPFTIQIINLLHAFKIIVNNELLGLFDKPKQSYQLTNLTMDGDAEFHSVEFKDAANVEISSDETPDEVLLTEI 501
            +  T F+Y+IP GL   DCVEI+GI+SG+ + + L S +Q     +IPL++S+  GG++ +        ++  + G           FT+QI+     +++ +N+E+L   +       +  L +DG+AEF SVEF D  +++ SS+   +E+ + ++
Sbjct:  104 KKGTQFTYDIPDGLIEGDCVEIKGILSGHRVVLELASRQQTGGRAQIPLRISINRGGHFELLCQPEPGARDRFKTGKSKGEFRTGSSFTVQILVENERYEVRLNDEVLSTIEHGSLHSMIHMLMLDGEAEFTSVEFLDIEDIDASSESEQEEIGINQV 261          
BLAST of Galectin domain-containing protein vs. TrEMBL
Match: A0A267FSN1 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig001655g1 PE=4 SV=1)

HSP 1 Score: 81.2629 bits (199), Expect = 2.785e-12
Identity = 47/155 (30.32%), Postives = 86/155 (55.48%), Query Frame = 1
Query:   46 TMFSYEIPGGLQSNDCVEIRGIMSGNGIFIGLLSNEQKVPD-EIPLKLSLELGGYWNMTTWNN--GQESSREGTITNSIYMDLPFTIQIINLLHAFKIIVNNELLGLFDKPKQSYQLTNLTMDGDAEFHSVEFKDAANVEISSDETPDEVLLTEI 501
            T F+Y+IP GL   DCVEI+GI+SG+ + + L S +Q     +IPL++S+  GG++ +        ++  + G           FT+QI+     +++ +N+E+L   +       +  L +DG+AEF SVEF D  +++ SS+   +E+ + ++
Sbjct:   65 TQFTYDIPDGLIEGDCVEIKGILSGHRVVLELASRQQTGGRAQIPLRISINRGGHFELLCQPEPGARDRFKTGKSKGEFRTGSSFTVQILVENERYEVRLNDEVLSTIEHGSLHSMIHMLMLDGEAEFTSVEFLDIEDIDASSESEQEEIGINQV 219          
BLAST of Galectin domain-containing protein vs. TrEMBL
Match: A0A267DVB1 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig000709g1 PE=4 SV=1)

HSP 1 Score: 80.8777 bits (198), Expect = 3.065e-12
Identity = 47/155 (30.32%), Postives = 86/155 (55.48%), Query Frame = 1
Query:   46 TMFSYEIPGGLQSNDCVEIRGIMSGNGIFIGLLSNEQKVPD-EIPLKLSLELGGYWNMTTWNN--GQESSREGTITNSIYMDLPFTIQIINLLHAFKIIVNNELLGLFDKPKQSYQLTNLTMDGDAEFHSVEFKDAANVEISSDETPDEVLLTEI 501
            T F+Y+IP GL   DCVEI+GI+SG+ + + L S +Q     +IPL++S+  GG++ +        ++  + G           FT+QI+     +++ +N+E+L   +       +  L +DG+AEF SVEF D  +++ SS+   +E+ + ++
Sbjct:   60 TQFTYDIPDGLIEGDCVEIKGILSGHRVVLELASRQQTGGRAQIPLRISINRGGHFELLCQPEPGARDRFKTGKSKGEFRTGSSFTVQILVENERYEVRLNDEVLSTIEHGSLHSMIHMLMLDGEAEFTSVEFLDIEDIDASSESEQEEIGINQV 214          
BLAST of Galectin domain-containing protein vs. Planmine SMEST
Match: SMESG000022399.1 (SMESG000022399.1)

