Ankyrin-2

Overview
NameAnkyrin-2
Smed IDSMED30009119
Length (bp)7276
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Ankyrin-2 (SMED30009119) t-SNE clustered cells

Violin plots show distribution of expression levels for Ankyrin-2 (SMED30009119) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Ankyrin-2 (SMED30009119) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Ankyrin-2 (SMED30009119) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30009119

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 16

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30009119SMESG000058557.1 dd_Smed_v4_1432_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30009119SMESG000058557.1 dd_Smed_v4_1432_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30009119SMESG000058557.1 dd_Smed_v4_1432_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30009119SMESG000058557.1 dd_Smed_v4_1432_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30009119SMESG000058557.1 dd_Smed_v4_1432_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30009119SMESG000058557.1 dd_Smed_v4_1432_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30009119SMESG000058557.1 dd_Smed_v4_1432_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30009119SMESG000058557.1 dd_Smed_v4_1432_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30009119SMESG000058557.1 dd_Smed_v4_1432_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30009119SMESG000058557.1 dd_Smed_v4_1432_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30009119SMESG000058557.1 dd_Smed_v4_1432_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30009119SMESG000058557.1 dd_Smed_v4_1432_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30009119SMESG000069362.1 SMESG000058557.1 Contig34816uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30009119SMESG000069362.1 SMESG000058557.1 Contig34816newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30009119SMESG000058557.1 Contig34817uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30009119SMESG000058557.1 Contig34817newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Ankyrin-2 vs. Ensembl Human
Match: ANK2 (ankyrin 2 [Source:HGNC Symbol;Acc:HGNC:493])

HSP 1 Score: 823.928 bits (2127), Expect = 0.000e+0
Identity = 493/1383 (35.65%), Postives = 763/1383 (55.17%), Query Frame = 2
Query:  236 FLRAAHNGYFSKVQEALNSNIDVNSCNSNGLNALHLASKGGHADIVQFLIDNGADIGAKTRKNNTAIHIASLAGSLEVVKILVKHGANINEQSQTGFTPLYMAAQENHVGVVKFLLDNGADINLSTTDNFTPLAVAIQQGHEETVSILLNKSNFLNSNDISNDIKLPPLHIATRKDDYHAVLLLLH--HQEDVQAAL--TQASLNGFTALHVAAYYNSDKVGRLLLENGAPVDYTSKNNVTALHVAAKWGRNKMVKVLLEFNANVEMSTRDGIRPLHCAASQGHRDICALLIEHKANCNTRTKNGLVPLHMVAQGNHSELVEFFINQNSVNVNETSLDFLTPLHISSHCNNVEVAEALIKHGANVNDRALNGFVALHIAAKQNHVEFVEMLMSNLCMIDTQTESGFTALHIASIIGSESIAKKLVENNCEIDIPDQFDRTSLHMATIFNHFNIVVYLKEHGGSVDKQMKTGETCLMLAIKSEHKAIVEYLINQ---------------------------------GASMSVSDSWGLTALH----WATLVVRENILNSNC----------TDINI---NEAIEIFKFVLDGCSRFDINRTTKNGISSLHLAADCGCLEIVHLLLDKGADINIISINGTTPLHIACKXXXXXXXXXXXXXXXXXXXTMAYVSCPWSPMHFSSYFGSVDSTILLISHENDQTSVREKLRQRTPNGNTCLHLAVQQLQTDIVRVLLENDADFNLENEDGLSAFDMAK------IVD------------------------DETIINLLGIDTTE---MMTTDDKVYLFQRE--EFSDEEQLETLYMDSLNELEFFGIGKNSGEKCELQLSIMSLLDYATTIDSIRRADMSLKINNSLNRYRNITLSEIKTRELLIAAQPASMISTISSTNTEMSPFDVEKWDFHRVTDLPVNSGFLVSFLVDARGGYMQAQRMPQMKIFVPPDAAPAPTRIICHLLRPEGVANLPGMNDCDGFASRILQIHSSCSRFQKPILIEMPYIALLKSNDREIVILKKNADSDTWKKHSNTFTEETLKAEFGSLYESITPVDQLESNRICRIITTDVPTYFSLISQFQRDVNMIGPDGGYIESKTDKRIKLTFPQGALMKKIQIGLEVQHVDPGIINHVVGDNHKISLSPIITVEPKRRKFRDLIEIQMGLPKGVTK-------NDIQDLKLLFSISEYIT--DWEDVTSSTELVLLENTNCMAHSTKISARVWLIYAPNVPNISELANKIYALHCPTPYVGKFLSYARRHDQEECQIRCLLITDDTPDKTLECQESFELIATGPEVEVINKLQYQIECAGNIVAVTKSDEAILFPVQSFVENRITLPIRVRNQDEPFQGKIAFIPHFQS 4090
            FLRAA  G   KV E L   ID+N+CN NGLNALHLA+K GH  +VQ L+  G+ + + T+K NTA+HIASLAG  EVVK+LVK GANIN QSQ GFTPLYMAAQENH+ VVK+LL+NGA+ + +T D FTPLAVA+QQGH + V+ILL        ND    ++LP LHIA RKDD  +  LLL   H  DVQ+ +   + + +GFT LH+AA+Y +  V  LLL  GA VD+T++N +T LHVA+K G   MVK+LL+    ++  TRDG+ PLHCAA  GH  +  LL+E  A    RTKNGL PLHM AQG+H E V+  + Q+   V++ +LD+LT LH+++HC +  V + L+   AN N RALNGF  LHIA K+N ++ +E+L+     I   TESG T +H+A+ +G  +I   L++N    D+ +    T+LHMA       +V  L  +G  VD + +  +T L +A +     IV+ L+                                   GA+ S++   G T LH    + +L V + +L              T ++I      ++I   +L+  +  +I   TK G++ LHLA+  G  ++V LLLDKGA+I++ + +G T LH+A + +  NV  +L +  +      A+    ++P+  + ++G+V     L+    +       +  +T NG T LH A QQ  T I+ VLL++ A  N    +G +A  +AK      +VD                         ET+  +L +   E    MT D   YL   +  E  D+    + ++D +N L +   G  S                    DS+R    S   +++L+    +  S +    ++I +   S ++  +  N+    +  E  D   ++  P++SGFLVSF+VDARGG M+  R   ++I +PP    APTR+ C L++   +A +P M + +G ASR++++  S ++F  P+++E+P+ A L+  +RE+V+L+ + + D+WK+H   +TE+ L      + E +   + LE  RICRIIT D P YF+++S+ ++D N+IGP+GG + S    +++  FP+GAL K+I++GL+ Q +   ++  ++G+  K + SPI+T+EP+RRKF   I + + +PK  +         D   L+LL SI+   T   WED+T +T L  +    C++ +T +SAR WLI    +      A+++Y      PY+ KF+ +A+ HD  E ++RC  +TDD  DKTLE QE+F  +A   +VEV+      ++C GN+V +TKS +  +F   +F ENR+ L ++VR+  +   G+++F+   +S
Sbjct:   35 FLRAARAGNLDKVVEYLKGGIDINTCNQNGLNALHLAAKEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLE-------NDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKHLL-QHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGYTPLHIAAKKNQMQIASTLLNYGAETNI--VTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADQD---AHTKLGYTPLIVACHYGNVKMVNFLLKQGAN-------VNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTALAIAKRLGYISVVDTLKVVTEEVTTTTTTITEKHKLNVPETMTEVLDVSDEEGDDTMTGDGGEYLRPEDLKELGDDSLPSSQFLDGMNYLRYSLEGGRS--------------------DSLR--SFSSDRSHTLSHASYLRDSAVMDDSVVIPSHQVSTLAKEAERNSYRLSWGTENLDNVALSSSPIHSGFLVSFMVDARGGAMRGCRHNGLRIIIPPRKCTAPTRVTCRLVKRHRLATMPPMVEGEGLASRLIEVGPSGAQFLGPVIVEIPHFAALRGKERELVVLR-SENGDSWKEHFCDYTEDELNEILNGMDEVLDSPEDLEKKRICRIITRDFPQYFAVVSRIKQDSNLIGPEGGVLSSTVVPQVQAVFPEGALTKRIRVGLQAQPMHSELVKKILGN--KATFSPIVTLEPRRRKFHKPITMTIPVPKASSDVMLNGFGGDAPTLRLLCSITGGTTPAQWEDITGTTPLTFV--NECVSFTTNVSARFWLIDCRQIQESVTFASQVYREIICVPYMAKFVVFAKSHDPIEARLRCFCMTDDKVDKTLEQQENFAEVARSRDVEVLEGKPIYVDCFGNLVPLTKSGQHHIFSFFAFKENRLPLFVKVRDTTQEPCGRLSFMKEPKS 1370          
BLAST of Ankyrin-2 vs. Ensembl Human
Match: ANK2 (ankyrin 2 [Source:HGNC Symbol;Acc:HGNC:493])

HSP 1 Score: 822.387 bits (2123), Expect = 0.000e+0
Identity = 494/1381 (35.77%), Postives = 760/1381 (55.03%), Query Frame = 2
Query:  236 FLRAAHNGYFSKVQEALNSNIDVNSCNSNGLNALHLASKGGHADIVQFLIDNGADIGAKTRKNNTAIHIASLAGSLEVVKILVKHGANINEQSQTGFTPLYMAAQENHVGVVKFLLDNGADINLSTTDNFTPLAVAIQQGHEETVSILLNKSNFLNSNDISNDIKLPPLHIATRKDDYHAVLLLLH--HQEDVQAALTQASLNGFTALHVAAYYNSDKVGRLLLENGAPVDYTSKNNVTALHVAAKWGRNKMVKVLLEFNANVEMSTRDGIRPLHCAASQGHRDICALLIEHKANCNTRTKNGLVPLHMVAQGNHSELVEFFINQNSVNVNETSLDFLTPLHISSHCNNVEVAEALIKHGANVNDRALNGFVALHIAAKQNHVEFVEMLMSNLCMIDTQTESGFTALHIASIIGSESIAKKLVENNCEIDIPDQFDRTSLHMATIFNHFNIVVYLKEHGGSVDKQMKTGETCLMLAIKSEHKAIVEYLINQ---------------------------------GASMSVSDSWGLTALH----WATLVVRENILNSNC----------TDINI---NEAIEIFKFVLDGCSRFDINRTTKNGISSLHLAADCGCLEIVHLLLDKGADINIISINGTTPLHIACKXXXXXXXXXXXXXXXXXXXTMAYVSCPWSPMHFSSYFGSVDSTILLISHENDQTSVREKLRQRTPNGNTCLHLAVQQLQTDIVRVLLENDADFNLENEDGLSAFDMAK------IVD------------------------DETIINLLGIDTTE---MMTTDDKVYLFQRE--EFSDEEQLETLYMDSLNELEFFGIGKNSGEKCELQLSIMSLLDYATTIDSIRRADMSLKINNSLNRYRNITLSEIKTRELLIAAQPASMISTISSTNTEMSPFDVEKWDFHRVTDLPVNSGFLVSFLVDARGGYMQAQRMPQMKIFVPPDAAPAPTRIICHLLRPEGVANLPGMNDCDGFASRILQIHSSCSRFQKPILIEMPYIALLKSNDREIVILKKNADSDTWKKHSNTFTEETLKAEFGSLYESITPVDQLESNRICRIITTDVPTYFSLISQFQRDVNMIGPDGGYIESKTDKRIKLTFPQGALMKKIQIGLEVQHVDPGIINHVVGDNHKISLSPIITVEPKRRKFRDLIEIQMGLPKGVTK-------NDIQDLKLLFSISEYIT--DWEDVTSSTELVLLENTNCMAHSTKISARVWLIYAPNVPNISELANKIYALHCPTPYVGKFLSYARRHDQEECQIRCLLITDDTPDKTLECQESFELIATGPEVEVINKLQYQIECAGNIVAVTKSDEAILFPVQSFVENRITLPIRVRNQDEPFQGKIAFIPHFQS 4090
            FLRAA  G   KV E L   ID+N+CN NGLNALHLA+K GH  +VQ L+  G+ + + T+K NTA+HIASLAG  EVVK+LVK GANIN QSQ GFTPLYMAAQENH+ VVK+LL+NGA+ + +T D FTPLAVA+QQGH + V+ILL        ND    ++LP LHIA RKDD  +  LLL   H  DVQ      S +GFT LH+AA+Y +  V  LLL  GA VD+T++N +T LHVA+K G   MVK+LL+    ++  TRDG+ PLHCAA  GH  +  LL+E  A    RTKNGL PLHM AQG+H E V+  + Q+   V++ +LD+LT LH+++HC +  V + L+   AN N RALNGF  LHIA K+N ++ +E+L+     I   TESG T +H+A+ +G  +I   L++N    D+ +    T+LHMA       +V  L  +G  VD + +  +T L +A +     IV+ L+                                   GA+ S++   G T LH    + +L V + +L              T ++I      ++I   +L+  +  +I   TK G++ LHLA+  G  ++V LLLDKGA+I++ + +G T LH+A + +  NV  +L +  +      A+    ++P+  + ++G+V     L+    +       +  +T NG T LH A QQ  T I+ VLL++ A  N    +G +A  +AK      +VD                         ET+  +L +   E    MT D   YL   +  E  D+    + ++D +N L +   G  S                    DS+R    S   +++L+    +  S +    ++I +   S ++  +  N+    +  E  D   ++  P++SGFLVSF+VDARGG M+  R   ++I +PP    APTR+ C L++   +A +P M + +G ASR++++  S ++F  P+++E+P+ A L+  +RE+V+L+ + + D+WK+H   +TE+ L      + E +   + LE  RICRIIT D P YF+++S+ ++D N+IGP+GG + S    +++  FP+GAL K+I++GL+ Q +   ++  ++G+  K + SPI+T+EP+RRKF   I + + +PK  +         D   L+LL SI+   T   WED+T +T L  +    C++ +T +SAR WLI    +      A+++Y      PY+ KF+ +A+ HD  E ++RC  +TDD  DKTLE QE+F  +A   +VEV+      ++C GN+V +TKS +  +F   +F ENR+ L ++VR+  +   G+++F+   +S
Sbjct:   14 FLRAARAGNLDKVVEYLKGGIDINTCNQNGLNALHLAAKEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLE-------NDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQ------SKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKHLL-QHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGYTPLHIAAKKNQMQIASTLLNYGAETNI--VTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADQD---AHTKLGYTPLIVACHYGNVKMVNFLLKQGAN-------VNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTALAIAKRLGYISVVDTLKVVTEEVTTTTTTITEKHKLNVPETMTEVLDVSDEEGDDTMTGDGGEYLRPEDLKELGDDSLPSSQFLDGMNYLRYSLEGGRS--------------------DSLR--SFSSDRSHTLSHASYLRDSAVMDDSVVIPSHQVSTLAKEAERNSYRLSWGTENLDNVALSSSPIHSGFLVSFMVDARGGAMRGCRHNGLRIIIPPRKCTAPTRVTCRLVKRHRLATMPPMVEGEGLASRLIEVGPSGAQFLGPVIVEIPHFAALRGKERELVVLR-SENGDSWKEHFCDYTEDELNEILNGMDEVLDSPEDLEKKRICRIITRDFPQYFAVVSRIKQDSNLIGPEGGVLSSTVVPQVQAVFPEGALTKRIRVGLQAQPMHSELVKKILGN--KATFSPIVTLEPRRRKFHKPITMTIPVPKASSDVMLNGFGGDAPTLRLLCSITGGTTPAQWEDITGTTPLTFV--NECVSFTTNVSARFWLIDCRQIQESVTFASQVYREIICVPYMAKFVVFAKSHDPIEARLRCFCMTDDKVDKTLEQQENFAEVARSRDVEVLEGKPIYVDCFGNLVPLTKSGQHHIFSFFAFKENRLPLFVKVRDTTQEPCGRLSFMKEPKS 1341          
BLAST of Ankyrin-2 vs. Ensembl Human
Match: ANK2 (ankyrin 2 [Source:HGNC Symbol;Acc:HGNC:493])

HSP 1 Score: 822.387 bits (2123), Expect = 0.000e+0
Identity = 494/1381 (35.77%), Postives = 760/1381 (55.03%), Query Frame = 2
Query:  236 FLRAAHNGYFSKVQEALNSNIDVNSCNSNGLNALHLASKGGHADIVQFLIDNGADIGAKTRKNNTAIHIASLAGSLEVVKILVKHGANINEQSQTGFTPLYMAAQENHVGVVKFLLDNGADINLSTTDNFTPLAVAIQQGHEETVSILLNKSNFLNSNDISNDIKLPPLHIATRKDDYHAVLLLLH--HQEDVQAALTQASLNGFTALHVAAYYNSDKVGRLLLENGAPVDYTSKNNVTALHVAAKWGRNKMVKVLLEFNANVEMSTRDGIRPLHCAASQGHRDICALLIEHKANCNTRTKNGLVPLHMVAQGNHSELVEFFINQNSVNVNETSLDFLTPLHISSHCNNVEVAEALIKHGANVNDRALNGFVALHIAAKQNHVEFVEMLMSNLCMIDTQTESGFTALHIASIIGSESIAKKLVENNCEIDIPDQFDRTSLHMATIFNHFNIVVYLKEHGGSVDKQMKTGETCLMLAIKSEHKAIVEYLINQ---------------------------------GASMSVSDSWGLTALH----WATLVVRENILNSNC----------TDINI---NEAIEIFKFVLDGCSRFDINRTTKNGISSLHLAADCGCLEIVHLLLDKGADINIISINGTTPLHIACKXXXXXXXXXXXXXXXXXXXTMAYVSCPWSPMHFSSYFGSVDSTILLISHENDQTSVREKLRQRTPNGNTCLHLAVQQLQTDIVRVLLENDADFNLENEDGLSAFDMAK------IVD------------------------DETIINLLGIDTTE---MMTTDDKVYLFQRE--EFSDEEQLETLYMDSLNELEFFGIGKNSGEKCELQLSIMSLLDYATTIDSIRRADMSLKINNSLNRYRNITLSEIKTRELLIAAQPASMISTISSTNTEMSPFDVEKWDFHRVTDLPVNSGFLVSFLVDARGGYMQAQRMPQMKIFVPPDAAPAPTRIICHLLRPEGVANLPGMNDCDGFASRILQIHSSCSRFQKPILIEMPYIALLKSNDREIVILKKNADSDTWKKHSNTFTEETLKAEFGSLYESITPVDQLESNRICRIITTDVPTYFSLISQFQRDVNMIGPDGGYIESKTDKRIKLTFPQGALMKKIQIGLEVQHVDPGIINHVVGDNHKISLSPIITVEPKRRKFRDLIEIQMGLPKGVTK-------NDIQDLKLLFSISEYIT--DWEDVTSSTELVLLENTNCMAHSTKISARVWLIYAPNVPNISELANKIYALHCPTPYVGKFLSYARRHDQEECQIRCLLITDDTPDKTLECQESFELIATGPEVEVINKLQYQIECAGNIVAVTKSDEAILFPVQSFVENRITLPIRVRNQDEPFQGKIAFIPHFQS 4090
            FLRAA  G   KV E L   ID+N+CN NGLNALHLA+K GH  +VQ L+  G+ + + T+K NTA+HIASLAG  EVVK+LVK GANIN QSQ GFTPLYMAAQENH+ VVK+LL+NGA+ + +T D FTPLAVA+QQGH + V+ILL        ND    ++LP LHIA RKDD  +  LLL   H  DVQ      S +GFT LH+AA+Y +  V  LLL  GA VD+T++N +T LHVA+K G   MVK+LL+    ++  TRDG+ PLHCAA  GH  +  LL+E  A    RTKNGL PLHM AQG+H E V+  + Q+   V++ +LD+LT LH+++HC +  V + L+   AN N RALNGF  LHIA K+N ++ +E+L+     I   TESG T +H+A+ +G  +I   L++N    D+ +    T+LHMA       +V  L  +G  VD + +  +T L +A +     IV+ L+                                   GA+ S++   G T LH    + +L V + +L              T ++I      ++I   +L+  +  +I   TK G++ LHLA+  G  ++V LLLDKGA+I++ + +G T LH+A + +  NV  +L +  +      A+    ++P+  + ++G+V     L+    +       +  +T NG T LH A QQ  T I+ VLL++ A  N    +G +A  +AK      +VD                         ET+  +L +   E    MT D   YL   +  E  D+    + ++D +N L +   G  S                    DS+R    S   +++L+    +  S +    ++I +   S ++  +  N+    +  E  D   ++  P++SGFLVSF+VDARGG M+  R   ++I +PP    APTR+ C L++   +A +P M + +G ASR++++  S ++F  P+++E+P+ A L+  +RE+V+L+ + + D+WK+H   +TE+ L      + E +   + LE  RICRIIT D P YF+++S+ ++D N+IGP+GG + S    +++  FP+GAL K+I++GL+ Q +   ++  ++G+  K + SPI+T+EP+RRKF   I + + +PK  +         D   L+LL SI+   T   WED+T +T L  +    C++ +T +SAR WLI    +      A+++Y      PY+ KF+ +A+ HD  E ++RC  +TDD  DKTLE QE+F  +A   +VEV+      ++C GN+V +TKS +  +F   +F ENR+ L ++VR+  +   G+++F+   +S
Sbjct:   14 FLRAARAGNLDKVVEYLKGGIDINTCNQNGLNALHLAAKEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLE-------NDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQ------SKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKHLL-QHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGYTPLHIAAKKNQMQIASTLLNYGAETNI--VTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADQD---AHTKLGYTPLIVACHYGNVKMVNFLLKQGAN-------VNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTALAIAKRLGYISVVDTLKVVTEEVTTTTTTITEKHKLNVPETMTEVLDVSDEEGDDTMTGDGGEYLRPEDLKELGDDSLPSSQFLDGMNYLRYSLEGGRS--------------------DSLR--SFSSDRSHTLSHASYLRDSAVMDDSVVIPSHQVSTLAKEAERNSYRLSWGTENLDNVALSSSPIHSGFLVSFMVDARGGAMRGCRHNGLRIIIPPRKCTAPTRVTCRLVKRHRLATMPPMVEGEGLASRLIEVGPSGAQFLGPVIVEIPHFAALRGKERELVVLR-SENGDSWKEHFCDYTEDELNEILNGMDEVLDSPEDLEKKRICRIITRDFPQYFAVVSRIKQDSNLIGPEGGVLSSTVVPQVQAVFPEGALTKRIRVGLQAQPMHSELVKKILGN--KATFSPIVTLEPRRRKFHKPITMTIPVPKASSDVMLNGFGGDAPTLRLLCSITGGTTPAQWEDITGTTPLTFV--NECVSFTTNVSARFWLIDCRQIQESVTFASQVYREIICVPYMAKFVVFAKSHDPIEARLRCFCMTDDKVDKTLEQQENFAEVARSRDVEVLEGKPIYVDCFGNLVPLTKSGQHHIFSFFAFKENRLPLFVKVRDTTQEPCGRLSFMKEPKS 1341          
BLAST of Ankyrin-2 vs. Ensembl Human
Match: ANK2 (ankyrin 2 [Source:HGNC Symbol;Acc:HGNC:493])

HSP 1 Score: 822.387 bits (2123), Expect = 0.000e+0
Identity = 493/1383 (35.65%), Postives = 763/1383 (55.17%), Query Frame = 2
Query:  236 FLRAAHNGYFSKVQEALNSNIDVNSCNSNGLNALHLASKGGHADIVQFLIDNGADIGAKTRKNNTAIHIASLAGSLEVVKILVKHGANINEQSQTGFTPLYMAAQENHVGVVKFLLDNGADINLSTTDNFTPLAVAIQQGHEETVSILLNKSNFLNSNDISNDIKLPPLHIATRKDDYHAVLLLLH--HQEDVQAAL--TQASLNGFTALHVAAYYNSDKVGRLLLENGAPVDYTSKNNVTALHVAAKWGRNKMVKVLLEFNANVEMSTRDGIRPLHCAASQGHRDICALLIEHKANCNTRTKNGLVPLHMVAQGNHSELVEFFINQNSVNVNETSLDFLTPLHISSHCNNVEVAEALIKHGANVNDRALNGFVALHIAAKQNHVEFVEMLMSNLCMIDTQTESGFTALHIASIIGSESIAKKLVENNCEIDIPDQFDRTSLHMATIFNHFNIVVYLKEHGGSVDKQMKTGETCLMLAIKSEHKAIVEYLINQ---------------------------------GASMSVSDSWGLTALH----WATLVVRENILNSNC----------TDINI---NEAIEIFKFVLDGCSRFDINRTTKNGISSLHLAADCGCLEIVHLLLDKGADINIISINGTTPLHIACKXXXXXXXXXXXXXXXXXXXTMAYVSCPWSPMHFSSYFGSVDSTILLISHENDQTSVREKLRQRTPNGNTCLHLAVQQLQTDIVRVLLENDADFNLENEDGLSAFDMAK------IVD------------------------DETIINLLGIDTTE---MMTTDDKVYLFQRE--EFSDEEQLETLYMDSLNELEFFGIGKNSGEKCELQLSIMSLLDYATTIDSIRRADMSLKINNSLNRYRNITLSEIKTRELLIAAQPASMISTISSTNTEMSPFDVEKWDFHRVTDLPVNSGFLVSFLVDARGGYMQAQRMPQMKIFVPPDAAPAPTRIICHLLRPEGVANLPGMNDCDGFASRILQIHSSCSRFQKPILIEMPYIALLKSNDREIVILKKNADSDTWKKHSNTFTEETLKAEFGSLYESITPVDQLESNRICRIITTDVPTYFSLISQFQRDVNMIGPDGGYIESKTDKRIKLTFPQGALMKKIQIGLEVQHVDPGIINHVVGDNHKISLSPIITVEPKRRKFRDLIEIQMGLPKGVTK-------NDIQDLKLLFSISEYIT--DWEDVTSSTELVLLENTNCMAHSTKISARVWLIYAPNVPNISELANKIYALHCPTPYVGKFLSYARRHDQEECQIRCLLITDDTPDKTLECQESFELIATGPEVEVINKLQYQIECAGNIVAVTKSDEAILFPVQSFVENRITLPIRVRNQDEPFQGKIAFIPHFQS 4090
            FLRAA  G   KV E L   ID+N+CN NGLNALHLA+K GH  +VQ L+  G+ + + T+K NTA+HIASLAG  EVVK+LVK GANIN QSQ GFTPLYMAAQENH+ VVK+LL+NGA+ + +T D FTPLAVA+QQGH + V+ILL        ND    ++LP LHIA RKDD  +  LLL   H  DVQ+ +   + + +GFT LH+AA+Y +  V  LLL  GA VD+T++N +T LHVA+K G   MVK+LL+    ++  TRDG+ PLHCAA  GH  +  LL+E  A    RTKNGL PLHM AQG+H E V+  + Q+   V++ +LD+LT LH+++HC +  V + L+   AN N RALNGF  LHIA K+N ++ +E+L+     I   TESG T +H+A+ +G  +I   L++N    D+ +    T+LHMA       +V  L  +G  VD + +  +T L +A +     IV+ L+                                   GA+ S++   G T LH    + +L V + +L              T ++I      ++I   +L+  +  +I   TK G++ LHLA+  G  ++V LLLDKGA+I++ + +G T LH+A + +  NV  +L +  +      A+    ++P+  + ++G+V     L+    +       +  +T NG T LH A QQ  T I+ VLL++ A  N    +G +A  +AK      +VD                         ET+  +L +   E    MT D   YL   +  E  D+    + ++D +N L +   G  S                    DS+R    S   +++L+    +  S +    ++I +   S ++  +  N+    +  E  D   ++  P++SGFLVSF+VDARGG M+  R   ++I +PP    APTR+ C L++   +A +P M + +G ASR++++  S ++F  P+++E+P+ A L+  +RE+V+L+ + + D+WK+H   +TE+ L      + E +   + LE  RICRIIT D P YF+++S+ ++D N+IGP+GG + S    +++  FP+GAL K+I++GL+ Q +   ++  ++G+  K + SPI+T+EP+RRKF   I + + +PK  +         D   L+LL SI+   T   WED+T +T L  +    C++ +T +SAR WLI    +      A+++Y      PY+ KF+ +A+ HD  E ++RC  +TDD  DKTLE QE+F  +A   +VEV+      ++C GN+V +TKS +  +F   +F ENR+ L ++VR+  +   G+++F+   +S
Sbjct:   14 FLRAARAGNLDKVVEYLKGGIDINTCNQNGLNALHLAAKEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLE-------NDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKHLL-QHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGYTPLHIAAKKNQMQIASTLLNYGAETNI--VTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADQD---AHTKLGYTPLIVACHYGNVKMVNFLLKQGAN-------VNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTALAIAKRLGYISVVDTLKVVTEEVTTTTTTITEKHKLNVPETMTEVLDVSDEEGDDTMTGDGGEYLRPEDLKELGDDSLPSSQFLDGMNYLRYSLEGGRS--------------------DSLR--SFSSDRSHTLSHASYLRDSAVMDDSVVIPSHQVSTLAKEAERNSYRLSWGTENLDNVALSSSPIHSGFLVSFMVDARGGAMRGCRHNGLRIIIPPRKCTAPTRVTCRLVKRHRLATMPPMVEGEGLASRLIEVGPSGAQFLGPVIVEIPHFAALRGKERELVVLR-SENGDSWKEHFCDYTEDELNEILNGMDEVLDSPEDLEKKRICRIITRDFPQYFAVVSRIKQDSNLIGPEGGVLSSTVVPQVQAVFPEGALTKRIRVGLQAQPMHSELVKKILGN--KATFSPIVTLEPRRRKFHKPITMTIPVPKASSDVMLNGFGGDAPTLRLLCSITGGTTPAQWEDITGTTPLTFV--NECVSFTTNVSARFWLIDCRQIQESVTFASQVYREIICVPYMAKFVVFAKSHDPIEARLRCFCMTDDKVDKTLEQQENFAEVARSRDVEVLEGKPIYVDCFGNLVPLTKSGQHHIFSFFAFKENRLPLFVKVRDTTQEPCGRLSFMKEPKS 1349          
BLAST of Ankyrin-2 vs. Ensembl Human
Match: ANK2 (ankyrin 2 [Source:HGNC Symbol;Acc:HGNC:493])

HSP 1 Score: 822.387 bits (2123), Expect = 0.000e+0
Identity = 493/1383 (35.65%), Postives = 763/1383 (55.17%), Query Frame = 2
Query:  236 FLRAAHNGYFSKVQEALNSNIDVNSCNSNGLNALHLASKGGHADIVQFLIDNGADIGAKTRKNNTAIHIASLAGSLEVVKILVKHGANINEQSQTGFTPLYMAAQENHVGVVKFLLDNGADINLSTTDNFTPLAVAIQQGHEETVSILLNKSNFLNSNDISNDIKLPPLHIATRKDDYHAVLLLLH--HQEDVQAAL--TQASLNGFTALHVAAYYNSDKVGRLLLENGAPVDYTSKNNVTALHVAAKWGRNKMVKVLLEFNANVEMSTRDGIRPLHCAASQGHRDICALLIEHKANCNTRTKNGLVPLHMVAQGNHSELVEFFINQNSVNVNETSLDFLTPLHISSHCNNVEVAEALIKHGANVNDRALNGFVALHIAAKQNHVEFVEMLMSNLCMIDTQTESGFTALHIASIIGSESIAKKLVENNCEIDIPDQFDRTSLHMATIFNHFNIVVYLKEHGGSVDKQMKTGETCLMLAIKSEHKAIVEYLINQ---------------------------------GASMSVSDSWGLTALH----WATLVVRENILNSNC----------TDINI---NEAIEIFKFVLDGCSRFDINRTTKNGISSLHLAADCGCLEIVHLLLDKGADINIISINGTTPLHIACKXXXXXXXXXXXXXXXXXXXTMAYVSCPWSPMHFSSYFGSVDSTILLISHENDQTSVREKLRQRTPNGNTCLHLAVQQLQTDIVRVLLENDADFNLENEDGLSAFDMAK------IVD------------------------DETIINLLGIDTTE---MMTTDDKVYLFQRE--EFSDEEQLETLYMDSLNELEFFGIGKNSGEKCELQLSIMSLLDYATTIDSIRRADMSLKINNSLNRYRNITLSEIKTRELLIAAQPASMISTISSTNTEMSPFDVEKWDFHRVTDLPVNSGFLVSFLVDARGGYMQAQRMPQMKIFVPPDAAPAPTRIICHLLRPEGVANLPGMNDCDGFASRILQIHSSCSRFQKPILIEMPYIALLKSNDREIVILKKNADSDTWKKHSNTFTEETLKAEFGSLYESITPVDQLESNRICRIITTDVPTYFSLISQFQRDVNMIGPDGGYIESKTDKRIKLTFPQGALMKKIQIGLEVQHVDPGIINHVVGDNHKISLSPIITVEPKRRKFRDLIEIQMGLPKGVTK-------NDIQDLKLLFSISEYIT--DWEDVTSSTELVLLENTNCMAHSTKISARVWLIYAPNVPNISELANKIYALHCPTPYVGKFLSYARRHDQEECQIRCLLITDDTPDKTLECQESFELIATGPEVEVINKLQYQIECAGNIVAVTKSDEAILFPVQSFVENRITLPIRVRNQDEPFQGKIAFIPHFQS 4090
            FLRAA  G   KV E L   ID+N+CN NGLNALHLA+K GH  +VQ L+  G+ + + T+K NTA+HIASLAG  EVVK+LVK GANIN QSQ GFTPLYMAAQENH+ VVK+LL+NGA+ + +T D FTPLAVA+QQGH + V+ILL        ND    ++LP LHIA RKDD  +  LLL   H  DVQ+ +   + + +GFT LH+AA+Y +  V  LLL  GA VD+T++N +T LHVA+K G   MVK+LL+    ++  TRDG+ PLHCAA  GH  +  LL+E  A    RTKNGL PLHM AQG+H E V+  + Q+   V++ +LD+LT LH+++HC +  V + L+   AN N RALNGF  LHIA K+N ++ +E+L+     I   TESG T +H+A+ +G  +I   L++N    D+ +    T+LHMA       +V  L  +G  VD + +  +T L +A +     IV+ L+                                   GA+ S++   G T LH    + +L V + +L              T ++I      ++I   +L+  +  +I   TK G++ LHLA+  G  ++V LLLDKGA+I++ + +G T LH+A + +  NV  +L +  +      A+    ++P+  + ++G+V     L+    +       +  +T NG T LH A QQ  T I+ VLL++ A  N    +G +A  +AK      +VD                         ET+  +L +   E    MT D   YL   +  E  D+    + ++D +N L +   G  S                    DS+R    S   +++L+    +  S +    ++I +   S ++  +  N+    +  E  D   ++  P++SGFLVSF+VDARGG M+  R   ++I +PP    APTR+ C L++   +A +P M + +G ASR++++  S ++F  P+++E+P+ A L+  +RE+V+L+ + + D+WK+H   +TE+ L      + E +   + LE  RICRIIT D P YF+++S+ ++D N+IGP+GG + S    +++  FP+GAL K+I++GL+ Q +   ++  ++G+  K + SPI+T+EP+RRKF   I + + +PK  +         D   L+LL SI+   T   WED+T +T L  +    C++ +T +SAR WLI    +      A+++Y      PY+ KF+ +A+ HD  E ++RC  +TDD  DKTLE QE+F  +A   +VEV+      ++C GN+V +TKS +  +F   +F ENR+ L ++VR+  +   G+++F+   +S
Sbjct:   14 FLRAARAGNLDKVVEYLKGGIDINTCNQNGLNALHLAAKEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLE-------NDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKHLL-QHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGYTPLHIAAKKNQMQIASTLLNYGAETNI--VTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADQD---AHTKLGYTPLIVACHYGNVKMVNFLLKQGAN-------VNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTALAIAKRLGYISVVDTLKVVTEEVTTTTTTITEKHKLNVPETMTEVLDVSDEEGDDTMTGDGGEYLRPEDLKELGDDSLPSSQFLDGMNYLRYSLEGGRS--------------------DSLR--SFSSDRSHTLSHASYLRDSAVMDDSVVIPSHQVSTLAKEAERNSYRLSWGTENLDNVALSSSPIHSGFLVSFMVDARGGAMRGCRHNGLRIIIPPRKCTAPTRVTCRLVKRHRLATMPPMVEGEGLASRLIEVGPSGAQFLGPVIVEIPHFAALRGKERELVVLR-SENGDSWKEHFCDYTEDELNEILNGMDEVLDSPEDLEKKRICRIITRDFPQYFAVVSRIKQDSNLIGPEGGVLSSTVVPQVQAVFPEGALTKRIRVGLQAQPMHSELVKKILGN--KATFSPIVTLEPRRRKFHKPITMTIPVPKASSDVMLNGFGGDAPTLRLLCSITGGTTPAQWEDITGTTPLTFV--NECVSFTTNVSARFWLIDCRQIQESVTFASQVYREIICVPYMAKFVVFAKSHDPIEARLRCFCMTDDKVDKTLEQQENFAEVARSRDVEVLEGKPIYVDCFGNLVPLTKSGQHHIFSFFAFKENRLPLFVKVRDTTQEPCGRLSFMKEPKS 1349          
BLAST of Ankyrin-2 vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 681.019 bits (1756), Expect = 0.000e+0
Identity = 495/1607 (30.80%), Postives = 784/1607 (48.79%), Query Frame = 2
Query:  236 FLRAAHNGYFSKVQEALNSNIDVNSCNSNGLNALHLASKGGHADIVQFLIDNGADIGAKTRKNNTAIHIASLAGSLEVVKILVKHGANINEQSQTGFTPLYMAAQENHVGVVKFLLDNGADINLSTTDNFTPLAVAIQQGHEETVSILLNKSNFLNSNDISNDIKLPPLHIATRKDDYHAVLLLLH--HQEDVQAALTQASLNGFTALHVAAYYNSDKVGRLLLENGAPVDYTSKNNVTALHVAAKWGRNKMVKVLLEFNANVEMSTRDGIRPLHCAASQGHRDICALLIEHKANCNTRTKNGLVP---------------------------------LHMVAQGNHSELVEFFINQNSVNVNETSLDFLTPLHISSHCNNVEVAEALIKH---------------------------------GANVNDRALNGFVALHIAAKQNHVEFVEMLMSNLCMIDTQ---------------------------------TESGFTALHIASIIGSESIAKKLVENNCEIDIPDQFDRTSLHMATIFNHFNIVVYLKEHGGSVDKQMKTGETCLMLAIKSEHKAIVEYLINQGASMSVSDSWGLTALHWATLVVRENILNSNCTDININEAIEIFKFVLDGCSRFDINRTTKNGISSLHLAADCGCLEIVHLLLDKGADINIISINGTTPLHIACKXXXXXXXXXXXXXXXXXXXTMAYVSCPWSPMHFSSYFGSVDSTILLISHENDQTSVREKLRQRTPNGNTCLHLAVQQLQTDIVRVLLENDADFNLENEDGLSAFDMAKIVDDETIINLL----GIDTTEMMTTDDKVYLFQREEFSDEEQLETLYMDSLNELEFFGIGKNSGEKCELQLSIMSLLDYATTIDSIRRADMSLKINNSL---NRYRNITLSEIKTRELLIAAQPASMISTISSTNTE----------------------MSPFDVEKWDFHRVTDLPVNSG----------------------------FLVSFLVDARGGYMQAQRMPQMKIFVPPDAAPAPTRIICHLLRPEGVANLPGMNDCDGFASRILQIHSSCSRFQKPILIEMPYIALLKSNDREIVILKKNADSDTWKKHSNTFTEETLKAEFGSLY--ESITPVDQLESNRICRIITTDVPTYFSLISQFQRDVNMIGPDGGYIESKTDKRIKLTFPQGALMKKIQIGLEVQHVDPGIINHVVGDNHKISLSPIITVEPKRRKFRDLIEIQMGLPK-----------GVTKNDIQDLKLLFSIS--EYITDWEDVTSSTELVLLENTNCMAHSTKISARVWLIYAPNVPNISELANKIYALHCPTPYVGKFLSYARRHDQEECQIRCLLITDDTPDKTLECQESFELIATGPEVEVINKLQYQIECAGNIVAVTKSDEAILFPVQSFVENRITLPIRVRNQDE---PFQGKIAFIPHFQSLSKQIVKXXXXXXXXXXXXXXXMVGSFRN-PDRKHRVKNATLERIKGCQAIAK--TELDLKSVADAVGADWRXXXXXXXXXXDDINLVLNENCTDEEKAFMTLINWQTVLGFKATGNELNRALRQIGREDVVKSCIGDISFVEDEA 4519
            FLRAA  G   KV E L +  D+N+ N+NGLN+LHLASK GH+++V+ LI   A + A TRK NTA+HIASLAG   +V ILV++GAN+N QS  GFTPLYMAAQENH  VVK+LL +GA+  LST D FTPLAVA+QQGH+  V++LL        ND    ++LP LHIA +KDD  A  LLL   H  DV       S +GFT LH+AA+Y  + VG+LLLE GA V+Y +++N++ LHVA KWGR  M  +LL   A ++  T+D + PLHCAA  GH  +  LL+   A  + +TKNGL P                                 LH+ A   H  + +  +++ S + N  +L+  TPLHI+   N ++V E L+K+                                 GAN +   + G   LH+AA+ N  + V +L+ N   +D Q                                 T   ++ LHIA+  G E +A  L+++N +  +  +   T LH+A+ + +  +V  L E G  VD + K   T L +A    +  +   L+  GAS   +   G T LH A           N  +I    A  + +F      + D N  ++ G + LHL+A  G  EI  LL++ G+D+   + NG T +H+  + ++  V  +L  + +  +   +  +  ++P+H + +FG ++    L+ +  D   V EK R       T LH A QQ   + VR LLEN A  N +   G +   +A+ +   +++  L            TT D+ Y  Q  E  +    ET++ +S +E +       +  + +   ++   L  +T +  I   +  L+ +  L        I    +   +      P +  S I+++N++                        P D  +    R  + P+N+G                            FL+SFLVDARGG M+  R   ++I VPP  A  P R+ C  LR + +A+ P +++ +  ASRIL++  + ++F  P+++E+P+ A L+  +REIVIL+ + D   WK+H    TE+ ++      +  E +  +D L++ RI RI+T+D P YF+++++ +++V+ +GP+GG I S    R++  FP G+L K I++ ++ Q V   ++  + G+  ++++SPI+TVEP+RRKF   I + + LP+           G    +   L+LL SI+       WED+T +T+L      + ++ +T +SAR WL+      + + +A ++Y      PY+ KF  +ARR    E Q+R   +TDD  DKTLE QE F+LIA   +VEV+      +E +GN+V +TKS + +      F ENR+   ++ R+ D+     +G+I F+   +  S  +  P       +   + +  G  +  P  K   K+ T    +   A+ K   E   ++V   +GADW  L   LE+   DI  +       E K   TL  W  +    A  + L++ALRQIGR+D+V+S    I++ E +A
Sbjct:   37 FLRAARAGDLEKVLELLRAGTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLL-------ENDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDV------TSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDR-SADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAA--------KKNQMEI----ASTLLQF------KADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEIN---SKTNAGYTPLHVACHFGQLNMVKFLVENGAD---VGEKTRA----SYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIAQRLGYVSVVETLRTVTETTVITETTTVDERYKPQNPEAMN----ETMFSESEDEGQAAEHEAVAAHEKDFSDNLTQGLQDSTGVHMIHTGEQLLQRSQELENGGAIPKINSGGMSPEKEFAKIAPVATSSPIATSNSQSFGIAPRAGSISGQFQQQPLHGAGPEDNLEELVRRAQNHPINAGNYDNGGVAMLENGHADNVPIGHHVTQPSFLISFLVDARGGAMRGCRHSGVRIIVPPRKASQPIRVTCRYLRKDKLAHPPPLSEGEELASRILEMAPAGAKFLGPVILEVPHFASLRDREREIVILRSD-DGQHWKEHQLEATEDAVQEVLNESFDAEDLAQLDDLQTPRITRILTSDFPMYFAVVTRVRQEVHCVGPEGGVIISSVVPRVQAIFPDGSLTKTIKVSVQAQPVPQEMVTRLHGN--RVAVSPIVTVEPRRRKFHKPITLCIPLPQSNNRGMLTQYSGQQGQEPPTLRLLCSITGGSAPAQWEDITGTTQLTF--TGDEVSFTTTVSARFWLMDCQTPRDAARMAQEVYNEAISIPYMAKFAVFARRTFPVEGQLRVFCMTDDKEDKTLEKQEHFKLIAKSRDVEVLKGKHQFLEFSGNLVPITKSGDQLSLFFLPFQENRLAFMVKTRSNDDNEAATEGRIGFMAEPKIRSDAL--PPQQPICTLAISLPEYTGEIKTAPPPK---KDLTPFEQRYGSALEKDLPEFVHQNVLKGIGADWPRLGRALEVPHRDIQHIRQNYPGQECK--NTLKIWIHLKKEDANQDNLDQALRQIGRDDIVRS----IAYGEPDA 1581          

HSP 2 Score: 239.965 bits (611), Expect = 5.928e-63
Identity = 193/726 (26.58%), Postives = 326/726 (44.90%), Query Frame = 2
Query:  521 GFTPLYMAAQENHVGVVKFLLDNGADINLSTTDNFTPLAVAIQQGHEETVSILLNKSNFLNSNDISNDIKLPPLHIATRKDDYHAVLLLLHHQEDVQAALTQASLNGFTALHVAAYYNSDKVGRLLLENGAPVDYTSKNNVTALHVAAKWGRNKMVKVLLEFNA-----------------------------NVEMSTRDGIRPLHCAASQGHRDICALLIEHKANCN---------------------------------TRTKNGLVPLHMVAQGNHSELVEFFINQNS--------------------------------VNVNETSLDFLTPLHISSHCNNVEVAEALIKHGANVNDRALNGFVALHIAAKQNHVEFVEMLMSNLCMIDTQTESGFTALHIASIIGSESIAKKLVENNCEIDIPDQFDRTSLHMATIFNHFNIVVYLKEHGGSVDKQMKTGETCLMLAIKSEHKAIVEYLINQGASMSVSDSWGLTALHWATLVVRENILNSNCTDININEAIEIFKFVLDGCSRFDINRTTKNGISSLHLAADCGCLEIVHLLLDKGADINIISINGTTPLHIACKXXXXXXXXXXXXXXXXXXXTMAYVSCPWSPMHFSSYFGSVDSTILLISHENDQTSVREKLRQRTPNGNTCLHLAVQQLQTDIVRVLLENDADFNLENEDGLSAFDMAKIVDDETIINLLGIDTTEMMTTDDKVY 2416
            G      AA+   +  V  LL  G DIN S  +    L +A ++GH E V  L+ +   +++     +     LHIA+       V +L+ +  +V       S+NGFT L++AA  N ++V + LL++GA    ++++  T L VA + G +++V VLLE ++                             N +++++ G  PLH AA  GH ++  LL+E  AN N                                 +RTK+ L PLH  A+  H ++V+  + Q +                                  V++ ++D+LTPLH+++HC +V VA+ L+   A+ N RALNGF  LHIA K+N ++ VE+L+     I+  TESG T LH+A+ +G+ +I   L++     D+      T LH+A   N  ++V  L  +G  VD Q +  +T L +A +  +  IV  L+  GA+ + +     + LH A    +E                E+   +LD  +  D    TK G + LHLA+  G LE+V LLL++G  ++I   N  TPLH+A      N   V +  L   +   A     ++P+H ++    ++    L+  + D  +       ++  G T LHL+ Q+   +I  +L+EN +D   +  +GL+A  +    D   +  +L  +  E+ +  +  Y
Sbjct:   33 GSASFLRAARAGDLEKVLELLRAGTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTA---LHIASLAGQSLIVTILVENGANVNV----QSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQE----------------EVAGILLDHNA--DKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAH---YNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNA-------KSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGY 723          
BLAST of Ankyrin-2 vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 681.019 bits (1756), Expect = 0.000e+0
Identity = 495/1607 (30.80%), Postives = 784/1607 (48.79%), Query Frame = 2
Query:  236 FLRAAHNGYFSKVQEALNSNIDVNSCNSNGLNALHLASKGGHADIVQFLIDNGADIGAKTRKNNTAIHIASLAGSLEVVKILVKHGANINEQSQTGFTPLYMAAQENHVGVVKFLLDNGADINLSTTDNFTPLAVAIQQGHEETVSILLNKSNFLNSNDISNDIKLPPLHIATRKDDYHAVLLLLH--HQEDVQAALTQASLNGFTALHVAAYYNSDKVGRLLLENGAPVDYTSKNNVTALHVAAKWGRNKMVKVLLEFNANVEMSTRDGIRPLHCAASQGHRDICALLIEHKANCNTRTKNGLVP---------------------------------LHMVAQGNHSELVEFFINQNSVNVNETSLDFLTPLHISSHCNNVEVAEALIKH---------------------------------GANVNDRALNGFVALHIAAKQNHVEFVEMLMSNLCMIDTQ---------------------------------TESGFTALHIASIIGSESIAKKLVENNCEIDIPDQFDRTSLHMATIFNHFNIVVYLKEHGGSVDKQMKTGETCLMLAIKSEHKAIVEYLINQGASMSVSDSWGLTALHWATLVVRENILNSNCTDININEAIEIFKFVLDGCSRFDINRTTKNGISSLHLAADCGCLEIVHLLLDKGADINIISINGTTPLHIACKXXXXXXXXXXXXXXXXXXXTMAYVSCPWSPMHFSSYFGSVDSTILLISHENDQTSVREKLRQRTPNGNTCLHLAVQQLQTDIVRVLLENDADFNLENEDGLSAFDMAKIVDDETIINLL----GIDTTEMMTTDDKVYLFQREEFSDEEQLETLYMDSLNELEFFGIGKNSGEKCELQLSIMSLLDYATTIDSIRRADMSLKINNSL---NRYRNITLSEIKTRELLIAAQPASMISTISSTNTE----------------------MSPFDVEKWDFHRVTDLPVNSG----------------------------FLVSFLVDARGGYMQAQRMPQMKIFVPPDAAPAPTRIICHLLRPEGVANLPGMNDCDGFASRILQIHSSCSRFQKPILIEMPYIALLKSNDREIVILKKNADSDTWKKHSNTFTEETLKAEFGSLY--ESITPVDQLESNRICRIITTDVPTYFSLISQFQRDVNMIGPDGGYIESKTDKRIKLTFPQGALMKKIQIGLEVQHVDPGIINHVVGDNHKISLSPIITVEPKRRKFRDLIEIQMGLPK-----------GVTKNDIQDLKLLFSIS--EYITDWEDVTSSTELVLLENTNCMAHSTKISARVWLIYAPNVPNISELANKIYALHCPTPYVGKFLSYARRHDQEECQIRCLLITDDTPDKTLECQESFELIATGPEVEVINKLQYQIECAGNIVAVTKSDEAILFPVQSFVENRITLPIRVRNQDE---PFQGKIAFIPHFQSLSKQIVKXXXXXXXXXXXXXXXMVGSFRN-PDRKHRVKNATLERIKGCQAIAK--TELDLKSVADAVGADWRXXXXXXXXXXDDINLVLNENCTDEEKAFMTLINWQTVLGFKATGNELNRALRQIGREDVVKSCIGDISFVEDEA 4519
            FLRAA  G   KV E L +  D+N+ N+NGLN+LHLASK GH+++V+ LI   A + A TRK NTA+HIASLAG   +V ILV++GAN+N QS  GFTPLYMAAQENH  VVK+LL +GA+  LST D FTPLAVA+QQGH+  V++LL        ND    ++LP LHIA +KDD  A  LLL   H  DV       S +GFT LH+AA+Y  + VG+LLLE GA V+Y +++N++ LHVA KWGR  M  +LL   A ++  T+D + PLHCAA  GH  +  LL+   A  + +TKNGL P                                 LH+ A   H  + +  +++ S + N  +L+  TPLHI+   N ++V E L+K+                                 GAN +   + G   LH+AA+ N  + V +L+ N   +D Q                                 T   ++ LHIA+  G E +A  L+++N +  +  +   T LH+A+ + +  +V  L E G  VD + K   T L +A    +  +   L+  GAS   +   G T LH A           N  +I    A  + +F      + D N  ++ G + LHL+A  G  EI  LL++ G+D+   + NG T +H+  + ++  V  +L  + +  +   +  +  ++P+H + +FG ++    L+ +  D   V EK R       T LH A QQ   + VR LLEN A  N +   G +   +A+ +   +++  L            TT D+ Y  Q  E  +    ET++ +S +E +       +  + +   ++   L  +T +  I   +  L+ +  L        I    +   +      P +  S I+++N++                        P D  +    R  + P+N+G                            FL+SFLVDARGG M+  R   ++I VPP  A  P R+ C  LR + +A+ P +++ +  ASRIL++  + ++F  P+++E+P+ A L+  +REIVIL+ + D   WK+H    TE+ ++      +  E +  +D L++ RI RI+T+D P YF+++++ +++V+ +GP+GG I S    R++  FP G+L K I++ ++ Q V   ++  + G+  ++++SPI+TVEP+RRKF   I + + LP+           G    +   L+LL SI+       WED+T +T+L      + ++ +T +SAR WL+      + + +A ++Y      PY+ KF  +ARR    E Q+R   +TDD  DKTLE QE F+LIA   +VEV+      +E +GN+V +TKS + +      F ENR+   ++ R+ D+     +G+I F+   +  S  +  P       +   + +  G  +  P  K   K+ T    +   A+ K   E   ++V   +GADW  L   LE+   DI  +       E K   TL  W  +    A  + L++ALRQIGR+D+V+S    I++ E +A
Sbjct:   37 FLRAARAGDLEKVLELLRAGTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLL-------ENDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDV------TSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDR-SADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAA--------KKNQMEI----ASTLLQF------KADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEIN---SKTNAGYTPLHVACHFGQLNMVKFLVENGAD---VGEKTRA----SYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIAQRLGYVSVVETLRTVTETTVITETTTVDERYKPQNPEAMN----ETMFSESEDEGQAAEHEAVAAHEKDFSDNLTQGLQDSTGVHMIHTGEQLLQRSQELENGGAIPKINSGGMSPEKEFAKIAPVATSSPIATSNSQSFGIAPRAGSISGQFQQQPLHGAGPEDNLEELVRRAQNHPINAGNYDNGGVAMLENGHADNVPIGHHVTQPSFLISFLVDARGGAMRGCRHSGVRIIVPPRKASQPIRVTCRYLRKDKLAHPPPLSEGEELASRILEMAPAGAKFLGPVILEVPHFASLRDREREIVILRSD-DGQHWKEHQLEATEDAVQEVLNESFDAEDLAQLDDLQTPRITRILTSDFPMYFAVVTRVRQEVHCVGPEGGVIISSVVPRVQAIFPDGSLTKTIKVSVQAQPVPQEMVTRLHGN--RVAVSPIVTVEPRRRKFHKPITLCIPLPQSNNRGMLTQYSGQQGQEPPTLRLLCSITGGSAPAQWEDITGTTQLTF--TGDEVSFTTTVSARFWLMDCQTPRDAARMAQEVYNEAISIPYMAKFAVFARRTFPVEGQLRVFCMTDDKEDKTLEKQEHFKLIAKSRDVEVLKGKHQFLEFSGNLVPITKSGDQLSLFFLPFQENRLAFMVKTRSNDDNEAATEGRIGFMAEPKIRSDAL--PPQQPICTLAISLPEYTGEIKTAPPPK---KDLTPFEQRYGSALEKDLPEFVHQNVLKGIGADWPRLGRALEVPHRDIQHIRQNYPGQECK--NTLKIWIHLKKEDANQDNLDQALRQIGRDDIVRS----IAYGEPDA 1581          