HSP 1 Score: 540.806 bits (1392), Expect = 0.000e+0
Identity = 309/309 (100.00%), Postives = 309/309 (100.00%), Query Frame = 1
Query:   49 MFSYEIPGGLQSNDCVEIRGIMSGNGIFIGLLSNEQKVPDEIPLKLSLELGGYWNMTTWNNGQESSREGTITNSIYMDLPFTIQIINLLHAFKIIVNNELLGLFDKPKQSYQLTNLTMDGDAEFHSVEFKDAANVEISSDETPDEVLLTEIKKKENSSPPSFIRVDESRVSQYGKHPKTIEAPLVELKVSNQSCLPENTNTIVDDLLITXXXXXXXXXXXXXXXXXXXXXXXXXXXXINLSVPKSGSXXXXXXXXARRDKKLTSDLNNRNTINLGDIDTSHRLDVTNSEIDAAVKLKKYKHQKSPKSNE 975
            MFSYEIPGGLQSNDCVEIRGIMSGNGIFIGLLSNEQKVPDEIPLKLSLELGGYWNMTTWNNGQESSREGTITNSIYMDLPFTIQIINLLHAFKIIVNNELLGLFDKPKQSYQLTNLTMDGDAEFHSVEFKDAANVEISSDETPDEVLLTEIKKKENSSPPSFIRVDESRVSQYGKHPKTIEAPLVELKVSNQSCLPENTNTIVDDLLITRNSSTSRSSSRSSSSSESSEENKSQSNSINLSVPKSGSDDLLILDIARRDKKLTSDLNNRNTINLGDIDTSHRLDVTNSEIDAAVKLKKYKHQKSPKSNE
Sbjct:    1 MFSYEIPGGLQSNDCVEIRGIMSGNGIFIGLLSNEQKVPDEIPLKLSLELGGYWNMTTWNNGQESSREGTITNSIYMDLPFTIQIINLLHAFKIIVNNELLGLFDKPKQSYQLTNLTMDGDAEFHSVEFKDAANVEISSDETPDEVLLTEIKKKENSSPPSFIRVDESRVSQYGKHPKTIEAPLVELKVSNQSCLPENTNTIVDDLLITRNSSTSRSSSRSSSSSESSEENKSQSNSINLSVPKSGSDDLLILDIARRDKKLTSDLNNRNTINLGDIDTSHRLDVTNSEIDAAVKLKKYKHQKSPKSNE 309          

HSP 2 Score: 164.466 bits (415), Expect = 0.000e+0
Identity = 123/130 (94.62%), Postives = 125/130 (96.15%), Query Frame = 2
Query:  953 KSLQNPMNVHKHNWNXXXXXXXXXXXXXXXXXEDGLQGTFTIIDSKNDLKIGMQVPLQKKEKKKFHTLDNHLAKLGKHKSKSNKTITHDISLNXXXXXXXXXXXXXXXXSVMEITTPFVELKFEDMVDNK 1342
            KS ++  NVHKHNWNLSKLFKKKSFSPSKQKPEDGLQGTFTIIDSKNDLKIGMQVP QKKEKK FHTLDNHLAKLGKHKSKSNKTITHDISLNEETYEEIKIEITEKEESVMEITTPFVELKFEDMVDNK
Sbjct:  303 KSPKSNENVHKHNWNLSKLFKKKSFSPSKQKPEDGLQGTFTIIDSKNDLKIGMQVPRQKKEKKNFHTLDNHLAKLGKHKSKSNKTITHDISLNEETYEEIKIEITEKEESVMEITTPFVELKFEDMVDNK 432          
BLAST of Galectin domain-containing protein vs. Planmine SMEST
Match: SMESG000022399.1 (SMESG000022399.1)