HSP 2 Score: 239.965 bits (611), Expect = 5.928e-63
Identity = 193/726 (26.58%), Postives = 326/726 (44.90%), Query Frame = 2
Query:  521 GFTPLYMAAQENHVGVVKFLLDNGADINLSTTDNFTPLAVAIQQGHEETVSILLNKSNFLNSNDISNDIKLPPLHIATRKDDYHAVLLLLHHQEDVQAALTQASLNGFTALHVAAYYNSDKVGRLLLENGAPVDYTSKNNVTALHVAAKWGRNKMVKVLLEFNA-----------------------------NVEMSTRDGIRPLHCAASQGHRDICALLIEHKANCN---------------------------------TRTKNGLVPLHMVAQGNHSELVEFFINQNS--------------------------------VNVNETSLDFLTPLHISSHCNNVEVAEALIKHGANVNDRALNGFVALHIAAKQNHVEFVEMLMSNLCMIDTQTESGFTALHIASIIGSESIAKKLVENNCEIDIPDQFDRTSLHMATIFNHFNIVVYLKEHGGSVDKQMKTGETCLMLAIKSEHKAIVEYLINQGASMSVSDSWGLTALHWATLVVRENILNSNCTDININEAIEIFKFVLDGCSRFDINRTTKNGISSLHLAADCGCLEIVHLLLDKGADINIISINGTTPLHIACKXXXXXXXXXXXXXXXXXXXTMAYVSCPWSPMHFSSYFGSVDSTILLISHENDQTSVREKLRQRTPNGNTCLHLAVQQLQTDIVRVLLENDADFNLENEDGLSAFDMAKIVDDETIINLLGIDTTEMMTTDDKVY 2416
            G      AA+   +  V  LL  G DIN S  +    L +A ++GH E V  L+ +   +++     +     LHIA+       V +L+ +  +V       S+NGFT L++AA  N ++V + LL++GA    ++++  T L VA + G +++V VLLE ++                             N +++++ G  PLH AA  GH ++  LL+E  AN N                                 +RTK+ L PLH  A+  H ++V+  + Q +                                  V++ ++D+LTPLH+++HC +V VA+ L+   A+ N RALNGF  LHIA K+N ++ VE+L+     I+  TESG T LH+A+ +G+ +I   L++     D+      T LH+A   N  ++V  L  +G  VD Q +  +T L +A +  +  IV  L+  GA+ + +     + LH A    +E                E+   +LD  +  D    TK G + LHLA+  G LE+V LLL++G  ++I   N  TPLH+A      N   V +  L   +   A     ++P+H ++    ++    L+  + D  +       ++  G T LHL+ Q+   +I  +L+EN +D   +  +GL+A  +    D   +  +L  +  E+ +  +  Y
Sbjct:   33 GSASFLRAARAGDLEKVLELLRAGTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTA---LHIASLAGQSLIVTILVENGANVNV----QSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQE----------------EVAGILLDHNA--DKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAH---YNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNA-------KSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGY 723          
BLAST of Ankyrin-2 vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 679.478 bits (1752), Expect = 0.000e+0
Identity = 494/1607 (30.74%), Postives = 783/1607 (48.72%), Query Frame = 2
Query:  236 FLRAAHNGYFSKVQEALNSNIDVNSCNSNGLNALHLASKGGHADIVQFLIDNGADIGAKTRKNNTAIHIASLAGSLEVVKILVKHGANINEQSQTGFTPLYMAAQENHVGVVKFLLDNGADINLSTTDNFTPLAVAIQQGHEETVSILLNKSNFLNSNDISNDIKLPPLHIATRKDDYHAVLLLLH--HQEDVQAALTQASLNGFTALHVAAYYNSDKVGRLLLENGAPVDYTSKNNVTALHVAAKWGRNKMVKVLLEFNANVEMSTRDGIRPLHCAASQGHRDICALLIEHKANCNTRTKNGLVP---------------------------------LHMVAQGNHSELVEFFINQNSVNVNETSLDFLTPLHISSHCNNVEVAEALIKH---------------------------------GANVNDRALNGFVALHIAAKQNHVEFVEMLMSNLCMIDTQ---------------------------------TESGFTALHIASIIGSESIAKKLVENNCEIDIPDQFDRTSLHMATIFNHFNIVVYLKEHGGSVDKQMKTGETCLMLAIKSEHKAIVEYLINQGASMSVSDSWGLTALHWATLVVRENILNSNCTDININEAIEIFKFVLDGCSRFDINRTTKNGISSLHLAADCGCLEIVHLLLDKGADINIISINGTTPLHIACKXXXXXXXXXXXXXXXXXXXTMAYVSCPWSPMHFSSYFGSVDSTILLISHENDQTSVREKLRQRTPNGNTCLHLAVQQLQTDIVRVLLENDADFNLENEDGLSAFDMAKIVDDETIINLL----GIDTTEMMTTDDKVYLFQREEFSDEEQLETLYMDSLNELEFFGIGKNSGEKCELQLSIMSLLDYATTIDSIRRADMSLKINNSLNR---YRNITLSEIKTRELLIAAQPASMISTISSTNTE----------------------MSPFDVEKWDFHRVTDLPVNSG----------------------------FLVSFLVDARGGYMQAQRMPQMKIFVPPDAAPAPTRIICHLLRPEGVANLPGMNDCDGFASRILQIHSSCSRFQKPILIEMPYIALLKSNDREIVILKKNADSDTWKKHSNTFTEETLKAEFGSLY--ESITPVDQLESNRICRIITTDVPTYFSLISQFQRDVNMIGPDGGYIESKTDKRIKLTFPQGALMKKIQIGLEVQHVDPGIINHVVGDNHKISLSPIITVEPKRRKFRDLIEIQMGLPK-----------GVTKNDIQDLKLLFSIS--EYITDWEDVTSSTELVLLENTNCMAHSTKISARVWLIYAPNVPNISELANKIYALHCPTPYVGKFLSYARRHDQEECQIRCLLITDDTPDKTLECQESFELIATGPEVEVINKLQYQIECAGNIVAVTKSDEAILFPVQSFVENRITLPIRVRNQDE---PFQGKIAFIPHFQSLSKQIVKXXXXXXXXXXXXXXXMVGSFRN-PDRKHRVKNATLERIKGCQAIAK--TELDLKSVADAVGADWRXXXXXXXXXXDDINLVLNENCTDEEKAFMTLINWQTVLGFKATGNELNRALRQIGREDVVKSCIGDISFVEDEA 4519
            FLRAA  G   KV E L +  D+N+ N+NGLN+LHLASK GH+++V+ LI   A + A TRK NTA+HIASLAG   +V ILV++GAN+N QS  GFTPLYMAAQENH  VVK+LL +GA+  LST D FTPLAVA+QQGH+  V++LL        ND    ++LP LHIA +KDD  A  LLL   H  DV       S +GFT LH+AA+Y  + VG+LLLE GA V+Y +++N++ LHVA KWGR  M  +LL   A ++  T+D + PLHCAA  GH  +  LL+   A  + +TKNGL P                                 LH+ A   H  + +  +++ S + N  +L+  TPLHI+   N ++V E L+K+                                 GAN +   + G   LH+AA+ N  + V +L+ N   +D Q                                 T   ++ LHIA+  G E +A  L+++N +  +  +   T LH+A+ + +  +V  L E G  VD + K   T L +A    +  +   L+  GAS   +   G T LH A           N  +I    A  + +F      + D N  ++ G + LHL+A  G  EI  LL++ G+D+   + NG T +H+  + ++  V  +L  + +  +   +  +  ++P+H + +FG ++    L+ +  D   V EK R       T LH A QQ   + VR LLEN A  N +   G +   +A+ +   +++  L            TT D+ Y  Q  E  +    ET++ +S +E +       +  + +   ++   L  +T +  I   +  L+ +  L        I    +   +      P +  S I+++N++                        P D  +    R  + P+N+G                            FL+SFLVDARGG M+  R   ++I VPP  A  P R+ C  LR + +A+ P +++ +  ASRIL++  + ++F  P+++E+P+ A L+  +REIVIL+ + D   WK+H    TE+ ++      +  E +  +D L++ RI RI+T+D P YF+++++ +++V+ +GP+GG I S    R++  FP G+L K I++ ++ Q V   ++  + G+  ++++SPI+TVEP+RRKF   I + + LP+           G    +   L+LL SI+       WED+T +T+L      + ++ +T +SAR WL+      + + +A ++Y      PY+ KF  +ARR    E Q+R   +TDD  DKTLE QE F+LIA   +VEV+      +E +GN+V +TKS + +      F ENR+   ++ R+ D+     +G+I F+   +  S  +          +   + +  G  +  P  K   K+ T    +   A+ K   E   ++V   +GADW  L   LE+   DI  +       E K   TL  W  +    A  + L++ALRQIGR+D+V+S    I++ E +A
Sbjct:   37 FLRAARAGDLEKVLELLRAGTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLL-------ENDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDV------TSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDR-SADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAA--------KKNQMEI----ASTLLQF------KADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEIN---SKTNAGYTPLHVACHFGQLNMVKFLVENGAD---VGEKTRA----SYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIAQRLGYVSVVETLRTVTETTVITETTTVDERYKPQNPEAMN----ETMFSESEDEGQAAEHEAVAAHEKDFSDNLTQGLQDSTGVHMIHTGEQLLQRSQELENGGAIPKINSGGMSPEKEFAKIAPVATSSPIATSNSQSFGIAPRAGSISGQFQQQPLHGAGPEDNLEELVRRAQNHPINAGNYDNGGVAMLENGHADNVPIGHHVTQPSFLISFLVDARGGAMRGCRHSGVRIIVPPRKASQPIRVTCRYLRKDKLAHPPPLSEGEELASRILEMAPAGAKFLGPVILEVPHFASLRDREREIVILRSD-DGQHWKEHQLEATEDAVQEVLNESFDAEDLAQLDDLQTPRITRILTSDFPMYFAVVTRVRQEVHCVGPEGGVIISSVVPRVQAIFPDGSLTKTIKVSVQAQPVPQEMVTRLHGN--RVAVSPIVTVEPRRRKFHKPITLCIPLPQSNNRGMLTQYSGQQGQEPPTLRLLCSITGGSAPAQWEDITGTTQLTF--TGDEVSFTTTVSARFWLMDCQTPRDAARMAQEVYNEAISIPYMAKFAVFARRTFPVEGQLRVFCMTDDKEDKTLEKQEHFKLIAKSRDVEVLKGKHQFLEFSGNLVPITKSGDQLSLFFLPFQENRLAFMVKTRSNDDNEAATEGRIGFMAEPKIRSDALPP--QQPICTLAISLPEYTGEIKTAPPPK---KDLTPFEQRYGSALEKDLPEFVHQNVLKGIGADWPRLGRALEVPHRDIQHIRQNYPGQECK--NTLKIWIHLKKEDANQDNLDQALRQIGRDDIVRS----IAYGEPDA 1581          

HSP 2 Score: 239.195 bits (609), Expect = 1.023e-62
Identity = 193/726 (26.58%), Postives = 326/726 (44.90%), Query Frame = 2
Query:  521 GFTPLYMAAQENHVGVVKFLLDNGADINLSTTDNFTPLAVAIQQGHEETVSILLNKSNFLNSNDISNDIKLPPLHIATRKDDYHAVLLLLHHQEDVQAALTQASLNGFTALHVAAYYNSDKVGRLLLENGAPVDYTSKNNVTALHVAAKWGRNKMVKVLLEFNA-----------------------------NVEMSTRDGIRPLHCAASQGHRDICALLIEHKANCN---------------------------------TRTKNGLVPLHMVAQGNHSELVEFFINQNS--------------------------------VNVNETSLDFLTPLHISSHCNNVEVAEALIKHGANVNDRALNGFVALHIAAKQNHVEFVEMLMSNLCMIDTQTESGFTALHIASIIGSESIAKKLVENNCEIDIPDQFDRTSLHMATIFNHFNIVVYLKEHGGSVDKQMKTGETCLMLAIKSEHKAIVEYLINQGASMSVSDSWGLTALHWATLVVRENILNSNCTDININEAIEIFKFVLDGCSRFDINRTTKNGISSLHLAADCGCLEIVHLLLDKGADINIISINGTTPLHIACKXXXXXXXXXXXXXXXXXXXTMAYVSCPWSPMHFSSYFGSVDSTILLISHENDQTSVREKLRQRTPNGNTCLHLAVQQLQTDIVRVLLENDADFNLENEDGLSAFDMAKIVDDETIINLLGIDTTEMMTTDDKVY 2416
            G      AA+   +  V  LL  G DIN S  +    L +A ++GH E V  L+ +   +++     +     LHIA+       V +L+ +  +V       S+NGFT L++AA  N ++V + LL++GA    ++++  T L VA + G +++V VLLE ++                             N +++++ G  PLH AA  GH ++  LL+E  AN N                                 +RTK+ L PLH  A+  H ++V+  + Q +                                  V++ ++D+LTPLH+++HC +V VA+ L+   A+ N RALNGF  LHIA K+N ++ VE+L+     I+  TESG T LH+A+ +G+ +I   L++     D+      T LH+A   N  ++V  L  +G  VD Q +  +T L +A +  +  IV  L+  GA+ + +     + LH A    +E                E+   +LD  +  D    TK G + LHLA+  G LE+V LLL++G  ++I   N  TPLH+A      N   V +  L   +   A     ++P+H ++    ++    L+  + D  +       ++  G T LHL+ Q+   +I  +L+EN +D   +  +GL+A  +    D   +  +L  +  E+ +  +  Y
Sbjct:   33 GSASFLRAARAGDLEKVLELLRAGTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTA---LHIASLAGQSLIVTILVENGANVNV----QSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQE----------------EVAGILLDHNA--DKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAH---YNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNA-------KSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGY 723          
BLAST of Ankyrin-2 vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 679.478 bits (1752), Expect = 0.000e+0
Identity = 494/1607 (30.74%), Postives = 783/1607 (48.72%), Query Frame = 2
Query:  236 FLRAAHNGYFSKVQEALNSNIDVNSCNSNGLNALHLASKGGHADIVQFLIDNGADIGAKTRKNNTAIHIASLAGSLEVVKILVKHGANINEQSQTGFTPLYMAAQENHVGVVKFLLDNGADINLSTTDNFTPLAVAIQQGHEETVSILLNKSNFLNSNDISNDIKLPPLHIATRKDDYHAVLLLLH--HQEDVQAALTQASLNGFTALHVAAYYNSDKVGRLLLENGAPVDYTSKNNVTALHVAAKWGRNKMVKVLLEFNANVEMSTRDGIRPLHCAASQGHRDICALLIEHKANCNTRTKNGLVP---------------------------------LHMVAQGNHSELVEFFINQNSVNVNETSLDFLTPLHISSHCNNVEVAEALIKH---------------------------------GANVNDRALNGFVALHIAAKQNHVEFVEMLMSNLCMIDTQ---------------------------------TESGFTALHIASIIGSESIAKKLVENNCEIDIPDQFDRTSLHMATIFNHFNIVVYLKEHGGSVDKQMKTGETCLMLAIKSEHKAIVEYLINQGASMSVSDSWGLTALHWATLVVRENILNSNCTDININEAIEIFKFVLDGCSRFDINRTTKNGISSLHLAADCGCLEIVHLLLDKGADINIISINGTTPLHIACKXXXXXXXXXXXXXXXXXXXTMAYVSCPWSPMHFSSYFGSVDSTILLISHENDQTSVREKLRQRTPNGNTCLHLAVQQLQTDIVRVLLENDADFNLENEDGLSAFDMAKIVDDETIINLL----GIDTTEMMTTDDKVYLFQREEFSDEEQLETLYMDSLNELEFFGIGKNSGEKCELQLSIMSLLDYATTIDSIRRADMSLKINNSLNR---YRNITLSEIKTRELLIAAQPASMISTISSTNTE----------------------MSPFDVEKWDFHRVTDLPVNSG----------------------------FLVSFLVDARGGYMQAQRMPQMKIFVPPDAAPAPTRIICHLLRPEGVANLPGMNDCDGFASRILQIHSSCSRFQKPILIEMPYIALLKSNDREIVILKKNADSDTWKKHSNTFTEETLKAEFGSLY--ESITPVDQLESNRICRIITTDVPTYFSLISQFQRDVNMIGPDGGYIESKTDKRIKLTFPQGALMKKIQIGLEVQHVDPGIINHVVGDNHKISLSPIITVEPKRRKFRDLIEIQMGLPK-----------GVTKNDIQDLKLLFSIS--EYITDWEDVTSSTELVLLENTNCMAHSTKISARVWLIYAPNVPNISELANKIYALHCPTPYVGKFLSYARRHDQEECQIRCLLITDDTPDKTLECQESFELIATGPEVEVINKLQYQIECAGNIVAVTKSDEAILFPVQSFVENRITLPIRVRNQDE---PFQGKIAFIPHFQSLSKQIVKXXXXXXXXXXXXXXXMVGSFRN-PDRKHRVKNATLERIKGCQAIAK--TELDLKSVADAVGADWRXXXXXXXXXXDDINLVLNENCTDEEKAFMTLINWQTVLGFKATGNELNRALRQIGREDVVKSCIGDISFVEDEA 4519
            FLRAA  G   KV E L +  D+N+ N+NGLN+LHLASK GH+++V+ LI   A + A TRK NTA+HIASLAG   +V ILV++GAN+N QS  GFTPLYMAAQENH  VVK+LL +GA+  LST D FTPLAVA+QQGH+  V++LL        ND    ++LP LHIA +KDD  A  LLL   H  DV       S +GFT LH+AA+Y  + VG+LLLE GA V+Y +++N++ LHVA KWGR  M  +LL   A ++  T+D + PLHCAA  GH  +  LL+   A  + +TKNGL P                                 LH+ A   H  + +  +++ S + N  +L+  TPLHI+   N ++V E L+K+                                 GAN +   + G   LH+AA+ N  + V +L+ N   +D Q                                 T   ++ LHIA+  G E +A  L+++N +  +  +   T LH+A+ + +  +V  L E G  VD + K   T L +A    +  +   L+  GAS   +   G T LH A           N  +I    A  + +F      + D N  ++ G + LHL+A  G  EI  LL++ G+D+   + NG T +H+  + ++  V  +L  + +  +   +  +  ++P+H + +FG ++    L+ +  D   V EK R       T LH A QQ   + VR LLEN A  N +   G +   +A+ +   +++  L            TT D+ Y  Q  E  +    ET++ +S +E +       +  + +   ++   L  +T +  I   +  L+ +  L        I    +   +      P +  S I+++N++                        P D  +    R  + P+N+G                            FL+SFLVDARGG M+  R   ++I VPP  A  P R+ C  LR + +A+ P +++ +  ASRIL++  + ++F  P+++E+P+ A L+  +REIVIL+ + D   WK+H    TE+ ++      +  E +  +D L++ RI RI+T+D P YF+++++ +++V+ +GP+GG I S    R++  FP G+L K I++ ++ Q V   ++  + G+  ++++SPI+TVEP+RRKF   I + + LP+           G    +   L+LL SI+       WED+T +T+L      + ++ +T +SAR WL+      + + +A ++Y      PY+ KF  +ARR    E Q+R   +TDD  DKTLE QE F+LIA   +VEV+      +E +GN+V +TKS + +      F ENR+   ++ R+ D+     +G+I F+   +  S  +          +   + +  G  +  P  K   K+ T    +   A+ K   E   ++V   +GADW  L   LE+   DI  +       E K   TL  W  +    A  + L++ALRQIGR+D+V+S    I++ E +A
Sbjct:   37 FLRAARAGDLEKVLELLRAGTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLL-------ENDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDV------TSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDR-SADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAA--------KKNQMEI----ASTLLQF------KADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEIN---SKTNAGYTPLHVACHFGQLNMVKFLVENGAD---VGEKTRA----SYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIAQRLGYVSVVETLRTVTETTVITETTTVDERYKPQNPEAMN----ETMFSESEDEGQAAEHEAVAAHEKDFSDNLTQGLQDSTGVHMIHTGEQLLQRSQELENGGAIPKINSGGMSPEKEFAKIAPVATSSPIATSNSQSFGIAPRAGSISGQFQQQPLHGAGPEDNLEELVRRAQNHPINAGNYDNGGVAMLENGHADNVPIGHHVTQPSFLISFLVDARGGAMRGCRHSGVRIIVPPRKASQPIRVTCRYLRKDKLAHPPPLSEGEELASRILEMAPAGAKFLGPVILEVPHFASLRDREREIVILRSD-DGQHWKEHQLEATEDAVQEVLNESFDAEDLAQLDDLQTPRITRILTSDFPMYFAVVTRVRQEVHCVGPEGGVIISSVVPRVQAIFPDGSLTKTIKVSVQAQPVPQEMVTRLHGN--RVAVSPIVTVEPRRRKFHKPITLCIPLPQSNNRGMLTQYSGQQGQEPPTLRLLCSITGGSAPAQWEDITGTTQLTF--TGDEVSFTTTVSARFWLMDCQTPRDAARMAQEVYNEAISIPYMAKFAVFARRTFPVEGQLRVFCMTDDKEDKTLEKQEHFKLIAKSRDVEVLKGKHQFLEFSGNLVPITKSGDQLSLFFLPFQENRLAFMVKTRSNDDNEAATEGRIGFMAEPKIRSDALPP--QQPICTLAISLPEYTGEIKTAPPPK---KDLTPFEQRYGSALEKDLPEFVHQNVLKGIGADWPRLGRALEVPHRDIQHIRQNYPGQECK--NTLKIWIHLKKEDANQDNLDQALRQIGRDDIVRS----IAYGEPDA 1581          

HSP 2 Score: 239.195 bits (609), Expect = 1.023e-62
Identity = 193/726 (26.58%), Postives = 326/726 (44.90%), Query Frame = 2
Query:  521 GFTPLYMAAQENHVGVVKFLLDNGADINLSTTDNFTPLAVAIQQGHEETVSILLNKSNFLNSNDISNDIKLPPLHIATRKDDYHAVLLLLHHQEDVQAALTQASLNGFTALHVAAYYNSDKVGRLLLENGAPVDYTSKNNVTALHVAAKWGRNKMVKVLLEFNA-----------------------------NVEMSTRDGIRPLHCAASQGHRDICALLIEHKANCN---------------------------------TRTKNGLVPLHMVAQGNHSELVEFFINQNS--------------------------------VNVNETSLDFLTPLHISSHCNNVEVAEALIKHGANVNDRALNGFVALHIAAKQNHVEFVEMLMSNLCMIDTQTESGFTALHIASIIGSESIAKKLVENNCEIDIPDQFDRTSLHMATIFNHFNIVVYLKEHGGSVDKQMKTGETCLMLAIKSEHKAIVEYLINQGASMSVSDSWGLTALHWATLVVRENILNSNCTDININEAIEIFKFVLDGCSRFDINRTTKNGISSLHLAADCGCLEIVHLLLDKGADINIISINGTTPLHIACKXXXXXXXXXXXXXXXXXXXTMAYVSCPWSPMHFSSYFGSVDSTILLISHENDQTSVREKLRQRTPNGNTCLHLAVQQLQTDIVRVLLENDADFNLENEDGLSAFDMAKIVDDETIINLLGIDTTEMMTTDDKVY 2416
            G      AA+   +  V  LL  G DIN S  +    L +A ++GH E V  L+ +   +++     +     LHIA+       V +L+ +  +V       S+NGFT L++AA  N ++V + LL++GA    ++++  T L VA + G +++V VLLE ++                             N +++++ G  PLH AA  GH ++  LL+E  AN N                                 +RTK+ L PLH  A+  H ++V+  + Q +                                  V++ ++D+LTPLH+++HC +V VA+ L+   A+ N RALNGF  LHIA K+N ++ VE+L+     I+  TESG T LH+A+ +G+ +I   L++     D+      T LH+A   N  ++V  L  +G  VD Q +  +T L +A +  +  IV  L+  GA+ + +     + LH A    +E                E+   +LD  +  D    TK G + LHLA+  G LE+V LLL++G  ++I   N  TPLH+A      N   V +  L   +   A     ++P+H ++    ++    L+  + D  +       ++  G T LHL+ Q+   +I  +L+EN +D   +  +GL+A  +    D   +  +L  +  E+ +  +  Y
Sbjct:   33 GSASFLRAARAGDLEKVLELLRAGTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTA---LHIASLAGQSLIVTILVENGANVNV----QSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQE----------------EVAGILLDHNA--DKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAH---YNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNA-------KSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGY 723          
BLAST of Ankyrin-2 vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 486.108 bits (1250), Expect = 2.087e-140
Identity = 285/729 (39.09%), Postives = 416/729 (57.06%), Query Frame = 2
Query:  236 FLRAAHNGYFSKVQEALNSNIDVNSCNSNGLNALHLASKGGHADIVQFLIDNGADIGAKTRKNNTAIHIASLAGSLEVVKILVKHGANINEQSQTGFTPLYMAAQENHVGVVKFLLDNGADINLSTTDNFTPLAVAIQQGHEETVSILLNKSNFLNSNDISNDIKLPPLHIATRKDDYHAVLLLLH--HQEDVQAALTQASLNGFTALHVAAYYNSDKVGRLLLENGAPVDYTSKNNVTALHVAAKWGRNKMVKVLLEFNANVEMSTRDGIRPLHCAASQGHRDICALLIEHKANCNTRTKNGLVPLHMVAQGNHSELVEFFINQNSVNVNETSLDFLTPLHISSHCNNVEVAEALIKHGANVNDRALNGFVALHIAAKQNHVEFVEMLMSNLCMIDTQTESGFTALHIASIIGSESIAKKLVENNCEIDIPDQFDRTSLHMATIFNHFNIVVYLKEHGGSVDKQMKTGETCLMLAIKSEHKAIVEYLINQGASMSVSDSWGLTALHWATLVVRENILNSNCTDININEAIEIFKFVLDGCSRFDINRTTKNGISSLHLAADCGCLEIVHLLLDKGADINIISINGTTPLHIACKXXXXXXXXXXXXXXXXXXXTMAYVSCPWSPMHFSSYFGSVDSTILLISHENDQTSVREKLRQRTPNGNTCLHLAVQQLQTDIVRVLLENDADFNLENEDGLSAFDMAKIVDDETIINLLGIDTTEMMTTDDKVY 2416
            FLRAA  G   KV E L +  D+N+ N+NGLN+LHLASK GH+++V+ LI   A + A TRK NTA+HIASLAG   +V ILV++GAN+N QS  GFTPLYMAAQENH  VVK+LL +GA+  LST D FTPLAVA+QQGH+  V++LL        ND    ++LP LHIA +KDD  A  LLL   H  DV       S +GFT LH+AA+Y  + VG+LLLE GA V+Y +++N++ LHVA KWGR  M  +LL   A ++  T+D + PLHCAA  GH  +  LL+   A  + +TKNGL PLHM AQG+H +     +   +  V++ ++D+LTPLH+++HC +V VA+ L+   A+ N RALNGF  LHIA K+N ++ VE+L+     I+  TESG T LH+A+ +G+ +I   L++     D+      T LH+A   N  ++V  L  +G  VD Q +  +T L +A +  +  IV  L+  GA+ + +     + LH A    +E                E+   +LD  +  D    TK G + LHLA+  G LE+V LLL++G  ++I   N  TPLH+A      N   V +  L   +   A     ++P+H ++    ++    L+  + D  +       ++  G T LHL+ Q+   +I  +L+EN +D   +  +GL+A  +    D   +  +L  +  E+ +  +  Y
Sbjct:   37 FLRAARAGDLEKVLELLRAGTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLL-------ENDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDV------TSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRA-PVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQE----------------EVAGILLDHNA--DKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAH---YNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNA-------KSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGY 723          

HSP 2 Score: 298.516 bits (763), Expect = 5.093e-81
Identity = 194/596 (32.55%), Postives = 324/596 (54.36%), Query Frame = 2
Query: 2795 FLVSFLVDARGGYMQAQRMPQMKIFVPPDAAPAPTRIICHLLRPEGVANLPGMNDCDGFASRILQIHSSCSRFQKPILIEMPYIALLKSNDREIVILKKNADSDTWKKHSNTFTEETLKAEFGSLY--ESITPVDQLESNRICRIITTDVPTYFSLISQFQRDVNMIGPDGGYIESKTDKRIKLTFPQGALMKKIQIGLEVQHVDPGIINHVVGDNHKISLSPIITVEPKRRKFRDLIEIQMGLPK-----------GVTKNDIQDLKLLFSIS--EYITDWEDVTSSTELVLLENTNCMAHSTKISARVWLIYAPNVPNISELANKIYALHCPTPYVGKFLSYARRHDQEECQIRCLLITDDTPDKTLECQESFELIATGPEVEVINKLQYQIECAGNIVAVTKSDEAILFPVQSFVENRITLPIRVRNQDE---PFQGKIAFIPHFQSLSKQIVKXXXXXXXXXXXXXXXMVGSFRN-PDRKHRVKNATLERIKGCQAIAK--TELDLKSVADAVGADWRXXXXXXXXXXDDINLVLNENCTDEEKAFMTLINWQTVLGFKATGNELNRALRQIGREDVVKSCIGDISFVEDEA 4519
            FL+SFLVDARGG M+  R   ++I VPP  A  P R+ C  LR + +A+ P +++ +  ASRIL++  + ++F  P+++E+P+ A L+  +REIVIL+ + D   WK+H    TE+ ++      +  E +  +D L++ RI RI+T+D P YF+++++ +++V+ +GP+GG I S    R++  FP G+L K I++ ++ Q V   ++  + G+  ++++SPI+TVEP+RRKF   I + + LP+           G    +   L+LL SI+       WED+T +T+L      + ++ +T +SAR WL+      + + +A ++Y      PY+ KF  +ARR    E Q+R   +TDD  DKTLE QE F+LIA   +VEV+      +E +GN+V +TKS + +      F ENR+   ++ R+ D+     +G+I F+   +  S  +  P       +   + +  G  +  P  K   K+ T    +   A+ K   E   ++V   +GADW  L   LE+   DI  +       E K   TL  W  +    A  + L++ALRQIGR+D+V+S    I++ E +A
Sbjct: 1008 FLISFLVDARGGAMRGCRHSGVRIIVPPRKASQPIRVTCRYLRKDKLAHPPPLSEGEELASRILEMAPAGAKFLGPVILEVPHFASLRDREREIVILRSD-DGQHWKEHQLEATEDAVQEVLNESFDAEDLAQLDDLQTPRITRILTSDFPMYFAVVTRVRQEVHCVGPEGGVIISSVVPRVQAIFPDGSLTKTIKVSVQAQPVPQEMVTRLHGN--RVAVSPIVTVEPRRRKFHKPITLCIPLPQSNNRGMLTQYSGQQGQEPPTLRLLCSITGGSAPAQWEDITGTTQLTF--TGDEVSFTTTVSARFWLMDCQTPRDAARMAQEVYNEAISIPYMAKFAVFARRTFPVEGQLRVFCMTDDKEDKTLEKQEHFKLIAKSRDVEVLKGKHQFLEFSGNLVPITKSGDQLSLFFLPFQENRLAFMVKTRSNDDNEAATEGRIGFMAEPKIRSDAL--PPQQPICTLAISLPEYTGEIKTAPPPK---KDLTPFEQRYGSALEKDLPEFVHQNVLKGIGADWPRLGRALEVPHRDIQHIRQNYPGQECK--NTLKIWIHLKKEDANQDNLDQALRQIGRDDIVRS----IAYGEPDA 1587          

HSP 3 Score: 279.641 bits (714), Expect = 4.032e-75
Identity = 202/684 (29.53%), Postives = 323/684 (47.22%), Query Frame = 2
Query:  326 LNALHLASKGGHADIVQFLIDNGADIGAKTRKNNTAIHIASLAGSLEVVKILVKHGANINEQSQTGFTPLYMAAQENHVGVVKFLLDNGADINLSTTDNFTPLAVAIQQGHEETVSILLNKSNFLNSNDISNDIK--LPPLHIATRKDDYHAVLLLLHHQEDVQAALTQASLNGFTALHVAAYYNSDKVGRLLLENGAPVDYTSKNNVTALHVAAKWGRNKMVKVLLEFNANVEMSTRDGIRPLHCAASQGHRDICALLIEHKANCNTRTKNGLVPLHMVAQGNHSELVEFFINQNSVNVNETSLDFLTPLHISSHCNNVEVAEALIKHGANVNDRALNGFVALHIAAKQNHVEFVEMLMSNLCMIDTQTESGFTALHIASIIGSESIAKKLVENNCEIDIPDQFDRTSLHMATIFNHFNIVVYLKEHGGSVDKQMKTGETCLMLAIKSEHKAIVEYLINQGASMSVSDSWGLTALHWATLVVRENILNSNCTDININEAIEIFKFVLDGCSRFDINRTTKNGISSLHLAADCGCLEIVHLLLDKGADINIISINGTTPLHIACKXXXXXXXXXXXXXXXXXXXTMAYVSCPWSPMHFSSYFGSVDSTILLISHENDQTSVREKLRQRTPNGNTCLHLAVQQLQTDIVRVLLENDADFNLENEDGLSAFDMAKIVDDETIINLL 2371
            L ALH+A+K         L+ N  +    ++   T +HIA+  G   V ++L++ GAN+N Q++   +PL++A +     +   LL  GA I+  T D  TPL  A + GH++ V +L+     +    IS   K  L PLH+A + D   A   LL+H+    A +   +++  T LHVAA+    +V +LLL+  A  +  + N  T LH+A K  R K+V++LL++ A +E +T  G+ PLH AA  G  +I   L++  AN +  T  G  PLH+ A+ N +++V   I +N   V+  + +  TPLHI+S   N ++   L++ GAN N    + +  LHIAAK+   E   +L+ +       T+ GFT LH+AS  G+  + + L+E    +DI  +   T LH+A  +N+  + + L E+G S     K G T L +A K     I   L+   A  +     G T LH   L  +E                EI   +++  S  D+     NG++++HL A    + +  +L + GA+IN  +  G TPLH+AC                                    +FG ++    L+ +  D   V EK R       T LH A QQ   + VR LLEN A  N +   G +   +A+ +   +++  L
Sbjct:  195 LPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLV-----VQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHR----APVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLI-RNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLH---LSAQEG-------------HKEISGLLIENGS--DVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVAC------------------------------------HFGQLNMVKFLVENGAD---VGEKTRA----SYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIAQRLGYVSVVETL 807          

HSP 4 Score: 264.233 bits (674), Expect = 1.884e-70
Identity = 177/596 (29.70%), Postives = 297/596 (49.83%), Query Frame = 2
Query:  245 AAHNGYFSKVQEALNSNIDVNSCNSNGLNALHLASKGGHADIVQFLIDNGADIGAKTRKNNTAIHIASLAGSLEVVKILVKHGANINEQSQTGFTPLYMAAQENHVGVVKFLLDNGADINLSTTDNFTPLAVAIQQGHEETVSILLNKSNFLNSNDISNDIKLPPLHIATRKDDYHAVLLLLHHQEDVQAA----------------------LTQASLN-------GFTALHVAAYYNSDKVGRLLLENGAPVDYTSKNNVTALHVAAKWGRNKMVKVLLEFNANVEMSTRDGIRPLHCAASQGHRDICALLIEHKANCNTRTKNGLVPLHMVAQGNHSELVEFFINQNSVNVNETSLDFLTPLHISSHCNNVEVAEALIKHGANVNDRALNGFVALHIAAKQNHVEFVEMLMSNLCMIDTQTESGFTALHIASIIGSESIAKKLVENNCEIDIPDQFDRTSLHMATIFNHFNIVVYLKEHGGSVDKQMKTGETCLMLAIKSEHKAIVEYLINQGASMSVSDSWGLTALHWATLVVRENILNSNCTDININEAIEIFKFVLDGCSRFDINRTTKNGISSLHLAADCGCLEIVHLL 1945
            AAH G+ +  Q  L    +VN    + ++ LH+A+K G  ++   L+  GA I ++T+   T +H A+ +G  +VV +LV  GA I+ +++ G  PL+MAAQ +HV   + LL + A ++  T D  TPL VA   GH     +LL++S   NS  ++      PLHIA +K+    V LLL ++  ++A                       L Q   N       G T LH+AA  N   V R+L+ NGA VD  ++   T LH+A++ G   +V +LL+  AN   +TRD   PLH AA +G  ++  +L++H A+    TK G  PLH+ ++  + E+V   + + +  V+    + +TPLH+++H NN +VA  L+++GA+    A NG+  LHIAAK+N +E    L+      + ++ +GFT LH+++  G + I+  L+EN  ++        T++H+    +H  +   L  +G  ++ +   G T L +A       +V++L+  GA +        T LH A         ++NC            +++L+  +    N  T  G + L +A   G + +V  L
Sbjct:  234 AAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNG---FTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGT-PVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAA-----QQGHNNC-----------VRYLLENGA--SPNEQTATGQTPLSIAQRLGYVSVVETL 807          
BLAST of Ankyrin-2 vs. Ensembl Fly
Match: Ank (gene:FBgn0011747 transcript:FBtr0089172)

HSP 1 Score: 742.265 bits (1915), Expect = 0.000e+0
Identity = 521/1551 (33.59%), Postives = 795/1551 (51.26%), Query Frame = 2
Query:  236 FLRAAHNGYFSKVQEALNSN--IDVNSCNSNGLNALHLASKGGHADIVQFLIDNGADIGAKTRKNNTAIHIASLAGSLEVVKILVKHGANINEQSQTGFTPLYMAAQENHVGVVKFLLDNGADINLSTTDNFTPLAVAIQQGHEETVSILLNKSNFLNSNDISNDIKLPPLHIATRKDDYHAVLLLLHHQEDVQAALTQASLNGFTALHVAAYYNSDKVGRLLLENGAPVDYTSKNNVTALHVAAKWGRNKMVKVLLEFNANVEMSTRDGIRPLHCAASQGHRDICALLIEHKANCNTRTKNGLVPLHMVAQGNHSELVEFFINQNSVNVNETSLDFLTPLHISSHCNNVEVAEALIKHGANVNDRALNGFVALHIAAKQNHVEFVEMLMSNLCMIDTQTESGFTALHIASIIGSESIAKKLVENNCEIDIP--------------DQFD------------------RTSLHMATIFNHFNIVVYLKEHGGSVDKQMKTGETCLMLAIKSEHKAIVEYLINQGASMSVSDSWGLTALHWATLVVREN---ILNSNCTDININEAIE--------------IFKFVLDGCSRFDINRTTKNGISSLHLAADCGCLEIVHLLLDKGADINIISINGTTPLHIACKXXXXXXXXXXXXXXXXXXXTMAYVSCPWSPMHFSSYFGSVDSTILLISHENDQTSVREKLRQRTPNGNTCLHLAVQQLQTDIVRVLLENDADFNLENEDGLSAFDMAKIVDDETIINLL--GIDTTEMMTTDDKVYLFQREEFSDEEQLETLYMDSLNELEFFGIGKNSGEKCELQLSIMS-------------------LLD-----YATTIDSIRRADMSLKINNSLNRYRNIT-LSEIKTRELLIAAQPASMISTISSTNTEMSPFDVEKWDFHRVTDLPVNSGFLVSFLVDARGGYMQAQRMPQMKIFVPPDAAPAPTRIICHLLRPEGVANLPGMNDCDGFASRILQIHSSCSRFQKPILIEMPYIALLKSNDREIVILKKNADSDTWKKHSNTFTEETLKAEFGSLYESITPVDQLESNRICRIITTDVPTYFSLISQFQRDVNMIGPDGGYIESKTDKRIKLTFPQGALMKKIQIGLEVQHVDPGIINHVVGDNHKISLSPIITVEPKRRKFRDLIEIQMGLPKGVTKNDIQ-----------DLKLLFSISEYIT--DWEDVTSSTELVLLENTNCMAHSTKISARVWLIYAPNVPNISELANKIYALHCPTPYVGKFLSYARRHDQEECQIRCLLITDDTPDKTLECQESFELIATGPEVEVINKLQYQIECAGNIVAVTKSDEAILFPVQSFVENRITLPIRVRNQDEPFQGKIAFIPH---------------------FQSLSKQIVKXXXXXXXXXXXXXXXMVGSFRNPDRKHRVKNATLERI---KGC------QAIAKTELDLKSVADAVGADWRXXXXXXXXXXDDINLVLNEN-CTDEEKAFMTLINWQTVLGFKATGNELNRALRQIGREDVVKSCIGDISFVEDEAE 4522
            FLRAA +G   KV + L+     D+NSCN+NGLNALHLA+K G+ DI   L+  G  I   T+K NTA+HIASLAG  +V+  L+ + AN+N QS  GFTPLYMAAQENH    + LL NGA+ +LST D FTPLAVA+QQGH++ V++LL        ND+   ++LP LHIA +K+D +A  LLL H  D  A +   S  GFT LH+AA+Y +  +  LLL N A V+Y +K+N+T LHVA KWG+  +  +LL   A ++ +TRDG+ PLHCA+  GH ++   L++  A   T+TKNGL  LHM AQG H E     ++ N   V+E ++D+LT LH+++HC +V+VA+ L+ + AN N RALNGF  LHIA K+N ++ VE+L+ +   I   TESG T LH+AS +G  +I   L+++    D+P              +Q D                  +T LH+A+   + NI++ L +HG  ++ Q     + L +A K   + IV+ L+  GA  +     G T LH A    ++N   IL  N   I+     +              I + +L   S    N   +NG  ++H+A     LEI   LL  GAD+NIIS +G +PLH+A +  N +++ +LLE         A      +P+H ++  G V  + +L+ H  +       + +RT NG T LH+A      D+V+  +ENDAD  + +  G +    A       IINLL         +T D    L           +E+L + +   +    I  N G   E +L +M+                   LLD     Y  T D         K  ++ N   ++T +S +  +E+L    P  M S I  T     P +V       +    V+ GFLVSFLVDARGG M+  R   ++I VPP A   PTRI C  ++P+ V N P + + +   SRIL++      F  PI +E+P+   L+ N+REI+IL+ + + ++W++H N + +         + E I   ++  S+RI RI+T +VP +F+++S+ +++V++IGPDGG + S    ++K  FP  AL KKI++GL+ Q VD    + ++G    +++SP++TVEP+RRKF   I + +  PK  T + +             L+LL SIS   T   WEDVT ST L  + ++  +  +T +SAR WLI   N+ +   +A ++Y+     P+  KF+ +A+R  Q E +     +TDD  DKTLE QE F+ +A   ++EV+      +E AGNIV + K  E +    Q F ENR++    +++Q+ P  G+I F+ +                     F++++  + +               +     N +    VK   +++I   K C      + I + ++ L  +   +G+DW  LA  L +   DI+LV  E    D  K  M ++      G   TGN L  AL +IGR D+V+    +  F   + E
Sbjct:   42 FLRAARSGDIKKVMDFLDCGEISDINSCNANGLNALHLAAKDGYVDICCELLRRGIKIDNATKKGNTALHIASLAGQHDVINQLILYNANVNVQSLNGFTPLYMAAQENHDNCCRTLLANGANPSLSTEDGFTPLAVAMQQGHDKIVAVLL-------ENDVRGKVRLPALHIAAKKNDVNAAKLLLQH--DPNADIVSKS--GFTPLHIAAHYGNVDIATLLLNNKADVNYVAKHNITPLHVACKWGKLSLCTLLLCRGAKIDAATRDGLTPLHCASRSGHVEVIKHLLQQNAPILTKTKNGLSALHMAAQGEHDEAAHLLLD-NKAPVDEVTVDYLTALHVAAHCGHVKVAKLLLDYKANPNARALNGFTPLHIACKKNRIKMVELLIKHGANIGATTESGLTPLHVASFMGCINIVIYLLQHEASADLPTIRGETPLHLAARANQADIIRILLRSAKVDAIAREGQTPLHVASRLGNINIIMLLLQHGAEINAQSNDKYSALHIAAKEGQENIVQVLLENGAENNAVTKKGFTPLHLACKYGKQNVVQILLQNGASIDFQGKNDVTPLHVATHYNNPSIVELLLKNGS--SPNLCARNGQCAIHIACKKNYLEIAMQLLQHGADVNIISKSGFSPLHLAAQGGNVDMVQLLLEYGVIS----AAAKNGLTPLHVAAQEGHVLVSQILLEHGAN-------ISERTRNGYTPLHMAAHYGHLDLVKFFIENDADIEMSSNIGYTPLHQAAQQGHIMIINLLLRHKANPNALTKDGNTALHIASNLGYVTVMESLKIVTSTSV----INSNIG-AIEEKLKVMTPELMQETLLSDSDDESCDDLLDHNHYKYMATDDLKANYGQDQKNFDTTNTDHDLTDVSVLNKKEIL----PNEM-SCIELTEIGHKPDNV------VIARSQVHLGFLVSFLVDARGGSMRGYRHNGVRIIVPPKACAEPTRITCRYVKPQRVVNPPPLMEGEALVSRILEMSPVDGMFLSPITLEVPHYGTLRKNEREIIILRSD-NGESWREH-NLYKD--------IIGEDINQTEEFHSDRIVRIVTQNVPHFFAVVSRVRQEVHVIGPDGGTVFSTAVPQVKAIFPPHALTKKIRVGLQAQSVDLVECSKLLGQG--VAVSPVVTVEPRRRKFHKAITLSIPAPKACTNSMVNACYGNGNSSSPTLRLLCSISGGQTRATWEDVTGSTPLSFVRDS--VTFTTTVSARFWLIDCRNIIDAGRMATELYSHLAKVPFYVKFVIFAKRISQTEAKFSVFCMTDDKEDKTLEQQEYFKEVAKSRDIEVLQNQIVYLEFAGNIVPILKKGEQLYTKFQPFCENRLSFSAHIKDQEFP-HGRICFMTYPMVGPDEVPLKPLCTLNISVDFKTITNHLERDNLHSLNDCINAHGKL---NHNENIVFGVKEQQVKKIDITKACIMSSDIKLIHEADVILDDICSHLGSDWPLLANVLGVSQADIDLVKTEFLLNDSVKQSMAMLQLWLEHGGILTGNVLAEALYKIGRSDIVEKSFKNAEFGTHQPE 1533          
BLAST of Ankyrin-2 vs. Ensembl Fly
Match: Ank (gene:FBgn0011747 transcript:FBtr0300497)