HSP 1 Score: 540.421 bits (1391), Expect = 0.000e+0
Identity = 309/309 (100.00%), Postives = 309/309 (100.00%), Query Frame = 1
Query:   49 MFSYEIPGGLQSNDCVEIRGIMSGNGIFIGLLSNEQKVPDEIPLKLSLELGGYWNMTTWNNGQESSREGTITNSIYMDLPFTIQIINLLHAFKIIVNNELLGLFDKPKQSYQLTNLTMDGDAEFHSVEFKDAANVEISSDETPDEVLLTEIKKKENSSPPSFIRVDESRVSQYGKHPKTIEAPLVELKVSNQSCLPENTNTIVDDLLITXXXXXXXXXXXXXXXXXXXXXXXXXXXXINLSVPKSGSXXXXXXXXARRDKKLTSDLNNRNTINLGDIDTSHRLDVTNSEIDAAVKLKKYKHQKSPKSNE 975
            MFSYEIPGGLQSNDCVEIRGIMSGNGIFIGLLSNEQKVPDEIPLKLSLELGGYWNMTTWNNGQESSREGTITNSIYMDLPFTIQIINLLHAFKIIVNNELLGLFDKPKQSYQLTNLTMDGDAEFHSVEFKDAANVEISSDETPDEVLLTEIKKKENSSPPSFIRVDESRVSQYGKHPKTIEAPLVELKVSNQSCLPENTNTIVDDLLITRNSSTSRSSSRSSSSSESSEENKSQSNSINLSVPKSGSDDLLILDIARRDKKLTSDLNNRNTINLGDIDTSHRLDVTNSEIDAAVKLKKYKHQKSPKSNE
Sbjct:    1 MFSYEIPGGLQSNDCVEIRGIMSGNGIFIGLLSNEQKVPDEIPLKLSLELGGYWNMTTWNNGQESSREGTITNSIYMDLPFTIQIINLLHAFKIIVNNELLGLFDKPKQSYQLTNLTMDGDAEFHSVEFKDAANVEISSDETPDEVLLTEIKKKENSSPPSFIRVDESRVSQYGKHPKTIEAPLVELKVSNQSCLPENTNTIVDDLLITRNSSTSRSSSRSSSSSESSEENKSQSNSINLSVPKSGSDDLLILDIARRDKKLTSDLNNRNTINLGDIDTSHRLDVTNSEIDAAVKLKKYKHQKSPKSNE 309          

HSP 2 Score: 164.466 bits (415), Expect = 0.000e+0
Identity = 123/130 (94.62%), Postives = 125/130 (96.15%), Query Frame = 2
Query:  953 KSLQNPMNVHKHNWNXXXXXXXXXXXXXXXXXEDGLQGTFTIIDSKNDLKIGMQVPLQKKEKKKFHTLDNHLAKLGKHKSKSNKTITHDISLNXXXXXXXXXXXXXXXXSVMEITTPFVELKFEDMVDNK 1342
            KS ++  NVHKHNWNLSKLFKKKSFSPSKQKPEDGLQGTFTIIDSKNDLKIGMQVP QKKEKK FHTLDNHLAKLGKHKSKSNKTITHDISLNEETYEEIKIEITEKEESVMEITTPFVELKFEDMVDNK
Sbjct:  303 KSPKSNENVHKHNWNLSKLFKKKSFSPSKQKPEDGLQGTFTIIDSKNDLKIGMQVPRQKKEKKNFHTLDNHLAKLGKHKSKSNKTITHDISLNEETYEEIKIEITEKEESVMEITTPFVELKFEDMVDNK 432          
BLAST of Galectin domain-containing protein vs. Planmine SMEST
Match: SMESG000022399.1 (SMESG000022399.1)