HSP 1 Score: 742.265 bits (1915), Expect = 0.000e+0
Identity = 521/1551 (33.59%), Postives = 795/1551 (51.26%), Query Frame = 2
Query:  236 FLRAAHNGYFSKVQEALNSN--IDVNSCNSNGLNALHLASKGGHADIVQFLIDNGADIGAKTRKNNTAIHIASLAGSLEVVKILVKHGANINEQSQTGFTPLYMAAQENHVGVVKFLLDNGADINLSTTDNFTPLAVAIQQGHEETVSILLNKSNFLNSNDISNDIKLPPLHIATRKDDYHAVLLLLHHQEDVQAALTQASLNGFTALHVAAYYNSDKVGRLLLENGAPVDYTSKNNVTALHVAAKWGRNKMVKVLLEFNANVEMSTRDGIRPLHCAASQGHRDICALLIEHKANCNTRTKNGLVPLHMVAQGNHSELVEFFINQNSVNVNETSLDFLTPLHISSHCNNVEVAEALIKHGANVNDRALNGFVALHIAAKQNHVEFVEMLMSNLCMIDTQTESGFTALHIASIIGSESIAKKLVENNCEIDIP--------------DQFD------------------RTSLHMATIFNHFNIVVYLKEHGGSVDKQMKTGETCLMLAIKSEHKAIVEYLINQGASMSVSDSWGLTALHWATLVVREN---ILNSNCTDININEAIE--------------IFKFVLDGCSRFDINRTTKNGISSLHLAADCGCLEIVHLLLDKGADINIISINGTTPLHIACKXXXXXXXXXXXXXXXXXXXTMAYVSCPWSPMHFSSYFGSVDSTILLISHENDQTSVREKLRQRTPNGNTCLHLAVQQLQTDIVRVLLENDADFNLENEDGLSAFDMAKIVDDETIINLL--GIDTTEMMTTDDKVYLFQREEFSDEEQLETLYMDSLNELEFFGIGKNSGEKCELQLSIMS-------------------LLD-----YATTIDSIRRADMSLKINNSLNRYRNIT-LSEIKTRELLIAAQPASMISTISSTNTEMSPFDVEKWDFHRVTDLPVNSGFLVSFLVDARGGYMQAQRMPQMKIFVPPDAAPAPTRIICHLLRPEGVANLPGMNDCDGFASRILQIHSSCSRFQKPILIEMPYIALLKSNDREIVILKKNADSDTWKKHSNTFTEETLKAEFGSLYESITPVDQLESNRICRIITTDVPTYFSLISQFQRDVNMIGPDGGYIESKTDKRIKLTFPQGALMKKIQIGLEVQHVDPGIINHVVGDNHKISLSPIITVEPKRRKFRDLIEIQMGLPKGVTKNDIQ-----------DLKLLFSISEYIT--DWEDVTSSTELVLLENTNCMAHSTKISARVWLIYAPNVPNISELANKIYALHCPTPYVGKFLSYARRHDQEECQIRCLLITDDTPDKTLECQESFELIATGPEVEVINKLQYQIECAGNIVAVTKSDEAILFPVQSFVENRITLPIRVRNQDEPFQGKIAFIPH---------------------FQSLSKQIVKXXXXXXXXXXXXXXXMVGSFRNPDRKHRVKNATLERI---KGC------QAIAKTELDLKSVADAVGADWRXXXXXXXXXXDDINLVLNEN-CTDEEKAFMTLINWQTVLGFKATGNELNRALRQIGREDVVKSCIGDISFVEDEAE 4522
            FLRAA +G   KV + L+     D+NSCN+NGLNALHLA+K G+ DI   L+  G  I   T+K NTA+HIASLAG  +V+  L+ + AN+N QS  GFTPLYMAAQENH    + LL NGA+ +LST D FTPLAVA+QQGH++ V++LL        ND+   ++LP LHIA +K+D +A  LLL H  D  A +   S  GFT LH+AA+Y +  +  LLL N A V+Y +K+N+T LHVA KWG+  +  +LL   A ++ +TRDG+ PLHCA+  GH ++   L++  A   T+TKNGL  LHM AQG H E     ++ N   V+E ++D+LT LH+++HC +V+VA+ L+ + AN N RALNGF  LHIA K+N ++ VE+L+ +   I   TESG T LH+AS +G  +I   L+++    D+P              +Q D                  +T LH+A+   + NI++ L +HG  ++ Q     + L +A K   + IV+ L+  GA  +     G T LH A    ++N   IL  N   I+     +              I + +L   S    N   +NG  ++H+A     LEI   LL  GAD+NIIS +G +PLH+A +  N +++ +LLE         A      +P+H ++  G V  + +L+ H  +       + +RT NG T LH+A      D+V+  +ENDAD  + +  G +    A       IINLL         +T D    L           +E+L + +   +    I  N G   E +L +M+                   LLD     Y  T D         K  ++ N   ++T +S +  +E+L    P  M S I  T     P +V       +    V+ GFLVSFLVDARGG M+  R   ++I VPP A   PTRI C  ++P+ V N P + + +   SRIL++      F  PI +E+P+   L+ N+REI+IL+ + + ++W++H N + +         + E I   ++  S+RI RI+T +VP +F+++S+ +++V++IGPDGG + S    ++K  FP  AL KKI++GL+ Q VD    + ++G    +++SP++TVEP+RRKF   I + +  PK  T + +             L+LL SIS   T   WEDVT ST L  + ++  +  +T +SAR WLI   N+ +   +A ++Y+     P+  KF+ +A+R  Q E +     +TDD  DKTLE QE F+ +A   ++EV+      +E AGNIV + K  E +    Q F ENR++    +++Q+ P  G+I F+ +                     F++++  + +               +     N +    VK   +++I   K C      + I + ++ L  +   +G+DW  LA  L +   DI+LV  E    D  K  M ++      G   TGN L  AL +IGR D+V+    +  F   + E
Sbjct:   42 FLRAARSGDIKKVMDFLDCGEISDINSCNANGLNALHLAAKDGYVDICCELLRRGIKIDNATKKGNTALHIASLAGQHDVINQLILYNANVNVQSLNGFTPLYMAAQENHDNCCRTLLANGANPSLSTEDGFTPLAVAMQQGHDKIVAVLL-------ENDVRGKVRLPALHIAAKKNDVNAAKLLLQH--DPNADIVSKS--GFTPLHIAAHYGNVDIATLLLNNKADVNYVAKHNITPLHVACKWGKLSLCTLLLCRGAKIDAATRDGLTPLHCASRSGHVEVIKHLLQQNAPILTKTKNGLSALHMAAQGEHDEAAHLLLD-NKAPVDEVTVDYLTALHVAAHCGHVKVAKLLLDYKANPNARALNGFTPLHIACKKNRIKMVELLIKHGANIGATTESGLTPLHVASFMGCINIVIYLLQHEASADLPTIRGETPLHLAARANQADIIRILLRSAKVDAIAREGQTPLHVASRLGNINIIMLLLQHGAEINAQSNDKYSALHIAAKEGQENIVQVLLENGAENNAVTKKGFTPLHLACKYGKQNVVQILLQNGASIDFQGKNDVTPLHVATHYNNPSIVELLLKNGS--SPNLCARNGQCAIHIACKKNYLEIAMQLLQHGADVNIISKSGFSPLHLAAQGGNVDMVQLLLEYGVIS----AAAKNGLTPLHVAAQEGHVLVSQILLEHGAN-------ISERTRNGYTPLHMAAHYGHLDLVKFFIENDADIEMSSNIGYTPLHQAAQQGHIMIINLLLRHKANPNALTKDGNTALHIASNLGYVTVMESLKIVTSTSV----INSNIG-AIEEKLKVMTPELMQETLLSDSDDESCDDLLDHNHYKYMATDDLKANYGQDQKNFDTTNTDHDLTDVSVLNKKEIL----PNEM-SCIELTEIGHKPDNV------VIARSQVHLGFLVSFLVDARGGSMRGYRHNGVRIIVPPKACAEPTRITCRYVKPQRVVNPPPLMEGEALVSRILEMSPVDGMFLSPITLEVPHYGTLRKNEREIIILRSD-NGESWREH-NLYKD--------IIGEDINQTEEFHSDRIVRIVTQNVPHFFAVVSRVRQEVHVIGPDGGTVFSTAVPQVKAIFPPHALTKKIRVGLQAQSVDLVECSKLLGQG--VAVSPVVTVEPRRRKFHKAITLSIPAPKACTNSMVNACYGNGNSSSPTLRLLCSISGGQTRATWEDVTGSTPLSFVRDS--VTFTTTVSARFWLIDCRNIIDAGRMATELYSHLAKVPFYVKFVIFAKRISQTEAKFSVFCMTDDKEDKTLEQQEYFKEVAKSRDIEVLQNQIVYLEFAGNIVPILKKGEQLYTKFQPFCENRLSFSAHIKDQEFP-HGRICFMTYPMVGPDEVPLKPLCTLNISVDFKTITNHLERDNLHSLNDCINAHGKL---NHNENIVFGVKEQQVKKIDITKACIMSSDIKLIHEADVILDDICSHLGSDWPLLANVLGVSQADIDLVKTEFLLNDSVKQSMAMLQLWLEHGGILTGNVLAEALYKIGRSDIVEKSFKNAEFGTHQPE 1533          
BLAST of Ankyrin-2 vs. Ensembl Fly
Match: Ank (gene:FBgn0011747 transcript:FBtr0089171)

HSP 1 Score: 742.265 bits (1915), Expect = 0.000e+0
Identity = 521/1551 (33.59%), Postives = 795/1551 (51.26%), Query Frame = 2
Query:  236 FLRAAHNGYFSKVQEALNSN--IDVNSCNSNGLNALHLASKGGHADIVQFLIDNGADIGAKTRKNNTAIHIASLAGSLEVVKILVKHGANINEQSQTGFTPLYMAAQENHVGVVKFLLDNGADINLSTTDNFTPLAVAIQQGHEETVSILLNKSNFLNSNDISNDIKLPPLHIATRKDDYHAVLLLLHHQEDVQAALTQASLNGFTALHVAAYYNSDKVGRLLLENGAPVDYTSKNNVTALHVAAKWGRNKMVKVLLEFNANVEMSTRDGIRPLHCAASQGHRDICALLIEHKANCNTRTKNGLVPLHMVAQGNHSELVEFFINQNSVNVNETSLDFLTPLHISSHCNNVEVAEALIKHGANVNDRALNGFVALHIAAKQNHVEFVEMLMSNLCMIDTQTESGFTALHIASIIGSESIAKKLVENNCEIDIP--------------DQFD------------------RTSLHMATIFNHFNIVVYLKEHGGSVDKQMKTGETCLMLAIKSEHKAIVEYLINQGASMSVSDSWGLTALHWATLVVREN---ILNSNCTDININEAIE--------------IFKFVLDGCSRFDINRTTKNGISSLHLAADCGCLEIVHLLLDKGADINIISINGTTPLHIACKXXXXXXXXXXXXXXXXXXXTMAYVSCPWSPMHFSSYFGSVDSTILLISHENDQTSVREKLRQRTPNGNTCLHLAVQQLQTDIVRVLLENDADFNLENEDGLSAFDMAKIVDDETIINLL--GIDTTEMMTTDDKVYLFQREEFSDEEQLETLYMDSLNELEFFGIGKNSGEKCELQLSIMS-------------------LLD-----YATTIDSIRRADMSLKINNSLNRYRNIT-LSEIKTRELLIAAQPASMISTISSTNTEMSPFDVEKWDFHRVTDLPVNSGFLVSFLVDARGGYMQAQRMPQMKIFVPPDAAPAPTRIICHLLRPEGVANLPGMNDCDGFASRILQIHSSCSRFQKPILIEMPYIALLKSNDREIVILKKNADSDTWKKHSNTFTEETLKAEFGSLYESITPVDQLESNRICRIITTDVPTYFSLISQFQRDVNMIGPDGGYIESKTDKRIKLTFPQGALMKKIQIGLEVQHVDPGIINHVVGDNHKISLSPIITVEPKRRKFRDLIEIQMGLPKGVTKNDIQ-----------DLKLLFSISEYIT--DWEDVTSSTELVLLENTNCMAHSTKISARVWLIYAPNVPNISELANKIYALHCPTPYVGKFLSYARRHDQEECQIRCLLITDDTPDKTLECQESFELIATGPEVEVINKLQYQIECAGNIVAVTKSDEAILFPVQSFVENRITLPIRVRNQDEPFQGKIAFIPH---------------------FQSLSKQIVKXXXXXXXXXXXXXXXMVGSFRNPDRKHRVKNATLERI---KGC------QAIAKTELDLKSVADAVGADWRXXXXXXXXXXDDINLVLNEN-CTDEEKAFMTLINWQTVLGFKATGNELNRALRQIGREDVVKSCIGDISFVEDEAE 4522
            FLRAA +G   KV + L+     D+NSCN+NGLNALHLA+K G+ DI   L+  G  I   T+K NTA+HIASLAG  +V+  L+ + AN+N QS  GFTPLYMAAQENH    + LL NGA+ +LST D FTPLAVA+QQGH++ V++LL        ND+   ++LP LHIA +K+D +A  LLL H  D  A +   S  GFT LH+AA+Y +  +  LLL N A V+Y +K+N+T LHVA KWG+  +  +LL   A ++ +TRDG+ PLHCA+  GH ++   L++  A   T+TKNGL  LHM AQG H E     ++ N   V+E ++D+LT LH+++HC +V+VA+ L+ + AN N RALNGF  LHIA K+N ++ VE+L+ +   I   TESG T LH+AS +G  +I   L+++    D+P              +Q D                  +T LH+A+   + NI++ L +HG  ++ Q     + L +A K   + IV+ L+  GA  +     G T LH A    ++N   IL  N   I+     +              I + +L   S    N   +NG  ++H+A     LEI   LL  GAD+NIIS +G +PLH+A +  N +++ +LLE         A      +P+H ++  G V  + +L+ H  +       + +RT NG T LH+A      D+V+  +ENDAD  + +  G +    A       IINLL         +T D    L           +E+L + +   +    I  N G   E +L +M+                   LLD     Y  T D         K  ++ N   ++T +S +  +E+L    P  M S I  T     P +V       +    V+ GFLVSFLVDARGG M+  R   ++I VPP A   PTRI C  ++P+ V N P + + +   SRIL++      F  PI +E+P+   L+ N+REI+IL+ + + ++W++H N + +         + E I   ++  S+RI RI+T +VP +F+++S+ +++V++IGPDGG + S    ++K  FP  AL KKI++GL+ Q VD    + ++G    +++SP++TVEP+RRKF   I + +  PK  T + +             L+LL SIS   T   WEDVT ST L  + ++  +  +T +SAR WLI   N+ +   +A ++Y+     P+  KF+ +A+R  Q E +     +TDD  DKTLE QE F+ +A   ++EV+      +E AGNIV + K  E +    Q F ENR++    +++Q+ P  G+I F+ +                     F++++  + +               +     N +    VK   +++I   K C      + I + ++ L  +   +G+DW  LA  L +   DI+LV  E    D  K  M ++      G   TGN L  AL +IGR D+V+    +  F   + E
Sbjct:   42 FLRAARSGDIKKVMDFLDCGEISDINSCNANGLNALHLAAKDGYVDICCELLRRGIKIDNATKKGNTALHIASLAGQHDVINQLILYNANVNVQSLNGFTPLYMAAQENHDNCCRTLLANGANPSLSTEDGFTPLAVAMQQGHDKIVAVLL-------ENDVRGKVRLPALHIAAKKNDVNAAKLLLQH--DPNADIVSKS--GFTPLHIAAHYGNVDIATLLLNNKADVNYVAKHNITPLHVACKWGKLSLCTLLLCRGAKIDAATRDGLTPLHCASRSGHVEVIKHLLQQNAPILTKTKNGLSALHMAAQGEHDEAAHLLLD-NKAPVDEVTVDYLTALHVAAHCGHVKVAKLLLDYKANPNARALNGFTPLHIACKKNRIKMVELLIKHGANIGATTESGLTPLHVASFMGCINIVIYLLQHEASADLPTIRGETPLHLAARANQADIIRILLRSAKVDAIAREGQTPLHVASRLGNINIIMLLLQHGAEINAQSNDKYSALHIAAKEGQENIVQVLLENGAENNAVTKKGFTPLHLACKYGKQNVVQILLQNGASIDFQGKNDVTPLHVATHYNNPSIVELLLKNGS--SPNLCARNGQCAIHIACKKNYLEIAMQLLQHGADVNIISKSGFSPLHLAAQGGNVDMVQLLLEYGVIS----AAAKNGLTPLHVAAQEGHVLVSQILLEHGAN-------ISERTRNGYTPLHMAAHYGHLDLVKFFIENDADIEMSSNIGYTPLHQAAQQGHIMIINLLLRHKANPNALTKDGNTALHIASNLGYVTVMESLKIVTSTSV----INSNIG-AIEEKLKVMTPELMQETLLSDSDDESCDDLLDHNHYKYMATDDLKANYGQDQKNFDTTNTDHDLTDVSVLNKKEIL----PNEM-SCIELTEIGHKPDNV------VIARSQVHLGFLVSFLVDARGGSMRGYRHNGVRIIVPPKACAEPTRITCRYVKPQRVVNPPPLMEGEALVSRILEMSPVDGMFLSPITLEVPHYGTLRKNEREIIILRSD-NGESWREH-NLYKD--------IIGEDINQTEEFHSDRIVRIVTQNVPHFFAVVSRVRQEVHVIGPDGGTVFSTAVPQVKAIFPPHALTKKIRVGLQAQSVDLVECSKLLGQG--VAVSPVVTVEPRRRKFHKAITLSIPAPKACTNSMVNACYGNGNSSSPTLRLLCSISGGQTRATWEDVTGSTPLSFVRDS--VTFTTTVSARFWLIDCRNIIDAGRMATELYSHLAKVPFYVKFVIFAKRISQTEAKFSVFCMTDDKEDKTLEQQEYFKEVAKSRDIEVLQNQIVYLEFAGNIVPILKKGEQLYTKFQPFCENRLSFSAHIKDQEFP-HGRICFMTYPMVGPDEVPLKPLCTLNISVDFKTITNHLERDNLHSLNDCINAHGKL---NHNENIVFGVKEQQVKKIDITKACIMSSDIKLIHEADVILDDICSHLGSDWPLLANVLGVSQADIDLVKTEFLLNDSVKQSMAMLQLWLEHGGILTGNVLAEALYKIGRSDIVEKSFKNAEFGTHQPE 1533          
BLAST of Ankyrin-2 vs. Ensembl Fly
Match: Ank (gene:FBgn0011747 transcript:FBtr0089173)

HSP 1 Score: 742.265 bits (1915), Expect = 0.000e+0
Identity = 521/1551 (33.59%), Postives = 795/1551 (51.26%), Query Frame = 2
Query:  236 FLRAAHNGYFSKVQEALNSN--IDVNSCNSNGLNALHLASKGGHADIVQFLIDNGADIGAKTRKNNTAIHIASLAGSLEVVKILVKHGANINEQSQTGFTPLYMAAQENHVGVVKFLLDNGADINLSTTDNFTPLAVAIQQGHEETVSILLNKSNFLNSNDISNDIKLPPLHIATRKDDYHAVLLLLHHQEDVQAALTQASLNGFTALHVAAYYNSDKVGRLLLENGAPVDYTSKNNVTALHVAAKWGRNKMVKVLLEFNANVEMSTRDGIRPLHCAASQGHRDICALLIEHKANCNTRTKNGLVPLHMVAQGNHSELVEFFINQNSVNVNETSLDFLTPLHISSHCNNVEVAEALIKHGANVNDRALNGFVALHIAAKQNHVEFVEMLMSNLCMIDTQTESGFTALHIASIIGSESIAKKLVENNCEIDIP--------------DQFD------------------RTSLHMATIFNHFNIVVYLKEHGGSVDKQMKTGETCLMLAIKSEHKAIVEYLINQGASMSVSDSWGLTALHWATLVVREN---ILNSNCTDININEAIE--------------IFKFVLDGCSRFDINRTTKNGISSLHLAADCGCLEIVHLLLDKGADINIISINGTTPLHIACKXXXXXXXXXXXXXXXXXXXTMAYVSCPWSPMHFSSYFGSVDSTILLISHENDQTSVREKLRQRTPNGNTCLHLAVQQLQTDIVRVLLENDADFNLENEDGLSAFDMAKIVDDETIINLL--GIDTTEMMTTDDKVYLFQREEFSDEEQLETLYMDSLNELEFFGIGKNSGEKCELQLSIMS-------------------LLD-----YATTIDSIRRADMSLKINNSLNRYRNIT-LSEIKTRELLIAAQPASMISTISSTNTEMSPFDVEKWDFHRVTDLPVNSGFLVSFLVDARGGYMQAQRMPQMKIFVPPDAAPAPTRIICHLLRPEGVANLPGMNDCDGFASRILQIHSSCSRFQKPILIEMPYIALLKSNDREIVILKKNADSDTWKKHSNTFTEETLKAEFGSLYESITPVDQLESNRICRIITTDVPTYFSLISQFQRDVNMIGPDGGYIESKTDKRIKLTFPQGALMKKIQIGLEVQHVDPGIINHVVGDNHKISLSPIITVEPKRRKFRDLIEIQMGLPKGVTKNDIQ-----------DLKLLFSISEYIT--DWEDVTSSTELVLLENTNCMAHSTKISARVWLIYAPNVPNISELANKIYALHCPTPYVGKFLSYARRHDQEECQIRCLLITDDTPDKTLECQESFELIATGPEVEVINKLQYQIECAGNIVAVTKSDEAILFPVQSFVENRITLPIRVRNQDEPFQGKIAFIPH---------------------FQSLSKQIVKXXXXXXXXXXXXXXXMVGSFRNPDRKHRVKNATLERI---KGC------QAIAKTELDLKSVADAVGADWRXXXXXXXXXXDDINLVLNEN-CTDEEKAFMTLINWQTVLGFKATGNELNRALRQIGREDVVKSCIGDISFVEDEAE 4522
            FLRAA +G   KV + L+     D+NSCN+NGLNALHLA+K G+ DI   L+  G  I   T+K NTA+HIASLAG  +V+  L+ + AN+N QS  GFTPLYMAAQENH    + LL NGA+ +LST D FTPLAVA+QQGH++ V++LL        ND+   ++LP LHIA +K+D +A  LLL H  D  A +   S  GFT LH+AA+Y +  +  LLL N A V+Y +K+N+T LHVA KWG+  +  +LL   A ++ +TRDG+ PLHCA+  GH ++   L++  A   T+TKNGL  LHM AQG H E     ++ N   V+E ++D+LT LH+++HC +V+VA+ L+ + AN N RALNGF  LHIA K+N ++ VE+L+ +   I   TESG T LH+AS +G  +I   L+++    D+P              +Q D                  +T LH+A+   + NI++ L +HG  ++ Q     + L +A K   + IV+ L+  GA  +     G T LH A    ++N   IL  N   I+     +              I + +L   S    N   +NG  ++H+A     LEI   LL  GAD+NIIS +G +PLH+A +  N +++ +LLE         A      +P+H ++  G V  + +L+ H  +       + +RT NG T LH+A      D+V+  +ENDAD  + +  G +    A       IINLL         +T D    L           +E+L + +   +    I  N G   E +L +M+                   LLD     Y  T D         K  ++ N   ++T +S +  +E+L    P  M S I  T     P +V       +    V+ GFLVSFLVDARGG M+  R   ++I VPP A   PTRI C  ++P+ V N P + + +   SRIL++      F  PI +E+P+   L+ N+REI+IL+ + + ++W++H N + +         + E I   ++  S+RI RI+T +VP +F+++S+ +++V++IGPDGG + S    ++K  FP  AL KKI++GL+ Q VD    + ++G    +++SP++TVEP+RRKF   I + +  PK  T + +             L+LL SIS   T   WEDVT ST L  + ++  +  +T +SAR WLI   N+ +   +A ++Y+     P+  KF+ +A+R  Q E +     +TDD  DKTLE QE F+ +A   ++EV+      +E AGNIV + K  E +    Q F ENR++    +++Q+ P  G+I F+ +                     F++++  + +               +     N +    VK   +++I   K C      + I + ++ L  +   +G+DW  LA  L +   DI+LV  E    D  K  M ++      G   TGN L  AL +IGR D+V+    +  F   + E
Sbjct:   42 FLRAARSGDIKKVMDFLDCGEISDINSCNANGLNALHLAAKDGYVDICCELLRRGIKIDNATKKGNTALHIASLAGQHDVINQLILYNANVNVQSLNGFTPLYMAAQENHDNCCRTLLANGANPSLSTEDGFTPLAVAMQQGHDKIVAVLL-------ENDVRGKVRLPALHIAAKKNDVNAAKLLLQH--DPNADIVSKS--GFTPLHIAAHYGNVDIATLLLNNKADVNYVAKHNITPLHVACKWGKLSLCTLLLCRGAKIDAATRDGLTPLHCASRSGHVEVIKHLLQQNAPILTKTKNGLSALHMAAQGEHDEAAHLLLD-NKAPVDEVTVDYLTALHVAAHCGHVKVAKLLLDYKANPNARALNGFTPLHIACKKNRIKMVELLIKHGANIGATTESGLTPLHVASFMGCINIVIYLLQHEASADLPTIRGETPLHLAARANQADIIRILLRSAKVDAIAREGQTPLHVASRLGNINIIMLLLQHGAEINAQSNDKYSALHIAAKEGQENIVQVLLENGAENNAVTKKGFTPLHLACKYGKQNVVQILLQNGASIDFQGKNDVTPLHVATHYNNPSIVELLLKNGS--SPNLCARNGQCAIHIACKKNYLEIAMQLLQHGADVNIISKSGFSPLHLAAQGGNVDMVQLLLEYGVIS----AAAKNGLTPLHVAAQEGHVLVSQILLEHGAN-------ISERTRNGYTPLHMAAHYGHLDLVKFFIENDADIEMSSNIGYTPLHQAAQQGHIMIINLLLRHKANPNALTKDGNTALHIASNLGYVTVMESLKIVTSTSV----INSNIG-AIEEKLKVMTPELMQETLLSDSDDESCDDLLDHNHYKYMATDDLKANYGQDQKNFDTTNTDHDLTDVSVLNKKEIL----PNEM-SCIELTEIGHKPDNV------VIARSQVHLGFLVSFLVDARGGSMRGYRHNGVRIIVPPKACAEPTRITCRYVKPQRVVNPPPLMEGEALVSRILEMSPVDGMFLSPITLEVPHYGTLRKNEREIIILRSD-NGESWREH-NLYKD--------IIGEDINQTEEFHSDRIVRIVTQNVPHFFAVVSRVRQEVHVIGPDGGTVFSTAVPQVKAIFPPHALTKKIRVGLQAQSVDLVECSKLLGQG--VAVSPVVTVEPRRRKFHKAITLSIPAPKACTNSMVNACYGNGNSSSPTLRLLCSISGGQTRATWEDVTGSTPLSFVRDS--VTFTTTVSARFWLIDCRNIIDAGRMATELYSHLAKVPFYVKFVIFAKRISQTEAKFSVFCMTDDKEDKTLEQQEYFKEVAKSRDIEVLQNQIVYLEFAGNIVPILKKGEQLYTKFQPFCENRLSFSAHIKDQEFP-HGRICFMTYPMVGPDEVPLKPLCTLNISVDFKTITNHLERDNLHSLNDCINAHGKL---NHNENIVFGVKEQQVKKIDITKACIMSSDIKLIHEADVILDDICSHLGSDWPLLANVLGVSQADIDLVKTEFLLNDSVKQSMAMLQLWLEHGGILTGNVLAEALYKIGRSDIVEKSFKNAEFGTHQPE 1533          
BLAST of Ankyrin-2 vs. Ensembl Fly
Match: Ank2 (gene:FBgn0261788 transcript:FBtr0303122)

HSP 1 Score: 713.761 bits (1841), Expect = 0.000e+0
Identity = 485/1536 (31.58%), Postives = 800/1536 (52.08%), Query Frame = 2
Query:  236 FLRAAHNGYFSKVQEALNSNIDVNSCNSNGLNALHLASKGGHADIVQFLIDNGADIGAKTRKNNTAIHIASLAGSLEVVKILVKHGANINEQSQTGFTPLYMAAQENHVGVVKFLLDNGADINLSTTDNFTPLAVAIQQGHEETVSILLNKSNFLNSNDISNDIKLPPLHIATRKDDYHAVLLLLH--HQEDVQAALTQASLNGFTALHVAAYYNSDKVGRLLLENGAPVDYTSKNNVTALHVAAKWGRNKMVKVLLEFNANVEMSTRDGIRPLHCAASQGHRDICALLIEHKANCNTRTKNGLVP---------------------------------LHMVAQGNHSELVEFFINQNSVNVNETSLDFLTPLHISSHCNNVEVAEALIKHGANVNDRALNGFVALHIAA---------------------------------KQNHVEFVEMLMSNLCMIDTQTESGFTALHIASIIGSESIAKKLVENNCEIDIPDQFDRTSLHMATIFNHFNIVVYLKEHGGSVDKQMKTGETCLMLAIKSEHKAIVEYLINQGASMSVSDSWGLTALHWA--------TLVVRENILNSNCTDININEAIEIF--KFVLDGCSRFD-----INRTTKNGISSLHLAADCGCLEIVHLLLDKGADINIISINGTTPLHIACKXXXXXXXXXXXXXXXXXXXTMAYVSCPWSPMHFSSYFGSVDSTILLISHENDQTSVREKLRQRTPNGNTCLHLAVQQLQTDIVRVLLENDADFNLENEDGLSAFDMAKIVDDETIINLLGIDTTEMMTTDDKVYLFQREEFSDEEQLETLYMDSLNELEFFGIGKNSGEKCELQLSIMSLLDYATTIDSIRR-ADMSLKINNSLNRYRNITLSEIKTRELLIAAQPASMISTISSTNTEM---SP------FDVEKWDFHRVTDLPVNSG-------FLVSFLVDARGGYMQAQRMPQMKIFVPPDAAPAPTRIICHLLRPEGVANLPGMNDCDGFASRILQIHSSCSRFQKPILIEMPYIALLKSNDREIVILKKNADSDTWKKHSNTFTEETLKAEFGSLYE--SITPVDQLESNRICRIITTDVPTYFSLISQFQRDVNMIGPDGGYIESKTDKRIKLTFPQGALMKKIQIGLEVQHVDPGIINHVVGDNHKISLSPIITVEPKRRKFRDLIEIQMGLPKGVTKNDIQD-------LKLLFSIS--EYITDWEDVTSSTELVLLENTNCMAHSTKISARVWLIYAPNVPNISELANKIYALHCPTPYVGKFLSYARRHDQEECQIRCLLITDDTPDKTLECQESFELIATGPEVEVI-NKLQYQIECAGNIVAVTKSDEAILFPVQSFVENRITLPIRVRNQDEPFQGKIAFIPHFQSLSKQIVKXXXXXXXXXXXXXXXMVGSFRNPDR---KHRVKNATLERIKGCQAIAKTELDLKSVADAVGADWRXXXXXXXXXXDDINLVLNENCTDEEKAFMTLINWQTVLGFKATGN----ELNRALRQIGREDVVKSC 4486
            FLRAA  G   +V E L +NID+N+ N+NGLNALHLASK GH  +V  L+  GA + + T+K NTA+HIASLAG  EVVK+L++H A++N QSQ GFTPLYMAAQENH  VV+ LL NGA+ +L+T D FTPLAVA+QQGH++ V++LL        +D    ++LP LHIA +KDD  A  LLL   H  DV       S +GFT LH+A++Y +  +  LL++ GA V+Y++K+N++ LHVAAKWG+  MV +LLE   N+E  TRDG+ PLHCAA  GH  +  +L+E  A  + +TKNGL P                                 LH+ A   H  + +  +++N+ + N  +L+  TPLHI+   N ++V E L++HGA+++    +G   LH+AA                                 + N  + + +L+ N   +D +     T LHIAS +G+  I   L+++  ++D   +   T+LH+A       +   L E+G ++D   K G T L L  K  H  + + L+ + A +      G+T LH A         L++ E   + + T  N +  + I   K  +D  +         N  +K G + LHL++  G  EI +LL++  A +N  + NG TP+H+  + +N NV  +L ++ +     MA     ++P+H +S+FG  +    L+ +  +  +        T  G T LH   QQ    IV +LLE+ A+ N +  +G +   +A+ +     I++L  D+ + +T +D+      +    EE+   +  ++++E       +  GE   L       L    T+D ++   D SL I+ + +  R  +    ++ E      P      IS   T++   SP        +     H   D P + G       FLVSFLVDARGG M+  R   +++ +P  +   PTR+ C  ++P+   + P + + +  ASR+L++    ++F  P+++E+P+ A L+  +REI+IL+ + + +TW++H+   +EE +       +E   I  +++   N +CR +T D P YF+++S+ +++V+ IGP+GG + S    +++  FPQGAL KKI++GL+ Q VDP +   ++G    +++SPI+TVEP+RRKF   I + M  PK  ++  I         L+LL SI+       WEDVT ST L  +   +C++ +T +SAR WL+   N+ + +++A ++Y      P++ KF+ +A++ +  E ++R   +TDD  DKTLE  E +  +A   +VEV+  K QY IE AGN+V VTKS + +    ++F ENR+   +RV++Q     G+  F+   +    +  +    +  I+    +    +    DR    +R    +L + +    I   ++ +  +++ +G DW  LA E+ +  ++I+ ++N+N     +   ++I       +K   N     L  AL+ IGR+D++K C
Sbjct:   15 FLRAARAGNLERVLEHLKNNIDINTSNANGLNALHLASKDGHIHVVSELLRRGAIVDSATKKGNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGANQSLATEDGFTPLAVAMQQGHDKVVAVLLE-------SDTRGKVRLPALHIAAKKDDVKAATLLLDNDHNPDV------TSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNA-DANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIAARKNQMDIATTLLEYGALANAESKAGFTPLHLSSQEGHAEISNLLIEHKAAVNHPAKNGLTPMHLCAQEDNVNVAEILEKNGANID--MA-TKAGYTPLHVASHFGQANMVRFLLQNGANVDAA-------TSIGYTPLHQTAQQGHCHIVNLLLEHKANANAQTVNGQTPLHIARKLG---YISVL--DSLKTITKEDETAAAPSQA---EEKYRVVAPEAMHESFMSDSEEEGGEDNMLSDQPYRYL----TVDEMKSLGDDSLPIDVTRDE-RMDSNRMTQSAEYASGVPPTIGEEVISPHKTQVYGSSPKATVDGVYIANGSGH---DEPPHVGRKLSWKSFLVSFLVDARGGAMRGCRHSGVRMIIPSRSTCQPTRVTCRYVKPQRTMHPPQLMEGEALASRVLELGPCSTKFIGPVVMEVPHFASLRGKEREIIILRSD-NGETWREHTIDNSEEIIHDVLQQCFEPEEIAQLEEQAGNHVCRFVTYDFPQYFAVVSRIRQEVHAIGPEGGMVSSTVVPQVQAVFPQGALTKKIKVGLQAQPVDPDLTAKLLGRG--VAVSPIVTVEPRRRKFHKAITLSMPAPKAHSQGMINQYSGNTPTLRLLCSITGGPSRAQWEDVTGSTPLTFV--NDCVSFTTTVSARFWLMDCRNISDATKMATELYKEVIHVPFIAKFVVFAKKVEPFEAKLRVFCMTDDREDKTLEKHELYTEVAKSRDVEVLEGKPQY-IEMAGNLVPVTKSGDQLQVQFKAFRENRLPFTVRVKDQHADIVGRTLFMKEPKVAKGEPPQQPICILNIVLPEAVIPDSTTAFSDRVTSAYRTSMFSLSKHQNDHYIG--DIRIVDLSNLLGKDWIQLAPEIGINGEEIDEIINQNTDSIARQAQSMIRL-----YKDKPNYDILSLETALKNIGRDDIMKKC 1497          

HSP 2 Score: 249.21 bits (635), Expect = 1.562e-65
Identity = 198/716 (27.65%), Postives = 322/716 (44.97%), Query Frame = 2
Query:  521 GFTPLYMAAQENHVGVVKFLLDNGADINLSTTDNFTPLAVAIQQGHEETVSILLNKSNFLNSNDISNDIKLPPLHIATRKDDYHAVLLLLHHQEDVQAALTQASLNGFTALHVAAYYNSDKVGRLLLENGAPVDYTSKNNVTALHVAAKWGRNKMVKVLLEFNA-----------------------------NVEMSTRDGIRPLHCAASQGHRDICALLIEHKANCN---------------------------------TRTKNGLVPLHMVAQGNHSELVEFFINQNS--------------------------------VNVNETSLDFLTPLHISSHCNNVEVAEALIKHGANVNDRALNGFVALHIAAKQNHVEFVEMLMSNLCMIDTQTESGFTALHIASIIGSESIAKKLVENNCEIDIPDQFDRTSLHMATIFNHFNIVVYLKEHGGSVDKQMKTGETCLMLAIKSEHKAIVEYLINQGASMSVSDSWGLTALHWATLVVRENIL-----NSNCTDININEA------------IEIFKFVLDGCSRFDINRTTKNGISSLHLAADCGCLEIVHLLLDKGADINIISINGTTPLHIACKXXXXXXXXXXXXXXXXXXXTMAYVSCPWSPMHFSSYFGSVDSTILLISHENDQTSVREKLRQRTPNGNTCLHLAVQQLQTDIVRVLLENDADFNLENEDGLSAFDMA 2335
            G T    AA+  ++  V   L N  DIN S  +    L +A + GH   VS LL +   ++S     +     LHIA+       V LLL H     A++   S NGFT L++AA  N D V RLLL NGA     +++  T L VA + G +K+V VLLE +                              N +++++ G  PLH A+  G+++I  LLI+  A+ N                                  +T++GL PLH  A+  H ++V+  + + +                                  V+E ++D+LT LH+++HC +V VA+ L+   A+ N RALNGF  LHIA K+N ++ VE+L+ +   I   TESG T LH+A+ +G  +I   L++++   D+P     T LH+A   N  +I+  L  +G  VD + +  +T L +A +  +  IV  L+  GA +  +     TALH A    ++ +      N    D    +             I++ + +L      D++   KNG++ LH+A      ++  LLL+KGA  +  + NG TPLHIA + N  ++   LLE  +  +   A     ++P+H SS  G  + + LLI H       +  +     NG T +HL  Q+   ++  +L +N A+ ++  + G +   +A
Sbjct:   11 GNTSFLRAARAGNLERVLEHLKNNIDINTSNANGLNALHLASKDGHIHVVSELLRRGAIVDSATKKGNTA---LHIASLAGQEEVVKLLLEH----NASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGANQSLATEDGFTPLAVAMQQGHDKVVAVLLESDTRGKVRLPALHIAAKKDDVKAATLLLDNDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQ--KEADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIAARKNQMDIATTLLEYGALAN---AESKAGFTPLHLSSQEGHAEISNLLIEH-------KAAVNHPAKNGLTPMHLCAQEDNVNVAEILEKNGANIDMATKAGYTPLHVA 707          
BLAST of Ankyrin-2 vs. Ensembl Zebrafish
Match: ank3a (ankyrin 3a [Source:ZFIN;Acc:ZDB-GENE-060621-1])

HSP 1 Score: 794.267 bits (2050), Expect = 0.000e+0
Identity = 517/1552 (33.31%), Postives = 812/1552 (52.32%), Query Frame = 2
Query:  236 FLRAAHNGYFSKVQEALNSNIDVNSCNSNGLNALHLASKGGHADIVQFLIDNGADIGAKTRKNNTAIHIASLAGSLEVVKILVKHGANINEQSQTGFTPLYMAAQENHVGVVKFLLDNGADINLSTTDNFTPLAVAIQQGHEETVSILLNKSNFLNSNDISNDIKLPPLHIATRKDDYHAVLLLLH--HQEDVQAALTQASLNGFTALHVAAYYNSDKVGRLLLENGAPVDYTSKNNVTALHVAAKWGRNKMVKVLLEFNANVEMSTRDGIRPLHCAASQGHRDICALLIEHKANCNTRTKNGLVPLHMVAQGNHSELVEFFINQNSVNVNETSLDFLTPLHISSHCNNVEVAEALIKHGANVNDRALNGFVALHIAAKQNHVEFVEMLMSNLCMIDTQTESGFTALHIASIIGSESIAKKL---------------------------------VENNCEIDIPDQFDRTSLHMATIFNHFNIVVYLKEHGGSVDKQMKTGETCLMLAIKSEHKAIVEYLINQGASMSVSDSWGLT----ALHWATLVVRENILN----------SNCTDININEAIEIFKFVL--------------DGCSRFDI--------------------NRTTKNGISSLHLAADCGCLEIVHLLLDKGADINIISINGTTPLHIACKXXXXXXXXXXXXXXXXXXXTMAYVSCPWSPMHFSSYFGSVDSTILLISHENDQTSVREKLRQRTPNGNTCLHLAVQQLQTDIVRVLLENDADFNLENEDGLSAFDMAKIVDDETII---------NLLGIDTTEMMTTDDKVYLFQREEFSDEEQLETLYMDSLNELEFFGIGKNSGEKCEL-------QLSIMSLLDYATTIDSIRRADMSLKIN----NSLNRYRNITLSEIKTRELLIAAQPASMISTISSTNTEM-----SPFDVEKWDFHRVTDLPVNSGFLVSFLVDARGGYMQAQRMPQMKIFVPPDAAPAPTRIICHLLRPEGVANLPGMNDCDGFASRILQIHSSCSRFQKPILIEMPYIALLKSNDREIVILKKNADSDTWKKHSNTFTEETLKAEFGSLYESITPVDQLESNRICRIITTDVPTYFSLISQFQRDVNMIGPDGGYIESKTDKRIKLTFPQGALMKKIQIGLEVQHVDPGIINHVVGDNHKISLSPIITVEPKRRKFRDLIEIQMGLPK--------GVTKNDIQDLKLLFSISEYIT--DWEDVTSSTELVLLENTNCMAHSTKISARVWLIYAPNVPNISELANKIYALHCPTPYVGKFLSYARRHDQEECQIRCLLITDDTPDKTLECQESFELIATGPEVEVINKLQYQIECAGNIVAVTKSDEAILFPVQSFVENRITLPIRVRNQDEPFQGKIAFIPH---FQSLSKQIVKXXXXXXXXXXXXXXXMVGSFRNPDRKHRVKNATLERIKGCQA---------IAKTELDLKSVADAVGADWRXXXXXXXXXXDDINLVLNENCTD-EEKAFMTLINWQTVLGFKATGNELNRALRQIGREDVVKSCIGDI 4498
            +LRAA  G   KV + L + +D+N CN NGLNALHLASK GH ++V  L+  GA++ A T+K NTA+HIASLAG  EVV+ LV +GAN+N QSQ GFTPLYMAAQENH+ VV+FLL+N +  +++T D FTPLAVA+QQGH++ VS+LL        ND    ++LP LHIA RKDD  +  LLL   H  DV+      S +GFT LH+AA+Y +  V  LLL  GA VD+ ++N++T LHVA+K G   MVK+LL+  + +E  T+DG+ PLHC A  GH  +  +L++  A   ++TKNGL PLHM  QG+H   V+  +  N+  V++ + D+LT LH+++HC + +VA+ ++   AN N +ALNGF  LHIA K+N V+ +E+L+ +   +   TESG T +H+A+ +G E+I K+L                                 ++N  ++DI  + D+T+LH+A+      IV  L + G   +    +G T L L+ +  H+ I   L+ QG+S+S +   G T    A  +  L V   +L           S  T +++    +  +  L              +G +   I                    N  T+ GIS LHLAA  G +++V LLL K A++N+ + NG TPLH+A +++ + V  VLL   +      A     ++P+H + ++G++     L+ ++        K   +T NG T LH A QQ  T I+ +LL+  A  N    +G +A  +A+ +   +++         NL     TE    +    + +  + SD+E ++     ++ E    G    +GE  +        +L   SL        SI     S +I+    N+LNR  +     +   E+L   +   +  T    N  M     +P  V++   H     PV+SGFLVSF+VDARGG M+  R   M+I VPP   PAPTRI C L +   +A  P M + +G  SR++++  + ++F  P+++E+P+   ++  +RE+++L+ + + +TWK+H        L +    + E +    +LE  RICRIIT D P YF+++S+ +++ + +GP+GG + S+    +K  FPQGAL KKI++GL+ Q V   ++  ++G+  + S SPI+TVEP+RRKF   I + + +P         G        L+LL SI+   +   WED+T +T L  +  T+C++ +T +SAR WL     +     LA+++Y      PY+ KF+ +A+  D  E  +RC  +TDD  DKTLE QE+FE +A   ++E++       EC GNI  + KS + ++F   +F ENR+   I+VR+  +   G+I+F+      + L +  +  +        + +        + DR+H   +  L +     A           +T+L +  VAD +G  W  LA E+    D+IN +  EN      ++FM L  W +  G  AT + L   L ++ R D+V    G I
Sbjct:   46 YLRAARAGNLEKVLDYLKTGVDINICNQNGLNALHLASKEGHVEVVAELLKLGANVDAATKKGNTALHIASLAGQTEVVRELVTNGANVNAQSQNGFTPLYMAAQENHLDVVRFLLENNSSQSIATEDGFTPLAVALQQGHDQVVSLLL-------ENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVE------SKSGFTPLHIAAHYGNINVATLLLNRGAAVDFMARNDITPLHVASKRGNGNMVKLLLDRGSKIEAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNAP-VDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQIDVVRYLLQNGAKVDIKAKDDQTALHIASRLGKLEIVQQLLQKGALPNAATTSGYTPLHLSAREGHQEIAALLLEQGSSLSAATKKGFTPLHVAAKYGQLEVANLLLQKKAAPDAAGKSGLTPLHVAAHYDNQRVALLLLDQGASPHSPAKNGYTPLHIAAKKNQLEIGTTLLEYGAECNTVTRQGISPLHLAAQEGSVDLVSLLLTKQANVNMGNKNGLTPLHLAAQDDKAGVTEVLLNHGAEID---AQTKSGYTPLHVACHYGNMKMANFLLENQ-------AKPNAKTKNGYTPLHQAAQQGHTHIINMLLQYGASPNELTLNGNTALSIARRLGYISVVDTLRGVTDENLTATPITEKHKINVPETMNEFLDMSDDEAVKDHEAQTVGE---EGEDAMTGETEKYLRPQDLRELGDDSLPQEGYMGFSIGARSASPRISSDRSNTLNR-SSFARDSMMIEEILAPTKDTHLAVTREYNNECMRRYSWTPDTVDQS--HNTVCSPVHSGFLVSFMVDARGGSMRGSRHDGMRIIVPPRKCPAPTRITCRLAKRHRLAYPPPMVEGEGLVSRLVEMGPAGAQFLGPVIVEIPHFGSMRGKERELIVLRSD-NGETWKEHHYDCKVTELTSILNGMDEEMDSPAELEKKRICRIITKDFPQYFAVVSRIKQESDHMGPEGGVLTSEAVPMVKAAFPQGALTKKIRVGLQAQPVPEDMVRTIIGN--RASFSPIVTVEPRRRKFHKPITMTIPVPPRSKEAVANGRKGEPAPCLRLLCSITGGTSPAQWEDITGTTPLSFV--TDCVSFTTNVSARFWLADCQQISETVGLASQLYRELICVPYLAKFVVFAKMIDHIEFSMRCFCMTDDKVDKTLEQQENFEEVARSKDIEILEGKPIHGECYGNIYPLAKSGQQLIFNFYAFKENRLPFNIKVRDIGQEPCGRISFLREPKTAKGLPQSAICNLNFTLPTHRKEMESDPDDENDKDRRHTFASLALRKRYSYLADPASSPQSPCERTDLRMAIVADHLGLSWTELAREMNFSVDEINHIRTENPNSLTAQSFMLLKKWVSRDGKNATTDALTAVLTKVNRMDIVTLLEGPI 1562          
BLAST of Ankyrin-2 vs. Ensembl Zebrafish
Match: ank3a (ankyrin 3a [Source:ZFIN;Acc:ZDB-GENE-060621-1])