HSP 1 Score: 540.421 bits (1391), Expect = 0.000e+0
Identity = 309/309 (100.00%), Postives = 309/309 (100.00%), Query Frame = 1
Query:   49 MFSYEIPGGLQSNDCVEIRGIMSGNGIFIGLLSNEQKVPDEIPLKLSLELGGYWNMTTWNNGQESSREGTITNSIYMDLPFTIQIINLLHAFKIIVNNELLGLFDKPKQSYQLTNLTMDGDAEFHSVEFKDAANVEISSDETPDEVLLTEIKKKENSSPPSFIRVDESRVSQYGKHPKTIEAPLVELKVSNQSCLPENTNTIVDDLLITXXXXXXXXXXXXXXXXXXXXXXXXXXXXINLSVPKSGSXXXXXXXXARRDKKLTSDLNNRNTINLGDIDTSHRLDVTNSEIDAAVKLKKYKHQKSPKSNE 975
            MFSYEIPGGLQSNDCVEIRGIMSGNGIFIGLLSNEQKVPDEIPLKLSLELGGYWNMTTWNNGQESSREGTITNSIYMDLPFTIQIINLLHAFKIIVNNELLGLFDKPKQSYQLTNLTMDGDAEFHSVEFKDAANVEISSDETPDEVLLTEIKKKENSSPPSFIRVDESRVSQYGKHPKTIEAPLVELKVSNQSCLPENTNTIVDDLLITRNSSTSRSSSRSSSSSESSEENKSQSNSINLSVPKSGSDDLLILDIARRDKKLTSDLNNRNTINLGDIDTSHRLDVTNSEIDAAVKLKKYKHQKSPKSNE
Sbjct:    1 MFSYEIPGGLQSNDCVEIRGIMSGNGIFIGLLSNEQKVPDEIPLKLSLELGGYWNMTTWNNGQESSREGTITNSIYMDLPFTIQIINLLHAFKIIVNNELLGLFDKPKQSYQLTNLTMDGDAEFHSVEFKDAANVEISSDETPDEVLLTEIKKKENSSPPSFIRVDESRVSQYGKHPKTIEAPLVELKVSNQSCLPENTNTIVDDLLITRNSSTSRSSSRSSSSSESSEENKSQSNSINLSVPKSGSDDLLILDIARRDKKLTSDLNNRNTINLGDIDTSHRLDVTNSEIDAAVKLKKYKHQKSPKSNE 309          

HSP 2 Score: 164.466 bits (415), Expect = 0.000e+0
Identity = 123/130 (94.62%), Postives = 125/130 (96.15%), Query Frame = 2
Query:  953 KSLQNPMNVHKHNWNXXXXXXXXXXXXXXXXXEDGLQGTFTIIDSKNDLKIGMQVPLQKKEKKKFHTLDNHLAKLGKHKSKSNKTITHDISLNXXXXXXXXXXXXXXXXSVMEITTPFVELKFEDMVDNK 1342
            KS ++  NVHKHNWNLSKLFKKKSFSPSKQKPEDGLQGTFTIIDSKNDLKIGMQVP QKKEKK FHTLDNHLAKLGKHKSKSNKTITHDISLNEETYEEIKIEITEKEESVMEITTPFVELKFEDMVDNK
Sbjct:  303 KSPKSNENVHKHNWNLSKLFKKKSFSPSKQKPEDGLQGTFTIIDSKNDLKIGMQVPRQKKEKKNFHTLDNHLAKLGKHKSKSNKTITHDISLNEETYEEIKIEITEKEESVMEITTPFVELKFEDMVDNK 432          
BLAST of Galectin domain-containing protein vs. Planmine SMEST
Match: SMESG000022399.1 (SMESG000022399.1)

HSP 1 Score: 540.421 bits (1391), Expect = 0.000e+0
Identity = 309/309 (100.00%), Postives = 309/309 (100.00%), Query Frame = 1
Query:   49 MFSYEIPGGLQSNDCVEIRGIMSGNGIFIGLLSNEQKVPDEIPLKLSLELGGYWNMTTWNNGQESSREGTITNSIYMDLPFTIQIINLLHAFKIIVNNELLGLFDKPKQSYQLTNLTMDGDAEFHSVEFKDAANVEISSDETPDEVLLTEIKKKENSSPPSFIRVDESRVSQYGKHPKTIEAPLVELKVSNQSCLPENTNTIVDDLLITXXXXXXXXXXXXXXXXXXXXXXXXXXXXINLSVPKSGSXXXXXXXXARRDKKLTSDLNNRNTINLGDIDTSHRLDVTNSEIDAAVKLKKYKHQKSPKSNE 975
            MFSYEIPGGLQSNDCVEIRGIMSGNGIFIGLLSNEQKVPDEIPLKLSLELGGYWNMTTWNNGQESSREGTITNSIYMDLPFTIQIINLLHAFKIIVNNELLGLFDKPKQSYQLTNLTMDGDAEFHSVEFKDAANVEISSDETPDEVLLTEIKKKENSSPPSFIRVDESRVSQYGKHPKTIEAPLVELKVSNQSCLPENTNTIVDDLLITRNSSTSRSSSRSSSSSESSEENKSQSNSINLSVPKSGSDDLLILDIARRDKKLTSDLNNRNTINLGDIDTSHRLDVTNSEIDAAVKLKKYKHQKSPKSNE
Sbjct:    1 MFSYEIPGGLQSNDCVEIRGIMSGNGIFIGLLSNEQKVPDEIPLKLSLELGGYWNMTTWNNGQESSREGTITNSIYMDLPFTIQIINLLHAFKIIVNNELLGLFDKPKQSYQLTNLTMDGDAEFHSVEFKDAANVEISSDETPDEVLLTEIKKKENSSPPSFIRVDESRVSQYGKHPKTIEAPLVELKVSNQSCLPENTNTIVDDLLITRNSSTSRSSSRSSSSSESSEENKSQSNSINLSVPKSGSDDLLILDIARRDKKLTSDLNNRNTINLGDIDTSHRLDVTNSEIDAAVKLKKYKHQKSPKSNE 309          