HSP 1 Score: 794.267 bits (2050), Expect = 0.000e+0
Identity = 517/1552 (33.31%), Postives = 812/1552 (52.32%), Query Frame = 2
Query:  236 FLRAAHNGYFSKVQEALNSNIDVNSCNSNGLNALHLASKGGHADIVQFLIDNGADIGAKTRKNNTAIHIASLAGSLEVVKILVKHGANINEQSQTGFTPLYMAAQENHVGVVKFLLDNGADINLSTTDNFTPLAVAIQQGHEETVSILLNKSNFLNSNDISNDIKLPPLHIATRKDDYHAVLLLLH--HQEDVQAALTQASLNGFTALHVAAYYNSDKVGRLLLENGAPVDYTSKNNVTALHVAAKWGRNKMVKVLLEFNANVEMSTRDGIRPLHCAASQGHRDICALLIEHKANCNTRTKNGLVPLHMVAQGNHSELVEFFINQNSVNVNETSLDFLTPLHISSHCNNVEVAEALIKHGANVNDRALNGFVALHIAAKQNHVEFVEMLMSNLCMIDTQTESGFTALHIASIIGSESIAKKL---------------------------------VENNCEIDIPDQFDRTSLHMATIFNHFNIVVYLKEHGGSVDKQMKTGETCLMLAIKSEHKAIVEYLINQGASMSVSDSWGLT----ALHWATLVVRENILN----------SNCTDININEAIEIFKFVL--------------DGCSRFDI--------------------NRTTKNGISSLHLAADCGCLEIVHLLLDKGADINIISINGTTPLHIACKXXXXXXXXXXXXXXXXXXXTMAYVSCPWSPMHFSSYFGSVDSTILLISHENDQTSVREKLRQRTPNGNTCLHLAVQQLQTDIVRVLLENDADFNLENEDGLSAFDMAKIVDDETII---------NLLGIDTTEMMTTDDKVYLFQREEFSDEEQLETLYMDSLNELEFFGIGKNSGEKCEL-------QLSIMSLLDYATTIDSIRRADMSLKIN----NSLNRYRNITLSEIKTRELLIAAQPASMISTISSTNTEM-----SPFDVEKWDFHRVTDLPVNSGFLVSFLVDARGGYMQAQRMPQMKIFVPPDAAPAPTRIICHLLRPEGVANLPGMNDCDGFASRILQIHSSCSRFQKPILIEMPYIALLKSNDREIVILKKNADSDTWKKHSNTFTEETLKAEFGSLYESITPVDQLESNRICRIITTDVPTYFSLISQFQRDVNMIGPDGGYIESKTDKRIKLTFPQGALMKKIQIGLEVQHVDPGIINHVVGDNHKISLSPIITVEPKRRKFRDLIEIQMGLPK--------GVTKNDIQDLKLLFSISEYIT--DWEDVTSSTELVLLENTNCMAHSTKISARVWLIYAPNVPNISELANKIYALHCPTPYVGKFLSYARRHDQEECQIRCLLITDDTPDKTLECQESFELIATGPEVEVINKLQYQIECAGNIVAVTKSDEAILFPVQSFVENRITLPIRVRNQDEPFQGKIAFIPH---FQSLSKQIVKXXXXXXXXXXXXXXXMVGSFRNPDRKHRVKNATLERIKGCQA---------IAKTELDLKSVADAVGADWRXXXXXXXXXXDDINLVLNENCTD-EEKAFMTLINWQTVLGFKATGNELNRALRQIGREDVVKSCIGDI 4498
            +LRAA  G   KV + L + +D+N CN NGLNALHLASK GH ++V  L+  GA++ A T+K NTA+HIASLAG  EVV+ LV +GAN+N QSQ GFTPLYMAAQENH+ VV+FLL+N +  +++T D FTPLAVA+QQGH++ VS+LL        ND    ++LP LHIA RKDD  +  LLL   H  DV+      S +GFT LH+AA+Y +  V  LLL  GA VD+ ++N++T LHVA+K G   MVK+LL+  + +E  T+DG+ PLHC A  GH  +  +L++  A   ++TKNGL PLHM  QG+H   V+  +  N+  V++ + D+LT LH+++HC + +VA+ ++   AN N +ALNGF  LHIA K+N V+ +E+L+ +   +   TESG T +H+A+ +G E+I K+L                                 ++N  ++DI  + D+T+LH+A+      IV  L + G   +    +G T L L+ +  H+ I   L+ QG+S+S +   G T    A  +  L V   +L           S  T +++    +  +  L              +G +   I                    N  T+ GIS LHLAA  G +++V LLL K A++N+ + NG TPLH+A +++ + V  VLL   +      A     ++P+H + ++G++     L+ ++        K   +T NG T LH A QQ  T I+ +LL+  A  N    +G +A  +A+ +   +++         NL     TE    +    + +  + SD+E ++     ++ E    G    +GE  +        +L   SL        SI     S +I+    N+LNR  +     +   E+L   +   +  T    N  M     +P  V++   H     PV+SGFLVSF+VDARGG M+  R   M+I VPP   PAPTRI C L +   +A  P M + +G  SR++++  + ++F  P+++E+P+   ++  +RE+++L+ + + +TWK+H        L +    + E +    +LE  RICRIIT D P YF+++S+ +++ + +GP+GG + S+    +K  FPQGAL KKI++GL+ Q V   ++  ++G+  + S SPI+TVEP+RRKF   I + + +P         G        L+LL SI+   +   WED+T +T L  +  T+C++ +T +SAR WL     +     LA+++Y      PY+ KF+ +A+  D  E  +RC  +TDD  DKTLE QE+FE +A   ++E++       EC GNI  + KS + ++F   +F ENR+   I+VR+  +   G+I+F+      + L +  +  +        + +        + DR+H   +  L +     A           +T+L +  VAD +G  W  LA E+    D+IN +  EN      ++FM L  W +  G  AT + L   L ++ R D+V    G I
Sbjct:   46 YLRAARAGNLEKVLDYLKTGVDINICNQNGLNALHLASKEGHVEVVAELLKLGANVDAATKKGNTALHIASLAGQTEVVRELVTNGANVNAQSQNGFTPLYMAAQENHLDVVRFLLENNSSQSIATEDGFTPLAVALQQGHDQVVSLLL-------ENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVE------SKSGFTPLHIAAHYGNINVATLLLNRGAAVDFMARNDITPLHVASKRGNGNMVKLLLDRGSKIEAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNAP-VDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQIDVVRYLLQNGAKVDIKAKDDQTALHIASRLGKLEIVQQLLQKGALPNAATTSGYTPLHLSAREGHQEIAALLLEQGSSLSAATKKGFTPLHVAAKYGQLEVANLLLQKKAAPDAAGKSGLTPLHVAAHYDNQRVALLLLDQGASPHSPAKNGYTPLHIAAKKNQLEIGTTLLEYGAECNTVTRQGISPLHLAAQEGSVDLVSLLLTKQANVNMGNKNGLTPLHLAAQDDKAGVTEVLLNHGAEID---AQTKSGYTPLHVACHYGNMKMANFLLENQ-------AKPNAKTKNGYTPLHQAAQQGHTHIINMLLQYGASPNELTLNGNTALSIARRLGYISVVDTLRGVTDENLTATPITEKHKINVPETMNEFLDMSDDEAVKDHEAQTVGE---EGEDAMTGETEKYLRPQDLRELGDDSLPQEGYMGFSIGARSASPRISSDRSNTLNR-SSFARDSMMIEEILAPTKDTHLAVTREYNNECMRRYSWTPDTVDQS--HNTVCSPVHSGFLVSFMVDARGGSMRGSRHDGMRIIVPPRKCPAPTRITCRLAKRHRLAYPPPMVEGEGLVSRLVEMGPAGAQFLGPVIVEIPHFGSMRGKERELIVLRSD-NGETWKEHHYDCKVTELTSILNGMDEEMDSPAELEKKRICRIITKDFPQYFAVVSRIKQESDHMGPEGGVLTSEAVPMVKAAFPQGALTKKIRVGLQAQPVPEDMVRTIIGN--RASFSPIVTVEPRRRKFHKPITMTIPVPPRSKEAVANGRKGEPAPCLRLLCSITGGTSPAQWEDITGTTPLSFV--TDCVSFTTNVSARFWLADCQQISETVGLASQLYRELICVPYLAKFVVFAKMIDHIEFSMRCFCMTDDKVDKTLEQQENFEEVARSKDIEILEGKPIHGECYGNIYPLAKSGQQLIFNFYAFKENRLPFNIKVRDIGQEPCGRISFLREPKTAKGLPQSAICNLNFTLPTHRKEMESDPDDENDKDRRHTFASLALRKRYSYLADPASSPQSPCERTDLRMAIVADHLGLSWTELAREMNFSVDEINHIRTENPNSLTAQSFMLLKKWVSRDGKNATTDALTAVLTKVNRMDIVTLLEGPI 1562          
BLAST of Ankyrin-2 vs. Ensembl Zebrafish
Match: ank2b (ankyrin 2b, neuronal [Source:ZFIN;Acc:ZDB-GENE-041010-165])

HSP 1 Score: 790.415 bits (2040), Expect = 0.000e+0
Identity = 527/1551 (33.98%), Postives = 790/1551 (50.93%), Query Frame = 2
Query:  236 FLRAAHNGYFSKVQEALNSNIDVNSCNSNGLNALHLASKGGHADIVQFLIDNGADIGAKTRKNNTAIHIASLAGSLEVVKILVKHGANINEQSQTGFTPLYMAAQENHVGVVKFLLDNGADINLSTTDNFTPLAVAIQQGHEETVSILLNKSNFLNSNDISNDIKLPPLHIATRKDDYHAVLLLLH--HQEDVQAALTQASLNGFTALHVAAYYNSDKVGRLLLENGAPVDYTSKNNVTALHVAAKWGRNKMVKVLLEFNANVEMSTRDGIRPLHCAASQGHRDICALLIEHKANCNTRTKNGLVPLHMVAQGNHSELVEFFINQNSVNVNETSLDFLTPLHISSHCNNVEVAEALIKHGANVNDRALNGFVALHIAAKQNHVEFVEMLMSNLCMIDTQTESGFTALHIASIIGSESIAKKLVENNCEIDIPD---------------------------------QFDRTSLHMATIFNHFNIVVYLKEHGGSVDKQMKTGETCLMLAIKSEHKAIVEYLINQGASMSVSDSWGLTALH----WATLVVRENILNSNC----------TDININEAIEIFKFVL--------------DGCSRFDI--------------------NRTTKNGISSLHLAADCGCLEIVHLLLDKGADINIISINGTTPLHIACKXXXXXXXXXXXXXXXXXXXTMAYVSCPWSPMHFSSYFGSVDSTILLISHENDQTSVREKLRQRTPNGNTCLHLAVQQLQTDIVRVLLENDADFNLENEDGLSAFDMAK------IVD------------------------DETIINLLGIDTTE---MMTTDDKVYLFQRE--EFSDEEQLETLYMDSLNELEFFGIGKNSGEKCELQLSIMSLLDYATTIDSIRRADMSLKINNSLNRYRNITLSEIKTRELLIAAQP--ASMISTISSTNTEMSPFDVEKWDFHRVTDLPVNSGFLVSFLVDARGGYMQAQRMPQMKIFVPPDAAPAPTRIICHLLRPEGVANLPGMNDCDGFASRILQIHSSCSRFQKPILIEMPYIALLKSNDREIVILKKNADSDTWKKHSNTFTEETLKAEFGSLYESITPVDQLESNRICRIITTDVPTYFSLISQFQRDVNMIGPDGGYIESKTDKRIKLTFPQGALMKKIQIGLEVQHVDPGIINHVVGDNHKISLSPIITVEPKRRKFRDLIEIQMGLPKGVT--------KNDIQDLKLLFSISEYIT--DWEDVTSSTELVLLENTNCMAHSTKISARVWLIYAPNVPNISELANKIYALHCPTPYVGKFLSYARRHDQEECQIRCLLITDDTPDKTLECQESFELIATGPEVEVINKLQYQIECAGNIVAVTKSDEAILFPVQSFVENRITLPIRVRNQDEPFQGKIAFIPH---FQSLSKQIVKXXXXXXXXXXXXXXXMVGSFRNPDRKHRVKNATLERIKGCQAIA-KTELDLKSVADAVGADWRXXXXXXXXXXDDINLVLNEN---CTDEEKAFMTLINWQTVLGFKATGNELNRALRQIGREDVV 4477
            FLRAA  G   KV E L   +D+ + N NGLNALHLA+K GH D+VQ L+  G+ + + T+K NTA+HIASLAG  +VVKIL K GANIN QSQ GFTPLYMA+QENH+ VV++LL+NG + +++T D FTPLA+A+QQGH + VSILL        ND    ++LP LHIA RKDD  +  LLL   H  DVQ      S +GFT LH+AA+Y +  V  LLL  GA VD+T++N +T LHVA+K G   MV +LL+  A ++  TRDG+ PLHCAA  GH     LL+E  A    RTKNGL PLHM AQG+H E V+  + Q+   V++ +LD+LT LH+++HC +  V + L+   AN N RALNGF  LHIA K+N V+ +E+L+     I   TESG T +H+A+ +G  +I   L++N    D+ +                                 + D+T LH+A+      IV  L +H    D     G T L +A +  H  +   L+  GA+ S++   G T LH    + +L V + +L              T +++    +  K  L              +G +   I                    N  TK G+  +HLA+  G  E+  LLL +GA +N+ + +G T LH+A + +   V  +L++  +            ++P+  + ++G+      L+       SV +K    T NG T LH A QQ  T I+ VLL+  A  N    +G +A  +A+      +VD                         ET+  +L +   E    MT D   YL   +  E  D+  L   Y+D +N L F   G  S                                 +SL+R    T     ++   I      ++ +S++   N E   ++ E  D   ++  P +SGFLVSF+VDARGG M+  R   +++ +PP    APTR+ C L++   +A +P M + DG ASR++++  S ++F  P+++E+P+ A L+  +RE+VIL+     ++WK+H   +TEE L      + E + P ++LE  RICRIIT D P YF+++S+ ++D N+IGP+GG + S     ++  FP+GAL K+I++GL+ Q +   ++ +++G+  K + SPI+T+EP+RRKF   I + + +PK             +   L+LL SI+   T   WED+T +T L      +C++ +T +SAR WLI    V      A  +Y      PY+ KF+ +A+ HD  E ++RC  +TDD  DKTLE QE+F  +A   +VEV+      ++C GN+V +TKS +  +F   +F ENR+ L I++R+  +   G+++F      F++LS   V  +                   N       K A L+     Q  A + E  L  +A+ +G  W  LA ELE     IN + NEN     D+  A + L  W+   G  A+ N L + L +I R D+V
Sbjct:   24 FLRAARAGNIDKVLEYLKGGVDIGTSNQNGLNALHLAAKEGHVDLVQELLGRGSSVDSATKKGNTALHIASLAGQGDVVKILSKRGANINAQSQNGFTPLYMASQENHLDVVRYLLENGGNQSIATEDGFTPLAIALQQGHNQVVSILLE-------NDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQ------SKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVHLLLDRGAQIDAKTRDGLTPLHCAARSGHDTAVELLLERGAPMLARTKNGLSPLHMAAQGDHVECVKHLL-QHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRVKVMELLIKYGAFIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVSNIRGETALHMAARAGQMEVVRCLLRNGAMVDARAREDQTPLHIASRLGKTEIVQLLLQHMAHPDAATANGYTPLHIAAREGHLDVTTVLLEAGAAHSLATKKGFTPLHVASKYGSLEVAKLLLQRRAPPDSAGKNGLTPLHVAAHYDNQKVALLLLDKGASPHATAKNGYTPLHIAAKKNQMEIATTLLQYGAETNIQTKQGVMPIHLASQEGHSEMAALLLQRGAQVNVTTKSGLTSLHLAAQEDKVGVGEILVKQGANLDQQ---TKLGYTPLIVACHYGNAKMVNFLL---KSGASVNDK----TKNGYTPLHQAAQQGNTHIINVLLQYGAKPNAITVNGNTALAIARRLGYISVVDTLRVVTEEIVTTTTTVTEKHKLNVPETMTEVLDVSDEEGDDTMTGDGGEYLRAEDLRELGDDS-LPGQYLDGMNYLRFSLEGGRS---------------------------------DSLDRSYTPTHQSYYSKHYGIMEDVIYSNQVSSLGREN-EKDSWETENLDNIALSSSPAHSGFLVSFMVDARGGAMRGCRHNGLRLIIPPRKCSAPTRVTCRLVKRHRLATMPPMVEGDGLASRLIEVGPSGAQFLGPVIVEIPHFAALRGKERELVILRSET-GESWKEHHCEYTEEELNQVLNGMDERLDPPEELEKKRICRIITRDFPQYFAVVSRIKQDSNLIGPEGGVLSSTVVPEVQAVFPEGALTKRIRVGLQTQPMSVDVVRNMLGN--KATFSPIVTLEPRRRKFHKPITMTIPVPKSSADPALGSFGGGETPTLRLLCSITGGTTPAQWEDITGTTPLTF--TNDCVSFTTNVSARFWLIDCRQVQESVNFATLMYREIICVPYMAKFVIFAKTHDPIEARLRCFCMTDDKMDKTLEQQENFSEVARSRDVEVLEGKPIYVDCFGNLVPLTKSGQHHVFSFYAFKENRLALFIKIRDNTQEPCGRLSFTKEPRSFRTLSHGAVCNL-------------------NISLPAYSKAAFLDIAVDPQDEADRKESRLAVIANHLGFSWSELARELEFSDVQINQIRNENPNSLQDQSHALIRL--WKEREGKNASENSLMKTLTKINRMDIV 1489          
BLAST of Ankyrin-2 vs. Ensembl Zebrafish
Match: BX469921.1 (ankyrin 3a [Source:NCBI gene;Acc:103909035])

HSP 1 Score: 781.556 bits (2017), Expect = 0.000e+0
Identity = 509/1555 (32.73%), Postives = 810/1555 (52.09%), Query Frame = 2
Query:  236 FLRAAHNGYFSKVQEALNSNIDVNSCNSNGLNALHLASKGGHADIVQFLIDNGADIGAKTRKNNTAIHIASLAGSLEVVKILVKHGANINEQSQTGFTPLYMAAQENHVGVVKFLLDNGADINLSTTDNFTPLAVAIQQGHEETVSILLNKSNFLNSNDISNDIKLPPLHIATRKDDYHAVLLLLH--HQEDVQAALTQASLNGFTALHVAAYYNSDKVGRLLLENGAPVDYTSKNNVTALHVAAKWGRNKMVKVLLEFNANVEMSTRDGIRPLHCAASQGHRDICALLIEHKANCNTRTKNGLVPLHMVAQGNHSELVEFFINQNSVNVNETSLDFLTPLHISSHCNNVEVAEALIKHGANVNDRALNGFVALHIAAKQNHVEFVEMLMSNLCMIDTQTESGFTALHIASIIGSESIAKKL---------------------------------VENNCEIDIPDQFDRTSLHMATIFNHFNIVVYLKEHGGSVDKQMKTGETCLMLAIKSEHKAIVEYLINQGASMSVSDSWGLT----ALHWATLVVRENILN----------SNCTDININEAIEIFKFVL--------------DGCSRFDI--------------------NRTTKNGISSLHLAADCGCLEIVHLLLDKGADINIISINGTTPLHIACKXXXXXXXXXXXXXXXXXXXTMAYVSCPWSPMHFSSYFGSVDSTILLISHE---NDQTSVREKLRQRTPNG--NTCLHLAVQQLQTDIVRVLLENDADFNLENEDGLSAFDMAKIVDDETII---------NLLGIDTTEMMTTDDKVYLFQREEFSDEEQLETLYMDSLNE---------LEFFGIGKNSGEKCELQLSIMSLLDYATTIDSIRRADMSLKINNSLNRYRNITLSEIKTRELLIAAQPASMISTISSTNTEM-----SPFDVEKWDFHRVTDLPVNSGFLVSFLVDARGGYMQAQRMPQMKIFVPPDAAPAPTRIICHLLRPEGVANLPGMNDCDGFASRILQIHSSCSRFQKPILIEMPYIALLKSNDREIVILKKNADSDTWKKHSNTFTEETLKAEFGSLYESITPVDQLESNRICRIITTDVPTYFSLISQFQRDVNMIGPDGGYIESKTDKRIKLTFPQGALMKKIQIGLEVQHVDPGIINHVVGDNHKISLSPIITVEPKRRKFRDLIEIQMGLPK--------GVTKNDIQDLKLLFSISEYIT--DWEDVTSSTELVLLENTNCMAHSTKISARVWLIYAPNVPNISELANKIYALHCPTPYVGKFLSYARRHDQEECQIRCLLITDDTPDKTLECQESFELIATGPEVEVINKLQYQIECAGNIVAVTKSDEAILFPVQSFVENRITLPIRVRNQDEPFQGKIAFIPH---FQSLSKQIVKXXXXXXXXXXXXXXXMVGSFRNPDRKHRVKNATLERIKGCQA---------IAKTELDLKSVADAVGADWRXXXXXXXXXXDDINLVLNENCTD-EEKAFMTLINWQTVLGFKATGNELNRALRQIGREDVVKSCIGDI 4498
            +LRAA  G   KV + L + +D+N CN NGLNALHLASK GH ++V  L+  GA++ A T+K NTA+HIASLAG  EVV+ LV +GAN+N QSQ GFTPLYMAAQENH+ VV+FLL+N +  +++T D FTPLAVA+QQGH++ VS+LL        ND    ++LP LHIA RKDD  +  LLL   H  DV+      S +GFT LH+AA+Y +  V  LLL  GA VD+ ++N++T LHVA+K G   MVK+LL+  + +E  T+DG+ PLHC A  GH  +  +L++  A   ++TKNGL PLHM  QG+H   V+  +  N+  V++ + D+LT LH+++HC + +VA+ ++   AN N +ALNGF  LHIA K+N V+ +E+L+ +   +   TESG T +H+A+ +G E+I K+L                                 ++N  ++DI  + D+T+LH+A+      IV  L + G   +    +G T L L+ +  H+ I   L+ QG+S+S +   G T    A  +  L V   +L           S  T +++    +  +  L              +G +   I                    N  T+ GIS LHLAA  G +++V LLL K A++N+ + NG TPLH+A +++ + V  VLL   +      A     ++P+H + ++G++     L+ ++   N +T V         NG  +  +  + QQ  T I+ +LL+  A  N    +G +A  +A+ +   +++         NL     TE    +    + +  + SD+E ++     ++ E          E +   ++  E  +  L     + ++    S      S   +N+LNR  +     +   E+L   +   +  T    N  M     +P  V++   H     PV+SGFLVSF+VDARGG M+  R   M+I VPP   PAPTRI C L +   +A  P M + +G  SR++++  + ++F  P+++E+P+   ++  +RE+++L+ + + +TWK+H        L +    + E +    +LE  RICRIIT D P YF+++S+ +++ + +GP+GG + S+    +K  FPQGAL KKI++GL+ Q V   ++  ++G+  + S SPI+TVEP+RRKF   I + + +P         G        L+LL SI+   +   WED+T +T L  +  T+C++ +T +SAR WL     +     LA+++Y      PY+ KF+ +A+  D  E  +RC  +TDD  DKTLE QE+FE +A   ++E++       EC GNI  + KS + ++F   +F ENR+   I+VR+  +   G+I+F+      + L +  +  +        + +        + DR+H   +  L +     A           +T+L +  VAD +G  W  LA E+    D+IN +  EN      ++FM L  W +  G  AT + L   L ++ R D+V    G I
Sbjct:   46 YLRAARAGNLEKVLDYLKTGVDINICNQNGLNALHLASKEGHVEVVAELLKLGANVDAATKKGNTALHIASLAGQTEVVRELVTNGANVNAQSQNGFTPLYMAAQENHLDVVRFLLENNSSQSIATEDGFTPLAVALQQGHDQVVSLLL-------ENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVE------SKSGFTPLHIAAHYGNINVATLLLNRGAAVDFMARNDITPLHVASKRGNGNMVKLLLDRGSKIEAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNAP-VDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQIDVVRYLLQNGAKVDIKAKDDQTALHIASRLGKLEIVQQLLQKGALPNAATTSGYTPLHLSAREGHQEIAALLLEQGSSLSAATKKGFTPLHVAAKYGQLEVANLLLQKKAAPDAAGKSGLTPLHVAAHYDNQRVALLLLDQGASPHSPAKNGYTPLHIAAKKNQLEIGTTLLEYGAECNTVTRQGISPLHLAAQEGSVDLVSLLLTKQANVNMGNKNGLTPLHLAAQDDKAGVTEVLLNHGAEID---AQTKSGYTPLHVACHYGNMKMANFLLENQAKPNAKTKV-------IVNGYFDMLIPFSAQQGHTHIINMLLQYGASPNELTLNGNTALSIARRLGYISVVDTLRGVTDENLTATPITEKHKINVPETMNEFLDMSDDEAVKDHEAQTVGEEGEDAMTGETEKYLRPQDLRELGDDSLPQEGYMGFSIGARSASLRSFSSDRSNTLNR-SSFARDSMMIEEILAPTKDTHLAVTREYNNECMRRYSWTPDTVDQS--HNTVCSPVHSGFLVSFMVDARGGSMRGSRHDGMRIIVPPRKCPAPTRITCRLAKRHRLAYPPPMVEGEGLVSRLVEMGPAGAQFLGPVIVEIPHFGSMRGKERELIVLRSD-NGETWKEHHYDCKVTELTSILNGMDEEMDSPAELEKKRICRIITKDFPQYFAVVSRIKQESDHMGPEGGVLTSEAVPMVKAAFPQGALTKKIRVGLQAQPVPEDMVRTIIGN--RASFSPIVTVEPRRRKFHKPITMTIPVPPRSKEAVANGRKGEPAPCLRLLCSITGGTSPAQWEDITGTTPLSFV--TDCVSFTTNVSARFWLADCQQISETVGLASQLYRELICVPYLAKFVVFAKMIDHIEFSMRCFCMTDDKVDKTLEQQENFEEVARSKDIEILEGKPIHGECYGNIYPLAKSGQQLIFNFYAFKENRLPFNIKVRDIGQEPCGRISFLREPKTAKGLPQSAICNLNFTLPTHRKEMESDPDDENDKDRRHTFASLALRKRYSYLADPASSPQSPCERTDLRMAIVADHLGLSWTELAREMNFSVDEINHIRTENPNSLTAQSFMLLKKWVSRDGKNATTDALTAVLTKVNRMDIVTLLEGPI 1568          
BLAST of Ankyrin-2 vs. Ensembl Zebrafish
Match: ank3a (ankyrin 3a [Source:ZFIN;Acc:ZDB-GENE-060621-1])

HSP 1 Score: 772.696 bits (1994), Expect = 0.000e+0
Identity = 480/1403 (34.21%), Postives = 757/1403 (53.96%), Query Frame = 2
Query:  236 FLRAAHNGYFSKVQEALNSNIDVNSCNSNGLNALHLASKGGHADIVQFLIDNGADIGAKTRKNNTAIHIASLAGSLEVVKILVKHGANINEQSQTGFTPLYMAAQENHVGVVKFLLDNGADINLSTTDNFTPLAVAIQQGHEETVSILLNKSNFLNSNDISNDIKLPPLHIATRKDDYHAVLLLLH--HQEDVQAAL--TQASLNGFTALHVAAYYNSDKVGRLLLENGAPVDYTSKNNVTALHVAAKWGRNKMVKVLLEFNANVEMSTRDGIRPLHCAASQGHRDICALLIEHKANCNTRTKNGLVPLHMVAQGNHSELVEFFINQNSVNVNETSLDFLTPLHISSHCNNVEVAEALIKHGANVNDRALNGFVALHIAAKQNHVEFVEMLMSNLCMIDTQTESGFTALHIASIIGSESIAKKL---------------------------------VENNCEIDIPDQFDRTSLHMATIFNHFNIVVYLKEHGGSVDKQMKTGETCLMLAIKSEHKAIVEYLINQGASMSVSDSWGLT----ALHWATLVVRENILN----------SNCTDINI-----NEAIEIFKFVLD-GCSRF------------------------------DINRTTKNGISSLHLAADCGCLEIVHLLLDKGADINIISINGTTPLHIACKXXXXXXXXXXXXXXXXXXXTMAYVSCPWSPMHFSSYFGSVDSTILLISHENDQTSVREKLRQRTPNGNTCLHLAVQQLQTDIVRVLLENDADFNLENEDGLSAFDMAKIVDDETIINLL-GID----TTEMMTTDDKVYLFQR-EEF---SDEEQLETLYMDSLNELEFFGIGKNSGEKCELQLSIMSLLDYATTIDSIRRADMSLKINNSLNRYRNITLSEIKTRELLIAAQPASMISTISSTNTEMSPFDVEKW------DFHRVTDLPVNSG-----------FLVSFLVDARGGYMQAQRMPQMKIFVPPDAAPAPTRIICHLLRPEGVANLPGMNDCDGFASRILQIHSSCSRFQKPILIEMPYIALLKSNDREIVILKKNADSDTWKKHSNTFTEETLKAEFGSLYESITPVDQLESNRICRIITTDVPTYFSLISQFQRDVNMIGPDGGYIESKTDKRIKLTFPQGALMKKIQIGLEVQHVDPGIINHVVGDNHKISLSPIITVEPKRRKFRDLIEIQMGLPK--------GVTKNDIQDLKLLFSISEYIT--DWEDVTSSTELVLLENTNCMAHSTKISARVWLIYAPNVPNISELANKIYALHCPTPYVGKFLSYARRHDQEECQIRCLLITDDTPDKTLECQESFELIATGPEVEVINKLQYQIECAGNIVAVTKSDEAILFPVQSFVENRITLPIRVRNQDEPFQGKIAFI 4075
            +LRAA  G   KV + L + +D+N CN NGLNALHLASK GH ++V  L+  GA++ A T+K NTA+HIASLAG  EVV+ LV +GAN+N QSQ GFTPLYMAAQENH+ VV+FLL+N +  +++T D FTPLAVA+QQGH++ VS+LL        ND    ++LP LHIA RKDD  +  LLL   H  DV++ +   + + +GFT LH+AA+Y +  V  LLL  GA VD+ ++N++T LHVA+K G   MVK+LL+  + +E  T+DG+ PLHC A  GH  +  +L++  A   ++TKNGL PLHM  QG+H   V+  +  N+  V++ + D+LT LH+++HC + +VA+ ++   AN N +ALNGF  LHIA K+N V+ +E+L+ +   +   TESG T +H+A+ +G E+I K+L                                 ++N  ++DI  + D+T+LH+A+      IV  L + G   +    +G T L L+ +  H+ I   L+ QG+S+S +   G T    A  +  L V   +L           S  T +++     N+ + +   +LD G S                                + N  T+ GIS LHLAA  G +++V LLL K A++N+ + NG TPLH+A +++ + V  VLL   +      A     ++P+H + ++G++     L+ ++        K   +T NG T LH A QQ  T I+ +LL+  A  N    +G +A  +A+ +   ++++ L G+     T   +T   K+ + +   EF   SD+E  + +      E E +   ++  E  +  L     + ++    S      S   +N+LNR  +     +   E+L   +   +  T    N  M  +    W        H     PV+SG           FLVSF+VDARGG M+  R   M+I VPP   PAPTRI C L +   +A  P M + +G  SR++++  + ++F  P+++E+P+   ++  +RE+++L+ + + +TWK+H        L +    + E +    +LE  RICRIIT D P YF+++S+ +++ + +GP+GG + S+    +K  FPQGAL KKI++GL+ Q V   ++  ++G+  + S SPI+TVEP+RRKF   I + + +P         G        L+LL SI+   +   WED+T +T L  +  T+C++ +T +SAR WL     +     LA+++Y      PY+ KF+ +A+  D  E  +RC  +TDD  DKTLE QE+FE +A   ++E++       EC GNI  + KS + ++F   +F ENR+   I+VR+  +   G+I+F+
Sbjct:   29 YLRAARAGNLEKVLDYLKTGVDINICNQNGLNALHLASKEGHVEVVAELLKLGANVDAATKKGNTALHIASLAGQTEVVRELVTNGANVNAQSQNGFTPLYMAAQENHLDVVRFLLENNSSQSIATEDGFTPLAVALQQGHDQVVSLLLE-------NDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVESKMMVNRTTESGFTPLHIAAHYGNINVATLLLNRGAAVDFMARNDITPLHVASKRGNGNMVKLLLDRGSKIEAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNAP-VDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQIDVVRYLLQNGAKVDIKAKDDQTALHIASRLGKLEIVQQLLQKGALPNAATTSGYTPLHLSAREGHQEIAALLLEQGSSLSAATKKGFTPLHVAAKYGQLEVANLLLQKKAAPDAAGKSGLTPLHVAAHYDNQRVALL--LLDQGASPHSPAKNGYTPLHIAAKKNQLEIGTTLLEYGAECNTVTRQGISPLHLAAQEGSVDLVSLLLTKQANVNMGNKNGLTPLHLAAQDDKAGVTEVLLNHGAEID---AQTKSGYTPLHVACHYGNMKMANFLLENQ-------AKPNAKTKNGYTPLHQAAQQGHTHIINMLLQYGASPNELTLNGNTALSIARRLGYISVVDTLRGVTDENLTATPITEKHKINVPETMNEFLDMSDDEGEDAM----TGETEKYLRPQDLRELGDDSLPQEGYMGFSIGARSASLRSFSSDRSNTLNRS-SFARDSMMIEEILAPTKDTHLAVTREYNNECMRRYS---WTPDTVDQSHNTVCSPVHSGPSSPLPQYDSRFLVSFMVDARGGSMRGSRHDGMRIIVPPRKCPAPTRITCRLAKRHRLAYPPPMVEGEGLVSRLVEMGPAGAQFLGPVIVEIPHFGSMRGKERELIVLRSD-NGETWKEHHYDCKVTELTSILNGMDEEMDSPAELEKKRICRIITKDFPQYFAVVSRIKQESDHMGPEGGVLTSEAVPMVKAAFPQGALTKKIRVGLQAQPVPEDMVRTIIGN--RASFSPIVTVEPRRRKFHKPITMTIPVPPRSKEAVANGRKGEPAPCLRLLCSITGGTSPAQWEDITGTTPLSFV--TDCVSFTTNVSARFWLADCQQISETVGLASQLYRELICVPYLAKFVVFAKMIDHIEFSMRCFCMTDDKVDKTLEQQENFEEVARSKDIEILEGKPIHGECYGNIYPLAKSGQQLIFNFYAFKENRLPFNIKVRDIGQEPCGRISFL 1398          
BLAST of Ankyrin-2 vs. Ensembl Xenopus
Match: tpm4 (tropomyosin 4 [Source:Xenbase;Acc:XB-GENE-6077097])

HSP 1 Score: 833.943 bits (2153), Expect = 0.000e+0
Identity = 529/1540 (34.35%), Postives = 821/1540 (53.31%), Query Frame = 2
Query:  236 FLRAAHNGYFSKVQEALNSNIDVNSCNSNGLNALHLASKGGHADIVQFLIDNGADIGAKTRKNNTAIHIASLAGSLEVVKILVKHGANINEQSQTGFTPLYMAAQENHVGVVKFLLDNGADINLSTTDNFTPLAVAIQQGHEETVSILLNKSNFLNSNDISNDIKLPPLHIATRKDDYHAVLLLLH--HQEDVQAALTQASLNGFTALHVAAYYNSDKVGRLLLENGAPVDYTSKNNVTALHVAAKWGRNKMVKVLLEFNANVEMSTRDGIRPLHCAASQGHRDICALLIEHKANCNTRTKNGLVPLHMVAQGNHSELVEFFINQNSVNVNETSLDFLTPLHISSHCNNVEVAEALIKHGANVNDRALNGFVALHIAAKQNHVEFVEMLMSNLCMIDTQTESGFT---------------------------------ALHIASIIGSESIAKKLVENNCEIDIPDQFDRTSLHMATIFNHFNIVVYLKEHGGSVDKQMKTGETCLMLAIKSEHKAIVEYLINQGASMSVSDSWGLTALHWAT---------LVVRENIL-----NSNCTDININEAIEIFKFVL----DGCSRF------------------------------DINRTTKNGISSLHLAADCGCLEIVHLLLDKGADINIISINGTTPLHIACKXXXXXXXXXXXXXXXXXXXTMAYVSCPWSPMHFSSYFGSVDSTILLISHENDQTSVREKLRQRTPNGNTCLHLAVQQLQTDIVRVLLENDADFNLENEDGLSAFDMAKIVDDETIINLLGIDTTEMMTTDDKVYLFQREEFSDEEQLETLYMDSLNELEFFGIG---KNSGEKCELQLSIMSLLDYATTIDSIRRADMSLKINNSLNRYRNITLSE-------IKTRELLIAA--QPASMISTISSTNTEMSPFDVEKWDFHRVTDLPVNSGFLVSFLVDARGGYMQAQRMPQMKIFVPPDAAPAPTRIICHLLRPEGVANLPGMNDCDGFASRILQIHSSCSRFQKPILIEMPYIALLKSNDREIVILKKNADSDTWKKHSNTFTEETLKAEFGSLYESITPVDQLESNRICRIITTDVPTYFSLISQFQRDVNMIGPDGGYIESKTDKRIKLTFPQGALMKKIQIGLEVQHVDPGIINHVVGDNHKISLSPIITVEPKRRKFRDLIEIQMGLPK--------GVTKNDIQDLKLLFSISEYIT--DWEDVTSSTELVLLENTNCMAHSTKISARVWLIYAPNVPNISELANKIYALHCPTPYVGKFLSYARRHDQEECQIRCLLITDDTPDKTLECQESFELIATGPEVEVINKLQYQIECAGNIVAVTKSDEAILFPVQSFVENRITLPIRVRNQDEPFQGKIAFIPHFQS---LSKQIV----------KXXXXXXXXXXXXXXXMVGSFRNPDRKHRVKNATLERIKGCQAIAKTELDLKSVADAVGADWRXXXXXXXXXXDDINLVLNENCTD-EEKAFMTLINWQTVLGFKATGNELNRALRQIGREDVVKSCIGDI 4498
            +LRAA +G   K  + L + +D+N CN NGLNALHLASK GH +IV  LI  GAD+ A T+K NTA+HIASLAG  EVV++LV +GAN+N QSQ GFTPLYMAAQENH+ VVKFLLDNGA  +L+T D FTPLAVA+QQGH++ VS+LL        ND    ++LP LHIA RKDD  A  LLL   H  DV+      S +GFT LH+AA+Y +  V  LLL  GA VD+T++N++T LHVA+K G   MVK+LL+  + ++  TRDG+ PLHC A  GH  +  +L++  A   ++TKNGL PLHM  QG+H   V+  + Q++V V++ + D+LT LH+++HC + +VA+ L+   AN N +ALNGF  LHIA K+N ++ +E+L+ +   I   TESG T                                 ALH+A+  G   + + L++N  +++   + D+T LH++      +IV  L + G   D    +G T L L+ +  H  +   L+  GAS  +    G T LH A          L++++N        S  T +++    +  K  L     G S                                D N  TK GI+ +HLAA  G +++V LLL + A++N+ + +G TPLH+A + +  +V  VL    +    T       ++P+H +S++G++     L+ H +       K+  +T NG T LH A QQ  T I+ VLL++ A  N    +G +A  +A+ +   ++++ L + T E +TT   V   ++ + +  E +  +   S +E E    G   K  G +   +L   SL     T  SI     SL+   S +  R+ TL+        +   ELL  +  Q  S+     S +     +  +  D   +   PV+SGFLVSF+VDARGG M+  R   M+I +PP    APTRI C L++   +A  P M + +G ASR++++  S ++F  P+++E+P+   ++S +RE+++L+ + + + WK+H      E L      + E +   ++LE  RICRI+T D P YF+++S+ +++ N IGP+GG ++S T  R++ +FP+GAL K+I++GL+ Q V   ++  V+G+  + + SPI+TVEP+RRKF   I + + +P         G   +    L+LL SI+   +   WED+T +T L  +   +C++ +T +SAR WL     +P    LA ++Y      PY+ KF+ +A+ +D  E ++RC  +TDD  DKTLE QE+FE +A   ++EV+      ++C GN+  +TK  + ++F   +F ENR+   ++VR+  +   G+++F+   ++   L +  V          K  T  D       +D   +F +   + R    T   +       +T++ +  VAD +G  W  LA EL    D+IN +  EN      ++FM L  W    G  AT + L   L +I R D+V    G I
Sbjct:   19 YLRAARSGNLEKALDYLKNGVDINICNQNGLNALHLASKEGHVEIVSELIQRGADVDASTKKGNTALHIASLAGQTEVVRVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVKFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLE-------NDTKGKVRLPALHIAARKDDTKAAALLLQNDHNADVE------SKSGFTPLHIAAHYGNINVATLLLNRGAAVDFTARNDITPLHVASKRGNANMVKLLLDRGSKIDAKTRDGLTPLHCGARSGHEQVVGMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLL-QHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRLKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLNHHGASPNTTNVRGETALHMAARAGQSEVVRFLLQNGAQVEAKAKDDQTPLHISARLGKADIVQQLLKQGAYPDAATTSGYTPLHLSSREGHDDVASVLLEHGASFGIVTKKGFTPLHVAAKYGKIEVVKLLLQKNASPDAAGKSGLTPLHVAAHYDNQKVALLLLDKGASPHGAAKNGYTPLHIAAKKNQMDIATTLLEYGADANAITKQGIAPVHLAAQEGHVDMVSLLLTRSANVNVSNKSGLTPLHLAAQEDRVSVAEVLANQGAVIDGTTKMF---YTPLHVASHYGNIKMVTFLLQHGS-------KVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGASPNEVTVNGNTALAIARRLGYISVVDTLKVVTEETLTTVQLVT--EKHKMNVPETMNEVLDMSDDEGEDAMTGDTDKYLGPQDLKELGDDSLPQEGYTGFSIGARSASLR---SFSSDRSYTLNRSSFARDSMMIEELLAPSKDQHLSLTRDFDSDSLRHYSWAADTLDNVNLVSSPVHSGFLVSFMVDARGGSMRGSRHNGMRIIIPPRKCTAPTRITCRLVKRHKLATPPPMVEGEGLASRLVEMGPSGAQFLGPVIVEIPHFGSMRSKERELIVLR-SENGENWKEHQYDCRVEELTELLNGMDEELDSAEELEKKRICRIVTKDFPQYFAVVSRIKQESNQIGPEGGVLKSTTVPRVQASFPEGALTKRIRVGLQAQPVPDDLVKKVIGN--RATFSPIVTVEPRRRKFHKPITMTIPIPPPSGEGVSNGYKGDTTPSLRLLCSITGGTSPAQWEDITGTTPLTFV--NDCVSFTTNVSARFWLGDCHQIPETVSLATQLYRELICVPYMAKFVVFAKMNDPVEARLRCFCMTDDKVDKTLEQQENFEEVARSKDIEVLEGKPIYVDCYGNLAPLTKGGQQLIFNFYAFKENRLPFSVKVRDHSQEPCGRLSFLKEPKTTKGLPQTAVCNLNITLPTQKKETESDQDDENEKVDRRQNFVSLALRKRYSYLTEPGMSPQSPCERTDIRMAIVADHLGLSWTELARELNFSVDEINQIRVENPNSLTAQSFMLLKKWVVRDGKNATTDALTNVLTKINRIDIVTLLEGPI 1524          
BLAST of Ankyrin-2 vs. Ensembl Xenopus
Match: tpm4 (tropomyosin 4 [Source:Xenbase;Acc:XB-GENE-6077097])

HSP 1 Score: 832.787 bits (2150), Expect = 0.000e+0
Identity = 529/1540 (34.35%), Postives = 821/1540 (53.31%), Query Frame = 2
Query:  236 FLRAAHNGYFSKVQEALNSNIDVNSCNSNGLNALHLASKGGHADIVQFLIDNGADIGAKTRKNNTAIHIASLAGSLEVVKILVKHGANINEQSQTGFTPLYMAAQENHVGVVKFLLDNGADINLSTTDNFTPLAVAIQQGHEETVSILLNKSNFLNSNDISNDIKLPPLHIATRKDDYHAVLLLLH--HQEDVQAALTQASLNGFTALHVAAYYNSDKVGRLLLENGAPVDYTSKNNVTALHVAAKWGRNKMVKVLLEFNANVEMSTRDGIRPLHCAASQGHRDICALLIEHKANCNTRTKNGLVPLHMVAQGNHSELVEFFINQNSVNVNETSLDFLTPLHISSHCNNVEVAEALIKHGANVNDRALNGFVALHIAAKQNHVEFVEMLMSNLCMIDTQTESGFT---------------------------------ALHIASIIGSESIAKKLVENNCEIDIPDQFDRTSLHMATIFNHFNIVVYLKEHGGSVDKQMKTGETCLMLAIKSEHKAIVEYLINQGASMSVSDSWGLTALHWAT---------LVVRENIL-----NSNCTDININEAIEIFKFVL----DGCSRF------------------------------DINRTTKNGISSLHLAADCGCLEIVHLLLDKGADINIISINGTTPLHIACKXXXXXXXXXXXXXXXXXXXTMAYVSCPWSPMHFSSYFGSVDSTILLISHENDQTSVREKLRQRTPNGNTCLHLAVQQLQTDIVRVLLENDADFNLENEDGLSAFDMAKIVDDETIINLLGIDTTEMMTTDDKVYLFQREEFSDEEQLETLYMDSLNELEFFGIG---KNSGEKCELQLSIMSLLDYATTIDSIRRADMSLKINNSLNRYRNITLSE-------IKTRELLIAA--QPASMISTISSTNTEMSPFDVEKWDFHRVTDLPVNSGFLVSFLVDARGGYMQAQRMPQMKIFVPPDAAPAPTRIICHLLRPEGVANLPGMNDCDGFASRILQIHSSCSRFQKPILIEMPYIALLKSNDREIVILKKNADSDTWKKHSNTFTEETLKAEFGSLYESITPVDQLESNRICRIITTDVPTYFSLISQFQRDVNMIGPDGGYIESKTDKRIKLTFPQGALMKKIQIGLEVQHVDPGIINHVVGDNHKISLSPIITVEPKRRKFRDLIEIQMGLPK--------GVTKNDIQDLKLLFSISEYIT--DWEDVTSSTELVLLENTNCMAHSTKISARVWLIYAPNVPNISELANKIYALHCPTPYVGKFLSYARRHDQEECQIRCLLITDDTPDKTLECQESFELIATGPEVEVINKLQYQIECAGNIVAVTKSDEAILFPVQSFVENRITLPIRVRNQDEPFQGKIAFIPHFQS---LSKQIV----------KXXXXXXXXXXXXXXXMVGSFRNPDRKHRVKNATLERIKGCQAIAKTELDLKSVADAVGADWRXXXXXXXXXXDDINLVLNENCTD-EEKAFMTLINWQTVLGFKATGNELNRALRQIGREDVVKSCIGDI 4498
            +LRAA +G   K  + L + +D+N CN NGLNALHLASK GH +IV  LI  GAD+ A T+K NTA+HIASLAG  EVV++LV +GAN+N QSQ GFTPLYMAAQENH+ VVKFLLDNGA  +L+T D FTPLAVA+QQGH++ VS+LL        ND    ++LP LHIA RKDD  A  LLL   H  DV+      S +GFT LH+AA+Y +  V  LLL  GA VD+T++N++T LHVA+K G   MVK+LL+  + ++  TRDG+ PLHC A  GH  +  +L++  A   ++TKNGL PLHM  QG+H   V+  + Q++V V++ + D+LT LH+++HC + +VA+ L+   AN N +ALNGF  LHIA K+N ++ +E+L+ +   I   TESG T                                 ALH+A+  G   + + L++N  +++   + D+T LH++      +IV  L + G   D    +G T L L+ +  H  +   L+  GAS  +    G T LH A          L++++N        S  T +++    +  K  L     G S                                D N  TK GI+ +HLAA  G +++V LLL + A++N+ + +G TPLH+A + +  +V  VL    +    T       ++P+H +S++G++     L+ H +       K+  +T NG T LH A QQ  T I+ VLL++ A  N    +G +A  +A+ +   ++++ L + T E +TT   V   ++ + +  E +  +   S +E E    G   K  G +   +L   SL     T  SI     SL+   S +  R+ TL+        +   ELL  +  Q  S+     S +     +  +  D   +   PV+SGFLVSF+VDARGG M+  R   M+I +PP    APTRI C L++   +A  P M + +G ASR++++  S ++F  P+++E+P+   ++S +RE+++L+ + + + WK+H      E L      + E +   ++LE  RICRI+T D P YF+++S+ +++ N IGP+GG ++S T  R++ +FP+GAL K+I++GL+ Q V   ++  V+G+  + + SPI+TVEP+RRKF   I + + +P         G   +    L+LL SI+   +   WED+T +T L  +   +C++ +T +SAR WL     +P    LA ++Y      PY+ KF+ +A+ +D  E ++RC  +TDD  DKTLE QE+FE +A   ++EV+      ++C GN+  +TK  + ++F   +F ENR+   ++VR+  +   G+++F+   ++   L +  V          K  T  D       +D   +F +   + R    T   +       +T++ +  VAD +G  W  LA EL    D+IN +  EN      ++FM L  W    G  AT + L   L +I R D+V    G I
Sbjct:   19 YLRAARSGNLEKALDYLKNGVDINICNQNGLNALHLASKEGHVEIVSELIQRGADVDASTKKGNTALHIASLAGQTEVVRVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVKFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLE-------NDTKGKVRLPALHIAARKDDTKAAALLLQNDHNADVE------SKSGFTPLHIAAHYGNINVATLLLNRGAAVDFTARNDITPLHVASKRGNANMVKLLLDRGSKIDAKTRDGLTPLHCGARSGHEQVVGMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLL-QHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRLKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLNHHGASPNTTNVRGETALHMAARAGQSEVVRFLLQNGAQVEAKAKDDQTPLHISARLGKADIVQQLLKQGAYPDAATTSGYTPLHLSSREGHDDVASVLLEHGASFGIVTKKGFTPLHVAAKYGKIEVVKLLLQKNASPDAAGKSGLTPLHVAAHYDNQKVALLLLDKGASPHGAAKNGYTPLHIAAKKNQMDIATTLLEYGADANAITKQGIAPVHLAAQEGHVDMVSLLLTRSANVNVSNKSGLTPLHLAAQEDRVSVAEVLANQGAVIDGTTKMF---YTPLHVASHYGNIKMVTFLLQHGS-------KVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGASPNEVTVNGNTALAIARRLGYISVVDTLKVVTEETLTTVQLVT--EKHKMNVPETMNEVLDMSDDEGEDAMTGDTDKYLGPQDLKELGDDSLPQEGYTGFSIGARSASLR---SFSSDRSYTLNRSSFARDSMMIEELLAPSKDQHLSLTRDFDSDSLRHYSWAADTLDNVNLVSSPVHSGFLVSFMVDARGGSMRGSRHNGMRIIIPPRKCTAPTRITCRLVKRHKLATPPPMVEGEGLASRLVEMGPSGAQFLGPVIVEIPHFGSMRSKERELIVLR-SENGENWKEHQYDCRVEELTELLNGMDEELDSAEELEKKRICRIVTKDFPQYFAVVSRIKQESNQIGPEGGVLKSTTVPRVQASFPEGALTKRIRVGLQAQPVPDDLVKKVIGN--RATFSPIVTVEPRRRKFHKPITMTIPIPPPSGEGVSNGYKGDTTPSLRLLCSITGGTSPAQWEDITGTTPLTFV--NDCVSFTTNVSARFWLGDCHQIPETVSLATQLYRELICVPYMAKFVVFAKMNDPVEARLRCFCMTDDKVDKTLEQQENFEEVARSKDIEVLEGKPIYVDCYGNLAPLTKGGQQLIFNFYAFKENRLPFSVKVRDHSQEPCGRLSFLKEPKTTKGLPQTAVCNLNITLPTQKKETESDQDDENEKVDRRQNFVSLALRKRYSYLTEPGMSPQSPCERTDIRMAIVADHLGLSWTELARELNFSVDEINQIRVENPNSLTAQSFMLLKKWVVRDGKNATTDALTNVLTKINRIDIVTLLEGPI 1524          
BLAST of Ankyrin-2 vs. Ensembl Xenopus
Match: tpm4 (tropomyosin 4 [Source:Xenbase;Acc:XB-GENE-6077097])