HSP 2 Score: 164.466 bits (415), Expect = 0.000e+0
Identity = 123/130 (94.62%), Postives = 125/130 (96.15%), Query Frame = 2
Query:  953 KSLQNPMNVHKHNWNXXXXXXXXXXXXXXXXXEDGLQGTFTIIDSKNDLKIGMQVPLQKKEKKKFHTLDNHLAKLGKHKSKSNKTITHDISLNXXXXXXXXXXXXXXXXSVMEITTPFVELKFEDMVDNK 1342
            KS ++  NVHKHNWNLSKLFKKKSFSPSKQKPEDGLQGTFTIIDSKNDLKIGMQVP QKKEKK FHTLDNHLAKLGKHKSKSNKTITHDISLNEETYEEIKIEITEKEESVMEITTPFVELKFEDMVDNK
Sbjct:  303 KSPKSNENVHKHNWNLSKLFKKKSFSPSKQKPEDGLQGTFTIIDSKNDLKIGMQVPRQKKEKKNFHTLDNHLAKLGKHKSKSNKTITHDISLNEETYEEIKIEITEKEESVMEITTPFVELKFEDMVDNK 432          
BLAST of Galectin domain-containing protein vs. Planmine SMEST
Match: SMESG000022399.1 (SMESG000022399.1)

HSP 1 Score: 540.421 bits (1391), Expect = 0.000e+0
Identity = 309/309 (100.00%), Postives = 309/309 (100.00%), Query Frame = 1
Query:   49 MFSYEIPGGLQSNDCVEIRGIMSGNGIFIGLLSNEQKVPDEIPLKLSLELGGYWNMTTWNNGQESSREGTITNSIYMDLPFTIQIINLLHAFKIIVNNELLGLFDKPKQSYQLTNLTMDGDAEFHSVEFKDAANVEISSDETPDEVLLTEIKKKENSSPPSFIRVDESRVSQYGKHPKTIEAPLVELKVSNQSCLPENTNTIVDDLLITXXXXXXXXXXXXXXXXXXXXXXXXXXXXINLSVPKSGSXXXXXXXXARRDKKLTSDLNNRNTINLGDIDTSHRLDVTNSEIDAAVKLKKYKHQKSPKSNE 975
            MFSYEIPGGLQSNDCVEIRGIMSGNGIFIGLLSNEQKVPDEIPLKLSLELGGYWNMTTWNNGQESSREGTITNSIYMDLPFTIQIINLLHAFKIIVNNELLGLFDKPKQSYQLTNLTMDGDAEFHSVEFKDAANVEISSDETPDEVLLTEIKKKENSSPPSFIRVDESRVSQYGKHPKTIEAPLVELKVSNQSCLPENTNTIVDDLLITRNSSTSRSSSRSSSSSESSEENKSQSNSINLSVPKSGSDDLLILDIARRDKKLTSDLNNRNTINLGDIDTSHRLDVTNSEIDAAVKLKKYKHQKSPKSNE
Sbjct:    1 MFSYEIPGGLQSNDCVEIRGIMSGNGIFIGLLSNEQKVPDEIPLKLSLELGGYWNMTTWNNGQESSREGTITNSIYMDLPFTIQIINLLHAFKIIVNNELLGLFDKPKQSYQLTNLTMDGDAEFHSVEFKDAANVEISSDETPDEVLLTEIKKKENSSPPSFIRVDESRVSQYGKHPKTIEAPLVELKVSNQSCLPENTNTIVDDLLITRNSSTSRSSSRSSSSSESSEENKSQSNSINLSVPKSGSDDLLILDIARRDKKLTSDLNNRNTINLGDIDTSHRLDVTNSEIDAAVKLKKYKHQKSPKSNE 309          