HSP 1 Score: 831.632 bits (2147), Expect = 0.000e+0
Identity = 527/1550 (34.00%), Postives = 811/1550 (52.32%), Query Frame = 2
Query:  236 FLRAAHNGYFSKVQEALNSNIDVNSCNSNGLNALHLASKGGHADIVQFLIDNGADIGAKTRKNNTAIHIASLAGSLEVVKILVKHGANINEQSQTGFTPLYMAAQENHVGVVKFLLDNGADINLSTTDNFTPLAVAIQQGHEETVSILLNKSNFLNSNDISNDIKLPPLHIATRKDDYHAVLLLLH--HQEDVQAALTQASLNGFTALHVAAYYNSDKVGRLLLENGAPVDYTSKNNVTALHVAAKWGRNKMVKVLLEFNANVEMSTRDGIRPLHCAASQGHRDICALLIEHKANCNTRTKNGLVPLHMVAQGNHSELVEFFINQNSVNVNETSLDFLTPLHISSHCNNVEVAEALIKHGANVNDRALNGFVALHIAAKQNHVEFVEMLMSNLCMIDTQTESGFT---------------------------------ALHIASIIGSESIAKKLVENNCEIDIPDQFDRTSLHMATIFNHFNIVVYLKEHGGSVDKQMKTGETCLMLAIKSEHKAIVEYLINQGASMSVSDSWGLTALHWAT---------LVVRENIL-----NSNCTDININEAIEIFKFVL----DGCSRF------------------------------DINRTTKNGISSLHLAADCGCLEIVHLLLDKGADINIISINGTTPLHIACKXXXXXXXXXXXXXXXXXXXTMAYVSCPWSPMHFSSYFGSVDSTILLISHENDQTSVREKLRQRTPNGNTCLHLAVQQLQTDIVRVLLENDADFNLENEDGLSAFDMAK------IVD----------------------DETIINLLGIDTTE---MMTTDDKVYLFQREEFSDEEQLETLYMDSLNELEF--FGIGKNSGEKCELQLSIMSLLDYATTIDSIRRADMSLKINNSLNRYRNITLSEIKTRELLIAA--QPASMISTISSTNTEMSPFDVEKWDFHRVTDLPVNSGFLVSFLVDARGGYMQAQRMPQMKIFVPPDAAPAPTRIICHLLRPEGVANLPGMNDCDGFASRILQIHSSCSRFQKPILIEMPYIALLKSNDREIVILKKNADSDTWKKHSNTFTEETLKAEFGSLYESITPVDQLESNRICRIITTDVPTYFSLISQFQRDVNMIGPDGGYIESKTDKRIKLTFPQGALMKKIQIGLEVQHVDPGIINHVVGDNHKISLSPIITVEPKRRKFRDLIEIQMGLPK--------GVTKNDIQDLKLLFSISEYIT--DWEDVTSSTELVLLENTNCMAHSTKISARVWLIYAPNVPNISELANKIYALHCPTPYVGKFLSYARRHDQEECQIRCLLITDDTPDKTLECQESFELIATGPEVEVINKLQYQIECAGNIVAVTKSDEAILFPVQSFVENRITLPIRVRNQDEPFQGKIAFIPHFQSLSKQIVKXXXXXXXXXXXXXXXMVGSFRNPDRKHRVKNATLERIKGCQAIAKTELDLKSVADAVGADWRXXXXXXXXXXDDINLVLNENCTD-EEKAFMTLINWQTVLGFKATGNELNRALRQIGREDVVKSCIGDI 4498
            +LRAA +G   K  + L + +D+N CN NGLNALHLASK GH +IV  LI  GAD+ A T+K NTA+HIASLAG  EVV++LV +GAN+N QSQ GFTPLYMAAQENH+ VVKFLLDNGA  +L+T D FTPLAVA+QQGH++ VS+LL        ND    ++LP LHIA RKDD  A  LLL   H  DV+      S +GFT LH+AA+Y +  V  LLL  GA VD+T++N++T LHVA+K G   MVK+LL+  + ++  TRDG+ PLHC A  GH  +  +L++  A   ++TKNGL PLHM  QG+H   V+  + Q++V V++ + D+LT LH+++HC + +VA+ L+   AN N +ALNGF  LHIA K+N ++ +E+L+ +   I   TESG T                                 ALH+A+  G   + + L++N  +++   + D+T LH++      +IV  L + G   D    +G T L L+ +  H  +   L+  GAS  +    G T LH A          L++++N        S  T +++    +  K  L     G S                                D N  TK GI+ +HLAA  G +++V LLL + A++N+ + +G TPLH+A + +  +V  VL    +    T       ++P+H +S++G++     L+ H +       K+  +T NG T LH A QQ  T I+ VLL++ A  N    +G +A  +A+      +VD                       ET+  +L +   E    MT D   YL         + L+ L  DSL +  +  F IG  S           SL  +++        D S  +N S     +     +   ELL  +  Q  S+     S +     +  +  D   +   PV+SGFLVSF+VDARGG M+  R   M+I +PP    APTRI C L++   +A  P M + +G ASR++++  S ++F  P+++E+P+   ++S +RE+++L+ + + + WK+H      E L      + E +   ++LE  RICRI+T D P YF+++S+ +++ N IGP+GG ++S T  R++ +FP+GAL K+I++GL+ Q V   ++  V+G+  + + SPI+TVEP+RRKF   I + + +P         G   +    L+LL SI+   +   WED+T +T L  +   +C++ +T +SAR WL     +P    LA ++Y      PY+ KF+ +A+ +D  E ++RC  +TDD  DKTLE QE+FE +A   ++EV+      ++C GN+  +TK  + ++F   +F ENR+   ++VR+  +   G+++F+        +  K +    +    I +         DR+    +  L     C+   +T++ +  VAD +G  W  LA EL    D+IN +  EN      ++FM L  W    G  AT + L   L +I R D+V    G I
Sbjct:   28 YLRAARSGNLEKALDYLKNGVDINICNQNGLNALHLASKEGHVEIVSELIQRGADVDASTKKGNTALHIASLAGQTEVVRVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVKFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLE-------NDTKGKVRLPALHIAARKDDTKAAALLLQNDHNADVE------SKSGFTPLHIAAHYGNINVATLLLNRGAAVDFTARNDITPLHVASKRGNANMVKLLLDRGSKIDAKTRDGLTPLHCGARSGHEQVVGMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLL-QHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRLKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLNHHGASPNTTNVRGETALHMAARAGQSEVVRFLLQNGAQVEAKAKDDQTPLHISARLGKADIVQQLLKQGAYPDAATTSGYTPLHLSSREGHDDVASVLLEHGASFGIVTKKGFTPLHVAAKYGKIEVVKLLLQKNASPDAAGKSGLTPLHVAAHYDNQKVALLLLDKGASPHGAAKNGYTPLHIAAKKNQMDIATTLLEYGADANAITKQGIAPVHLAAQEGHVDMVSLLLTRSANVNVSNKSGLTPLHLAAQEDRVSVAEVLANQGAVIDGTTKMF---YTPLHVASHYGNIKMVTFLLQHGS-------KVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGASPNEVTVNGNTALAIARRLGYISVVDTLKVVTEETLTTLVTEKHKMNVPETMNEVLDMSDDEGEDAMTGDTDKYL-------GPQDLKELGDDSLPQEGYTGFSIGARSA----------SLRSFSS--------DRSYTLNRS-----SFARDSMMIEELLAPSKDQHLSLTRDFDSDSLRHYSWAADTLDNVNLVSSPVHSGFLVSFMVDARGGSMRGSRHNGMRIIIPPRKCTAPTRITCRLVKRHKLATPPPMVEGEGLASRLVEMGPSGAQFLGPVIVEIPHFGSMRSKERELIVLR-SENGENWKEHQYDCRVEELTELLNGMDEELDSAEELEKKRICRIVTKDFPQYFAVVSRIKQESNQIGPEGGVLKSTTVPRVQASFPEGALTKRIRVGLQAQPVPDDLVKKVIGN--RATFSPIVTVEPRRRKFHKPITMTIPIPPPSGEGVSNGYKGDTTPSLRLLCSITGGTSPAQWEDITGTTPLTFV--NDCVSFTTNVSARFWLGDCHQIPETVSLATQLYRELICVPYMAKFVVFAKMNDPVEARLRCFCMTDDKVDKTLEQQENFEEVARSKDIEVLEGKPIYVDCYGNLAPLTKGGQQLIFNFYAFKENRLPFSVKVRDHSQEPCGRLSFLKE-----PKTTKGLPQTAVCNLNITLPTQKKNEKVDRRQNFVSLALRPQSPCE---RTDIRMAIVADHLGLSWTELARELNFSVDEINQIRVENPNSLTAQSFMLLKKWVVRDGKNATTDALTNVLTKINRIDIVTLLEGPI 1510          

HSP 2 Score: 350.903 bits (899), Expect = 1.113e-96
Identity = 235/739 (31.80%), Postives = 369/739 (49.93%), Query Frame = 2
Query:  407 AKTRKNNTAIHIASLAGSLEVVKILVKHGANINEQSQTGFTPLYMAAQENHV---------------------------------GVVKFLLDNGADINLSTTDNFTPL---------------------------------AVAIQQGHEETVSILLNKSNFLNSNDISNDIKLPPLHIATRKDDYHAVLLLLH--HQEDVQAALTQASLNGFTALHVAAYYNSDKVGRLLLENGAPVDYTSKNNVTALHVAAKWGRNKMVKVLLEFNANVEMSTRDGIRPLHCAASQGHRDICALLIEHKANCNTRTKNGLVPLHMVAQGNHSELVEFFINQNSVNVNETSLDFLTPLHISSHCNNVEVAEALIKHGANVNDRALNGFVALHIAAKQNHVEFVEMLMSNLCMIDTQTESGFTALHIASIIGSESIAKKLVENNCEIDIPDQFDRTSLHMATIFNHFNIVVYLKEHGGSVDKQMKTGETCLMLAIKSEHKAIVEYLINQGASMSVSDSWGLTALHWATLVVRENILNSNCTDININEAIEIFKFVLDGCSRFDINRTTKNGISSLHLAADCGCLEIVHLLLDKGADINIISINGTTPLHIACKXXXXXXXXXXXXXXXXXXXTMAYVSCPWSPMHFSSYFGSVDSTILLISHENDQTSVREKLRQRTPNGNTCLHLAVQQLQTDIVRVLLENDADFNLENEDGLSAFDMAKIVDDETIINLLG-----ID-TTEMMTT 2401
             K    N +   A+ +G+LE     +K+G +IN  +Q G   L++A++E HV                                  VV+ L+ NGA++N  + + FTPL                                 AVA+QQGH++ VS+LL        ND    ++LP LHIA RKDD  A  LLL   H  DV+      S +GFT LH+AA+Y +  V  LLL  GA VD+T++N++T LHVA+K G   MVK+LL+  + ++  TRDG+ PLHC A  GH  +  +L++  A   ++TKNGL PLHM  QG+H   V+  + Q++V V++ + D+LT LH+++HC + +VA+ L+   AN N +ALNGF  LHIA K+N ++ +E+L+ +   I   TESG T +H+A+ +G  +I  +L  +    +  +    T+LHMA       +V +L ++G  V+ + K  +T L ++ +     IV+ L+ QGA    + + G T LH ++   RE                ++   +L+  + F I   TK G + LH+AA  G +E+V LLL K A  +    +G TPLH+A      +   V L  L   +         ++P+H ++    +D    L+ +  D  ++       T  G   +HLA Q+   D+V +LL   A+ N+ N+ GL+   +A   D  ++  +L      ID TT+M  T
Sbjct:   19 GKKSDTNASYLRAARSGNLEKALDYLKNGVDINICNQNGLNALHLASKEGHVEIVSELIQRGADVDASTKKGNTALHIASLAGQTEVVRVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVKFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLL-------ENDTKGKVRLPALHIAARKDDTKAAALLLQNDHNADVE------SKSGFTPLHIAAHYGNINVATLLLNRGAAVDFTARNDITPLHVASKRGNANMVKLLLDRGSKIDAKTRDGLTPLHCGARSGHEQVVGMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLL-QHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRLKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLNHHGASPNTTNVRGETALHMAARAGQSEVVRFLLQNGAQVEAKAKDDQTPLHISARLGKADIVQQLLKQGAYPDAATTSGYTPLHLSS---REG-------------HDDVASVLLEHGASFGI--VTKKGFTPLHVAAKYGKIEVVKLLLQKNASPDAAGKSGLTPLHVAAH---YDNQKVALLLLDKGASPHGAAKNGYTPLHIAAKKNQMDIATTLLEYGADANAI-------TKQGIAPVHLAAQEGHVDMVSLLLTRSANVNVSNKSGLTPLHLAAQEDRVSVAEVLANQGAVIDGTTKMFYT 715          
BLAST of Ankyrin-2 vs. Ensembl Xenopus
Match: tpm4 (tropomyosin 4 [Source:Xenbase;Acc:XB-GENE-6077097])

HSP 1 Score: 825.083 bits (2130), Expect = 0.000e+0
Identity = 529/1551 (34.11%), Postives = 821/1551 (52.93%), Query Frame = 2
Query:  236 FLRAAHNGYFSKVQEALNSNIDVNSCNSNGLNALHLASKGGHADIVQFLIDNGADIGAKTRKNNTAIHIASLAGSLEVVKILVKHGANINEQSQTGFTPLYMAAQENHVGVVKFLLDNGADINLSTTDNFTPLAVAIQQGHEETVSILLNKSNFLNSNDISNDIKLPPLHIATRKDDYHAVLLLLH--HQEDVQAALTQASLNGFTALHVAAYYNSDKVGRLLLENGAPVDYTSKNNVTALHVAAKWGRNKMVKVLLEFNANVEMSTRDGIRPLHCAASQGHRDICALLIEHKANCNTRTKNGLVPLHMVAQGNHSELVEFFINQNSVNVNETSLDFLTPLHISSHCNNVEVAEALIKHGANVNDRALNGFVALHIAAKQNHVEFVEMLMSNLCMIDTQTESGFT---------------------------------ALHIASIIGSESIAKKLVENNCEIDIPDQFDRTSLHMATIFNHFNIVVYLKEHGGSVDKQMKTGETCLMLAIKSEHKAIVEYLINQGASMSVSDSWGLTALHWAT---------LVVRENIL-----NSNCTDININEAIEIFKFVL----DGCSRF------------------------------DINRTTKNGISSLHLAADCGCLEIVHLLLDKGADINIISINGTTPLHIACKXXXXXXXXXXXXXXXXXXXTMAYVSCPWSPMHFSSYFGSVDSTILLISHENDQTSVREKLRQRTPNGNTCLHLAVQQLQTDIVRVLLENDADFNLENEDGLSAFDMAKIVDDETIINLLGIDTTEMMTTDDKVYLFQREEFSDEEQLETLYMDSLNELEFFGIG---KNSGEKCELQLSIMSLLDYATTIDSIRRADMSLKINNSLNRYRNITLSE-------IKTRELLIAA--QPASMISTISSTNTEMSPFDVEKWDFHRVTDLPVNSG-----------FLVSFLVDARGGYMQAQRMPQMKIFVPPDAAPAPTRIICHLLRPEGVANLPGMNDCDGFASRILQIHSSCSRFQKPILIEMPYIALLKSNDREIVILKKNADSDTWKKHSNTFTEETLKAEFGSLYESITPVDQLESNRICRIITTDVPTYFSLISQFQRDVNMIGPDGGYIESKTDKRIKLTFPQGALMKKIQIGLEVQHVDPGIINHVVGDNHKISLSPIITVEPKRRKFRDLIEIQMGLPK--------GVTKNDIQDLKLLFSISEYIT--DWEDVTSSTELVLLENTNCMAHSTKISARVWLIYAPNVPNISELANKIYALHCPTPYVGKFLSYARRHDQEECQIRCLLITDDTPDKTLECQESFELIATGPEVEVINKLQYQIECAGNIVAVTKSDEAILFPVQSFVENRITLPIRVRNQDEPFQGKIAFIPHFQS---LSKQIV----------KXXXXXXXXXXXXXXXMVGSFRNPDRKHRVKNATLERIKGCQAIAKTELDLKSVADAVGADWRXXXXXXXXXXDDINLVLNENCTD-EEKAFMTLINWQTVLGFKATGNELNRALRQIGREDVVKSCIGDI 4498
            +LRAA +G   K  + L + +D+N CN NGLNALHLASK GH +IV  LI  GAD+ A T+K NTA+HIASLAG  EVV++LV +GAN+N QSQ GFTPLYMAAQENH+ VVKFLLDNGA  +L+T D FTPLAVA+QQGH++ VS+LL        ND    ++LP LHIA RKDD  A  LLL   H  DV+      S +GFT LH+AA+Y +  V  LLL  GA VD+T++N++T LHVA+K G   MVK+LL+  + ++  TRDG+ PLHC A  GH  +  +L++  A   ++TKNGL PLHM  QG+H   V+  + Q++V V++ + D+LT LH+++HC + +VA+ L+   AN N +ALNGF  LHIA K+N ++ +E+L+ +   I   TESG T                                 ALH+A+  G   + + L++N  +++   + D+T LH++      +IV  L + G   D    +G T L L+ +  H  +   L+  GAS  +    G T LH A          L++++N        S  T +++    +  K  L     G S                                D N  TK GI+ +HLAA  G +++V LLL + A++N+ + +G TPLH+A + +  +V  VL    +    T       ++P+H +S++G++     L+ H +       K+  +T NG T LH A QQ  T I+ VLL++ A  N    +G +A  +A+ +   ++++ L + T E +TT   V   ++ + +  E +  +   S +E E    G   K  G +   +L   SL     T  SI     SL+   S +  R+ TL+        +   ELL  +  Q  S+     S +     +  +  D   +   PV+SG           FLVSF+VDARGG M+  R   M+I +PP    APTRI C L++   +A  P M + +G ASR++++  S ++F  P+++E+P+   ++S +RE+++L+ + + + WK+H      E L      + E +   ++LE  RICRI+T D P YF+++S+ +++ N IGP+GG ++S T  R++ +FP+GAL K+I++GL+ Q V   ++  V+G+  + + SPI+TVEP+RRKF   I + + +P         G   +    L+LL SI+   +   WED+T +T L  +   +C++ +T +SAR WL     +P    LA ++Y      PY+ KF+ +A+ +D  E ++RC  +TDD  DKTLE QE+FE +A   ++EV+      ++C GN+  +TK  + ++F   +F ENR+   ++VR+  +   G+++F+   ++   L +  V          K  T  D       +D   +F +   + R    T   +       +T++ +  VAD +G  W  LA EL    D+IN +  EN      ++FM L  W    G  AT + L   L +I R D+V    G I
Sbjct:   28 YLRAARSGNLEKALDYLKNGVDINICNQNGLNALHLASKEGHVEIVSELIQRGADVDASTKKGNTALHIASLAGQTEVVRVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVKFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLE-------NDTKGKVRLPALHIAARKDDTKAAALLLQNDHNADVE------SKSGFTPLHIAAHYGNINVATLLLNRGAAVDFTARNDITPLHVASKRGNANMVKLLLDRGSKIDAKTRDGLTPLHCGARSGHEQVVGMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLL-QHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRLKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLNHHGASPNTTNVRGETALHMAARAGQSEVVRFLLQNGAQVEAKAKDDQTPLHISARLGKADIVQQLLKQGAYPDAATTSGYTPLHLSSREGHDDVASVLLEHGASFGIVTKKGFTPLHVAAKYGKIEVVKLLLQKNASPDAAGKSGLTPLHVAAHYDNQKVALLLLDKGASPHGAAKNGYTPLHIAAKKNQMDIATTLLEYGADANAITKQGIAPVHLAAQEGHVDMVSLLLTRSANVNVSNKSGLTPLHLAAQEDRVSVAEVLANQGAVIDGTTKMF---YTPLHVASHYGNIKMVTFLLQHGS-------KVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGASPNEVTVNGNTALAIARRLGYISVVDTLKVVTEETLTTVQLVT--EKHKMNVPETMNEVLDMSDDEGEDAMTGDTDKYLGPQDLKELGDDSLPQEGYTGFSIGARSASLR---SFSSDRSYTLNRSSFARDSMMIEELLAPSKDQHLSLTRDFDSDSLRHYSWAADTLDNVNLVSSPVHSGYVSPLPQYDASFLVSFMVDARGGSMRGSRHNGMRIIIPPRKCTAPTRITCRLVKRHKLATPPPMVEGEGLASRLVEMGPSGAQFLGPVIVEIPHFGSMRSKERELIVLR-SENGENWKEHQYDCRVEELTELLNGMDEELDSAEELEKKRICRIVTKDFPQYFAVVSRIKQESNQIGPEGGVLKSTTVPRVQASFPEGALTKRIRVGLQAQPVPDDLVKKVIGN--RATFSPIVTVEPRRRKFHKPITMTIPIPPPSGEGVSNGYKGDTTPSLRLLCSITGGTSPAQWEDITGTTPLTFV--NDCVSFTTNVSARFWLGDCHQIPETVSLATQLYRELICVPYMAKFVVFAKMNDPVEARLRCFCMTDDKVDKTLEQQENFEEVARSKDIEVLEGKPIYVDCYGNLAPLTKGGQQLIFNFYAFKENRLPFSVKVRDHSQEPCGRLSFLKEPKTTKGLPQTAVCNLNITLPTQKKETESDQDDENEKVDRRQNFVSLALRKRYSYLTEPGMSPQSPCERTDIRMAIVADHLGLSWTELARELNFSVDEINQIRVENPNSLTAQSFMLLKKWVVRDGKNATTDALTNVLTKINRIDIVTLLEGPI 1544          

HSP 2 Score: 350.132 bits (897), Expect = 1.821e-96
Identity = 235/739 (31.80%), Postives = 369/739 (49.93%), Query Frame = 2
Query:  407 AKTRKNNTAIHIASLAGSLEVVKILVKHGANINEQSQTGFTPLYMAAQENHV---------------------------------GVVKFLLDNGADINLSTTDNFTPL---------------------------------AVAIQQGHEETVSILLNKSNFLNSNDISNDIKLPPLHIATRKDDYHAVLLLLH--HQEDVQAALTQASLNGFTALHVAAYYNSDKVGRLLLENGAPVDYTSKNNVTALHVAAKWGRNKMVKVLLEFNANVEMSTRDGIRPLHCAASQGHRDICALLIEHKANCNTRTKNGLVPLHMVAQGNHSELVEFFINQNSVNVNETSLDFLTPLHISSHCNNVEVAEALIKHGANVNDRALNGFVALHIAAKQNHVEFVEMLMSNLCMIDTQTESGFTALHIASIIGSESIAKKLVENNCEIDIPDQFDRTSLHMATIFNHFNIVVYLKEHGGSVDKQMKTGETCLMLAIKSEHKAIVEYLINQGASMSVSDSWGLTALHWATLVVRENILNSNCTDININEAIEIFKFVLDGCSRFDINRTTKNGISSLHLAADCGCLEIVHLLLDKGADINIISINGTTPLHIACKXXXXXXXXXXXXXXXXXXXTMAYVSCPWSPMHFSSYFGSVDSTILLISHENDQTSVREKLRQRTPNGNTCLHLAVQQLQTDIVRVLLENDADFNLENEDGLSAFDMAKIVDDETIINLLG-----ID-TTEMMTT 2401
             K    N +   A+ +G+LE     +K+G +IN  +Q G   L++A++E HV                                  VV+ L+ NGA++N  + + FTPL                                 AVA+QQGH++ VS+LL        ND    ++LP LHIA RKDD  A  LLL   H  DV+      S +GFT LH+AA+Y +  V  LLL  GA VD+T++N++T LHVA+K G   MVK+LL+  + ++  TRDG+ PLHC A  GH  +  +L++  A   ++TKNGL PLHM  QG+H   V+  + Q++V V++ + D+LT LH+++HC + +VA+ L+   AN N +ALNGF  LHIA K+N ++ +E+L+ +   I   TESG T +H+A+ +G  +I  +L  +    +  +    T+LHMA       +V +L ++G  V+ + K  +T L ++ +     IV+ L+ QGA    + + G T LH ++   RE                ++   +L+  + F I   TK G + LH+AA  G +E+V LLL K A  +    +G TPLH+A      +   V L  L   +         ++P+H ++    +D    L+ +  D  ++       T  G   +HLA Q+   D+V +LL   A+ N+ N+ GL+   +A   D  ++  +L      ID TT+M  T
Sbjct:   19 GKKSDTNASYLRAARSGNLEKALDYLKNGVDINICNQNGLNALHLASKEGHVEIVSELIQRGADVDASTKKGNTALHIASLAGQTEVVRVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVKFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLL-------ENDTKGKVRLPALHIAARKDDTKAAALLLQNDHNADVE------SKSGFTPLHIAAHYGNINVATLLLNRGAAVDFTARNDITPLHVASKRGNANMVKLLLDRGSKIDAKTRDGLTPLHCGARSGHEQVVGMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLL-QHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRLKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLNHHGASPNTTNVRGETALHMAARAGQSEVVRFLLQNGAQVEAKAKDDQTPLHISARLGKADIVQQLLKQGAYPDAATTSGYTPLHLSS---REG-------------HDDVASVLLEHGASFGI--VTKKGFTPLHVAAKYGKIEVVKLLLQKNASPDAAGKSGLTPLHVAAH---YDNQKVALLLLDKGASPHGAAKNGYTPLHIAAKKNQMDIATTLLEYGADANAI-------TKQGIAPVHLAAQEGHVDMVSLLLTRSANVNVSNKSGLTPLHLAAQEDRVSVAEVLANQGAVIDGTTKMFYT 715          
BLAST of Ankyrin-2 vs. Ensembl Xenopus
Match: tpm4 (tropomyosin 4 [Source:Xenbase;Acc:XB-GENE-6077097])

HSP 1 Score: 823.928 bits (2127), Expect = 0.000e+0
Identity = 529/1551 (34.11%), Postives = 821/1551 (52.93%), Query Frame = 2
Query:  236 FLRAAHNGYFSKVQEALNSNIDVNSCNSNGLNALHLASKGGHADIVQFLIDNGADIGAKTRKNNTAIHIASLAGSLEVVKILVKHGANINEQSQTGFTPLYMAAQENHVGVVKFLLDNGADINLSTTDNFTPLAVAIQQGHEETVSILLNKSNFLNSNDISNDIKLPPLHIATRKDDYHAVLLLLH--HQEDVQAALTQASLNGFTALHVAAYYNSDKVGRLLLENGAPVDYTSKNNVTALHVAAKWGRNKMVKVLLEFNANVEMSTRDGIRPLHCAASQGHRDICALLIEHKANCNTRTKNGLVPLHMVAQGNHSELVEFFINQNSVNVNETSLDFLTPLHISSHCNNVEVAEALIKHGANVNDRALNGFVALHIAAKQNHVEFVEMLMSNLCMIDTQTESGFT---------------------------------ALHIASIIGSESIAKKLVENNCEIDIPDQFDRTSLHMATIFNHFNIVVYLKEHGGSVDKQMKTGETCLMLAIKSEHKAIVEYLINQGASMSVSDSWGLTALHWAT---------LVVRENIL-----NSNCTDININEAIEIFKFVL----DGCSRF------------------------------DINRTTKNGISSLHLAADCGCLEIVHLLLDKGADINIISINGTTPLHIACKXXXXXXXXXXXXXXXXXXXTMAYVSCPWSPMHFSSYFGSVDSTILLISHENDQTSVREKLRQRTPNGNTCLHLAVQQLQTDIVRVLLENDADFNLENEDGLSAFDMAKIVDDETIINLLGIDTTEMMTTDDKVYLFQREEFSDEEQLETLYMDSLNELEFFGIG---KNSGEKCELQLSIMSLLDYATTIDSIRRADMSLKINNSLNRYRNITLSE-------IKTRELLIAA--QPASMISTISSTNTEMSPFDVEKWDFHRVTDLPVNSG-----------FLVSFLVDARGGYMQAQRMPQMKIFVPPDAAPAPTRIICHLLRPEGVANLPGMNDCDGFASRILQIHSSCSRFQKPILIEMPYIALLKSNDREIVILKKNADSDTWKKHSNTFTEETLKAEFGSLYESITPVDQLESNRICRIITTDVPTYFSLISQFQRDVNMIGPDGGYIESKTDKRIKLTFPQGALMKKIQIGLEVQHVDPGIINHVVGDNHKISLSPIITVEPKRRKFRDLIEIQMGLPK--------GVTKNDIQDLKLLFSISEYIT--DWEDVTSSTELVLLENTNCMAHSTKISARVWLIYAPNVPNISELANKIYALHCPTPYVGKFLSYARRHDQEECQIRCLLITDDTPDKTLECQESFELIATGPEVEVINKLQYQIECAGNIVAVTKSDEAILFPVQSFVENRITLPIRVRNQDEPFQGKIAFIPHFQS---LSKQIV----------KXXXXXXXXXXXXXXXMVGSFRNPDRKHRVKNATLERIKGCQAIAKTELDLKSVADAVGADWRXXXXXXXXXXDDINLVLNENCTD-EEKAFMTLINWQTVLGFKATGNELNRALRQIGREDVVKSCIGDI 4498
            +LRAA +G   K  + L + +D+N CN NGLNALHLASK GH +IV  LI  GAD+ A T+K NTA+HIASLAG  EVV++LV +GAN+N QSQ GFTPLYMAAQENH+ VVKFLLDNGA  +L+T D FTPLAVA+QQGH++ VS+LL        ND    ++LP LHIA RKDD  A  LLL   H  DV+      S +GFT LH+AA+Y +  V  LLL  GA VD+T++N++T LHVA+K G   MVK+LL+  + ++  TRDG+ PLHC A  GH  +  +L++  A   ++TKNGL PLHM  QG+H   V+  + Q++V V++ + D+LT LH+++HC + +VA+ L+   AN N +ALNGF  LHIA K+N ++ +E+L+ +   I   TESG T                                 ALH+A+  G   + + L++N  +++   + D+T LH++      +IV  L + G   D    +G T L L+ +  H  +   L+  GAS  +    G T LH A          L++++N        S  T +++    +  K  L     G S                                D N  TK GI+ +HLAA  G +++V LLL + A++N+ + +G TPLH+A + +  +V  VL    +    T       ++P+H +S++G++     L+ H +       K+  +T NG T LH A QQ  T I+ VLL++ A  N    +G +A  +A+ +   ++++ L + T E +TT   V   ++ + +  E +  +   S +E E    G   K  G +   +L   SL     T  SI     SL+   S +  R+ TL+        +   ELL  +  Q  S+     S +     +  +  D   +   PV+SG           FLVSF+VDARGG M+  R   M+I +PP    APTRI C L++   +A  P M + +G ASR++++  S ++F  P+++E+P+   ++S +RE+++L+ + + + WK+H      E L      + E +   ++LE  RICRI+T D P YF+++S+ +++ N IGP+GG ++S T  R++ +FP+GAL K+I++GL+ Q V   ++  V+G+  + + SPI+TVEP+RRKF   I + + +P         G   +    L+LL SI+   +   WED+T +T L  +   +C++ +T +SAR WL     +P    LA ++Y      PY+ KF+ +A+ +D  E ++RC  +TDD  DKTLE QE+FE +A   ++EV+      ++C GN+  +TK  + ++F   +F ENR+   ++VR+  +   G+++F+   ++   L +  V          K  T  D       +D   +F +   + R    T   +       +T++ +  VAD +G  W  LA EL    D+IN +  EN      ++FM L  W    G  AT + L   L +I R D+V    G I
Sbjct:   30 YLRAARSGNLEKALDYLKNGVDINICNQNGLNALHLASKEGHVEIVSELIQRGADVDASTKKGNTALHIASLAGQTEVVRVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVKFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLE-------NDTKGKVRLPALHIAARKDDTKAAALLLQNDHNADVE------SKSGFTPLHIAAHYGNINVATLLLNRGAAVDFTARNDITPLHVASKRGNANMVKLLLDRGSKIDAKTRDGLTPLHCGARSGHEQVVGMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLL-QHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRLKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLNHHGASPNTTNVRGETALHMAARAGQSEVVRFLLQNGAQVEAKAKDDQTPLHISARLGKADIVQQLLKQGAYPDAATTSGYTPLHLSSREGHDDVASVLLEHGASFGIVTKKGFTPLHVAAKYGKIEVVKLLLQKNASPDAAGKSGLTPLHVAAHYDNQKVALLLLDKGASPHGAAKNGYTPLHIAAKKNQMDIATTLLEYGADANAITKQGIAPVHLAAQEGHVDMVSLLLTRSANVNVSNKSGLTPLHLAAQEDRVSVAEVLANQGAVIDGTTKMF---YTPLHVASHYGNIKMVTFLLQHGS-------KVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGASPNEVTVNGNTALAIARRLGYISVVDTLKVVTEETLTTVQLVT--EKHKMNVPETMNEVLDMSDDEGEDAMTGDTDKYLGPQDLKELGDDSLPQEGYTGFSIGARSASLR---SFSSDRSYTLNRSSFARDSMMIEELLAPSKDQHLSLTRDFDSDSLRHYSWAADTLDNVNLVSSPVHSGYVSPLPQYDASFLVSFMVDARGGSMRGSRHNGMRIIIPPRKCTAPTRITCRLVKRHKLATPPPMVEGEGLASRLVEMGPSGAQFLGPVIVEIPHFGSMRSKERELIVLR-SENGENWKEHQYDCRVEELTELLNGMDEELDSAEELEKKRICRIVTKDFPQYFAVVSRIKQESNQIGPEGGVLKSTTVPRVQASFPEGALTKRIRVGLQAQPVPDDLVKKVIGN--RATFSPIVTVEPRRRKFHKPITMTIPIPPPSGEGVSNGYKGDTTPSLRLLCSITGGTSPAQWEDITGTTPLTFV--NDCVSFTTNVSARFWLGDCHQIPETVSLATQLYRELICVPYMAKFVVFAKMNDPVEARLRCFCMTDDKVDKTLEQQENFEEVARSKDIEVLEGKPIYVDCYGNLAPLTKGGQQLIFNFYAFKENRLPFSVKVRDHSQEPCGRLSFLKEPKTTKGLPQTAVCNLNITLPTQKKETESDQDDENEKVDRRQNFVSLALRKRYSYLTEPGMSPQSPCERTDIRMAIVADHLGLSWTELARELNFSVDEINQIRVENPNSLTAQSFMLLKKWVVRDGKNATTDALTNVLTKINRIDIVTLLEGPI 1546          
BLAST of Ankyrin-2 vs. Ensembl Mouse
Match: Ank2 (ankyrin 2, brain [Source:MGI Symbol;Acc:MGI:88025])

HSP 1 Score: 821.231 bits (2120), Expect = 0.000e+0
Identity = 493/1378 (35.78%), Postives = 761/1378 (55.22%), Query Frame = 2
Query:  236 FLRAAHNGYFSKVQEALNSNIDVNSCNSNGLNALHLASKGGHADIVQFLIDNGADIGAKTRKNNTAIHIASLAGSLEVVKILVKHGANINEQSQTGFTPLYMAAQENHVGVVKFLLDNGADINLSTTDNFTPLAVAIQQGHEETVSILLNKSNFLNSNDISNDIKLPPLHIATRKDDYHAVLLLLH--HQEDVQAAL--TQASLNGFTALHVAAYYNSDKVGRLLLENGAPVDYTSKNNVTALHVAAKWGRNKMVKVLLEFNANVEMSTRDGIRPLHCAASQGHRDICALLIEHKANCNTRTKNGLVPLHMVAQGNHSELVEFFINQNSVNVNETSLDFLTPLHISSHCNNVEVAEALIKHGANVNDRALNGFVALHIAAKQNHVEFVEMLMSNLCMIDTQTESGFTALHIASIIGSESIAKKLVENNCEIDIPDQFDRTSLHMATIFNHFNIVVYLKEHGGSVDKQMKTGETCLMLAIKSEHKAIVEYLINQ---------------------------------GASMSVSDSWGLTALH----WATLVVRENILNSNC----------TDINI---NEAIEIFKFVLDGCSRFDINRTTKNGISSLHLAADCGCLEIVHLLLDKGADINIISINGTTPLHIACKXXXXXXXXXXXXXXXXXXXTMAYVSCPWSPMHFSSYFGSVDSTILLISHENDQTSVREKLRQRTPNGNTCLHLAVQQLQTDIVRVLLENDADFNLENEDGLSAFDMAK------IVD------------------------DETIINLLGIDTTE---MMTTDDKVYLFQRE--EFSDEEQLETLYMDSLNELEFFGIGKNSGEKCELQLSIMSLLDYATTIDSIRRADMSLKINNSLNRYRNITLSEIKTRELLIAAQPASMISTISSTNTEMSPFDVEKWDFHRVTDLPVNSGFLVSFLVDARGGYMQAQRMPQMKIFVPPDAAPAPTRIICHLLRPEGVANLPGMNDCDGFASRILQIHSSCSRFQKPILIEMPYIALLKSNDREIVILKKNADSDTWKKHSNTFTEETLKAEFGSLYESITPVDQLESNRICRIITTDVPTYFSLISQFQRDVNMIGPDGGYIESKTDKRIKLTFPQGALMKKIQIGLEVQHVDPGIINHVVGDNHKISLSPIITVEPKRRKFRDLIEIQMGLPKGVTK-------NDIQDLKLLFSISEYIT--DWEDVTSSTELVLLENTNCMAHSTKISARVWLIYAPNVPNISELANKIYALHCPTPYVGKFLSYARRHDQEECQIRCLLITDDTPDKTLECQESFELIATGPEVEVINKLQYQIECAGNIVAVTKSDEAILFPVQSFVENRITLPIRVRNQDEPFQGKIAFI 4075
            FLRAA  G   KV E L   ID+N+CN NGLNALHLA+K GH  +VQ L+  G+ + + T+K NTA+HIASLAG  EVVK+LVK GANIN QSQ GFTPLYMAAQENH+ VVK+LL+NGA+ + +T D FTPLAVA+QQGH + V+ILL        ND    ++LP LHIA RKDD  +  LLL   H  DVQ+ +   + + +GFT LH+AA+Y +  V  LLL  GA VD+T++N +T LHVA+K G   MVK+LL+    ++  TRDG+ PLHCAA  GH  +  LL+E KA    RTKNGL PLHM AQG+H E V+  + Q    V++ +LD+LT LH+++HC +  V + L+   AN N RALNGF  LHIA K+N ++ +E+L+     I   TESG T +H+A+ +G  +I   L++N    D+ +    T+LHMA       +V  L  +G  VD + +  +T L +A +     IV+ L+                                   GA+ S++   G T LH    + +L V + +L              T ++I      ++I   +L+  +  + N  TK G++ LHLA+  G  ++V LLLDKGA+I++ + +G T LH+A + +  NV  +L +  +      AY    ++P+  + ++G+V     L+    +       +  +T NG T LH A QQ  T I+ VLL++ A  N    +G +A  +AK      +VD                         ET+  +L +   E    +T D   YL   +  E  D+    + ++D +N L +   G  S                    DS+R    S   +++L+    +  S +    ++I +   S ++  +  N+    +  E  D   ++  P++SGFLVSF+VDARGG M+  R   ++I +PP    APTR+ C L++   +A +P M + +G ASR++++  S ++F  P+++E+P+ A L+  +RE+V+L+ + + D+WK+H   +TE+ L      + E +   + LE  RICRIIT D P YF+++S+ ++D N+IGP+GG + S    +++  FP+GAL K+I++GL+ Q +   ++  ++G+  K + SPI+T+EP+RRKF   I + + +PK  +         D   L+LL SI+   T   WED+T +T L  +    C++ +T +SAR WLI    +      A+++Y      PY+ KF+ +A+ HD  E ++RC  +TDD  DKTLE QE+F  +A   +VEV+      ++C GN+V +TKS +  +F   +F ENR+ L ++VR+  +   G+++F+
Sbjct:   14 FLRAARAGNLDKVVEYLKGGIDINTCNQNGLNALHLAAKEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLE-------NDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERKAPLLARTKNGLSPLHMAAQGDHVECVKHLL-QYKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGYTPLHIAAKKNQMQIASTLLNYGA--ETNTVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADRD---AYTKLGYTPLIVACHYGNVKMVNFLLKQGAN-------VNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTALAIAKRLGYISVVDTLKVVTEEVTTTTTTITEKHKLNVPETMTEVLDVSDEEGDDTVTGDGGEYLRPEDLKELGDDSLPSSQFLDGMNYLRYSLEGGRS--------------------DSLR--SFSSDRSHTLSHASYLRDSAMIDDTVVIPSHQVSALAKEAERNSYRLSWGTENLDNVALSSSPIHSGFLVSFMVDARGGAMRGCRHNGLRIIIPPRKCTAPTRVTCRLVKRHRLATMPPMVEGEGLASRLIEVGPSGAQFLGPVIVEIPHFAALRGKERELVVLR-SENGDSWKEHFCDYTEDELNEILNGMDEVLDSPEDLEKKRICRIITRDFPQYFAVVSRIKQDSNLIGPEGGVLSSTVVSQVQAVFPEGALTKRIRVGLQAQPMHSELVKKILGN--KATFSPIVTLEPRRRKFHKPITMTIPVPKASSDVMLNGFGGDAPTLRLLCSITGGTTPAQWEDITGTTPLTFV--NECVSFTTNVSARFWLIDCRQIQESVAFASQVYREIICVPYMAKFVVFAKSHDPIEARLRCFCMTDDKVDKTLEQQENFSEVARSRDVEVLEGKPIYVDCFGNLVPLTKSGQHHIFSFFAFKENRLPLFVKVRDTTQEPCGRLSFM 1344          
BLAST of Ankyrin-2 vs. Ensembl Mouse
Match: Ank3 (ankyrin 3, epithelial [Source:MGI Symbol;Acc:MGI:88026])

HSP 1 Score: 818.15 bits (2112), Expect = 0.000e+0
Identity = 516/1542 (33.46%), Postives = 811/1542 (52.59%), Query Frame = 2
Query:  236 FLRAAHNGYFSKVQEALNSNIDVNSCNSNGLNALHLASKGGHADIVQFLIDNGADIGAKTRKNNTAIHIASLAGSLEVVKILVKHGANINEQSQTGFTPLYMAAQENHVGVVKFLLDNGADINLSTTDNFTPLAVAIQQGHEETVSILLNKSNFLNSNDISNDIKLPPLHIATRKDDYHAVLLLLHHQEDVQAALTQASLNGFTALHVAAYYNSDKVGRLLLENGAPVDYTSKNNVTALHVAAKWGRNKMVKVLLEFNANVEMSTRDGIRPLHCAASQGHRDICALLIEHKANCNTRTKNGLVPLHMVAQGNHSELVEFFINQNSVNVNETSLDFLTPLHISSHCNNVEVAEALIKHGANVNDRALNGFVALHIAAKQNHVEFVEMLMSNLCMIDTQTESGFTALHIASIIG---------------------------------SESIAKKLVENNCEIDIPDQFDRTSLHMATIFNHFNIVVYLKEHGGSVDKQMKTGETCLMLAIKSEHKAIVEYLINQGASMSVSDSWGLTALH----WATLVVRENILN----------SNCTDININEAIEIFKFVL----DGCSRF------------------------------DINRTTKNGISSLHLAADCGCLEIVHLLLDKGADINIISINGTTPLHIACKXXXXXXXXXXXXXXXXXXXTMAYVSCPWSPMHFSSYFGSVDSTILLISHENDQTSVREKLRQRTPNGNTCLHLAVQQLQTDIVRVLLENDADFNLENEDGLSAFDMAKIVDDETIINLLGI-----------------DTTEMMT-----TDDK---VYLFQREEFSDEEQLETLYMDSLNELEF--FGIGKNSGEKCELQLSIMSLLDYATTIDSIRRADMSLKINNSLNRYRNITLSEIKTRELLIAAQPASMIST--ISSTNTEMSPFDVEKWDFHRVTDLPVNSGFLVSFLVDARGGYMQAQRMPQMKIFVPPDAAPAPTRIICHLLRPEGVANLPGMNDCDGFASRILQIHSSCSRFQKPILIEMPYIALLKSNDREIVILKKNADSDTWKKHSNTFTEETLKAEFGSLYESITPVDQLESNRICRIITTDVPTYFSLISQFQRDVNMIGPDGGYIESKTDKRIKLTFPQGALMKKIQIGLEVQHVDPGIINHVVGDNHKISLSPIITVEPKRRKFRDLIEIQMGLPK--------GVTKNDIQDLKLLFSISEYIT--DWEDVTSSTELVLLENTNCMAHSTKISARVWLIYAPNVPNISELANKIYALHCPTPYVGKFLSYARRHDQEECQIRCLLITDDTPDKTLECQESFELIATGPEVEVINKLQYQIECAGNIVAVTKSDEAILFPVQSFVENRITLPIRVRNQDEPFQGKIAFIPHFQSLSKQIVKXXXXXXXXXXXXXXXMVGSFRNPDRKHRVKNATLERIKGCQAIAKTELDLKSVADAVGADWRXXXXXXXXXXDDINLVLNENCTDE-EKAFMTLINWQTVLGFKATGNELNRALRQIGREDVVKSCIGDI 4498
            +LRAA  G+  K  + + + +DVN CN NGLNALHLASK GH ++V  L+   A++ A T+K NTA+HIASLAG  EVVK+LV +GAN+N QSQ GFTPLYMAAQENH+ VV+FLLDNGA  +L+T D FTPLAVA+QQGH++ VS+LL        ND    ++LP LHIA RKDD  A  LLL  Q D  A +   S  GFT LH+AA+Y +  V  LLL   A VD+T++N++T LHVA+K G   MVK+LL+  A ++  TRDG+ PLHC A  GH  +  +L++  A   ++TKNGL PLHM  QG+H   V+  + Q++V V++ + D+LT LH+++HC + +VA+ L+   A+ N +ALNGF  LHIA K+N +  +E+L+ +   I   TESG T +H+A+ +G                                    + + LV++  +++   + D+T LH++      +IV  L + G S +    +G T L LA +  H+ +  +L++ GAS+S++   G T LH    +  L V   +L           S  T +++    +  K  L     G S                                D N  T+ GI+S+HLAA  G +++V LLL + A++N+ + +G TPLH+A + +  NV  VL+   ++     A     ++P+H   ++G++     L+ H         K+  +T NG T LH A QQ  T I+ VLL+N+A  N    +G +A  +A+ +   ++++ L +                 +  E M      +DD+         +++   + L+ L  DSL    +  F +G  S         I S   Y     S  R  M ++                   ELL+ ++   +  T    S +     +  +  D   +   PV+SGFLVSF+VDARGG M+  R   M+I +PP    APTRI C L++   +AN P M + +G ASR++++  + ++F  P+++E+P+   ++  +RE+++L+ + + +TWK+H      E L      + E +   ++L + RICRIIT D P YF+++S+ +++ N IGP+GG + S T   ++ +FP+GAL K+I++GL+ Q V    +  ++G+  K + SPI+TVEP+RRKF   I + + +P         G   +   +L+LL SI+   +   WED+T +T L  +++  C++ +T +SAR WL     V     LA+++Y      PY+ KF+ +A+ +D  E  +RC  +TDD  DKTLE QE+FE +A   ++EV+      ++C GN+  +TK  + ++F   SF ENR+   I++R+  +   G+++F+        +  K +    +    I +         DR+    +  L     C+   +T++ +  VAD +G  W  LA EL    D+IN +  EN      ++FM L  W T  G  AT + L   L +I R D+V    G I
Sbjct:   28 YLRAARAGHLEKALDYIKNGVDVNICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLE-------NDTKGKVRLPALHIAARKDDTKAAALLL--QNDTNADVESKS--GFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLL-QHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVD---AQTKMGYTPLHVGCHYGNIKIVNFLLQHS-------AKVNAKTKNGYTALHQAAQQGHTHIINVLLQNNASPNELTVNGNTALAIARRLGYISVVDTLKVVTEEIMTTTTITEKHKMNVPETMNEVLDMSDDEGEDAITGDTDKYLGPQDLKELGDDSLPAEGYVGFSLGARSASP-----KISSDRSYTLNRSSYARDSMMIE-------------------ELLVPSKEQHLTFTREFDSDSLRHYSWAADTLDNVNLVSSPVHSGFLVSFMVDARGGSMRGSRHHGMRIIIPPRKCTAPTRITCRLVKRHKLANPPPMVEGEGLASRLVEMGPAGAQFLGPVIVEIPHFGSMRGKERELIVLR-SENGETWKEHQFDSKNEDLAELLNGMDEELDSPEELGTKRICRIITKDFPQYFAVVSRIKQESNQIGPEGGILSSTTVPLVQASFPEGALTKRIRVGLQAQPVPEETVKKILGN--KATFSPIVTVEPRRRKFHKPITMTIPVPPPSGEGVSNGYKGDATPNLRLLCSITGGTSPAQWEDITGTTPLTFIKD--CVSFTTNVSARFWLADCHQVLETVGLASQLYRELICVPYMAKFVVFAKTNDPVESSLRCFCMTDDRVDKTLEQQENFEEVARSKDIEVLEGKPIYVDCYGNLAPLTKGGQQLVFNFYSFKENRLPFSIKIRDTSQEPCGRLSFLKE-----PKTTKGLPQTAVCNLNITLPAHKKAEKADRRQSFASLALRPQSPCE---RTDIRMAIVADHLGLSWTELARELNFSVDEINQIRVENPNSLISQSFMLLKKWVTRDGKNATTDALTSVLTKINRIDIVTLLEGPI 1510          
BLAST of Ankyrin-2 vs. Ensembl Mouse
Match: Ank3 (ankyrin 3, epithelial [Source:MGI Symbol;Acc:MGI:88026])