HSP 2 Score: 164.466 bits (415), Expect = 0.000e+0
Identity = 123/130 (94.62%), Postives = 125/130 (96.15%), Query Frame = 2
Query:  953 KSLQNPMNVHKHNWNXXXXXXXXXXXXXXXXXEDGLQGTFTIIDSKNDLKIGMQVPLQKKEKKKFHTLDNHLAKLGKHKSKSNKTITHDISLNXXXXXXXXXXXXXXXXSVMEITTPFVELKFEDMVDNK 1342
            KS ++  NVHKHNWNLSKLFKKKSFSPSKQKPEDGLQGTFTIIDSKNDLKIGMQVP QKKEKK FHTLDNHLAKLGKHKSKSNKTITHDISLNEETYEEIKIEITEKEESVMEITTPFVELKFEDMVDNK
Sbjct:  303 KSPKSNENVHKHNWNLSKLFKKKSFSPSKQKPEDGLQGTFTIIDSKNDLKIGMQVPRQKKEKKNFHTLDNHLAKLGKHKSKSNKTITHDISLNEETYEEIKIEITEKEESVMEITTPFVELKFEDMVDNK 432          
The following BLAST results are available for this feature:
BLAST of Galectin domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Galectin domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Galectin domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Galectin domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Galectin domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Galectin domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Galectin domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Galectin domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1I8I3S13.089e-1430.32Galectin OS=Macrostomum lignano OX=282301 PE=4 SV=... [more]
A0A1I8GPI74.676e-1430.32Galectin OS=Macrostomum lignano OX=282301 PE=4 SV=... [more]
A0A1I8J9781.932e-1229.75Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267FSN12.785e-1230.32Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
A0A267DVB13.065e-1230.32Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
back to top
BLAST of Galectin domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Galectin domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Galectin domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Galectin domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Galectin domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Galectin domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000022399.10.000e+0100.00SMESG000022399.1[more]
SMESG000022399.10.000e+0100.00SMESG000022399.1[more]
SMESG000022399.10.000e+0100.00SMESG000022399.1[more]
SMESG000022399.10.000e+0100.00SMESG000022399.1[more]
SMESG000022399.10.000e+0100.00SMESG000022399.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30009121 ID=SMED30009121|Name=Galectin domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1407bp
GTTATTATTATTATTATTTTACTTCTTTCAATTTGACGAGCTGATACAAT
GTTTTCTTACGAAATACCAGGAGGTTTGCAATCAAATGATTGTGTGGAAA
TACGAGGAATAATGAGCGGAAACGGTATTTTTATTGGGTTGCTATCAAAT
GAACAAAAAGTTCCCGATGAAATTCCGTTGAAATTATCTTTAGAATTAGG
TGGATATTGGAATATGACTACGTGGAATAATGGTCAAGAAAGTAGTCGTG
AAGGTACCATAACAAATTCAATCTACATGGATCTGCCATTTACTATACAG
ATAATAAATTTATTACATGCATTTAAGATAATTGTTAATAATGAACTTCT
TGGATTATTTGATAAGCCTAAGCAATCATATCAACTTACAAATCTTACTA
TGGATGGTGATGCCGAATTTCATTCGGTTGAATTTAAAGATGCTGCAAAC
GTTGAAATATCTAGTGATGAAACTCCAGATGAAGTTCTATTGACTGAAAT
TAAAAAGAAAGAAAACTCTTCTCCGCCATCATTTATTAGAGTTGATGAAA
GTAGAGTATCACAATATGGCAAACATCCTAAAACAATTGAAGCTCCATTA
GTGGAGCTGAAAGTATCTAATCAATCGTGTTTACCAGAAAATACAAATAC
CATTGTGGATGACTTATTGATAACTCGAAATTCATCTACTTCACGCTCTA
GTTCTCGATCATCCTCTAGCAGCGAAAGTTCTGAAGAGAATAAAAGTCAA
TCTAATTCAATTAATTTAAGCGTCCCAAAATCCGGATCTGATGATTTATT
AATTCTTGATATTGCTCGTCGCGATAAAAAACTTACTTCTGATTTAAATA
ATCGCAATACAATTAATCTAGGAGACATCGATACGTCTCATCGACTGGAT
GTAACAAATTCTGAAATTGATGCTGCCGTAAAATTGAAAAAATACAAGCA
CCAAAAGTCTCCAAAATCCAATGAATGTCCATAAGCATAATTGGAATTTA
TCGAAATTATTTAAGAAAAAATCATTCAGCCCGAGCAAACAAAAACCCGA
AGACGGACTGCAAGGAACATTTACAATAATCGATTCCAAGAACGATTTAA
AAATTGGCATGCAAGTACCGCTTCAGAAAAAAGAAAAGAAAAAATTTCAC
ACTTTGGATAATCATTTAGCAAAATTAGGAAAACATAAAAGCAAATCAAA
CAAAACAATCACACATGATATTAGCTTAAATGAAGAAACTTATGAAGAAA
TAAAGATAGAAATCACAGAAAAAGAAGAAAGTGTTATGGAAATAACAACA
CCGTTTGTAGAATTGAAATTTGAAGATATGGTAGATAATAAAATACAATA
AATGAAAAGAATATAAAATTCGGGGGGAAAGTAAAGAAATCAAAGGGAGA
CGTTGAT
back to top

protein sequence of SMED30009121-orf-1

>SMED30009121-orf-1 ID=SMED30009121-orf-1|Name=SMED30009121-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=312bp
MFSYEIPGGLQSNDCVEIRGIMSGNGIFIGLLSNEQKVPDEIPLKLSLEL
GGYWNMTTWNNGQESSREGTITNSIYMDLPFTIQIINLLHAFKIIVNNEL
LGLFDKPKQSYQLTNLTMDGDAEFHSVEFKDAANVEISSDETPDEVLLTE
IKKKENSSPPSFIRVDESRVSQYGKHPKTIEAPLVELKVSNQSCLPENTN
TIVDDLLITRNSSTSRSSSRSSSSSESSEENKSQSNSINLSVPKSGSDDL
LILDIARRDKKLTSDLNNRNTINLGDIDTSHRLDVTNSEIDAAVKLKKYK
HQKSPKSNECP*
back to top

protein sequence of SMED30009121-orf-2

>SMED30009121-orf-2 ID=SMED30009121-orf-2|Name=SMED30009121-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=127bp
MNVHKHNWNLSKLFKKKSFSPSKQKPEDGLQGTFTIIDSKNDLKIGMQVP
LQKKEKKKFHTLDNHLAKLGKHKSKSNKTITHDISLNEETYEEIKIEITE
KEESVMEITTPFVELKFEDMVDNKIQ*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000018Category 4 cell
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
PLANA:0000096ventral epidermis
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR001079Galectin_CRD
IPR013320ConA-like_dom_sf
Vocabulary: molecular function
TermDefinition
GO:0030246carbohydrate binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001079Galectin, carbohydrate recognition domainSMARTSM00908Gal_bind_lectin_2coord: 6..129
e-value: 3.9E-4
score: 23.9
IPR001079Galectin, carbohydrate recognition domainPFAMPF00337Gal-bind_lectincoord: 2..128
e-value: 1.1E-7
score: 31.5
IPR001079Galectin, carbohydrate recognition domainPROSITEPS51304GALECTINcoord: 2..130
score: 15.739
NoneNo IPR availableGENE3DG3DSA:2.60.120.200coord: 1..135
e-value: 2.9E-13
score: 51.4
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 211..241
IPR013320Concanavalin A-like lectin/glucanase domain superfamilySUPERFAMILYSSF49899Concanavalin A-like lectins/glucanasescoord: 2..130