HSP 1 Score: 818.15 bits (2112), Expect = 0.000e+0
Identity = 518/1542 (33.59%), Postives = 810/1542 (52.53%), Query Frame = 2
Query:  236 FLRAAHNGYFSKVQEALNSNIDVNSCNSNGLNALHLASKGGHADIVQFLIDNGADIGAKTRKNNTAIHIASLAGSLEVVKILVKHGANINEQSQTGFTPLYMAAQENHVGVVKFLLDNGADINLSTTDNFTPLAVAIQQGHEETVSILLNKSNFLNSNDISNDIKLPPLHIATRKDDYHAVLLLLHHQEDVQAALTQASLNGFTALHVAAYYNSDKVGRLLLENGAPVDYTSKNNVTALHVAAKWGRNKMVKVLLEFNANVEMSTRDGIRPLHCAASQGHRDICALLIEHKANCNTRTKNGLVPLHMVAQGNHSELVEFFINQNSVNVNETSLDFLTPLHISSHCNNVEVAEALIKHGANVNDRALNGFVALHIAAKQNHVEFVEMLMSNLCMIDTQTESGFTALHIASIIGSESIAKKLVENNCEIDIPDQFDRTSLHMATIFNHFNIVVYLKEHGGSVDKQMK---------------------------------TGETCLMLAIKSEHKAIVEYLINQGASMSVSDSWGLTALH----WATLVVRENILN----------SNCTDININEAIEIFKFVL----DGCSRF------------------------------DINRTTKNGISSLHLAADCGCLEIVHLLLDKGADINIISINGTTPLHIACKXXXXXXXXXXXXXXXXXXXTMAYVSCPWSPMHFSSYFGSVDSTILLISHENDQTSVREKLRQRTPNGNTCLHLAVQQLQTDIVRVLLENDADFNLENEDGLSAFDMAKIVDDETIINLLGI-----------------DTTEMMT-----TDDK---VYLFQREEFSDEEQLETLYMDSLNELEF--FGIGKNSGEKCELQLSIMSLLDYATTIDSIRRADMSLKINNSLNRYRNITLSEIKTRELLIAAQPASMIST--ISSTNTEMSPFDVEKWDFHRVTDLPVNSGFLVSFLVDARGGYMQAQRMPQMKIFVPPDAAPAPTRIICHLLRPEGVANLPGMNDCDGFASRILQIHSSCSRFQKPILIEMPYIALLKSNDREIVILKKNADSDTWKKHSNTFTEETLKAEFGSLYESITPVDQLESNRICRIITTDVPTYFSLISQFQRDVNMIGPDGGYIESKTDKRIKLTFPQGALMKKIQIGLEVQHVDPGIINHVVGDNHKISLSPIITVEPKRRKFRDLIEIQMGLPK--------GVTKNDIQDLKLLFSISEYIT--DWEDVTSSTELVLLENTNCMAHSTKISARVWLIYAPNVPNISELANKIYALHCPTPYVGKFLSYARRHDQEECQIRCLLITDDTPDKTLECQESFELIATGPEVEVINKLQYQIECAGNIVAVTKSDEAILFPVQSFVENRITLPIRVRNQDEPFQGKIAFIPHFQSLSKQIVKXXXXXXXXXXXXXXXMVGSFRNPDRKHRVKNATLERIKGCQAIAKTELDLKSVADAVGADWRXXXXXXXXXXDDINLVLNENCTDE-EKAFMTLINWQTVLGFKATGNELNRALRQIGREDVVKSCIGDI 4498
            +LRAA  G+  K  + + + +DVN CN NGLNALHLASK GH ++V  L+   A++ A T+K NTA+HIASLAG  EVVK+LV +GAN+N QSQ GFTPLYMAAQENH+ VV+FLLDNGA  +L+T D FTPLAVA+QQGH++ VS+LL        ND    ++LP LHIA RKDD  A  LLL  Q D  A +   S  GFT LH+AA+Y +  V  LLL   A VD+T++N++T LHVA+K G   MVK+LL+  A ++  TRDG+ PLHC A  GH  +  +L++  A   ++TKNGL PLHM  QG+H   V+  + Q++V V++ + D+LT LH+++HC + +VA+ L+   A+ N +ALNGF  LHIA K+N +  +E+L+ +   I   TESG T +H+A+ +G  +I  +L+ +    +  +    T+LHMA       +V YL + G  V+ + K                                 +G T L LA +  H+ +  +L++ GAS+S++   G T LH    +  L V   +L           S  T +++    +  K  L     G S                                D N  T+ GI+S+HLAA  G +++V LLL + A++N+ + +G TPLH+A + +  NV  VL+   ++     A     ++P+H   ++G++     L+ H         K+  +T NG T LH A QQ  T I+ VLL+N+A  N    +G +A  +A+ +   ++++ L +                 +  E M      +DD+         +++   + L+ L  DSL    +  F +G  S         I S   Y     S  R  M ++                   ELL+ ++   +  T    S +     +  +  D   +   PV+SGFLVSF+VDARGG M+  R   M+I +PP    APTRI C L++   +AN P M + +G ASR++++  + ++F  P+++E+P+   ++  +RE+++L+ + + +TWK+H      E L      + E +   ++L + RICRIIT D P YF+++S+ +++ N IGP+GG + S T   ++ +FP+GAL K+I++GL+ Q V    +  ++G+  K + SPI+TVEP+RRKF   I + + +P         G   +   +L+LL SI+   +   WED+T +T L  +++  C++ +T +SAR WL     V     LA+++Y      PY+ KF+ +A+ +D  E  +RC  +TDD  DKTLE QE+FE +A   ++EV+      ++C GN+  +TK  + ++F   SF ENR+   I++R+  +   G+++F+        +  K +    +    I +         DR+    +  L     C+   +T++ +  VAD +G  W  LA EL    D+IN +  EN      ++FM L  W T  G  AT + L   L +I R D+V    G I
Sbjct:   28 YLRAARAGHLEKALDYIKNGVDVNICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLL-------ENDTKGKVRLPALHIAARKDDTKAAALLL--QNDTNADVESKS--GFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLL-QHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVD---AQTKMGYTPLHVGCHYGNIKIVNFLLQHS-------AKVNAKTKNGYTALHQAAQQGHTHIINVLLQNNASPNELTVNGNTALAIARRLGYISVVDTLKVVTEEIMTTTTITEKHKMNVPETMNEVLDMSDDEGEDAITGDTDKYLGPQDLKELGDDSLPAEGYVGFSLGARSASP-----KISSDRSYTLNRSSYARDSMMIE-------------------ELLVPSKEQHLTFTREFDSDSLRHYSWAADTLDNVNLVSSPVHSGFLVSFMVDARGGSMRGSRHHGMRIIIPPRKCTAPTRITCRLVKRHKLANPPPMVEGEGLASRLVEMGPAGAQFLGPVIVEIPHFGSMRGKERELIVLR-SENGETWKEHQFDSKNEDLAELLNGMDEELDSPEELGTKRICRIITKDFPQYFAVVSRIKQESNQIGPEGGILSSTTVPLVQASFPEGALTKRIRVGLQAQPVPEETVKKILGN--KATFSPIVTVEPRRRKFHKPITMTIPVPPPSGEGVSNGYKGDATPNLRLLCSITGGTSPAQWEDITGTTPLTFIKD--CVSFTTNVSARFWLADCHQVLETVGLASQLYRELICVPYMAKFVVFAKTNDPVESSLRCFCMTDDRVDKTLEQQENFEEVARSKDIEVLEGKPIYVDCYGNLAPLTKGGQQLVFNFYSFKENRLPFSIKIRDTSQEPCGRLSFLK-----EPKTTKGLPQTAVCNLNITLPAHKKAEKADRRQSFASLALRPQSPCE---RTDIRMAIVADHLGLSWTELARELNFSVDEINQIRVENPNSLISQSFMLLKKWVTRDGKNATTDALTSVLTKINRIDIVTLLEGPI 1510          
BLAST of Ankyrin-2 vs. Ensembl Mouse
Match: Ank3 (ankyrin 3, epithelial [Source:MGI Symbol;Acc:MGI:88026])

HSP 1 Score: 816.609 bits (2108), Expect = 0.000e+0
Identity = 517/1531 (33.77%), Postives = 816/1531 (53.30%), Query Frame = 2
Query:  236 FLRAAHNGYFSKVQEALNSNIDVNSCNSNGLNALHLASKGGHADIVQFLIDNGADIGAKTRKNNTAIHIASLAGSLEVVKILVKHGANINEQSQTGFTPLYMAAQENHVGVVKFLLDNGADINLSTTDNFTPLAVAIQQGHEETVSILLNKSNFLNSNDISNDIKLPPLHIATRKDDYHAVLLLLHHQEDVQAALTQASLNGFTALHVAAYYNSDKVGRLLLENGAPVDYTSKNNVTALHVAAKWGRNKMVKVLLEFNANVEMSTRDGIRPLHCAASQGHRDICALLIEHKANCNTRTKNGLVPLHMVAQGNHSELVEFFINQNSVNVNETSLDFLTPLHISSHCNNVEVAEALIKHGANVNDRALNGFVALHIAAKQNHVEFVEMLMSNLCMIDTQTESGFTALHIASIIG---------------------------------SESIAKKLVENNCEIDIPDQFDRTSLHMATIFNHFNIVVYLKEHGGSVDKQMKTGETCLMLAIKSEHKAIVEYLINQGASMSVSDSWGLTALH----WATLVVRENILN----------SNCTDININEAIEIFKFVL----DGCSRF------------------------------DINRTTKNGISSLHLAADCGCLEIVHLLLDKGADINIISINGTTPLHIACKXXXXXXXXXXXXXXXXXXXTMAYVSCPWSPMHFSSYFGSVDSTILLISHENDQTSVREKLRQRTPNGNTCLHLAVQQLQTDIVRVLLENDADFNLENEDGLSAFDMAKIVDDETIINLLGIDTTEMMTTDDKVYLFQRE---------EFSDEEQLETLYMDS---LNELEFFGIGKNSGEKCELQLSIMSLLDYATTIDSIRRADMSLKINNSLNRYRNITLSEIKTRELLIAAQPASMIST--ISSTNTEMSPFDVEKWDFHRVTDLPVNSGFLVSFLVDARGGYMQAQRMPQMKIFVPPDAAPAPTRIICHLLRPEGVANLPGMNDCDGFASRILQIHSSCSRFQKPILIEMPYIALLKSNDREIVILKKNADSDTWKKHSNTFTEETLKAEFGSLYESITPVDQLESNRICRIITTDVPTYFSLISQFQRDVNMIGPDGGYIESKTDKRIKLTFPQGALMKKIQIGLEVQHVDPGIINHVVGDNHKISLSPIITVEPKRRKFRDLIEIQMGLPK--------GVTKNDIQDLKLLFSISEYIT--DWEDVTSSTELVLLENTNCMAHSTKISARVWLIYAPNVPNISELANKIYALHCPTPYVGKFLSYARRHDQEECQIRCLLITDDTPDKTLECQESFELIATGPEVEVINKLQYQIECAGNIVAVTKSDEAILFPVQSFVENRITLPIRVRNQDEPFQGKIAFIPHFQSLS----KQIVKXXXXXXXXXXXXXXXMVGSFRNPDRKHRVKNATLERIKGCQAIAKTELDLKSVADAVGADWRXXXXXXXXXXDDINLVLNENCTDE-EKAFMTLINWQTVLGFKATGNELNRALRQIGREDVVKSCIGDI 4498
            +LRAA  G+  K  + + + +DVN CN NGLNALHLASK GH ++V  L+   A++ A T+K NTA+HIASLAG  EVVK+LV +GAN+N QSQ GFTPLYMAAQENH+ VV+FLLDNGA  +L+T D FTPLAVA+QQGH++ VS+LL        ND    ++LP LHIA RKDD  A  LLL  Q D  A +   S  GFT LH+AA+Y +  V  LLL   A VD+T++N++T LHVA+K G   MVK+LL+  A ++  TRDG+ PLHC A  GH  +  +L++  A   ++TKNGL PLHM  QG+H   V+  + Q++V V++ + D+LT LH+++HC + +VA+ L+   A+ N +ALNGF  LHIA K+N +  +E+L+ +   I   TESG T +H+A+ +G                                    + + LV++  +++   + D+T LH++      +IV  L + G S +    +G T L LA +  H+ +  +L++ GAS+S++   G T LH    +  L V   +L           S  T +++    +  K  L     G S                                D N  T+ GI+S+HLAA  G +++V LLL + A++N+ + +G TPLH+A + +  NV  VL+   ++     A     ++P+H   ++G++     L+ H         K+  +T NG T LH A QQ  T I+ VLL+N+A  N    +G +A  +A+ +   ++++ L + T E+MTT       +           + SD+E  + +  D+   L   +   +G +S       L     + ++    S      S   + +LNR  +     +   ELL+ ++   +  T    S +     +  +  D   +   PV+SGFLVSF+VDARGG M+  R   M+I +PP    APTRI C L++   +AN P M + +G ASR++++  + ++F  P+++E+P+   ++  +RE+++L+ + + +TWK+H      E L      + E +   ++L + RICRIIT D P YF+++S+ +++ N IGP+GG + S T   ++ +FP+GAL K+I++GL+ Q V    +  ++G+  K + SPI+TVEP+RRKF   I + + +P         G   +   +L+LL SI+   +   WED+T +T L  +++  C++ +T +SAR WL     V     LA+++Y      PY+ KF+ +A+ +D  E  +RC  +TDD  DKTLE QE+FE +A   ++EV+      ++C GN+  +TK  + ++F   SF ENR+   I++R+  +   G+++F+   ++        +     TL         D   SF +   + R    T   +       +T++ +  VAD +G  W  LA EL    D+IN +  EN      ++FM L  W T  G  AT + L   L +I R D+V    G I
Sbjct:   28 YLRAARAGHLEKALDYIKNGVDVNICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLL-------ENDTKGKVRLPALHIAARKDDTKAAALLL--QNDTNADVESKS--GFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLL-QHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVD---AQTKMGYTPLHVGCHYGNIKIVNFLLQHS-------AKVNAKTKNGYTALHQAAQQGHTHIINVLLQNNASPNELTVNGNTALAIARRLGYISVVDTLKVVTEEIMTTTTITEKHKMNVPETMNEVLDMSDDEGEDAITGDTDKYLGPQDLKELGDDS-------LPAEGYVGFSLGARSASLRSFSSDRSYTLNR-SSYARDSMMIEELLVPSKEQHLTFTREFDSDSLRHYSWAADTLDNVNLVSSPVHSGFLVSFMVDARGGSMRGSRHHGMRIIIPPRKCTAPTRITCRLVKRHKLANPPPMVEGEGLASRLVEMGPAGAQFLGPVIVEIPHFGSMRGKERELIVLR-SENGETWKEHQFDSKNEDLAELLNGMDEELDSPEELGTKRICRIITKDFPQYFAVVSRIKQESNQIGPEGGILSSTTVPLVQASFPEGALTKRIRVGLQAQPVPEETVKKILGN--KATFSPIVTVEPRRRKFHKPITMTIPVPPPSGEGVSNGYKGDATPNLRLLCSITGGTSPAQWEDITGTTPLTFIKD--CVSFTTNVSARFWLADCHQVLETVGLASQLYRELICVPYMAKFVVFAKTNDPVESSLRCFCMTDDRVDKTLEQQENFEEVARSKDIEVLEGKPIYVDCYGNLAPLTKGGQQLVFNFYSFKENRLPFSIKIRDTSQEPCGRLSFLKEPKTTKGLPQTAVCNLNITLPAHKKAEKADRRQSFASLALRKRYSYLTEPSMSPQSPCERTDIRMAIVADHLGLSWTELARELNFSVDEINQIRVENPNSLISQSFMLLKKWVTRDGKNATTDALTSVLTKINRIDIVTLLEGPI 1523          
BLAST of Ankyrin-2 vs. Ensembl Mouse
Match: Ank3 (ankyrin 3, epithelial [Source:MGI Symbol;Acc:MGI:88026])

HSP 1 Score: 816.224 bits (2107), Expect = 0.000e+0
Identity = 517/1531 (33.77%), Postives = 816/1531 (53.30%), Query Frame = 2
Query:  236 FLRAAHNGYFSKVQEALNSNIDVNSCNSNGLNALHLASKGGHADIVQFLIDNGADIGAKTRKNNTAIHIASLAGSLEVVKILVKHGANINEQSQTGFTPLYMAAQENHVGVVKFLLDNGADINLSTTDNFTPLAVAIQQGHEETVSILLNKSNFLNSNDISNDIKLPPLHIATRKDDYHAVLLLLHHQEDVQAALTQASLNGFTALHVAAYYNSDKVGRLLLENGAPVDYTSKNNVTALHVAAKWGRNKMVKVLLEFNANVEMSTRDGIRPLHCAASQGHRDICALLIEHKANCNTRTKNGLVPLHMVAQGNHSELVEFFINQNSVNVNETSLDFLTPLHISSHCNNVEVAEALIKHGANVNDRALNGFVALHIAAKQNHVEFVEMLMSNLCMIDTQTESGFTALHIASIIG---------------------------------SESIAKKLVENNCEIDIPDQFDRTSLHMATIFNHFNIVVYLKEHGGSVDKQMKTGETCLMLAIKSEHKAIVEYLINQGASMSVSDSWGLTALH----WATLVVRENILN----------SNCTDININEAIEIFKFVL----DGCSRF------------------------------DINRTTKNGISSLHLAADCGCLEIVHLLLDKGADINIISINGTTPLHIACKXXXXXXXXXXXXXXXXXXXTMAYVSCPWSPMHFSSYFGSVDSTILLISHENDQTSVREKLRQRTPNGNTCLHLAVQQLQTDIVRVLLENDADFNLENEDGLSAFDMAKIVDDETIINLLGIDTTEMMTTDDKVYLFQRE---------EFSDEEQLETLYMDS---LNELEFFGIGKNSGEKCELQLSIMSLLDYATTIDSIRRADMSLKINNSLNRYRNITLSEIKTRELLIAAQPASMIST--ISSTNTEMSPFDVEKWDFHRVTDLPVNSGFLVSFLVDARGGYMQAQRMPQMKIFVPPDAAPAPTRIICHLLRPEGVANLPGMNDCDGFASRILQIHSSCSRFQKPILIEMPYIALLKSNDREIVILKKNADSDTWKKHSNTFTEETLKAEFGSLYESITPVDQLESNRICRIITTDVPTYFSLISQFQRDVNMIGPDGGYIESKTDKRIKLTFPQGALMKKIQIGLEVQHVDPGIINHVVGDNHKISLSPIITVEPKRRKFRDLIEIQMGLPK--------GVTKNDIQDLKLLFSISEYIT--DWEDVTSSTELVLLENTNCMAHSTKISARVWLIYAPNVPNISELANKIYALHCPTPYVGKFLSYARRHDQEECQIRCLLITDDTPDKTLECQESFELIATGPEVEVINKLQYQIECAGNIVAVTKSDEAILFPVQSFVENRITLPIRVRNQDEPFQGKIAFIPHFQSLS----KQIVKXXXXXXXXXXXXXXXMVGSFRNPDRKHRVKNATLERIKGCQAIAKTELDLKSVADAVGADWRXXXXXXXXXXDDINLVLNENCTDE-EKAFMTLINWQTVLGFKATGNELNRALRQIGREDVVKSCIGDI 4498
            +LRAA  G+  K  + + + +DVN CN NGLNALHLASK GH ++V  L+   A++ A T+K NTA+HIASLAG  EVVK+LV +GAN+N QSQ GFTPLYMAAQENH+ VV+FLLDNGA  +L+T D FTPLAVA+QQGH++ VS+LL        ND    ++LP LHIA RKDD  A  LLL  Q D  A +   S  GFT LH+AA+Y +  V  LLL   A VD+T++N++T LHVA+K G   MVK+LL+  A ++  TRDG+ PLHC A  GH  +  +L++  A   ++TKNGL PLHM  QG+H   V+  + Q++V V++ + D+LT LH+++HC + +VA+ L+   A+ N +ALNGF  LHIA K+N +  +E+L+ +   I   TESG T +H+A+ +G                                    + + LV++  +++   + D+T LH++      +IV  L + G S +    +G T L LA +  H+ +  +L++ GAS+S++   G T LH    +  L V   +L           S  T +++    +  K  L     G S                                D N  T+ GI+S+HLAA  G +++V LLL + A++N+ + +G TPLH+A + +  NV  VL+   ++     A     ++P+H   ++G++     L+ H         K+  +T NG T LH A QQ  T I+ VLL+N+A  N    +G +A  +A+ +   ++++ L + T E+MTT       +           + SD+E  + +  D+   L   +   +G +S       L     + ++    S      S   + +LNR  +     +   ELL+ ++   +  T    S +     +  +  D   +   PV+SGFLVSF+VDARGG M+  R   M+I +PP    APTRI C L++   +AN P M + +G ASR++++  + ++F  P+++E+P+   ++  +RE+++L+ + + +TWK+H      E L      + E +   ++L + RICRIIT D P YF+++S+ +++ N IGP+GG + S T   ++ +FP+GAL K+I++GL+ Q V    +  ++G+  K + SPI+TVEP+RRKF   I + + +P         G   +   +L+LL SI+   +   WED+T +T L  +++  C++ +T +SAR WL     V     LA+++Y      PY+ KF+ +A+ +D  E  +RC  +TDD  DKTLE QE+FE +A   ++EV+      ++C GN+  +TK  + ++F   SF ENR+   I++R+  +   G+++F+   ++        +     TL         D   SF +   + R    T   +       +T++ +  VAD +G  W  LA EL    D+IN +  EN      ++FM L  W T  G  AT + L   L +I R D+V    G I
Sbjct:   28 YLRAARAGHLEKALDYIKNGVDVNICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLE-------NDTKGKVRLPALHIAARKDDTKAAALLL--QNDTNADVESKS--GFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLL-QHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVD---AQTKMGYTPLHVGCHYGNIKIVNFLLQHS-------AKVNAKTKNGYTALHQAAQQGHTHIINVLLQNNASPNELTVNGNTALAIARRLGYISVVDTLKVVTEEIMTTTTITEKHKMNVPETMNEVLDMSDDEGEDAITGDTDKYLGPQDLKELGDDS-------LPAEGYVGFSLGARSASLRSFSSDRSYTLNR-SSYARDSMMIEELLVPSKEQHLTFTREFDSDSLRHYSWAADTLDNVNLVSSPVHSGFLVSFMVDARGGSMRGSRHHGMRIIIPPRKCTAPTRITCRLVKRHKLANPPPMVEGEGLASRLVEMGPAGAQFLGPVIVEIPHFGSMRGKERELIVLR-SENGETWKEHQFDSKNEDLAELLNGMDEELDSPEELGTKRICRIITKDFPQYFAVVSRIKQESNQIGPEGGILSSTTVPLVQASFPEGALTKRIRVGLQAQPVPEETVKKILGN--KATFSPIVTVEPRRRKFHKPITMTIPVPPPSGEGVSNGYKGDATPNLRLLCSITGGTSPAQWEDITGTTPLTFIKD--CVSFTTNVSARFWLADCHQVLETVGLASQLYRELICVPYMAKFVVFAKTNDPVESSLRCFCMTDDRVDKTLEQQENFEEVARSKDIEVLEGKPIYVDCYGNLAPLTKGGQQLVFNFYSFKENRLPFSIKIRDTSQEPCGRLSFLKEPKTTKGLPQTAVCNLNITLPAHKKAEKADRRQSFASLALRKRYSYLTEPSMSPQSPCERTDIRMAIVADHLGLSWTELARELNFSVDEINQIRVENPNSLISQSFMLLKKWVTRDGKNATTDALTSVLTKINRIDIVTLLEGPI 1523          
BLAST of Ankyrin-2 vs. UniProt/SwissProt
Match: sp|G5E8K5|ANK3_MOUSE (Ankyrin-3 OS=Mus musculus OX=10090 GN=Ank3 PE=1 SV=1)

HSP 1 Score: 813.913 bits (2101), Expect = 0.000e+0
Identity = 524/1563 (33.53%), Postives = 825/1563 (52.78%), Query Frame = 2
Query:  236 FLRAAHNGYFSKVQEALNSNIDVNSCNSNGLNALHLASKGGHADIVQFLIDNGADIGAKTRKNNTAIHIASLAGSLEVVKILVKHGANINEQSQTGFTPLYMAAQENHVGVVKFLLDNGADINLSTTDNFTPLAVAIQQGHEETVSILLNKSNFLNSNDISNDIKLPPLHIATRKDDYHAVLLLLHHQEDVQAALTQASLNGFTALHVAAYYNSDKVGRLLLENGAPVDYTSKNNVTALHVAAKWGRNKMVKVLLEFNANVEMSTRDGIRPLHCAASQGHRDICALLIEHKANCNTRTKNGLVPLHMVAQGNHSELVEFFINQNSVNVNETSLDFLTPLHISSHCNNVEVAEALIKHGANVNDRALNGFVALHIAAKQNHVEFVEMLMSNLCMIDTQTESGFTALHIASIIG---------------------------------SESIAKKLVENNCEIDIPDQFDRTSLHMATIFNHFNIVVYLKEHGGSVDKQMKTGETCLMLAIKSEHKAIVEYLINQGASMSVSDSWGLTALH----WATLVVRENILN----------SNCTDININEAIEIFKFVL----DGCSRF------------------------------DINRTTKNGISSLHLAADCGCLEIVHLLLDKGADINIISINGTTPLHIACKXXXXXXXXXXXXXXXXXXXTMAYVSCPWSPMHFSSYFGSVDSTILLISHENDQTSVREKLRQRTPNGNTCLHLAVQQLQTDIVRVLLENDADFNLENEDGLSAFDMAKIVDDETIINLLGIDTTEMMTTDDKVYLFQRE---------EFSDEEQLETLYMDSLNELEFFGIGKNSGEKC------ELQLSIMSLLD--------YATTIDSIRRADMSLKINN--------------SLNRYRNITLSE-------IKTRELLIAAQPASMIST--ISSTNTEMSPFDVEKWDFHRVTDLPVNSGFLVSFLVDARGGYMQAQRMPQMKIFVPPDAAPAPTRIICHLLRPEGVANLPGMNDCDGFASRILQIHSSCSRFQKPILIEMPYIALLKSNDREIVILKKNADSDTWKKHSNTFTEETLKAEFGSLYESITPVDQLESNRICRIITTDVPTYFSLISQFQRDVNMIGPDGGYIESKTDKRIKLTFPQGALMKKIQIGLEVQHVDPGIINHVVGDNHKISLSPIITVEPKRRKFRDLIEIQMGLPK--------GVTKNDIQDLKLLFSISEYIT--DWEDVTSSTELVLLENTNCMAHSTKISARVWLIYAPNVPNISELANKIYALHCPTPYVGKFLSYARRHDQEECQIRCLLITDDTPDKTLECQESFELIATGPEVEVINKLQYQIECAGNIVAVTKSDEAILFPVQSFVENRITLPIRVRNQDEPFQGKIAFIPHFQSLS----KQIVKXXXXXXXXXXXXXXXMVGSFRNPDRKHRVKNATLERIKGCQAIAKTELDLKSVADAVGADWRXXXXXXXXXXDDINLVLNENCTDE-EKAFMTLINWQTVLGFKATGNELNRALRQIGREDVVKSCIGDI 4498
            +LRAA  G+  K  + + + +DVN CN NGLNALHLASK GH ++V  L+   A++ A T+K NTA+HIASLAG  EVVK+LV +GAN+N QSQ GFTPLYMAAQENH+ VV+FLLDNGA  +L+T D FTPLAVA+QQGH++ VS+LL        ND    ++LP LHIA RKDD  A  LLL  Q D  A +   S  GFT LH+AA+Y +  V  LLL   A VD+T++N++T LHVA+K G   MVK+LL+  A ++  TRDG+ PLHC A  GH  +  +L++  A   ++TKNGL PLHM  QG+H   V+  + Q++V V++ + D+LT LH+++HC + +VA+ L+   A+ N +ALNGF  LHIA K+N +  +E+L+ +   I   TESG T +H+A+ +G                                    + + LV++  +++   + D+T LH++      +IV  L + G S +    +G T L LA +  H+ +  +L++ GAS+S++   G T LH    +  L V   +L           S  T +++    +  K  L     G S                                D N  T+ GI+S+HLAA  G +++V LLL + A++N+ + +G TPLH+A + +  NV  VL+   ++     A     ++P+H   ++G++     L+ H         K+  +T NG T LH A QQ  T I+ VLL+N+A  N    +G +A  +A+ +   ++++ L + T E+MTT       +           + SD+E  +    + L++ E+   G+  G+KC      ++Q  ++   D        Y    D     D SL                  S +  R+ TL+        +   ELL+ ++   +  T    S +     +  +  D   +   PV+SGFLVSF+VDARGG M+  R   M+I +PP    APTRI C L++   +AN P M + +G ASR++++  + ++F  P+++E+P+   ++  +RE+++L+ + + +TWK+H      E L      + E +   ++L + RICRIIT D P YF+++S+ +++ N IGP+GG + S T   ++ +FP+GAL K+I++GL+ Q V    +  ++G+  K + SPI+TVEP+RRKF   I + + +P         G   +   +L+LL SI+   +   WED+T +T L  +++  C++ +T +SAR WL     V     LA+++Y      PY+ KF+ +A+ +D  E  +RC  +TDD  DKTLE QE+FE +A   ++EV+      ++C GN+  +TK  + ++F   SF ENR+   I++R+  +   G+++F+   ++        +     TL         D   SF +   + R    T   +       +T++ +  VAD +G  W  LA EL    D+IN +  EN      ++FM L  W T  G  AT + L   L +I R D+V    G I
Sbjct:   28 YLRAARAGHLEKALDYIKNGVDVNICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLE-------NDTKGKVRLPALHIAARKDDTKAAALLL--QNDTNADVESKS--GFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLL-QHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVD---AQTKMGYTPLHVGCHYGNIKIVNFLLQHS-------AKVNAKTKNGYTALHQAAQQGHTHIINVLLQNNASPNELTVNGNTALAIARRLGYISVVDTLKVVTEEIMTTTTITEKHKMNVPETMNEVLDMSDDEVRKASAPEKLSDGEYISDGEE-GDKCTWFKIPKVQEVLVKSEDAITGDTDKYLGPQDLKELGDDSLPAEGYVGFSLGARSASLRSFSSDRSYTLNRSSYARDSMMIEELLVPSKEQHLTFTREFDSDSLRHYSWAADTLDNVNLVSSPVHSGFLVSFMVDARGGSMRGSRHHGMRIIIPPRKCTAPTRITCRLVKRHKLANPPPMVEGEGLASRLVEMGPAGAQFLGPVIVEIPHFGSMRGKERELIVLR-SENGETWKEHQFDSKNEDLAELLNGMDEELDSPEELGTKRICRIITKDFPQYFAVVSRIKQESNQIGPEGGILSSTTVPLVQASFPEGALTKRIRVGLQAQPVPEETVKKILGN--KATFSPIVTVEPRRRKFHKPITMTIPVPPPSGEGVSNGYKGDATPNLRLLCSITGGTSPAQWEDITGTTPLTFIKD--CVSFTTNVSARFWLADCHQVLETVGLASQLYRELICVPYMAKFVVFAKTNDPVESSLRCFCMTDDRVDKTLEQQENFEEVARSKDIEVLEGKPIYVDCYGNLAPLTKGGQQLVFNFYSFKENRLPFSIKIRDTSQEPCGRLSFLKEPKTTKGLPQTAVCNLNITLPAHKKAEKADRRQSFASLALRKRYSYLTEPSMSPQSPCERTDIRMAIVADHLGLSWTELARELNFSVDEINQIRVENPNSLISQSFMLLKKWVTRDGKNATTDALTSVLTKINRIDIVTLLEGPI 1562          
BLAST of Ankyrin-2 vs. UniProt/SwissProt
Match: sp|Q12955|ANK3_HUMAN (Ankyrin-3 OS=Homo sapiens OX=9606 GN=ANK3 PE=1 SV=3)

HSP 1 Score: 798.89 bits (2062), Expect = 0.000e+0
Identity = 481/1406 (34.21%), Postives = 757/1406 (53.84%), Query Frame = 2
Query:  236 FLRAAHNGYFSKVQEALNSNIDVNSCNSNGLNALHLASKGGHADIVQFLIDNGADIGAKTRKNNTAIHIASLAGSLEVVKILVKHGANINEQSQTGFTPLYMAAQENHVGVVKFLLDNGADINLSTTDNFTPLAVAIQQGHEETVSILLNKSNFLNSNDISNDIKLPPLHIATRKDDYHAVLLLLHHQEDVQAALTQASLNGFTALHVAAYYNSDKVGRLLLENGAPVDYTSKNNVTALHVAAKWGRNKMVKVLLEFNANVEMSTRDGIRPLHCAASQGHRDICALLIEHKANCNTRTKNGLVPLHMVAQGNHSELVEFFINQNSVNVNETSLDFLTPLHISSHCNNVEVAEALIKHGANVNDRALNGFVALHIAAKQNHVEFVEMLMSNLCMIDTQTESGFTALHIASIIG---------------------------------SESIAKKLVENNCEIDIPDQFDRTSLHMATIFNHFNIVVYLKEHGGSVDKQMKTGETCLMLAIKSEHKAIVEYLINQGASMSVSDSWGLTALHWATLVVRENILN--------------SNCTDININEAIEIFKFVL----DGCSRF------------------------------DINRTTKNGISSLHLAADCGCLEIVHLLLDKGADINIISINGTTPLHIACKXXXXXXXXXXXXXXXXXXXTMAYVSCPWSPMHFSSYFGSVDSTILLISHENDQTSVREKLRQRTPNGNTCLHLAVQQLQTDIVRVLLENDADFNLENEDGLSAFDMAK------IVD-----------------------DETIINLLGIDTTEMMTTDDKVYLFQREEFSD-EEQLETLYMDS---LNELEFFGIGKNSGEKCELQLSIMSLLDYATTIDSIRRADMSLKINNSLNRYRNITLSEIKTRELLIAAQPASMIST--ISSTNTEMSPFDVEKWDFHRVTDLPVNSGFLVSFLVDARGGYMQAQRMPQMKIFVPPDAAPAPTRIICHLLRPEGVANLPGMNDCDGFASRILQIHSSCSRFQKPILIEMPYIALLKSNDREIVILKKNADSDTWKKHSNTFTEETLKAEFGSLYESITPVDQLESNRICRIITTDVPTYFSLISQFQRDVNMIGPDGGYIESKTDKRIKLTFPQGALMKKIQIGLEVQHVDPGIINHVVGDNHKISLSPIITVEPKRRKFRDLIEIQMGLPK--------GVTKNDIQDLKLLFSISEYIT--DWEDVTSSTELVLLENTNCMAHSTKISARVWLIYAPNVPNISELANKIYALHCPTPYVGKFLSYARRHDQEECQIRCLLITDDTPDKTLECQESFELIATGPEVEVINKLQYQIECAGNIVAVTKSDEAILFPVQSFVENRITLPIRVRNQDEPFQGKIAFI 4075
            +LRAA  G+  K  + + + +D+N CN NGLNALHLASK GH ++V  L+   A++ A T+K NTA+HIASLAG  EVVK+LV +GAN+N QSQ GFTPLYMAAQENH+ VVKFLLDNGA  +L+T D FTPLAVA+QQGH++ VS+LL        ND    ++LP LHIA RKDD  A  LLL  Q D  A +   S +GFT LH+AA+Y +  V  LLL   A VD+T++N++T LHVA+K G   MVK+LL+  A ++  TRDG+ PLHC A  GH  +  +L++  A   ++TKNGL PLHM  QG+H   V+  +  N V V++ + D+LT LH+++HC + +VA+ L+   AN N +ALNGF  LHIA K+N ++ +E+L+ +   I   TESG T +H+A+ +G                                    + + LV++  +++   + D+T LH++      +IV  L + G S +    +G T L L+ +  H+ +  +L++ GAS+S++   G T LH A    +  + N              S  T +++    +  K  L     G S                                D N  T+ GI+S+HLAA  G +++V LLL + A++N+ + +G TPLH+A + +  NV  VL+   ++     A     ++P+H   ++G++     L+ H         K+  +T NG T LH A QQ  T I+ VLL+N+A  N    +G +A  +A+      +VD                        ET+  +L +   E+   +    L   E  SD EE  + +  D+   L   +   +G +S       L     + ++    S      S   + +LNR  +     +   ELL+ ++   +  T    S +     +  +  D   +   P++SGFLVSF+VDARGG M+  R   M+I +PP    APTRI C L++   +AN P M + +G ASR++++  + ++F  P+++E+P+   ++  +RE+++L+ + + +TWK+H      E L      + E +   ++L   RICRIIT D P YF+++S+ +++ N IGP+GG + S T   ++ +FP+GAL K+I++GL+ Q V   I+  ++G+  K + SPI+TVEP+RRKF   I + + +P         G   +   +L+LL SI+   +   WED+T +T L  +++  C++ +T +SAR WL     V     LA ++Y      PY+ KF+ +A+ +D  E  +RC  +TDD  DKTLE QE+FE +A   ++EV+      ++C GN+  +TK  + ++F   SF ENR+   I++R+  +   G+++F+
Sbjct:   45 YLRAARAGHLEKALDYIKNGVDINICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVKFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLE-------NDTKGKVRLPALHIAARKDDTKAAALLL--QNDNNADV--ESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRAAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHN-VPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLSAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVANLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATTLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLGRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVD---AQTKMGYTPLHVGCHYGNIKIVNFLLQHS-------AKVNAKTKNGYTPLHQAAQQGHTHIINVLLQNNASPNELTVNGNTALGIARRLGYISVVDTLKIVTEETMTTTTVTEKHKMNVPETMNEVLDMSDDEVRKANAPEMLSDGEYISDVEEGEDAMTGDTDKYLGPQDLKELGDDS-------LPAEGYMGFSLGARSASLRSFSSDRSYTLNR-SSYARDSMMIEELLVPSKEQHLTFTREFDSDSLRHYSWAADTLDNVNLVSSPIHSGFLVSFMVDARGGSMRGSRHHGMRIIIPPRKCTAPTRITCRLVKRHKLANPPPMVEGEGLASRLVEMGPAGAQFLGPVIVEIPHFGSMRGKERELIVLR-SENGETWKEHQFDSKNEDLTELLNGMDEELDSPEELGKKRICRIITKDFPQYFAVVSRIKQESNQIGPEGGILSSTTVPLVQASFPEGALTKRIRVGLQAQPVPDEIVKKILGN--KATFSPIVTVEPRRRKFHKPITMTIPVPPPSGEGVSNGYKGDTTPNLRLLCSITGGTSPAQWEDITGTTPLTFIKD--CVSFTTNVSARFWLADCHQVLETVGLATQLYRELICVPYMAKFVVFAKMNDPVESSLRCFCMTDDKVDKTLEQQENFEEVARSKDIEVLEGKPIYVDCYGNLAPLTKGGQQLVFNFYSFKENRLPFSIKIRDTSQEPCGRLSFL 1415          
BLAST of Ankyrin-2 vs. UniProt/SwissProt
Match: sp|O70511|ANK3_RAT (Ankyrin-3 OS=Rattus norvegicus OX=10116 GN=Ank3 PE=1 SV=3)

HSP 1 Score: 797.349 bits (2058), Expect = 0.000e+0
Identity = 479/1406 (34.07%), Postives = 759/1406 (53.98%), Query Frame = 2
Query:  236 FLRAAHNGYFSKVQEALNSNIDVNSCNSNGLNALHLASKGGHADIVQFLIDNGADIGAKTRKNNTAIHIASLAGSLEVVKILVKHGANINEQSQTGFTPLYMAAQENHVGVVKFLLDNGADINLSTTDNFTPLAVAIQQGHEETVSILLNKSNFLNSNDISNDIKLPPLHIATRKDDYHAVLLLLHH--QEDVQAALT--QASLNGFTALHVAAYYNSDKVGRLLLENGAPVDYTSKNNVTALHVAAKWGRNKMVKVLLEFNANVEMSTRDGIRPLHCAASQGHRDICALLIEHKANCNTRTKNGLVPLHMVAQGNHSELVEFFINQNSVNVNETSLDFLTPLHISSHCNNVEVAEALIKHGANVNDRALNGFVALHIAAKQNHVEFVEMLMSNLCMIDTQTESGFTALHIASIIG---------------------------------SESIAKKLVENNCEIDIPDQFDRTSLHMATIFNHFNIVVYLKEHGGSVDKQMKTGETCLMLAIKSEHKAIVEYLINQGASMSVSDSWGLTALH----WATLVVRENILN----------SNCTDININEAIEIFKFVL----DGCSRF------------------------------DINRTTKNGISSLHLAADCGCLEIVHLLLDKGADINIISINGTTPLHIACKXXXXXXXXXXXXXXXXXXXTMAYVSCPWSPMHFSSYFGSVDSTILLISHENDQTSVREKLRQRTPNGNTCLHLAVQQLQTDIVRVLLENDADFNLENEDGLSAFDMAK------IVD-----------------------DETIINLLGIDTTEMMTTDDKVYLFQREEFSDEEQLETLYMDSLNELEFFGIGKNSGEKCELQLSIMSLLDYATTIDSIRRADMSLKINNSLNRYRNITLSEIKTRELLIAAQPASMIST--ISSTNTEMSPFDVEKWDFHRVTDLPVNSGFLVSFLVDARGGYMQAQRMPQMKIFVPPDAAPAPTRIICHLLRPEGVANLPGMNDCDGFASRILQIHSSCSRFQKPILIEMPYIALLKSNDREIVILKKNADSDTWKKHSNTFTEETLKAEFGSLYESITPVDQLESNRICRIITTDVPTYFSLISQFQRDVNMIGPDGGYIESKTDKRIKLTFPQGALMKKIQIGLEVQHVDPGIINHVVGDNHKISLSPIITVEPKRRKFRDLIEIQMGLPK--------GVTKNDIQDLKLLFSISEYIT--DWEDVTSSTELVLLENTNCMAHSTKISARVWLIYAPNVPNISELANKIYALHCPTPYVGKFLSYARRHDQEECQIRCLLITDDTPDKTLECQESFELIATGPEVEVINKLQYQIECAGNIVAVTKSDEAILFPVQSFVENRITLPIRVRNQDEPFQGKIAFI 4075
            +LRAA  G+  K  + + + +DVN CN NGLNALHLASK GH ++V  L+   A++ A T+K NTA+HIASLAG  EVVK+LV +GAN+N QSQ GFTPLYMAAQENH+ VV+FLLDNGA  +L+T D FTPLAVA+QQGH++ VS+LL        ND    ++LP LHIA RKDD  A  LLL +    D+++ +   +A+ +GFT LH+AA+Y +  V  LLL   A VD+T++N++T LHVA+K G   MVK+LL+  A ++  TRDG+ PLHC A  GH  +  +L++  A   ++TKNGL PLHM  QG+H   V+  +  N V V++ + D+LT LH+++HC + +VA+ L+   AN N +ALNGF  LHIA K+N +  +E+L+ +   I   TESG T +H+A+ +G                                    + + LV++  +++   + D+T LH++      +IV  L + G S +    +G T L L+ +  H+ +  +L++ GAS+S++   G T LH    +  L V   +L           S  T +++    +  K  L     G S                                D N  T+ GI+S+HLAA  G +++V LLL + A++N+ + +G TPLH+A + +  NV  VL+   ++     A     ++P+H   ++G++     L+ H         K+  +T NG T LH A QQ  T I+ VLL+N+A  N    +G +A  +A+      +VD                        ET+  +L +   E+        L   E  SD E+ E       ++  + G  ++  E  +  L     + ++    S      S   + +LNR  +     +   ELL+ ++   +  T    S +     +  +  D   +   PV+SGFLVSF+VDARGG M+  R   M+I +PP    APTRI C L++   +AN P M + +G ASR++++  + ++F  P+++E+P+   ++  +RE+++L+ + + +TWK+H      E L      + E +   ++L + RICRIIT D P YF+++S+ +++ N IGP+GG + S T   ++ +FP+GAL K+I++GL+ Q V    +  ++G+  K + SPI+TVEP+RRKF   I + + +P         G   +    L+LL SI+   +   WED+T +T L  +++  C++ +T +SAR WL     V     LA+++Y      PY+ KF+ +A+ +D  E  +RC  +TDD  DKTLE QE+FE +A   ++EV+      ++C GN+  +TK  + ++F   SF ENR+   I+VR+  +   G+++F+
Sbjct:   45 YLRAARAGHLEKALDYIKNGVDVNICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLE-------NDTKGKVRLPALHIAARKDDTKAAALLLQNDTNADIESKMVVNRATESGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRAAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHN-VPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLSAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVD---AQTKMGYTPLHVGCHYGNIKIVNFLLQHS-------AKVNAKTKNGYTPLHQAAQQGHTHIINVLLQNNASPNELTVNGNTALAIARRLGYISVVDTLKVVTEEIMTTTTITEKHKMNVPETMNEVLDMSDDEVGKASAPEKLSDGEYISDGEEGEDAITGDTDK--YLG-PQDLKELGDDSLPAEGYVGFSLGARSASLRSFSSDRSYTLNR-SSYARDSMMIEELLVPSKEQHLPFTREFDSDSLRHYSWAADTLDNVNLVSSPVHSGFLVSFMVDARGGSMRGSRHHGMRIIIPPRKCTAPTRITCRLVKRHKLANPPPMVEGEGLASRLVEMGPAGAQFLGPVIVEIPHFGSMRGKERELIVLR-SENGETWKEHQFDSKNEDLSELLNGMDEELDSPEELGTKRICRIITKDFPQYFAVVSRIKQESNQIGPEGGILSSTTVPLVQASFPEGALTKRIRVGLQAQPVPEETVKKILGN--KATFSPIVTVEPRRRKFHKPITMTIPVPPPSGEGVSNGYKGDTTPSLRLLCSITGGTSPAQWEDITGTTPLTFIKD--CVSFTTNVSARFWLADCHQVLETVGLASQLYRELICVPYMAKFVVFAKTNDPVESSLRCFCMTDDRVDKTLEQQENFEEVARSKDIEVLEGKPIYVDCYGNLAPLTKGGQQLVFNFYSFKENRLPFSIKVRDTSQEPCGRLSFL 1423          
BLAST of Ankyrin-2 vs. UniProt/SwissProt
Match: sp|P16157|ANK1_HUMAN (Ankyrin-1 OS=Homo sapiens OX=9606 GN=ANK1 PE=1 SV=3)

HSP 1 Score: 756.903 bits (1953), Expect = 0.000e+0
Identity = 508/1537 (33.05%), Postives = 793/1537 (51.59%), Query Frame = 2
Query:  203 ISFS*SEKEHIFLRAAHNGYFSKVQEALNSNIDVNSCNSNGLNALHLASKGGHADIVQFLIDNGADIGAKTRKNNTAIHIASLAGSLEVVKILVKHGANINEQSQTGFTPLYMAAQENHVGVVKFLLDNGADINLSTTDNFTPLAVAIQQGHEETVSILLNKSNFLNSNDISNDIKLPPLHIATRKDDYHAVLLLLHHQEDVQAALTQASLNGFTALHVAAYYNSDKVGRLLLENGAPVDYTSKNNVTALHVAAKWGRNKMVKVLLEFNANVEMSTRDGIRPLHCAASQGHRDICALLIEHKANCNTRTKNGLVPLHMVAQGNHSELVEFFINQNSVNVNETSLDFLTPLHISSHCNNVEVAEALIKHGANVNDRALNGFVALHIAAKQNHVEFVEMLMSNLCMIDTQTESGFTALHIASIIGS---------------------------------ESIAKKLVENNCEIDIPDQFDRTSLHMATIFNHFNIVVYLKEHGGSVDKQMKTGETCLMLAIKSEHKAIVEYLINQGASMSVSDSWGLTALH----WATLVVRENILNSNC----------TDINI---NEAIEIFKFVL-----------DGCSRFDI--------------------NRTTKNGISSLHLAADCGCLEIVHLLLDKGADINIISINGTTPLHIACKXXXXXXXXXXXXXXXXXXXT--MAYVSCPWSPMHFSSYFGSVDSTILLISHENDQTSVREKLRQRTPNGNTCLHLAVQQLQTDIVRVLLENDADFNLENEDGLSAFDMAKIVDDETIINLLGI--DTTEMMTTDDKVYLFQREEFSDE-EQLETLYMDSLNELEFFGI----GKNSGEKCELQLSIMSLLDYATTIDSIRRADMSLKINNSLNRYRNITLSEIKTRELLIAAQPASMISTISSTNTEMSPFDVEKWDFHRVTDLPVNSGFLVSFLVDARGGYMQAQRMPQMKIFVPPDAAPAPTRIICHLLRPEGVANLPGMNDCDGFASRILQIHSSCSRFQKPILIEMPYIALLKSNDREIVILKKNADSDTWKKHSNTFTEETLKAEFGSLYESITPVDQLESNRICRIITTDVPTYFSLISQFQRDVNMIGPDGGYIESKTDKRIKLTFPQGALMKKIQIGLEVQHVDPGIINHVVGDNHKISLSPIITVEPKRRKFRDLIEIQMGLPKGVTKN-------DIQDLKLLFSI--SEYITDWEDVTSSTELVLLENTNCMAHSTKISARVWLIYAPNVPNISELANKIYALHCPTPYVGKFLSYARRHDQEECQIRCLLITDDTPDKTLECQESFELIATGPEVEVINKLQYQIECAGNIVAVTKSDEAILFPVQSFVENRITLPIRVRNQDEPFQGKIAFIPHFQSLSKQIVKXXXXXXXXXXXXXXXMVGS---FRNPD----RKHRVKNATLERIKGCQAIAKTELDLKSVADAVGADWRXXXXXXXXXXDDINLVLNENCTDEEKAFMTLIN-WQTVLGFKATGNELNRALRQIGREDVVKSCIG 4492
            + F  ++    FLRAA +G   K  + L + +D+N+CN NGLN LHLASK GH  +V  L+     +   T+K NTA+HIA+LAG  EVV+ LV +GAN+N QSQ GFTPLYMAAQENH+ VVKFLL+NGA+ N++T D FTPLAVA+QQGHE  V+ L+N             ++LP LHIA R DD     +LL +  +        S  GFT LH+AA+Y +  V +LLL  GA V++T +N +T LH+A++ G   MV++LL+  A +E  T+D + PLHCAA  GH  I  +L++H A    +TKNGL P+HM AQG+H + V   + Q    +++ +LD LTPLH+++HC +  VA+ L+  GA  N RALNGF  LHIA K+NHV  +E+L+     ID  TESG T LH+AS +G                                    +AK L++N  +++   + D+T LH A    H N+V  L E+  + +     G T L +A +  H   V  L+ + AS +     G T LH    +  + V E +L  +           T +++   +  ++I K +L           +G +   I                    N  +  G++ LHLAA  G  E+V LLL K A+ N+ + +G TPLH+  +  +  V  VL++       T  M Y     +P+H +S++G++     L+ H+ D       +  +T  G + LH A QQ  TDIV +LL+N A  N  + DG +   +AK +   ++ ++L +  D T  +   DK     R  F +  +++  +  D   EL  F       ++  E+ EL L  +  LD      +I R   ++     +        S+    + LI + PA+       T+  +SP              PV++GFLVSF+VDARGG M+  R   +++ +PP    APTRI C L++P+ ++  P + + +G ASRI+ +  + ++F  P+++E+P+ A     DRE+V+L+    S  WK+H + + E  L      + E +  +++LE  R+CRIITTD P YF ++S+  +D + IGP+GG ++SK    ++ TFP+ A+ K++++ L+ Q V   ++  ++G+  + + SPI+TVEP+RRKF   I +++ LP   T N       D   L+LL S+        WED+T +T+LV      C   +T +SAR WL   P        A  +Y      PY+ KF+ +A+ +D  E ++RC  +TDD  DKTLE  E+F  +A   ++EV+  +    E +GN+V V K+ +   F  QSF ENR+ +P++VR+      G ++F+   +++  +  + I     I         G+    R P     R   +  +T   + G +   + E+ +  +++ +G  W  LA EL+   +DIN +  EN     +  + L+N W    G  A    L  AL+ I R ++V    G
Sbjct:    5 VGFREADAATSFLRAARSGNLDKALDHLRNGVDINTCNQNGLNGLHLASKEGHVKMVVELLHKEIILETTTKKGNTALHIAALAGQDEVVRELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQNVATEDGFTPLAVALQQGHENVVAHLINYGT-------KGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVL----SKTGFTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETKTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLL-QYDAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHVRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKVNAKAKDDQTPLHCAARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALLEKEASQACMTKKGFTPLHVAAKYGKVRVAELLLERDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQVEVARSLLQYGGSANAESVQGVTPLHLAAQEGHAEMVALLLSKQANGNLGNKSGLTPLHLVAQEGHVPVADVLIKHGVMVDATTRMGY-----TPLHVASHYGNIKLVKFLLQHQAD-------VNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGASPNEVSSDGTTPLAIAKRLGYISVTDVLKVVTDETSFVLVSDK----HRMSFPETVDEILDVSEDEGEELISFKAERRDSRDVDEEKEL-LDFVPKLDQVVESPAIPRIPCAMPETVVIRSEEQEQASKEYDEDSLIPSSPAT------ETSDNISPVAS-----------PVHTGFLVSFMVDARGGSMRGSRHNGLRVVIPPRTCAAPTRITCRLVKPQKLSTPPPLAEEEGLASRIIALGPTGAQFLSPVIVEIPHFASHGRGDRELVVLRSENGS-VWKEHRSRYGESYLDQILNGMDEELGSLEELEKKRVCRIITTDFPLYFVIMSRLCQDYDTIGPEGGSLKSKLVPLVQATFPENAVTKRVKLALQAQPVPDELVTKLLGN--QATFSPIVTVEPRRRKFHRPIGLRIPLPPSWTDNPRDSGEGDTTSLRLLCSVIGGTDQAQWEDITGTTKLVYA--NECANFTTNVSARFWLSDCPRTAEAVNFATLLYKELTAVPYMAKFVIFAKMNDPREGRLRCYCMTDDKVDKTLEQHENFVEVARSRDIEVLEGMSLFAELSGNLVPVKKAAQQRSFHFQSFRENRLAMPVKVRDSSREPGGSLSFL--RKAMKYEDTQHILCHLNITMPPCAKGSGAEDRRRTPTPLALRYSILSESTPGSLSGTE---QAEMKMAVISEHLGLSWAELARELQFSVEDINRIRVENPNSLLEQSVALLNLWVIREGQNANMENLYTALQSIDRGEIVNMLEG 1485          
BLAST of Ankyrin-2 vs. UniProt/SwissProt
Match: sp|Q02357|ANK1_MOUSE (Ankyrin-1 OS=Mus musculus OX=10090 GN=Ank1 PE=1 SV=2)

HSP 1 Score: 751.125 bits (1938), Expect = 0.000e+0
Identity = 507/1523 (33.29%), Postives = 782/1523 (51.35%), Query Frame = 2
Query:  236 FLRAAHNGYFSKVQEALNSNIDVNSCNSNGLNALHLASKGGHADIVQFLIDNGADIGAKTRKNNTAIHIASLAGSLEVVKILVKHGANINEQSQTGFTPLYMAAQENHVGVVKFLLDNGADINLSTTDNFTPLAVAIQQGHEETVSILLNKSNFLNSNDISNDIKLPPLHIATRKDDYHAVLLLLHHQEDVQAALTQASLNGFTALHVAAYYNSDKVGRLLLENGAPVDYTSKNNVTALHVAAKWGRNKMVKVLLEFNANVEMSTRDGIRPLHCAASQGHRDICALLIEHKANCNTRTKNGLVPLHMVAQGNHSELVEFFINQNSVNVNETSLDFLTPLHISSHCNNVEVAEALIKHGANVNDRALNGFVALHIAAKQNHVEFVEMLMSNLCMIDTQTESGFTALHIASIIGSESIAKKLVE-------NNCEIDIPDQF--------------------------DRTSLHMATIFNHFNIVVYLKEHGGSVDKQMKTGETCLMLAIKSEHKAIVEYLINQGASMSVSDSWGLTALH----WATLVVRENILNSNC----------TDINI---NEAIEIFKFVL-----------DGCSRFDI--------------------NRTTKNGISSLHLAADCGCLEIVHLLLDKGADINIISINGTTPLHIACKXXXXXXXXXXXXXXXXXXXT--MAYVSCPWSPMHFSSYFGSVDSTILLISHENDQTSVREKLRQRTPNGNTCLHLAVQQLQTDIVRVLLENDADFNLENEDGLSAFDMAKIVDDETIINLLGIDTTEMMTTDDKVYLFQREEFSDEEQLETLYMDSLNEL-EFFGI------GKNSGEKCELQLSIMSLLDYATTIDSIRRADMSLKINNSLNRYRNITLSEIKTRELLIAAQPASMISTISSTNTEMSPFDVEKWDFHRVTDLPVNSGFLVSFLVDARGGYMQAQRMPQMKIFVPPDAAPAPTRIICHLLRPEGVANLPGMNDCDGFASRILQIHSSCSRFQKPILIEMPYIALLKSNDREIVILKKNADSDTWKKHSNTFTEETLKAEFGSLYESITPVDQLESNRICRIITTDVPTYFSLISQFQRDVNMIGPDGGYIESKTDKRIKLTFPQGALMKKIQIGLEVQHVDPGIINHVVGDNHKISLSPIITVEPKRRKFRDLIEIQMGLPKGVTKN-------DIQDLKLLFSI--SEYITDWEDVTSSTELVLLENTNCMAHSTKISARVWLIYAPNVPNISELANKIYALHCPTPYVGKFLSYARRHDQEECQIRCLLITDDTPDKTLECQESFELIATGPEVEVINKLQYQIECAGNIVAVTKSDEAILFPVQSFVENRITLPIRVRNQDEPFQGKIAFIPHFQSLSKQIVKXXXXXXXXXXXXXXXMVGSFRNPDRKHRVKNATLE-------RIKGCQAIAKTELDLKSVADAVGADWRXXXXXXXXXXDDINLVLNEN---CTDEEKAFMTLINWQTVLGFKATGNELNRALRQIGREDVV 4477
            FLRAA +G   K  + L + +D+N+CN NGLN LHLASK GH  +V  L+     +   T+K NTA+HIA+LAG  EVV+ LV +GAN+N QSQ GFTPLYMAAQENH+ VVKFLL+NGA+ N++T D FTPLAVA+QQGHE  V+ L+N             ++LP LHIA R DD     +LL +  +        S  GFT LH+AA+Y +  V +LLL  GA V++T +N +T LH+A++ G   MV++LL+  A +E  T+D + PLHCAA  GH  I  +L++H A    +TKNGL P+HM AQG+H + V   +  N+  +++ +LD LTPLH+++HC +  VA+ L+  GA  N RALNGF  LHIA K+NH+  +E+L+     ID  TESG T LH+AS +G   I K L++       +N +++ P                             D+T LH A    H  +V  L E+G S +     G T L  A +  H      L+ + AS +     G T LH    +  + + E +L  +           T +++   +  ++I K +L           +G +   I                    N  +  G++ LHLAA  G  E+V LLL K A+ N+ + +G TPLH+  +  +  V  VL++       T  M Y     +P+H +S++G++     L+ H+ D       +  +T  G + LH A QQ  TDIV +LL+N A  N  + +G +   +AK +   ++ ++L + T E       V +  +   S  E ++ +   S +E  E  G        ++ GE+ EL L  +  LD      +I R          +        S+    + LI + PA+       T+  +SP              PV++GFLVSF+VDARGG M+  R   +++ +PP    APTRI C L++P+ +   P + + +G ASRI+ +  + ++F  P+++E+P+ A     DRE+V+L+    S  WK+H + + E  L      + E +  +++LE  R+CRIITTD P YF ++S+  +D + IGP+GG + SK    ++ TFP+ A+ KK+++ L+ Q V   ++  ++G+  + + SPI+TVEP+RRKF   I +++ LP   T N       D   L+LL S+        WED+T +T+L+      C   +T +SAR WL   P        A  +Y      PY+ KF+ +A+ +D  E ++RC  +TDD  DKTLE  E+F  +A   ++EV+  +    E +GN+V V K+ +   F  QSF ENR+ +P++VR+      G ++F+   +++  +  + I     I         G+    DR+  +   TL        R+       + E+ +  + + +G  W  LA EL+   +DIN +  EN     D+  A +TL  W    G  A    L  ALR I R ++V
Sbjct:   12 FLRAARSGNLDKALDHLRNGVDINTCNQNGLNGLHLASKEGHVKMVVELLHKEIILETTTKKGNTALHIAALAGQDEVVRELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQNVATEDGFTPLAVALQQGHENVVAHLINYGT-------KGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVL----SKTGFTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETRTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYNA-EIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHIRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKANAKAKDDQTPLHCAARIGHTGMVKLLLENGASPNLATTAGHTPLHTAAREGHVDTALALLEKEASQACMTKKGFTPLHVAAKYGKVRLAELLLEHDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQIEVARSLLQYGGSANAESVQGVTPLHLAAQEGHTEMVALLLSKQANGNLGNKSGLTPLHLVSQEGHVPVADVLIKHGVTVDATTRMGY-----TPLHVASHYGNIKLVKFLLQHQAD-------VNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGASPNEVSSNGTTPLAIAKRLGYISVTDVLKVVTDETSV----VLVSDKHRMSYPETVDEILDVSEDEGDELVGSKAERRDSRDVGEEKEL-LDFVPKLDQVVESPAIPRIPCVTPETVVIRSEDQEQASKEYDEDSLIPSSPAT------ETSDNISPVAS-----------PVHTGFLVSFMVDARGGSMRGSRHNGLRVVIPPRTCAAPTRITCRLVKPQKLNTPPPLAEEEGLASRIIALGPTGAQFLSPVIVEIPHFASHGRGDRELVVLRSENGS-VWKEHKSRYGESYLDQILNGMDEELGSLEELEKKRVCRIITTDFPLYFVIMSRLCQDYDTIGPEGGSLRSKLVPLVQATFPENAVTKKVKLALQAQPVPDELVTKLLGN--QATFSPIVTVEPRRRKFHRPIGLRIPLPPSWTDNPRDSGEGDTTSLRLLCSVIGGTDQAQWEDITGTTKLIYA--NECANFTTNVSARFWLSDCPRTAEAVHFATLLYKELTAVPYMAKFVIFAKMNDAREGRLRCYCMTDDKVDKTLEQHENFVEVARSRDIEVLEGMPLFAELSGNLVPVKKAAQQRSFHFQSFRENRLAIPVKVRDSSREPGGFLSFL--RKTMKYEDTQHILCHLNITMPPCTKGSGA---EDRRRTLTPLTLRYSILSESRLGFTSDTDRVEMRMAVIREHLGLSWAELARELQFSVEDINRIRVENPNSLLDQSTALLTL--WVDREGENAKMENLYTALRNIDRSEIV 1476          

HSP 2 Score: 131.339 bits (329), Expect = 8.635e-29
Identity = 103/367 (28.07%), Postives = 178/367 (48.50%), Query Frame = 2
Query: 1235 DFLTPLHISSHCNNVEVAEALIKHGANVNDRALNGFVALHIAAKQNHVEFVEMLMSNLCMIDTQTESGFTALHIASIIGSESIAKKLVENNCEIDIPDQFDRTSLHMATIFNHFNIVVYLKEHGGSVDKQMKTGETCLMLAIKSEHKAIVEYLINQGASMSVSDSWGLTALHWATLVVRENILNSNCTDININEAIEIFKFVLDGCSRFDINRTTKNGISSLHLAADCGCLEIVHLLLDKGADINIISINGTTPLHIACKXXXXXXXXXXXXXXXXXXXTMAYVSCPWSPMHFSSYFGSVDSTILLISHENDQTSVREKLRQRTPNGNTCLHLAVQQLQTDIVRVLLENDADFNLENEDGLSAFDMA 2335
            D  T    ++   N++ A   +++G ++N    NG   LH+A+K+ HV+ V  L+    +++T T+ G TALHIA++ G + + ++LV     ++   Q   T L+MA   NH  +V +L E+G + +   + G T L +A++  H+ +V +LIN G    V     L ALH A                  N+       +L      D+   +K G + LH+AA    L +  LLL++GA +N    NG TPLHIA +  N  ++ +LL+  +             +P+H ++  G V  + +L+ H          ++ +T NG + +H+A Q    D VR+LL+ +A+ +    D L+   +A
Sbjct:    7 DAATSFLRAARSGNLDKALDHLRNGVDINTCNQNGLNGLHLASKEGHVKMVVELLHKEIILETTTKKGNTALHIAALAGQDEVVRELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQNVATEDGFTPLAVALQQGHENVVAHLINYGTKGKVR----LPALHIAAR----------------NDDTRTAAVLLQNDPNPDV--LSKTGFTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIE---TRTKDELTPLHCAARNGHVRISEILLDHG-------APIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYNAEIDDITLDHLTPLHVA 341          
BLAST of Ankyrin-2 vs. TrEMBL
Match: A0A4Z2D3Q5 (Ankyrin-3 isoform 1 (Fragment) OS=Schistosoma japonicum OX=6182 GN=EWB00_004838 PE=4 SV=1)

HSP 1 Score: 889.412 bits (2297), Expect = 0.000e+0
Identity = 578/1667 (34.67%), Postives = 883/1667 (52.97%), Query Frame = 2
Query:  203 ISFS*SEKEHIFLRAAHNGYFSKVQEALNSNIDVNSCNSNGLNALHLASKGGHADIVQFLIDNGADIGAKTRKNNTAIHIASLAGSLEVVKILVKHGANINEQSQTGFTPLYMAAQENHVGVVKFLLDNGADINLSTTDNFTPLAVAIQQGHEETVSILLNKSNFLNSNDISNDIKLPPLHIATRKDDYHAVLLLLHHQEDVQAALTQASLNGFTALHVAAYYNSDKVGRLLLENGAPVDYTSKNNVTALHVAAKWGRNKMVKVLLEFNANVEMSTRDGIRPLHCAASQGHRDICALLIEHKANCNTRTKNGLVPLHMVAQGNHSELVEFFINQNSVNVNETSLDFLTPLHISSHCNNVEVAEALIKHGANVNDRALNGFVALHIAAKQNHVEFVEMLMSNLCMIDTQTESGFTALHIASIIGSESIAKKLVENNCEIDIPDQFDRTSLHMATIFNHFNIVVYLKEHGGSVDKQMKT---------------------------------GETCLMLAIKSEHKAIVEYLINQGASMSVSDSWGLTALHWAT----LVVRENILNSNCTDINI--------------NEAIEIFKFVLDGCSRFD-----------------------------------INRTTKNGISSLHLAADCGCLEIVHLLLDKGADINIISINGTTPLHIACKXXXXXXXXXXXXXXXXXXXTMAYVSCPWSPMHFSSYFGSVDSTILLISHENDQTSVREKLRQRTPNGNTCLHLAVQQLQTDIVRVLLENDADFNLENEDGLSAFDMAKIVDDETIINLLGIDTTEMMTTDDKVYLFQREEFSDEEQLETLYMDSLNELEFFGIGKNSGEKCELQLSIMSLLDYATT-------IDSIRRADMSLKINNSLN----------------RYRNITLSEIKTRELLIAAQPASMISTISST---NTEMSPF-----DVEKWDFH----RVTDLPVNSGFLVSFLVDARGGYMQAQRMPQMKIFVPPDAAPAPTRIICHLLRPEGVANLPGMNDCDGFASRILQIHSSCSRFQKPILIEMPYIALLKSNDREIVILKKNADSDTWKKHSNTFTEETLKAEFGSLYESITPVDQLESNRICRIITTDVPTYFSLISQFQRDVNMIGPDGGYIESKTDKRIKLTFPQGALMKKIQIGLEVQHVDPGIINHVVGDNHKISLSPIITVEPKRRKFRDLIEIQMGLPKGVTKN-----------------DIQDLKLLFSISEYITD--WEDVTSSTELVLLENTNC-MAHSTKISARVWLIYAPNVPNISELANKIYALHCPTPYVGKFLSYARRHDQEECQIRCLLITDDTPDKTLECQESFELIATGPEVEVINKLQYQIECAGNIVAVTKSDEAILFPVQSFVENRITLPIRVRNQDEPFQGKIAFIPH----FQSLSKQIVKXXXXXXXXXXXXXXXMVGSFRN-----------PDRKHRVKNATLERIKGC------------QAIAKTELDLKSVADAVGADWRXXXXXXXXXXDD-INLVLNENCTDEEKAFMTLINWQTVLGFK-ATGNELNRALRQIGREDVVKSCIGDISFVEDEAEVKSAIEQLN-----------NDDKKTHDECWDDIIASKGKPSGYNESVDDSMIVETG 4660
            +S   +E E  FLRAA  G   KV E LN+ + +N  NS GL ALHLASK G+  IV  L+  GAD  A T+K NTA+HIASLAG  EVVK+L+  GAN+N QS  GFTPLYMAAQENH+ VV  LL  GA+  L+T D FTPLAVA+QQGH+  V+ LL K       D  +   +P LHIA RKDD +AV LLL++ E     +   S  GFT LH+AA+Y +  V R+L+E GA V++ +KNN+T LHVAAKWGR  MV++LL  NA V+  TRDG+ PLHCAA  GH ++ +LL+   AN + +T+NGL PLHM AQGN+ E+    I + + +V + + D LTPLH+++HC N EVA  L+ +G +VN  ALNGF  LHIA K+  +  +E+L+     I+  TESG + LH+A+ IG   I + L++    ++       T+LH+A      ++   L  HG SV+ + +                                  G T L +A K     ++  L+  GA ++     G T LH A     + V + ++ +    +N                  + + + +LD  ++ D                                    N ++++G + LHLAA  G  ++V LLL  GAD N  S NG  PLH+A + ++ +V  +L+ + +  S         +SP+H + +FG V+    L+   N        + QRT  G T LHLA QQ  + +VR+LLE  AD N+ N+ GL+   +A+     TI ++L   TT +++ ++     + EE  D + L   + D ++E  F  + ++           +S     TT        D+  +   S + N++ +                 Y + TLS+  T E ++  Q +S++ T+S     NTE   F     DV  WD       V   PVN+GFLVSF+VDARGG +QA+R P ++IF+PP+    P RI+C L+ P+ + + P MND DG A R+L+I  +  RF  PIL+E+P+ A LK  +REIVIL+ + + +TWK+H    T+++++      ++     ++L    I RI+T D+P YF+LI++ ++++ +IGP+GG + S     +++ FP GAL K+I++GL+V  VD  ++  ++G   ++S+SPI+T+EP+RRKF   I + + LPK V ++                 D   L+LL SI+   +   WED+T S+    L   +C ++ ++ +SAR+WL+  PN+  + ELA+++Y      PY+G+F+ YARR   EE Q+RCL +TDD+ +KTLE QE F+ IATGP +EV++   + IE AGN+V V K++E +   + +F ENR+ + +RV++  +P  GK+AF+ H     QS    +         +  E    M G+              P+  H+  +      +              + +AK+ELDL+ VA  + +DWR LA+ L L  +D  N+    N  +EE AF +L+ WQ   G    TG +L  AL+ IGR+D+++ C+ +I  V    E  +A+  LN           + +K++H +          + SG  ES+D     +TG
Sbjct:   20 VSGQLNETEQNFLRAARAGDLPKVVELLNTGVHINLSNSIGLTALHLASKEGYVHIVDELLRRGADFDAPTKKGNTALHIASLAGHFEVVKLLLDAGANLNRQSVIGFTPLYMAAQENHLDVVDLLLQRGANQALTTEDGFTPLAVALQQGHDRVVAHLLEK-------DSRSRGGMPALHIAARKDDANAVSLLLNNAE---VNVNHQSQPGFTPLHIAAHYGNVTVARVLIERGADVNFQAKNNITPLHVAAKWGRGGMVQLLLNSNALVDCRTRDGLTPLHCAARSGHAELASLLMGAGANPSAKTRNGLTPLHMAAQGNNEEVARVLILRGA-SVADRTGDSLTPLHVAAHCGNAEVARVLLDNGCDVNACALNGFTPLHIACKKQKIRVIELLLQYGAQINMTTESGLSPLHVAAFIGGPEIVQLLLQRGAHVNQATMRCETALHLAVRNRQVDVAETLIYHGASVNAKARDEQTPLHVACLTGTPGLISVLLSCKANPNLPARDGYTALHIAAKEGRHDLLGQLLEAGADLNARTKKGFTPLHLAAKRGQVKVAKQLIQAQPKSVNAIGQNDLTPLHIATHYNRLPVVQLLLDYDAQVDCRAGNGYTALHMAAKQNHLDIATLLLAHESDQVQIANSSSRSGFTPLHLAAQEGHTDVVSLLLQHGADPNHQSKNGLAPLHLAAQEDHVSVAQILISAGAEIS---PLTRAGYSPLHTACHFGQVNMVRYLLDLPN-----APDINQRTQMGFTPLHLAAQQCHSQVVRLLLEMGADSNIRNQQGLTPAHIARKQHFITIFDILKTVTTTVVSWEE-----EHEEL-DHQTLMLEHPDFMHEHPFAELDEDGAAPSPAISRKVSNKKIKTTEYENLHSSDTADQKSHSDQFNSAFDNTILAETENDDIWGQLEYMHSTLSDENTSEFIV-TQNSSVLETVSPKSIHNTEAQMFGGAQPDVGDWDLEIDNTTVIKKPVNTGFLVSFIVDARGGLIQARRYPDLRIFIPPNVVNGPLRIVCRLVHPDRLNSPPIMNDGDGLACRLLEIGPTGMRFASPILLEIPHCAFLKEKNREIVILRSD-NGETWKEHPLDATDQSVQDNLNGHFDYAGSFEELRDKSIHRILTYDLPQYFALITRIKQELILIGPEGGTLTSTVVPDVQVHFPPGALQKRIRVGLQVHPVDNELVTRMLGP--RVSVSPIVTIEPRRRKFHKPITLTIPLPKTVMRSSGGGNNTASMTKSRSTIDSPSLRLLCSITGGTSPAVWEDITGSSP---LSAHDCSVSFTSTVSARLWLVDCPNITEVVELASRVYHESLAVPYIGQFVVYARRFHPEEAQLRCLCLTDDSAEKTLELQEGFQRIATGPCIEVLDDHPHWIETAGNLVPVAKTEEQLQLGMHAFRENRLNMIVRVKDLSQPAVGKLAFMRHPRAVLQSAGSPVKPATVLEAKLPNEFTDYMTGAVLKTTDIDDIPSYIPEYDHQNGHQYTTNSESVPKTWEKQDQYEDEPLAKSELDLRQVAYHLKSDWRILAQCLGLSDEDQYNITSLPNRPEEEYAFTSLLLWQERNGNDLTTGTQLAEALQAIGRKDILEHCMTNIFPVVTADERATALRSLNGISSTSPNLNISREKRSHSK----------EGSGLRESIDTGYGTQTG 1644          
BLAST of Ankyrin-2 vs. TrEMBL
Match: A0A087TAX5 (Ankyrin-2 (Fragment) OS=Stegodyphus mimosarum OX=407821 GN=X975_25776 PE=4 SV=1)

HSP 1 Score: 864.759 bits (2233), Expect = 0.000e+0
Identity = 548/1557 (35.20%), Postives = 862/1557 (55.36%), Query Frame = 2
Query:  236 FLRAAHNGYFSKVQEALNSNIDVNSCNSNGLNALHLASKGGHADIVQFLIDNGADIGAKTRKNNTAIHIASLAGSLEVVKILVKHGANINEQSQTGFTPLYMAAQENHVGVVKFLLDNGADINLSTTDNFTPLAVAIQQGHEETVSILLNKSNFLNSNDISNDIKLPPLHIATRKDDYHAVLLLLH--HQEDVQAALTQASLNGFTALHVAAYYNSDKVGRLLLENGAPVDYTSKNNVTALHVAAKWGRNKMVKVLLEFNANVEMSTRDGIRPLHCAASQGHRDICALLIEHKANCNTRTKNGLVPLHMVAQGNHSELVEFFINQNSVNVNETSLDFLTPLHISSHCNNVEVAEALIKHGANVNDRALNGFVALHIAAKQNHVEFVEMLMSNLCMIDTQTESGFTALHIASIIGSESIAKKLVENNCEIDIP--------------DQFD-------------------RTSLHMATIFNHFNIVVYLKEHGGSVDKQMKTGETCLMLAIKSEHKAIVEYLINQGASMSVSDSWGLTALH----WATLVVRENILNSNC----------TDININ---EAIEIFKFVLDGCS--------------------RFDI-----------NRTTKNGISSLHLAADCGCLEIVHLLLDKGADINIISINGTTPLHIACKXXXXXXXXXXXXXXXXXXXTMAYVSCP----WSPMHFSSYFGSVDSTILLISHENDQTSVREKLRQRTPNGNTCLHLAVQQLQTDIVRVLLENDADFNLENEDGLSAFDMAKIVDDETIINLLGIDTTEMMTTDDKVYLFQREEFSDEEQLETLYM--------DSLNELEFFGIGKNS---------GEKCELQLSIMS--LLDYATTIDSIRRADMSLKINNSLNRYRNITLSEIKTRELLIAA--------QPASMISTISSTNTEMSPFDVEKWDFHRVTDLPVNSGFLVSFLVDARGGYMQAQRMPQMKIFVPPDAAPAPTRIICHLLRPEGVANLPGMNDCDGFASRILQIHSSCSRFQKPILIEMPYIALLKSNDREIVILKKNADSDTWKKHSNTFTEETLKAEFGSLYES--ITPVDQLESNRICRIITTDVPTYFSLISQFQRDVNMIGPDGGYIESKTDKRIKLTFPQGALMKKIQIGLEVQHVDPGIINHVVGDNHKISLSPIITVEPKRRKFRDLIEIQMGLPKGVTKN-------DIQDLKLLFSISEYI--TDWEDVTSSTELVLLENTNCMAHSTKISARVWLIYAPNVPNISELANKIYALHCPTPYVGKFLSYARRHDQEECQIRCLLITDDTPDKTLECQESFELIATGPEVEVI-NKLQYQIECAGNIVAVTKSDEAILFPVQSFVENRITLPIRVRNQDEPFQGKIAFIPHFQSLSKQIVKXXX-XXXXXXXXXXXXMVGSFRNPDRKHRVKNATLERIKGCQAIAKTELDLKSVADAVGADWRXXXXXXXXXXDDINLVLNENCTD-EEKAFMTLINWQTVLGFKATGNELNRALRQIGREDVVKSCIGDISFVEDEAE 4522
            FLRAA  G   KV E L  +ID+N+CN+NGLNALHLASK GH  +VQ L+  GA++   T+K NTA+HIASLAG  EVVKILV++GAN+N QSQ GFTPLYMAAQENH GVVKFLL N A+ +L+T D FTPLAVA+QQGH++ V++LL        ND    ++LP LHIA +KDD  A  LLL   H  DV       S +GFT LH+AA+Y ++ +  LLLE  A V+Y++K+ +T LHVAAKWG++ MV +L++  A ++ STRDG+ PLHCAA  GH  +  LL+E  A    +TKNGL PLHM +QG+H +     +   +  V++ ++D+LT LH+++HC +V VA+ L+   A+ N RALNGF  LHIA K+N ++ VE+L+ +   I+  TESG T LH+AS +G  +I   L+++    D+P              +Q D                   +T LH+A    + +IV  L +HG +VD   K   T L +A K   + +   L++  AS++ +   G T LH    +  + V   +L  +           T +++    + + +   +LD  +                    + DI           N  +K G + LHLAA  G  ++  LL++  AD+N  + NG +PLH+  + +  NV  +L+++        A +  P    ++P+H + +FG ++    L+ H+ D       +   T +G T LH A QQ  T I+ +LLE+ A  N     G +A  +A+ +   +++  L I T  ++TT       ++ +    E ++  +M        D + +   +G   ++         G+K   + +++    L Y TT D ++    +L  +N+L    ++T  E  T   LIA          P  ++   ++ ++ M+  +V   D  R    PV++GFLVSF+VDARGG M+  R   +++ +PP  AP P RI C  LR E +A  P + + +  ASRIL++  S ++F  P++IE+P+ A L+  +REI IL+ + + ++W++H+   +++ +   F   +E   +T ++ L +NRI RI+TTD P YF++I++ +++V+ IGP+GG + S    +++  FP+GAL KKI++GL+ Q + P ++  ++G+  ++++SPI+TVEP+RRKF   I + + +P+  TK        D   L+LL SI+       WEDVT ST L  +   +C++ +T +SAR WLI    V   ++ A ++Y      P++ KF+ +A+R D  E Q+R   +TDD  DKTLE QE F  +A   +VEV+  KLQY +E AGN+V VTKS E +    Q+F ENR+   IRV++  +   G++AF+   +    +  +     L+I++PE     V      ++K+     T   +   + I + +L L  +A  +G DW +LA +L++   DIN + +EN  D  ++A + L +W    G KATGN L + LR+I RED+V  C+ ++  V D+ E
Sbjct:   12 FLRAARAGNVEKVLEYLKGSIDINTCNANGLNALHLASKEGHVAVVQELVKRGANVNIATKKGNTALHIASLAGQEEVVKILVQNGANVNLQSQNGFTPLYMAAQENHDGVVKFLLANNANQSLATEDGFTPLAVALQQGHDKVVAVLLE-------NDAKGRVRLPALHIAAKKDDCKAAALLLQNDHDPDV------TSKSGFTPLHIAAHYGNENIATLLLEKNADVNYSAKHQITPLHVAAKWGKSNMVNLLIDKGAKIDASTRDGLTPLHCAARSGHDQVVDLLLEKGAPITAKTKNGLAPLHMASQGDHVDSARILLYHKA-PVDDVTVDYLTALHVAAHCGHVRVAKLLLDRKADPNARALNGFTPLHIACKKNRIKVVELLLKHGASIEATTESGLTPLHVASFMGCMNIVIYLIQHGANADVPTVRGETPLHLAARANQSDIIRILLRNGAHVDASAREHQTPLHIAARLGNVDIVGLLLQHGAAVDATTKDMYTALHIAAKEGQEEVASVLLDHNASLTATTKKGFTPLHLAAKYGNIKVARLLLQKDAPVDAQGKNGVTPLHVAAHYDHVNVALLLLDKGAFPHATAKNGYTPLHIAAKKNQMDIATTLLEYGAKPNAESKAGFTPLHLAAQEGHTDMTALLIEHHADVNAAAKNGLSPLHLCAQEDKVNVAAILVKNG-------AKIDPPTKAGYTPLHVACHFGQINMIRFLLQHKAD-------VHATTSHGYTPLHQAAQQGHTLIINLLLEHKASPNTTTNQGQTALSIAQRLGYISVVETLKIVTETIVTTTTTTITEEKYKVVAPETMQETFMSDSEDEGGDDIEDTSLYGKPAHATHVYLPYIEGQKLMTEDTMLGDQSLHYMTT-DELK----ALADDNTLGI--DVTRDERGTDSTLIAPLTAEEDHLTPQHVVHQETTLSSTMATDNV---DLGRA---PVHAGFLVSFMVDARGGAMRGCRHSGVRVIIPPRKAPMPMRITCRYLRKEKLAYPPPLMEGEACASRILEVGPSGAKFLGPVIIEVPHFASLRGREREITILRSD-NGESWREHTLEASDDAVHDVFNESFEGEELTAIEDLSTNRITRILTTDFPQYFAIITRIRQEVHAIGPEGGMVSSTVVPQVQAIFPEGALTKKIKVGLQAQPITPELVTKLLGN--RVAVSPIVTVEPRRRKFHKPITLTIPVPQAATKGMINQYSGDAPTLRLLCSITGGTIKAQWEDVTGSTPLTFV--NDCVSFTTTVSARFWLIDCRQVNEATKFATELYREAIHVPFMAKFVVFAKRRDPLEAQLRVFCMTDDKEDKTLESQEHFTEVAKSRDVEVLEGKLQY-LEFAGNLVPVTKSGEQLSLTFQAFRENRLPFTIRVKDPHQEPMGRVAFMREPRVGRGEPPQSPICNLNIVLPEADPTPVSELVTLEKKYGFVTET--SLAKPELIHRADLRLSDIAKELGDDWVSLALQLDVSESDINTIKSENPNDTSQQALIMLRHWLQRAGSKATGNFLEKGLRKINREDIVNQCMFNVELVTDDVE 1519          
BLAST of Ankyrin-2 vs. TrEMBL
Match: T1J7N3 (Uncharacterized protein OS=Strigamia maritima OX=126957 PE=4 SV=1)

HSP 1 Score: 863.988 bits (2231), Expect = 0.000e+0
Identity = 543/1550 (35.03%), Postives = 843/1550 (54.39%), Query Frame = 2
Query:  236 FLRAAHNGYFSKVQEALNSNIDVNSCNSNGLNALHLASKGGHADIVQFLIDNGADIGAKTRKNNTAIHIASLAGSLEVVKILVKHGANINEQSQTGFTPLYMAAQENHVGVVKFLLDNGADINLSTTDNFTPLAVAIQQGHEETVSILLNKSNFLNSNDISNDIKLPPLHIATRKDDYHAVLLLLH--HQEDVQAALTQASLNGFTALHVAAYYNSDKVGRLLLENGAPVDYTSKNNVTALHVAAKWGRNKMVKVLLEFNANVEMSTRDGIRPLHCAASQGHRDICALLIEHKANCNTRTKNGLVPLHMVAQGNHSELVEFFINQNSVNVNETSLDFLTPLHISSHCNNVEVAEALIKHGANVNDRALNGFVALHIAAKQNHVEFVEMLMSNLCMIDTQTESGFTALHIASIIGSESIAKKLVENNCEIDIP--------------DQFD-------------------RTSLHMATIFNHFNIVVYLKEHGGSVDKQMKTGETCLMLAIKSEHKAIVEYLINQGASMSVSDSWGLTALHWAT----------------------------LVVRENILNSNCTDININEAIEIFKFVLDGCSRFDI--------------------NRTTKNGISSLHLAADCGCLEIVHLLLDKGADINIISINGTTPLHIACKXXXXXXXXXXXXXXXXXXXTMAYVSCPWSPMHFSSYFGSVDSTILLISHENDQTSVREKLRQRTPNGNTCLHLAVQQLQTDIVRVLLENDADFNLENEDGLSAFDMAKIVDDETIINLLGIDTTEMMTTDDKVYLFQREEFSDEEQLETLYM-DSLNELEFFGIGKNSGEKCELQLSIMS--------LLDYA---TTIDSIRR-ADMSLKINNSLNRYRNITLSEIKTRELLIAAQPASMISTISSTNTEMSPFDVEKW---------DFHRVTDLPVNSGFLVSFLVDARGGYMQAQRMPQMKIFVPPDAAPAPTRIICHLLRPEGVANLPGMNDCDGFASRILQIHSSCSRFQKPILIEMPYIALLKSNDREIVILKKNADSDTWKKHSNTFTEETLKAEFGSLY--ESITPVDQLESNRICRIITTDVPTYFSLISQFQRDVNMIGPDGGYIESKTDKRIKLTFPQGALMKKIQIGLEVQHVDPGIINHVVGDNHKISLSPIITVEPKRRKFRDLIEIQMGLPKGVTKNDIQD-------LKLLFSISEYIT--DWEDVTSSTELVLLENTNCMAHSTKISARVWLIYAPNVPNISELANKIYALHCPTPYVGKFLSYARRHDQEECQIRCLLITDDTPDKTLECQESFELIATGPEVEVI-NKLQYQIECAGNIVAVTKSDEAILFPVQSFVENRITLPIRVRNQDEPFQGKIAFIPHFQSLSKQIVKXXXXXXXXXXXXXXXMVGSFRNPDRKHRVKNATLERIKGC---QAIAKTELDLKSVADAVGADWRXXXXXXXXXXDDINLVLNENCTD-EEKAFMTLINWQTVLGFKATGNELNRALRQIGREDVVKSCIGDISFVEDEAE 4522
            FLRAA  G   +V E L  +ID+N+ N+NGLNALHLASK GH ++V  L+  GA++ A T+K NTA+HIASLAG  E+VKILV+  A++N QSQ GFTPLYMAAQENH  VVKFLL NGA+ +L+T D FTPLAVA+QQGH++ V++LL        ND    ++LP LHIA +KDD  A  LLL   H  DV       S +GFT LH+AA+Y +D +  LLL+ GA V++ +K+N+T +HVAAKWG+  MV VLL+  ANVE STRDG+ PLHCAA  GH  +  LL+E  A    +TKNGL PLHM  QG+H +     +   +  V++ ++D+LT LH+++HC +V VA+ L+   A+ N RALNGF  LHIA K+N ++ VE+L+ +   I+  TESG T LH+AS +G  +I   L+++    D+P              +Q D                   +T LH+A    + +IV  L +HG +VD   K   T L +A K   + +   L+  GAS++ +   G T LH A                             L V  +  N N   + +++         +G +   I                    N  +K G + LHLAA  G  ++  LLL+  AD+N  + NG TPLH+  + +  NV  +L+++ +      +     ++P+H + +FG ++    L+ H  D  +        T  G T LH A QQ  T IV +LLEN A  N     G +A  +A+ +   +++  L I T  ++TT       ++      E ++  +M DS +E   FG+      + EL     +        L D +    T+D ++   D SL I   ++  R+  +     ++ L++A P +M       +  +SP   + +         D   ++  P+++GFLVSF+VDARGG M+  R   +++ +PP  AP PTRI C  L+ E +A+ P + + +  ASRIL++  + ++F  P++IE+P+ A L+  +REI IL+ + + +TW++H+   +EE ++      +  E ++ ++ L +NRI RI+TTD P YF++I++ +++V+ IGP+GG + S    +++  FP+GAL KKI++GL+ Q +   ++  ++G+  ++++SP++TVEP+RRKF   I + + +P+  ++  I         L+LL SI+  IT   WEDVT ST L  +   +C++ +T +SAR WL+   N+   +++A ++Y      P++ KF+ +A+R D  E ++R   +TDD  DKTLE QE F  +A   +VEV+ NK QY +E AGN++ VTKS E +     +F ENR+   +R ++ ++   G+IAF+   +       +       I          S   PD     K     +  G    + I K +L L  +A+ +G DW  LA +L++   DINL+  +   D  ++A + L  W  + G KATGN L +ALR+  RED+V  CI ++  V D+ E
Sbjct:   35 FLRAARAGNLDRVLEYLKGSIDINTSNANGLNALHLASKEGHVNVVTELLKRGANVDAATKKGNTALHIASLAGQEEIVKILVQQSASVNVQSQNGFTPLYMAAQENHDSVVKFLLSNGANQSLATEDGFTPLAVALQQGHDKVVAVLLE-------NDTRGKVRLPALHIAAKKDDCKAAALLLQNDHNPDV------TSKSGFTPLHIAAHYGNDNIANLLLQRGADVNFAAKHNITPMHVAAKWGKVNMVTVLLDKQANVEASTRDGLTPLHCAARSGHDQVVDLLLEKAAPITAKTKNGLAPLHMACQGDHVDSARILLYHKA-PVDDVTIDYLTALHVAAHCGHVRVAKLLLDRKADPNARALNGFTPLHIACKKNRIKVVELLLKHGASIEATTESGLTPLHVASFMGCMNIVIYLIQHGSNPDVPTVRGETPLHLAARANQTDIIRILLRNGAHVDARAREQQTPLHIAARLGNSDIVALLLQHGAAVDSTTKDMYTALHIAAKEGQEEVASVLLEHGASLTATTKKGFTPLHLAAKYGNMKVARLLLQRDAPVDAQGKNGVTPLHVAAHYDNQNVALLLLDKGASPHATAKNGYTPLHIAAKKNQMDIGTTLLEYGAKSNAESKAGFTPLHLAAQEGHTDMSTLLLEHHADVNCKAKNGLTPLHLCAQEDKVNVAAILVKNGAEID---SKTKAGYTPLHVACHFGQMNMVRFLLQHGADVNTT-------TAVGYTPLHQASQQGHTQIVNLLLENRASPNAVTNQGQTALSIAQRLGYISVVETLKIVTETVVTTTTTTVTEEKYRVVAPETMQETFMSDSEDEGAAFGVFA----RVELGFQAFAHFLGEDTMLGDQSYRYLTVDEMKSLGDDSLPI---MDPTRDERMEMHLVKDTLLSAAPPAM------DDDRISPQPPQGYAQFTGNYAPDNIDISRSPIHAGFLVSFMVDARGGAMRGCRHSGVRVIIPPRKAPMPTRITCRYLKKEKLAHPPPLMEGEACASRILEVGPTGAKFLGPVIIEVPHFASLRGKEREITILRSD-NGETWREHTLEASEEAVQEVLNESFDGEELSALEDLNTNRITRILTTDFPQYFAIITRVRQEVHAIGPEGGMVSSTVVPQVQAVFPEGALTKKIKVGLQAQPIPADLVAKMLGN--RVAVSPVVTVEPRRRKFHKPITLTIPVPQAASRGMINQYSGETPTLRLLCSITGGITRAQWEDVTGSTPLTFV--NDCVSFTTTVSARFWLMDCRNISEATKMATELYREAIHVPFMAKFVVFAKRIDPVEAKLRVFCMTDDKEDKTLENQEHFSEVAKSRDVEVLENKSQY-VEFAGNLIPVTKSGEQLALNFHAFRENRLPFIVREKDPNQEPIGRIAFMKEPKGGRSDPPQTPICNLNITLPDAD---ASPTGPDVLTLEKKYAYLKEMGLSKPETIHKADLRLSDIANLLGNDWVVLALQLDIPESDINLIKTDYPDDVNQQALVMLRLWMQLAGNKATGNNLEKALRKTNREDIVNQCIFNVELVTDDVE 1538          

HSP 2 Score: 241.891 bits (616), Expect = 7.505e-60
Identity = 197/707 (27.86%), Postives = 320/707 (45.26%), Query Frame = 2
Query:  500 INEQSQT-GFTPLYMAAQENHVGVVKFLLDNGADINLSTTDNFTPLAVAIQQGHEETVSILLNKSNFLNSNDISNDIKLPPLHIATRKDDYHAVLLLLHHQEDVQAALTQASLNGFTALHVAAYYNSDKVGRLLLENGAPVDYTSKNNVTALHVAAKWGRNKMVKVLLEFNA-----------------------------NVEMSTRDGIRPLHCAASQGHRDICALLIEH---------------------------------KANCNTRTKNGLVPLHMVAQGNHSELVEFFINQ--------------------------------NSVNVNETSLDFLTPLHISSHCNNVEVAEALIKHGANVNDRALNGFVALHIAAKQNHVEFVEMLMSNLCMIDTQTESGFTALHIASIIGSESIAKKLVENNCEIDIPDQFDRTSLHMATIFNHFNIVVYLKEHGGSVDKQMKTGETCLMLAIKSEHKAIVEYLINQGASMSVSDSWGLTALHWATLVVRENILNSNCTDININEAIEIFKFVLD-GCSRFDINRTTKNGISSLHLAADCGCLEIVHLLLDKGADINIISINGTTPLHIACKXXXXXXXXXXXXXXXXXXXTMAYVSCPWSPMHFSSYFGSVDSTILLISHENDQTSVREKLRQRTPNGNTCLHLAVQQLQTDIVRVLLENDADFNLENEDGLSAFDM 2332
            +  Q QT G      AA+  ++  V   L    DIN S  +    L +A ++GH   V+ LL +   +++     +     LHIA+       V +L+       A++   S NGFT L++AA  N D V + LL NGA     +++  T L VA + G +K+V VLLE +                              N +++++ G  PLH AA  G+ +I  LL++                                  +AN    T++GL PLH  A+  H ++V+  + +                                +   V++ ++D+LT LH+++HC +V VA+ L+   A+ N RALNGF  LHIA K+N ++ VE+L+ +   I+  TESG T LH+AS +G  +I   L+++    D+P     T LH+A   N  +I+  L  +G  VD + +  +T L +A +  +  IV  L+  GA++  +     TALH A    +E                E+   +L+ G S   +  TTK G + LHLAA  G +++  LLL + A ++    NG TPLH+A   +N NV L+LL+  +    T       ++P+H ++    +D    L+ +         K    +  G T LHLA Q+  TD+  +LLE+ AD N + ++GL+   +
Sbjct:   23 VANQDQTDGNASFLRAARAGNLDRVLEYLKGSIDINTSNANGLNALHLASKEGHVNVVTELLKRGANVDAATKKGNTA---LHIASLAGQEEIVKILVQQ----SASVNVQSQNGFTPLYMAAQENHDSVVKFLLSNGANQSLATEDGFTPLAVALQQGHDKVVAVLLENDTRGKVRLPALHIAAKKDDCKAAALLLQNDHNPDVTSKSGFTPLHIAAHYGNDNIANLLLQRGADVNFAAKHNITPMHVAAKWGKVNMVTVLLDKQANVEASTRDGLTPLHCAARSGHDQVVDLLLEKAAPITAKTKNGLAPLHMACQGDHVDSARILLYHKAPVDDVTIDYLTALHVAAHCGHVRVAKLLLDRKADPNARALNGFTPLHIACKKNRIKVVELLLKHGASIEATTESGLTPLHVASFMGCMNIVIYLIQHGSNPDVPTVRGETPLHLAARANQTDIIRILLRNGAHVDARAREQQTPLHIAARLGNSDIVALLLQHGAAVDSTTKDMYTALHIAAKEGQE----------------EVASVLLEHGAS---LTATTKKGFTPLHLAAKYGNMKVARLLLQRDAPVDAQGKNGVTPLHVAAHYDNQNVALLLLDKGASPHAT---AKNGYTPLHIAAKKNQMDIGTTLLEY-------GAKSNAESKAGFTPLHLAAQEGHTDMSTLLLEHHADVNCKAKNGLTPLHL 693          
BLAST of Ankyrin-2 vs. TrEMBL
Match: A0A2J7QN88 (Ankyrin-3 (Fragment) OS=Cryptotermes secundus OX=105785 GN=B7P43_G05342 PE=4 SV=1)

HSP 1 Score: 846.655 bits (2186), Expect = 0.000e+0
Identity = 549/1550 (35.42%), Postives = 848/1550 (54.71%), Query Frame = 2
Query:  236 FLRAAHNGYFSKVQEALNSNIDVNSCNSNGLNALHLASKGGHADIVQFLIDNGADIGAKTRKNNTAIHIASLAGSLEVVKILVKHGANINEQSQTGFTPLYMAAQENHVGVVKFLLDNGADINLSTTDNFTPLAVAIQQGHEETVSILLNKSNFLNSNDISNDIKLPPLHIATRKDDYHAVLLLLH--HQEDVQAALTQASLNGFTALHVAAYYNSDKVGRLLLENGAPVDYTSKNNVTALHVAAKWGRNKMVKVLLEFNANVEMSTRDGIRPLHCAASQGHRDICALLIEHKANCNTRTKNGLVPLHMVAQGNHSELVEFFINQNSVNVNETSLDFLTPLHISSHCNNVEVAEALIKHGANVNDRALNGFVALHIAAKQNHVEFVEMLMSNLCMIDTQTESGFTALHIASIIGSESIAKKLVENNCEIDIP--------------DQFD-------------------RTSLHMATIFNHFNIVVYLKEHGGSVDKQMKTGETCLMLAIKSEHKAIVEYLINQGASMSVSDSWGLTALH----WATLVVRENILNSNC----------TDININEAIE---IFKFVLD-GCS-------------------RFDI-----------NRTTKNGISSLHLAADCGCLEIVHLLLDKGADINIISINGTTPLHIACKXXXXXXXXXXXXXXXXXXXTMAYVSCPWSPMHFSSYFGSVDSTILLISHENDQTSVREKLRQRTPNGNTCLHLAVQQLQTDIVRVLLENDADFNLENEDGLSAFDMAKIVDDETIINLLGIDTTEMMTTDDKVYLFQREEF---SDEEQLETLYMDSLNELEFFGIGKNSGEKCELQLSIMSLLDYATTIDSIRR-ADMSLKINNSLNRYRNITLSEIKTRELLIAAQPASMISTISS----------TNTEMSPFDVEKWDFHRVTDLPVNSGFLVSFLVDARGGYMQAQRMPQMKIFVPPDAAPAPTRIICHLLRPEGVANLPGMNDCDGFASRILQIHSSCSRFQKPILIEMPYIALLKSNDREIVILKKNADSDTWKKHSNTFTEETLKAEFGSLYES--ITPVDQLESNRICRIITTDVPTYFSLISQFQRDVNMIGPDGGYIESKTDKRIKLTFPQGALMKKIQIGLEVQHVDPGIINHVVGDNHKISLSPIITVEPKRRKFRDLIEIQMGLPKGVTKN-------DIQDLKLLFSISEYIT--DWEDVTSSTELVLLENTNCMAHSTKISARVWLIYAPNVPNISELANKIYALHCPTPYVGKFLSYARRHDQEECQIRCLLITDDTPDKTLECQESFELIATGPEVEVI-NKLQYQIECAGNIVAVTKSDEAILFPVQSFVENRITLPIRVRNQDEPFQGKIAFIPHFQSLSKQIVKXXXXXXXXXXXXXXXMVGSFRNPDRKHRVKNATLERIKGCQAI----AKTELDLKSVADAVGADWRXXXXXXXXXXDDINLVLNENCTDEEKAFMTLIN-WQTVLGFKATGNELNRALRQIGREDVVKSCIGDISFVEDEAEVKSAIEQ 4543
            FLRAA  G+  KV E L SNID+N+ NSNGLNALHLASK GH ++V  L+  GA + A T+K NTA+HIASLAG  EVVK+LV +GA +N QSQ GFTPLYMAAQENH  VV+FLL NGA+ +L+T D FTPLAVA+QQGH++ V++LL        ND    ++LP LHIA +KDD  A  LLL   H  DV       S +GFT LH+AA+Y ++ +  LLL  GA V+Y++K+N+T LHVAAKWG+  MV +LLE  AN+E  TRDG+ PLHCAA  GH  +  +++E  A  +++TKNGL PLHM +QG+H +     +   +  V+E ++D+LT LH+++HC +V VA+ L+   A+ N RALNGF  LHIA K+N ++ VE+L+ +   I+  TESG T LH+AS +G  +I   L++++   D+P              +Q D                   +T LH+A+   + +IV+ L +HG +VD   K   T L +A K   + +   L+  GAS++ +   G T LH    +  + V + +L  +           T +++    +   +   +LD G S                   + DI           N  +K G + LHL++  G  ++  LL++  AD N  + NG TPLH+  + +  NV  +L+++ +    T       ++P+H +S+FG ++    L+ H  D       ++  T  G T LH A QQ  T IV +LLEN A  N     G +A  +A+ +   +++  L + T   + T+  V     E++   + E   ET   DS +E          GE   L       L    T+D ++   D SL I+  + R   I       RE +  A P ++  TIS           T T  +P +++      +   PV+ GFLVSFLVDARGG M+  R   +++ VPP  A  P R+ C  L+ + +++ P + + +  ASRIL++    ++F  P++IE+P+   L+  +REIVIL+ + + +TW++H+   +EE +       +E   +T +++  S R+ RI+TTD P YF+++S+ +++V+ IGP+GG + S    +++  FPQGAL KKI++GL+ Q +   +   ++G+  ++++SPI+TVEP+RRKF   I + + +P+   K        D   L+LL SI+   T   WEDVT ST L  +   +C++ +T +SAR WL+   N+ + +++A ++Y      P++ KF+ +A+R D  E ++R   +TDD  DKTLE QE F  +A   +VEV+  K QY IE AGN+V VTKS + +    ++F ENR+   +RV++      G+I F+   +    +  +    +  I+    I    +   PD     K  +  R  G   +     +T+L L  +++ +G DW  LA EL +   DINLV +E  +   +  M+++  W    G KATGN L  AL +IGR+D+V+ CI ++  + D A  K  ++Q
Sbjct:   16 FLRAARAGHLDKVLEHLKSNIDINTSNSNGLNALHLASKDGHVNVVTELLKRGAVVDAATKKGNTALHIASLAGQEEVVKLLVANGAAVNVQSQNGFTPLYMAAQENHDNVVRFLLANGANQSLATEDGFTPLAVAMQQGHDKVVAVLLE-------NDTRGKVRLPALHIAAKKDDCKAAALLLQNDHNPDV------TSKSGFTPLHIAAHYGNESIANLLLNRGADVNYSAKHNITPLHVAAKWGKTNMVSLLLEKGANIESKTRDGLTPLHCAARSGHEQVVDMMLERGAPISSKTKNGLAPLHMASQGDHVDAARILLYHRA-PVDEVTVDYLTALHVAAHCGHVRVAKLLLDRKADPNARALNGFTPLHIACKKNRIKVVELLLKHGASIEATTESGLTPLHVASFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAAVDSTTKDMYTALHIAGKEGQEEVASVLLEHGASLTATTKKGFTPLHLAAKYGNMKVAKLLLQRDAPVDAQGKNGVTPLHVASHYDHQNVALLLLDKGASPHATAKNGHTPLHIAARKNQMDIATTLLEYGAKANAESKAGFTPLHLSSQEGHTDMSSLLIEHQADANHKAKNGLTPLHLCAQEDRVNVASILVKNGAEVDST---TKAGYTPLHVASHFGQINMVRFLLQHGAD-------VKASTSIGYTPLHQAAQQGHTTIVNLLLENSAPPNSLTNQGQTALSIAQKLGYISVVETLKVVTEPSIPTN--VASGAEEKYRVVAPETMQETFMSDSEDE---------GGEDTMLSDQPYRYL----TVDEMKSLGDDSLPID--VTRDERID----SNRECM--APPTAVDDTISPQHVKESYAQFTATHYTPDNID------INRHPVHVGFLVSFLVDARGGAMRGCRHSGVRVIVPPRKATMPMRVTCRYLKRDKLSHPPPLMEGEALASRILELGPVGAKFLGPVIIEVPHFGSLRGMEREIVILRSD-NGETWREHTLEASEEAVHEVLNESFEGEELTALEETTSGRMTRILTTDFPQYFAVVSRIRQEVHAIGPEGGMVSSSVVPQVQAVFPQGALTKKIKVGLQAQPIAVELAAKLLGN--RVAVSPIVTVEPRRRKFHKPITLTIPVPQAANKGMINQYSGDAPTLRLLCSITGGTTRAQWEDVTGSTPLTFV--NDCVSFTTTVSARFWLMDCRNIGDATKMATELYKEAIHVPFMAKFVIFAKRVDVLEARLRVFCMTDDKEDKTLEHQEHFTEVAKSRDVEVLEGKPQY-IEFAGNLVPVTKSGDQLQLGFRAFKENRLPFTVRVKDPHADTVGRILFMREPKVAKGEPPQQPVCILNIVLPETILPESTLSEPDLLVLHKKYSFLRDGGLGRLDTTYQRTDLRLSDISNLLGEDWVPLASELGITTSDINLVKSECPSIVAQQAMSMLRLWLQQAGNKATGNVLETALHKIGRDDIVQQCIFNVDEM-DRAVAKVQLDQ 1505          
BLAST of Ankyrin-2 vs. TrEMBL
Match: A0A3Q0GJA5 (ankyrin-3 isoform X27 OS=Alligator sinensis OX=38654 GN=ANK3 PE=4 SV=1)

HSP 1 Score: 839.336 bits (2167), Expect = 0.000e+0
Identity = 527/1511 (34.88%), Postives = 821/1511 (54.33%), Query Frame = 2
Query:  236 FLRAAHNGYFSKVQEALNSNIDVNSCNSNGLNALHLASKGGHADIVQFLIDNGADIGAKTRKNNTAIHIASLAGSLEVVKILVKHGANINEQSQTGFTPLYMAAQENHVGVVKFLLDNGADINLSTTDNFTPLAVAIQQGHEETVSILLNKSNFLNSNDISNDIKLPPLHIATRKDDYHAVLLLLH--HQEDVQAAL--TQASLNGFTALHVAAYYNSDKVGRLLLENGAPVDYTSKNNVTALHVAAKWGRNKMVKVLLEFNANVEMSTRDGIRPLHCAASQGHRDICALLIEHKANCNTRTKNGLVPLHMVAQGNHSELVEFFINQNSVNVNETSLDFLTPLHISSHCNNVEVAEALIKHGANVNDRALNGFVALHIAAKQNHVEFVEMLMSNLCMIDTQTESGFTALHIASIIGSESIAKKLVENNCEIDIPDQFDRTSLHMATIFNHFNIVVYLKEHGGSVDKQMKTGETCLMLAIKSEHKAIVEYLINQGASMSVSDSWGLTALHWATLVVREN--------------ILNSNCTDININEA---IEIFKFVL------DGCSR-------------------------FDINRTTKNGISSLHLAADCGCLEIVHLLLDKGADINIISINGTTPLHIACKXXXXXXXXXXXXXXXXXXXTMAYVSCPWSPMHFSSYFGSVDSTILLISHENDQTSVREKLRQRTPNGNTCLHLAVQQLQTDIVRVLLENDADFNLENEDGLSAFDMAKIVDDETIINLLGIDTTEMMTT---DDKVYLFQRE------EFSDEEQLETLYMDS---LNELEFFGIGKNSGEKCELQLSIMSLLDYATTIDSIRRADMSLKINNSLNRYRNITLSEIKTRELLIAA--QPASMISTISSTNTEMSPFDVEKWDFHRVTDLPVNSGFLVSFLVDARGGYMQAQRMPQMKIFVPPDAAPAPTRIICHLLRPEGVANLPGMNDCDGFASRILQIHSSCSRFQKPILIEMPYIALLKSNDREIVILKKNADSDTWKKHSNTFTEETLKAEFGSLYESITPVDQLESNRICRIITTDVPTYFSLISQFQRDVNMIGPDGGYIESKTDKRIKLTFPQGALMKKIQIGLEVQHVDPGIINHVVGDNHKISLSPIITVEPKRRKFRDLIEIQMGLP----KGVTKNDIQD----LKLLFSISEYIT--DWEDVTSSTELVLLENTNCMAHSTKISARVWLIYAPNVPNISELANKIYALHCPTPYVGKFLSYARRHDQEECQIRCLLITDDTPDKTLECQESFELIATGPEVEVINKLQYQIECAGNIVAVTKSDEAILFPVQSFVENRITLPIRVRNQDEPFQGKIAFIPHFQS---LSKQIV----------KXXXXXXXXXXXXXXXMVGSFRNPDRKHRVKNATLERIKGCQAIAKTELDLKSVADAVGADWRXXXXXXXXXXDDINLVLNENCTDE-EKAFMTLINWQTVLGFKATGNELNRALRQIGREDVVKSCIGDI 4498
            +LRAA  G   K  + L S +D+N CN NGLNALHLASK GH ++V  LI  GA++ A T+K NTA+HIASLAG  EVVK+LV + AN+N QSQ GFTPLYMAAQENH+ VVKFLLDNGA  +L+T D FTPLAVA+QQGH++ VS+LL        ND    ++LP LHIA RKDD  A  LLL   H  DV++ +   + + +GFT LH+AA+Y +  V  LLL  GA VD+T++N++T LHVA+K G   MVK+LL+  A ++  TRDG+ PLHC A  GH  +  +L++  A   ++TKNGL PLHM  QG+H   V+  I Q++V V++ + D+LT LH+++HC + +VA+ L+   AN N +ALNGF  LHIA K+N ++ +E+L+ +   I   TESG T +H+A+ +G  +I  +L+ +    +  +    T+LHMA       +V YL ++G  V+ + K  +T L ++ +     IV+ L+ QGAS + + + G T LH +     E+              I     T +++      IE+   +L      D   +                          D N  T+ GI+ +HLAA  G +++V LLL + A++N+ + +G TPLH+A + +  NV  VL+   +    T A     ++P+H   ++G++     L+ H         K+  +T NG T LH A QQ  T I+ VLL++ A  N    +G +A  +AK +   ++++ L + T E MTT    +K  +   E      + SD+E  + +  D+   L   +   +G +S       L     + ++    S      S   + +LNR  +     +   ELL+    Q  S      S +     +  +  D   +   P++SGFLVSF+VDARGG M+  R   M+I +PP    APTRI C L++   +A+ P M + +G ASR++++  + ++F  P+++E+P+   ++  +RE+++L+ + + +TWK+H      E L      + E +   ++LE  RICRIIT D P YF+++S+ +++ N IGP+GG + S T  R++ +FP+GAL K+I++GL+ Q V   I+  ++G+  K + SPI+TVEP+RRKF   I + + +P    +GVT     D    L+LL SI+   +   WED+T +T L  +   +C++ +T +SAR WL     +     LA ++Y      PY+ KF+ +A+ +D  E  +RC  +TDD  DKTLE QE+FE +A   ++EV+      ++C GN+  +TK  + ++F   +F ENR+   I++R+  +   G+++F+   ++   L +  V          K  T  D        D   +F +   + R    T   +       +T++ +  VAD +G  W  LA EL    D+IN +  EN      ++FM L  W T  G  AT + L   L +I R D+V    G I
Sbjct:   28 YLRAARAGNLEKALDYLKSGVDINICNQNGLNALHLASKEGHVEVVSELIQRGANVDAATKKGNTALHIASLAGQTEVVKVLVANAANVNAQSQNGFTPLYMAAQENHLEVVKFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLE-------NDTKGKVRLPALHIAARKDDTKAAALLLQNDHNADVESKMMVNRTTESGFTPLHIAAHYGNINVATLLLNRGAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLI-QHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKTANPNAKALNGFTPLHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARAGQTEVVRYLIQNGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNATTTSGYTPLHLSAREGHEDVALVLLDHGASLAIITKKGFTPLHVASKYGKIEVANLLLQKNASPDAAGKNGYTPLHIAAKKNQMDIATTLLEYGADANAVTRQGIAPVHLAAQEGHVDMVSLLLTRNANMNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAV---TDAQTKMGYTPLHVGCHYGNIKIVNFLLQH-------FAKVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGASPNELTVNGNTALAIAKRLGYISVVDTLKVVTEETMTTITVTEKHKMNVPETMNEVLDMSDDEGEDAMTGDTDKYLGPQDLKELGDDS-------LPAEGYMGFSLGARSASLRSFSSDRSYTLNR-SSYARDSMMIEELLVPPKDQHLSFPREFDSDSLRHYSWAADTLDNVNLVSSPIHSGFLVSFMVDARGGSMRGSRHHGMRIIIPPRKCTAPTRITCRLVKRHKLASPPPMVEGEGLASRLVEMGPAGAQFLGPVIVEIPHFGSMRGKERELIVLR-SENGETWKEHQYDSKHEGLNEILNGMDEELDSAEELEKKRICRIITKDFPQYFAVVSRIKQESNQIGPEGGVLSSTTVPRVQASFPEGALTKRIRVGLQAQPVPDEIVKKILGN--KATFSPIVTVEPRRRKFHKPITMTIPVPPPSGEGVTNGYKGDTTPSLRLLCSITGGTSPAQWEDITGTTPLTFI--NDCVSFTTNVSARFWLADCHQLLETVGLATQLYRELICVPYMAKFVIFAKMNDPVESNLRCFCMTDDKVDKTLEQQENFEEVARSKDIEVLEGKPIYVDCYGNLAPLTKGGQQLVFNFYAFKENRLPFSIKIRDTSQEPCGRLSFLKEPKTTRGLPQTAVCNLNITLPAHKKETESDQDDETEKADRRQNFVSLALRKRYSYLTEPGMSPQSPCERTDIRMAIVADHLGLSWTELARELNFSVDEINQIRVENPNSLIAQSFMLLKKWVTRDGKNATTDALTTVLTKINRIDIVTLLEGPI 1507          
BLAST of Ankyrin-2 vs. Ensembl Cavefish
Match: ank3a (ankyrin 3a [Source:ZFIN;Acc:ZDB-GENE-060621-1])

HSP 1 Score: 805.438 bits (2079), Expect = 0.000e+0
Identity = 518/1571 (32.97%), Postives = 816/1571 (51.94%), Query Frame = 2
Query:  236 FLRAAHNGYFSKVQEALNSNIDVNSCNSNGLNALHLASKGGHADIVQFLIDNGADIGAKTRKNNTAIHIASLAGSLEVVKILVKHGANINEQSQTGFTPLYMAAQENHVGVVKFLLDNGADINLSTTDNFTPLAVAIQQGHEETVSILLNKSNFLNSNDISNDIKLPPLHIATRKDDYHAVLLLLH--HQEDVQAALTQASLNGFTALHVAAYYNSDKVGRLLLENGAPVDYTSKNNVTALHVAAKWGRNKMVKVLLEFNANVEMSTRDGIRPLHCAASQGHRDICALLIEHKANCNTRTKNGLVPLHMVAQGNHSELVEFFINQNSVNVNETSLDFLTPLHISSHCNNVEVAEALIKHGANVNDRALNGFVALHIAAKQNHVEFVEMLMSNLCMIDTQTESGFTALHIASIIGSESIAKKL---------------------------------VENNCEIDIPDQFDRTSLHMATIFNHFNIVVYLKEHGGSVDKQMKTGETCLMLAIKSEHKAIVEYLINQGASMSVS---------------------------------DSWGLTALHWATLVVRENIL--------------NSNCTDINI---NEAIEIFKFVLDGCSRFDINRTTKNGISSLHLAADCGCLEIVHLLLDKGADINIISINGTTPLHIACKXXXXXXXXXXXXXXXXXXXTMAYVSCPWSPMHFSSYFGSVDSTILLISHENDQTSVREKLRQRTPNGNTCLHLAVQQLQTDIVRVLLENDADFNLENEDGLSAFDMAKIVDDETIINLLGIDTTEMMTTDDKVYLFQREEFSDEEQL-ETLYMDSL------------NELEFFGIGKNSGEKCELQLSIMSLLDYATTIDSIRRADMSLKINNSLNRYRNITLSEIKTRELLIAAQPASMISTISSTNTEMSPFDVEKWD------FHRVTDLPVNSGFLVSFLVDARGGYMQAQRMPQMKIFVPPDAAPAPTRIICHLLRPEGVANLPGMNDCDGFASRILQIHSSCSRFQKPILIEMPYIALLKSNDREIVILKKNADSDTWKKHSNTFTEETLKAEFGSLYESITPVDQLESNRICRIITTDVPTYFSLISQFQRDVNMIGPDGGYIESKTDKRIKLTFPQGALMKKIQIGLEVQHVDPGIINHVVGDNHKISLSPIITVEPKRRKFRDLIEIQMGLPK--------GVTKNDIQDLKLLFSISEYIT--DWEDVTSSTELVLLENTNCMAHSTKISARVWLIYAPNVPNISELANKIYALHCPTPYVGKFLSYARRHDQEECQIRCLLITDDTPDKTLECQESFELIATGPEVEVINKLQYQIECAGNIVAVTKSDEAILFPVQSFVENRITLPIRVRNQDEPFQGKIAFIPHFQSLSKQIVKXXXXXXXXXXXXXXXMVGS-----FRNPDRKHRVKNATLERIKGC---------QAIAKTELDLKSVADAVGADWRXXXXXXXXXXDDINLVLNENCTD-EEKAFMTLINWQTVLGFKATGNELNRALRQIGREDVVKSCIGDI----------SFVEDEAEVKS 4531
            +LRAA  G   K  + L + +D+N CN NGLNALHLASK GH ++V  L+  GA + A T+K NTA+HIASLAG  +VV+ LV +GAN+N QSQ GFTPLYMAAQENH+ VV+FLL++GA  +++T D FTPLAVA+QQGH++ VS+LL        ND    ++LP LHIA RKDD  +  LLL   H  DV+      S +GFT LH+AA+Y +  V  LLL  GA VD+ ++N++T LHVAAK G   MVK+LL+  A ++  T+DG+ PLHC A  GH  +  +L++  A   ++TKNGL PLHM  QG+H   V+  + Q+ V V++ + D+LT LH+++HC + +VA+ ++   AN N +ALNGF  LHIA K+N V+ +E+L+ +   +   TESG T +H+A+ +G E+I K+L                                 ++N  ++DI  + D+T+LH+A+      IV  L + G        +G T L LA++  H+     L+  GAS+S +                                    GLT LH A     + +                +  T ++I      +EI   +L+  +  + N  T+ GIS LHLAA  G +++V LLL K A++N+ + NG TPLH+A + +   V  VLL   +      A+    ++P+H + ++G++     L+ ++        K+  +T +G T LH A QQ  T I+ +LL++ A  N    +G +A  +A+ +   ++++ L   T E +T    V   ++ + +  E + E L M                E E +   ++  E  +  L     + ++    S+     S   +N+ NR   +  S +   E +IA    + +S     N  +  +    W        H     P++SGFLVSF+VDARGG M+  R   M+I +PP   PAPTRI C L +   +A  P M + +G  SR++++  + + F  P+++E+P+   ++  +RE+++L+ + + DTWK+H      E L A    + E +    +LE  RICRI+T D P YF+++S+ +++ + +GP+GG + S+    ++  FP GAL KKI++GL+ Q V   ++ +V+G+  + S SPI+TVEP+RRKF   I + + +P         G   +    L+LL SI+   +   WED+T +T L  +  T+C++ +T +SAR WL     V     LA  +Y      PY+ KF+ +A+  D  E ++RC  +TDD  DKTLE QE+FE +A   ++E++      ++C GN+   +KS + ++F   +F ENR+   ++VR+  +   G+++F+   +S SK +                  + S       N DR+H   +  L +                 +T+L +  VAD +G  W  LA E+    D+IN +  EN      ++FM L  W +  G  AT + L   L ++ R D+V    G I          SF +D AE  S
Sbjct:   47 YLRAARAGNLEKALDYLKTGVDINICNQNGLNALHLASKEGHVEVVAELLKLGASVDAATKKGNTALHIASLAGQTDVVRELVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLEHGASQSIATEDGFTPLAVALQQGHDQVVSLLLE-------NDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVE------SKSGFTPLHIAAHYGNINVATLLLNRGAAVDFMARNDITPLHVAAKRGNGNMVKLLLDRGAKIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLL-QHDVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQADVVRYLLQNGAKVDIKAKDDQTALHIASRLGKAEIVQLLLQKGAWASAATTSGYTPLHLAVREGHQETASLLLEHGASLSAATKKGFTPLHVAAKYGQIEAAKLLLQKRAAPDTAGKTGLTPLHVAAHYDNQRVALLLLDHGASPHAAAKNGYTPLHIAAKKNQLEIGTTLLEFGA--ETNAVTRQGISPLHLAAQEGSVDLVSLLLTKNANVNMGNKNGLTPLHLAAQEDRVGVAEVLLNHGAEVD---AHTKTGYTPLHVACHYGNMKMVSFLLENQ-------AKINSKTKSGYTPLHQAAQQGHTHIINMLLQHRASANELTLNGNTALSIARRLGYISVVDTLRGLTDENLTATPPVS--EKHKLNVPETMNEFLDMSDDEDREREREDAMTGETEKYLRPQDLKELGDDSLPQEGYMGFSIGARSVSMRSFSSDRSNTQNRTSCVRDSMVI--EEVIAPTKDTHLSVSREQNESLRRYS---WTPDTMDHSHNTVSSPIHSGFLVSFMVDARGGSMRGSRHDGMRIIIPPRKCPAPTRITCRLAKRHRLAYPPPMVEGEGLVSRLVEVGPAGAHFLGPVIVEIPHFGSMRGKERELIVLRSD-NGDTWKEHHYDCRGEDLLALLNGMDEELDSPIELEKKRICRIVTKDFPQYFAVVSRIKQESDHMGPEGGVLTSEAVPMVRAAFPPGALTKKIRVGLQAQPVPEEVVRNVIGN--RASFSPIVTVEPRRRKFHKPITMTIPVPPRAKEAAANGRKGDPAPCLRLLCSITGGTSPAQWEDITGTTPLSFV--TDCVSFTTNVSARFWLADCQQVSETVALATPLYRELICVPYLAKFVVFAKPTDPMEARLRCFCMTDDKVDKTLEQQENFEEVARSKDIEILEGKPIYVDCYGNLAPFSKSSQQLIFTFYAFKENRLPFNVKVRDVGQEACGRLSFLREPKS-SKGLPHSAICNLNFTLPTHRKEMESDPDDENDNKDRRHTFASFALRKRYSYLTDPSSSPQSPCERTDLRMAIVADHLGLSWTELAREMNFSVDEINHIRTENPNSLTAQSFMLLKKWVSRDGKNATTDALTAGLTKVNRMDIVTLLEGPIFDYGNISGTRSFADDSAENSS 1578          
BLAST of Ankyrin-2 vs. Ensembl Cavefish
Match: ank3b (ankyrin 3b [Source:ZFIN;Acc:ZDB-GENE-060621-2])

HSP 1 Score: 788.489 bits (2035), Expect = 0.000e+0
Identity = 514/1534 (33.51%), Postives = 807/1534 (52.61%), Query Frame = 2
Query:  263 FSKVQEALNSNIDVNSCNSNGLNALHLASKGGHADIVQFLIDNGADIGAKTRKNNTAIHIASLAGSLEVVKILVKHGANINEQSQTGFTPLYMAAQENHVGVVKFLLDNGADINLSTTDNFTPLAVAIQQGHEETVSILLNKSNFLNSNDISNDIKLPPLHIATRKDDYHAVLLLLH--HQEDVQAALTQASLNGFTALHVAAYYNSDKVGRLLLENGAPVDYTSKNNVTALHVAAKWGRNKMVKVLLEFNANVEMSTRDGIRPLHCAASQGHRDICALLIEHKANCNTRTKNGLVPLHMVAQGNHSELVEFFINQNSVNVNETSLDFLTPLHISSHCNNVEVAEALIKHGANVNDRALNGFVALHIAAKQNHVEFVEMLMSNLCMIDTQTESGFTALHIASIIGSESIA---------------------------------KKLVENNCEIDIPDQFDRTSLHMATIFNHFNIVVYLKEHGGSVDKQMKTGETCLMLAIKSEHKAIVEYLINQGASMSVSDSWGLTALHWATLVVRENILNSNCTDININEAIEIFKFVLDGCSRFDINRTTKNGISSLHLAADCGCLEIVHLLLDKGADINIISINGTTPLHIACKXXXXXXXXXXXXXXXXXXXTMAYVSCPWSPMHFSSYFGSVDSTILLISH-------------------ENDQTSVREKL-------RQRTPNGNTCLHLA---------------------------VQQLQTDIVRVLLENDADFNLENEDGLSAFDMAKIVDDETIINLLGIDTTEMMTTDDKVYLFQRE---------EFSDEEQLETLYMDS---LNELEFFGIGKNSGEKCELQLSIMSLLDYATTIDSIRRADMSLKINNSLNRYRNITLSEIKTRELLIAAQPASMIST--ISSTNTEMSPFDVEKWDFHRVTDLPVNSGFLVSFLVDARGGYMQAQRMPQMKIFVPPDAAPAPTRIICHLLRPEGVANLPGMNDCDGFASRILQIHSSCSRFQKPILIEMPYIALLKSNDREIVILKKNADSDTWKKHSNTFTEETLKAEFGSLYESITPVDQLESNRICRIITTDVPTYFSLISQFQRDVNMIGPDGGYIESKTDKRIKLTFPQGALMKKIQIGLEVQHVDPGIINHVVGDNHKISLSPIITVEPKRRKFRDLIEIQMGLP----KGVTKNDIQD----LKLLFSISEYIT--DWEDVTSSTELVLLENTNCMAHSTKISARVWLIYAPNVPNISELANKIYALHCPTPYVGKFLSYARRHDQEECQIRCLLITDDTPDKTLECQESFELIATGPEVEVINKLQYQIECAGNIVAVTKSDEAILFPVQSFVENRITLPIRVRNQDEPFQGKIAFIPHFQSLSKQIVKXXXXXXXXXXXXXXXMVGSFRNPDRKHRVKNATLER---------IKGCQAIAKTELDLKSVADAVGADWRXXXXXXXXXXDDINLVLNENCTD-EEKAFMTLINWQTVLGFKATGNELNRALRQIGREDVVKSCIGDI 4498
              K  + L S +D+N CN NGLNALHLASK GH ++V  LI  GA + A T+K NTA+HIASLAG  +VVK LV +GAN+N QSQ GFTPLYMAAQENH+ VV++LLDNG+  +++T D FTPLAVA+QQGH++ VS+LL        ND    ++LP LHIA RKDD  A  LLL   H  DV+      S +GFT LH+AA+Y +  V  LLL  GA VD+ ++N++T LHVA+K G + MVK+LLE  A ++  T+DG+ PLHC A  GH  +  +L++  A   ++TKNGL PLHM  QG+H   V+  ++ + V V++ + D+LT LH+++HC + +VA+ ++   AN N +ALNGF  LHIA K+N ++ +E+L+ +   I   TESG T +H+A+ +G E+I                                  K LV+N   +D   + D+T LH+++      I+  L +HG   D    +G T L LA +  HK +   L++QGAS+ ++   G T LH A    +                IE+   +L    R   + + K+G++ LH+AA     ++  LLLD+GA  +  + NG TPLHIA K N   +   LLE  +    T A      SP+H +S  G+VD   LL++                    + DQ +V E L          T  G T LH+A                            QQ  T I+ +LL++ A  N    +G +A  +A+ +   ++++ L + T E +TT       +           + SD+E  + +  D+   L   +   +G +S       L     + ++    +      S   +N+LNR  + T   +   E+L   +   + +     + +     +  +  D   +   P++SGFLVSF+VDARGG M+  R   M+I +PP    APTRI C L++   +A+ P M + +G ASR++++  + + F  P+++E+P+   ++  +RE++IL+ + + +TWK+H      E L      + E +  +++LE  RICRIIT D P YF+++S+ +++ N +GP+GG + S T   ++ +FP+GAL KKI++GL+ Q V    +  ++G+  + + SPI+TVEP+RRKF   I + + +P    +GVT     D    L+LL SI+   +   WED+T +T L  +   +C++ +T +SAR WL     +P+   LA ++Y      PY+ KF+ +A+ +D  E  +RC  +TDD  DKTLE QE+FE +A   ++EV+      ++C GN+  +TK+ + +L    +F ENR+   +++R+  +   G+++F+   ++ SK I +       I        +     P+R+H   +  L +         +       +T+L +  VAD +G  W  LA E++   D+IN +  EN      ++FM L  W    G  AT + L  AL +I R D+V    G I
Sbjct:    1 LEKALDYLKSGVDINICNQNGLNALHLASKEGHVEVVTQLIKMGATVDAATKKGNTALHIASLAGQSDVVKELVTNGANVNAQSQNGFTPLYMAAQENHLDVVRYLLDNGSSQSIATEDGFTPLAVALQQGHDQVVSLLLE-------NDTKGKVRLPALHIAARKDDTKAAALLLQNDHNADVE------SKSGFTPLHIAAHYGNINVATLLLNRGAAVDFKARNDITPLHVASKRGNSNMVKLLLERGARIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLH-HEVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHENIVTQLMNHGASPNTTNVRGETALHMAARAGQTEVVKYLVQNGAYVDAKSKDDQTPLHISSRLGKPEIIQQLLQHGACPDSTTTSGYTPLHLAAREGHKDVASILLDQGASLGITTKKGFTPLHVAAKYGK----------------IEVANLLLQ--KRAPPDASGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMEIATTLLEYGAD---TNAITRQGISPLHLASQEGNVDMVTLLMARDATINLCNKSGLTPLHLAAQEDQVNVAEVLVNHGATVDPETKMGYTPLHVACHYGNVKMVHFLLKNQAKVNAKTKVTAAQQGHTHIINLLLQHGAAPNELTVNGNTALSIARRLGYISVVDTLRVVTEETLTTLTVTEKHKMNVPETMNEVLDMSDDEGEDAMTGDTDKYLGPQDLRELGDDS-------LPQEGYVGFSIGARTASLRSFSSDRSNTLNR-SSFTRDSMMIEEILAPTKDTHLAAAKDFDADSLRRYSWTGDTLDNVNLVSSPIHSGFLVSFMVDARGGSMRGSRHNGMRIIIPPRKCTAPTRITCRLVKRHKLASPPPMVEGEGLASRLVEVGPAGAHFLGPVIVEIPHFGSMRGKERELIILR-SENGETWKEHQYDCRTEALNELLNGMDEELESLEELEKKRICRIITKDFPQYFAVVSRIKQESNQMGPEGGVLSSMTVPHVQASFPEGALTKKIRVGLQAQPVPDETVKKILGN--RATFSPIVTVEPRRRKFHKPITMTIPVPPLSGEGVTNGYKGDSTPCLRLLCSITGGTSPAQWEDITGTTPLTFV--NDCVSFTTNVSARFWLADCHQIPDTVGLATQLYRELICVPYMAKFVVFAKMNDPVESNLRCFCMTDDKVDKTLEQQENFEEVARSKDIEVLEGKPIYVDCYGNLTPLTKAGQQLLLNFYAFKENRLPFCVKIRDNSQEPCGRLSFLRELKT-SKGIPQTAVCNLNITLPA----LKKTEKPERRHTFASLALRKRYSYLTEPGMSPQSPCERTDLRMAIVADHLGLSWTELAREMDFSVDEINHIRVENPNSLTTQSFMLLKKWVNRDGKNATTDVLTAALTKINRMDIVTLLEGPI 1481          

HSP 2 Score: 256.914 bits (655), Expect = 4.187e-68
Identity = 163/521 (31.29%), Postives = 274/521 (52.59%), Query Frame = 2
Query:  245 AAHNGYFSKVQEALNSNIDVNSCNSNGLNALHLASKGGHADIVQFLIDNGADIGAKTRKNNTAIHIASLAGSLEVVKILVKHGANINEQSQTGFTPLYMAAQENHVGVVKFLLDNGADINLSTTDNFTPLAVAIQQGHEETVSILLNKSNFLNSNDISNDIKLPPLHIATRKDDYHAVLLLLHHQEDVQAA-------------------LTQ-----ASLN-----GFTALHVAAYYNSDKVGRLLLENGAPVDYTSKNNVTALHVAAKWGRNKMVKVLLEFNANVEMSTRDGIRPLHCAASQGHRDICALLIEHKANCNTRTKNGLVPLHMVAQGNHSELVEFFINQNSVNVNETSLDFLTPLHISSHCNNVEVAEALIKHGANVNDRALNGFVALHIAAKQNHVEFVEMLMSNLCMIDTQTESGFTALHIASIIGSESIAKKLVENNCEIDIPDQFDRTSLHMATIFNHFNIVVYLKEHGGSVDKQMKTGETCLMLAIKSEHKAIVEYLINQGASMSV 1720
            AAH G  +     LN    V+    N +  LH+ASK G++++V+ L++ GA I AKT+   T +H  + +G  +VV++L+  GA I  +++ G +PL+MA Q +H+  V+ LL +   ++  T D  T L VA   GH +   ++++K    N+  ++      PLHIA +K+    + LLL H   +QA                    +TQ     AS N     G TALH+AA     +V + L++NGA VD  SK++ T LH++++ G+ ++++ LL+  A  + +T  G  PLH AA +GH+D+ ++L++  A+    TK G  PLH+ A+    E+    + Q     + +    LTPLH+++H +N +VA  L+  GA+ +  A NG+  LHIAAK+N +E    L+      +  T  G + LH+AS  G+  +   L+  +  I++ ++   T LH+A   +  N+   L  HG +VD + K G T L +A    +  +V +L+   A ++ 
Sbjct:  189 AAHYGNINVATLLLNRGAAVDFKARNDITPLHVASKRGNSNMVKLLLERGARIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLHHEVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNG---FTPLHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHENIVTQLMNHGASPNTTNVRGETALHMAARAGQTEVVKYLVQNGAYVDAKSKDDQTPLHISSRLGKPEIIQQLLQHGACPDSTTTSGYTPLHLAAREGHKDVASILLDQGASLGITTKKGFTPLHVAAKYGKIEVANLLL-QKRAPPDASGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMEIATTLLEYGADTNAITRQGISPLHLASQEGNVDMVTLLMARDATINLCNKSGLTPLHLAAQEDQVNVAEVLVNHGATVDPETKMGYTPLHVACHYGNVKMVHFLLKNQAKVNA 705          

HSP 3 Score: 222.631 bits (566), Expect = 1.320e-57
Identity = 126/385 (32.73%), Postives = 209/385 (54.29%), Query Frame = 2
Query:  245 AAHNGYFSKVQEALNSNIDVNSCNSNGLNALHLASKGGHADIVQFLIDNGADIGAKTRKNNTAIHIASLAGSLEVVKILVKHGANINEQSQTGFTPLYMAAQENHVGVVKFLLDNGADINLSTTDNFTPLAVAIQQGHEETVSILLNKSNFLNSNDISNDIKLPPLHIATRKDDYHAVLLLLHHQEDVQAALTQASLNGFTALHVAAYYNSDKVGRLLLENGAPVDYTSKNNVTALHVAAKWGRNKMVKVLLEFNANVEMSTRDGIRPLHCAASQGHRDICALLIEHKANCNTRTKNGLVPLHMVAQGNHSELVEFFI-NQNSVNVNETSLDFLTPLHISSHCNNVEVAEALIKHGANVNDRALNGFVALHIAAKQNHVEFVEML 1396
            AA  G+ + V + +N     N+ N  G  ALH+A++ G  ++V++L+ NGA + AK++ + T +HI+S  G  E+++ L++HGA  +  + +G+TPL++AA+E H  V   LLD GA + ++T   FTPL VA + G  E  ++LL K       D S    L PLH+A   D+    LLLL    D  A+   A+ NG+T LH+AA  N  ++   LLE GA  +  ++  ++ LH+A++ G   MV +L+  +A + +  + G+ PLH AA +   ++  +L+ H A  +  TK G  PLH+     + ++V F + NQ  VN              ++   +  +   L++HGA  N+  +NG  AL IA +  ++  V+ L
Sbjct:  387 AAFMGHENIVTQLMNHGASPNTTNVRGETALHMAARAGQTEVVKYLVQNGAYVDAKSKDDQTPLHISSRLGKPEIIQQLLQHGACPDSTTTSGYTPLHLAAREGHKDVASILLDQGASLGITTKKGFTPLHVAAKYGKIEVANLLLQKR---APPDASGKSGLTPLHVAAHYDNQKVALLLL----DQGASPHAAAKNGYTPLHIAAKKNQMEIATTLLEYGADTNAITRQGISPLHLASQEGNVDMVTLLMARDATINLCNKSGLTPLHLAAQEDQVNVAEVLVNHGATVDPETKMGYTPLHVACHYGNVKMVHFLLKNQAKVNAKTKV--------TAAQQGHTHIINLLLQHGAAPNELTVNGNTALSIARRLGYISVVDTL 756          
BLAST of Ankyrin-2 vs. Ensembl Cavefish
Match: ank3a (ankyrin 3a [Source:ZFIN;Acc:ZDB-GENE-060621-1])

HSP 1 Score: 768.459 bits (1983), Expect = 0.000e+0
Identity = 469/1393 (33.67%), Postives = 747/1393 (53.63%), Query Frame = 2
Query:  269 KVQEALNSNIDVNSCNSNGLNALHLASKGGHADIVQFLIDNGADIGAKTRKNNTAIHIASLAGSLEVVKILVKHGANINEQSQTGFTPLYMAAQENHVGVVKFLLDNGADINLSTTDNFTPLAVAIQQGHEETVSILLNKSNFLNSNDISNDIKLPPLHIATRKDDYHAVLLLLH--HQEDVQAAL--TQASLNGFTALHVAAYYNSDKVGRLLLENGAPVDYTSKNNVTALHVAAKWGRNKMVKVLLEFNANVEMSTRDGIRPLHCAASQGHRDICALLIEHKANCNTRTKNGLVPLHMVAQGNHSELVEFFINQNSVNVNETSLDFLTPLHISSHCNNVEVAEALIKHGANVNDRALNGFVALHIAAKQNHVEFVEMLMSNLCMIDTQTESGFTALHIASIIGSESIAKKL---------------------------------VENNCEIDIPDQFDRTSLHMATIFNHFNIVVYLKEHGGSVDKQMKTGETCLMLAIKSEHKAIVEYLINQGASMSVS---------------------------------DSWGLTALHWATLVVRENIL--------------NSNCTDINI---NEAIEIFKFVLDGCSRFDINRTTKNGISSLHLAADCGCLEIVHLLLDKGADINIISINGTTPLHIACKXXXXXXXXXXXXXXXXXXXTMAYVSCPWSPMHFSSYFGSVDSTILLISHENDQTSVREKLRQRTPNGNTCLHLAVQQLQTDIVRVLLENDADFNLENEDGLSAFDMAKIVDDETIINLLGIDTTEMMTTDDKVYLFQR-------EEF---SDEEQLETLYMDSLNELEFFGIGKNSGEKCELQLSIMSLLDYATTIDSIRRADMSLKINNSLNRYRNITLSEIKTRELLIAAQPASMISTISSTNTEMSPFDVEKWD------FHRVTDLPVNSG-----------FLVSFLVDARGGYMQAQRMPQMKIFVPPDAAPAPTRIICHLLRPEGVANLPGMNDCDGFASRILQIHSSCSRFQKPILIEMPYIALLKSNDREIVILKKNADSDTWKKHSNTFTEETLKAEFGSLYESITPVDQLESNRICRIITTDVPTYFSLISQFQRDVNMIGPDGGYIESKTDKRIKLTFPQGALMKKIQIGLEVQHVDPGIINHVVGDNHKISLSPIITVEPKRRKFRDLIEIQMGLPK--------GVTKNDIQDLKLLFSISEYIT--DWEDVTSSTELVLLENTNCMAHSTKISARVWLIYAPNVPNISELANKIYALHCPTPYVGKFLSYARRHDQEECQIRCLLITDDTPDKTLECQESFELIATGPEVEVINKLQYQIECAGNIVAVTKSDEAILFPVQSFVENRITLPIRVRNQDEPFQGKIAFI 4075
            K  + L + +D+N CN NGLNALHLASK GH ++V  L+  GA + A T+K NTA+HIASLAG  +VV+ LV +GAN+N QSQ GFTPLYMAAQENH+ VV+FLL++GA  +++T D FTPLAVA+QQGH++ VS+LL        ND    ++LP LHIA RKDD  +  LLL   H  DV++ +     + +GFT LH+AA+Y +  V  LLL  GA VD+ ++N++T LHVAAK G   MVK+LL+  A ++  T+DG+ PLHC A  GH  +  +L++  A   ++TKNGL PLHM  QG+H   V+  + Q+ V V++ + D+LT LH+++HC + +VA+ ++   AN N +ALNGF  LHIA K+N V+ +E+L+ +   +   TESG T +H+A+ +G E+I K+L                                 ++N  ++DI  + D+T+LH+A+      IV  L + G        +G T L LA++  H+     L+  GAS+S +                                    GLT LH A     + +                +  T ++I      +EI   +L+  +  + N  T+ GIS LHLAA  G +++V LLL K A++N+ + NG TPLH+A + +   V  VLL   +      A+    ++P+H + ++G++     L+ ++        K+  +T +G T LH A QQ  T I+ +LL++ A  N    +G +A  +A+ +   ++++ L   T E +T    V    +        EF   SD+E  + +      E E +   ++  E  +  L     + ++    S+     S   +N+ NR   +  S +   E +IA    + +S     N  +  +    W        H     P++SG           FLVSF+VDARGG M+  R   M+I +PP   PAPTRI C L +   +A  P M + +G  SR++++  + + F  P+++E+P+   ++  +RE+++L+ + + DTWK+H      E L A    + E +    +LE  RICRI+T D P YF+++S+ +++ + +GP+GG + S+    ++  FP GAL KKI++GL+ Q V   ++ +V+G+  + S SPI+TVEP+RRKF   I + + +P         G   +    L+LL SI+   +   WED+T +T L  +  T+C++ +T +SAR WL     V     LA  +Y      PY+ KF+ +A+  D  E ++RC  +TDD  DKTLE QE+FE +A   ++E++      ++C GN+   +KS + ++F   +F ENR+   ++VR+  +   G+++F+
Sbjct:    2 KALDYLKTGVDINICNQNGLNALHLASKEGHVEVVAELLKLGASVDAATKKGNTALHIASLAGQTDVVRELVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLEHGASQSIATEDGFTPLAVALQQGHDQVVSLLLE-------NDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVESKVHTYTHTHSGFTPLHIAAHYGNINVATLLLNRGAAVDFMARNDITPLHVAAKRGNGNMVKLLLDRGAKIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLL-QHDVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQADVVRYLLQNGAKVDIKAKDDQTALHIASRLGKAEIVQLLLQKGAWASAATTSGYTPLHLAVREGHQETASLLLEHGASLSAATKKGFTPLHVAAKYGQIEAAKLLLQKRAAPDTAGKTGLTPLHVAAHYDNQRVALLLLDHGASPHAAAKNGYTPLHIAAKKNQLEIGTTLLEFGA--ETNAVTRQGISPLHLAAQEGSVDLVSLLLTKNANVNMGNKNGLTPLHLAAQEDRVGVAEVLLNHGAEVD---AHTKTGYTPLHVACHYGNMKMVSFLLENQ-------AKINSKTKSGYTPLHQAAQQGHTHIINMLLQHRASANELTLNGNTALSIARRLGYISVVDTLRGLTDENLTATPPVSEKHKLNVPETMNEFLDMSDDEGEDAM----TGETEKYLRPQDLKELGDDSLPQEGYMGFSIGARSVSMRSFSSDRSNTQNRTSCVRDSMVI--EEVIAPTKDTHLSVSREQNESLRRYS---WTPDTMDHSHNTVSSPIHSGPSSPLPQYDSRFLVSFMVDARGGSMRGSRHDGMRIIIPPRKCPAPTRITCRLAKRHRLAYPPPMVEGEGLVSRLVEVGPAGAHFLGPVIVEIPHFGSMRGKERELIVLRSD-NGDTWKEHHYDCRGEDLLALLNGMDEELDSPIELEKKRICRIVTKDFPQYFAVVSRIKQESDHMGPEGGVLTSEAVPMVRAAFPPGALTKKIRVGLQAQPVPEEVVRNVIGN--RASFSPIVTVEPRRRKFHKPITMTIPVPPRAKEAAANGRKGDPAPCLRLLCSITGGTSPAQWEDITGTTPLSFV--TDCVSFTTNVSARFWLADCQQVSETVALATPLYRELICVPYLAKFVVFAKPTDPMEARLRCFCMTDDKVDKTLEQQENFEEVARSKDIEILEGKPIYVDCYGNLAPFSKSSQQLIFTFYAFKENRLPFNVKVRDVGQEACGRLSFL 1360          

HSP 2 Score: 278.1 bits (710), Expect = 3.998e-74
Identity = 184/597 (30.82%), Postives = 295/597 (49.41%), Query Frame = 2
Query:  245 AAHNGYFSKVQEALNSNIDVNSCNSNGLNALHLASKGGHADIVQFLIDNGADIGAKTRKNNTAIHIASLAGSLEVVKILVKHGANINEQSQTGFTPLYMAAQENHVGVVKFLLDNGADINLSTTDNFTPLAVAIQQGHEETVSILLNKSNFLNSNDISNDIKLPPLHIATRKDDYHAVLLLLHHQEDVQAALTQASL------------------------------NGFTALHVAAYYNSDKVGRLLLENGAPVDYTSKNNVTALHVAAKWGRNKMVKVLLEFNANVEMSTRDGIRPLHCAASQGHRDICALLIEHKANCNTRTKNGLVPLHMVAQGNHSELVEFFINQNSVNVNETSLDFLTPLHISSHCNNVEVAEALIKHGANVNDRALNGFVALHIAAKQNHVEFVEMLMSNLCMIDTQTESGFTALHIASIIGSESIAKKLVENNCEIDIPDQFDRTSLHMATIFNHFNIVVYLKEHGGSVDKQMKTGETCLMLAIKSEHKAIVEYLINQGASMSVSDSWGLTALHWATLVVRENILNSNCTDININEAIEIFKFVLDGCSRFDINRTTKNGISSLHLAADCGCLEIVHLL 1945
            AAH G  +     LN    V+    N +  LH+A+K G+ ++V+ L+D GA I AKT+   T +H  + +G  +VV++L+  GA I  +++ G +PL+MA Q +H+  V+ LL +   ++  T D  T L VA   GH +   ++++K    N+  ++      PLHIA +K+    + LLL H   +Q A+T++ L                               G TALH+AA      V R LL+NGA VD  +K++ TALH+A++ G+ ++V++LL+  A    +T  G  PLH A  +GH++  +LL+EH A+ +  TK G  PLH+ A+    E  +  + Q     +      LTPLH+++H +N  VA  L+ HGA+ +  A NG+  LHIAAK+N +E    L+      +  T  G + LH+A+  GS  +   L+  N  +++ ++   T LH+A   +   +   L  HG  VD   KTG T L +A    +  +V +L+   A ++     G T LH A      +I+N                 +L    R   N  T NG ++L +A   G + +V  L
Sbjct:  196 AAHYGNINVATLLLNRGAAVDFMARNDITPLHVAAKRGNGNMVKLLLDRGAKIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHDVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNG---FTPLHIACKKNRVKVMELLLKHGASLQ-AVTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQADVVRYLLQNGAKVDIKAKDDQTALHIASRLGKAEIVQLLLQKGAWASAATTSGYTPLHLAVREGHQETASLLLEHGASLSAATKKGFTPLHVAAKYGQIEAAKLLL-QKRAAPDTAGKTGLTPLHVAAHYDNQRVALLLLDHGASPHAAAKNGYTPLHIAAKKNQLEIGTTLLEFGAETNAVTRQGISPLHLAAQEGSVDLVSLLLTKNANVNMGNKNGLTPLHLAAQEDRVGVAEVLLNHGAEVDAHTKTGYTPLHVACHYGNMKMVSFLLENQAKINSKTKSGYTPLHQAAQQGHTHIIN----------------MLLQ--HRASANELTLNGNTALSIARRLGYISVVDTL 769          

HSP 3 Score: 253.062 bits (645), Expect = 1.665e-66
Identity = 149/451 (33.04%), Postives = 240/451 (53.22%), Query Frame = 2
Query:  245 AAHNGYFSKVQEALNSNIDVNSCNSNGLNALHLASKGGHADIVQFLIDNGADIGAKTRKNNTAIHIASLAGSLEVVKILVKHGANINEQSQTGFTPLYMAAQENHVGVVKFLLDNGADINLSTTDNFTPLAVAIQQGHEETVSILLNKSNFLNSNDISNDIKLPPLHIATRKDDYHAVLLLLHHQEDVQAALTQASLNGFTALHVAAYYNSDKVGRLLLENGAPVDYTSKNNVTALHVAAKWGRNKMVKVLLEFNANVEMSTRDGIRPLHCAASQGHRDICALLIEHKANCNTRTKNGLVPLHMVAQGNHSELVEFFINQNSVNVNETSLDFLTPLHISSHCNNVEVAEALIKHGANVNDRALNGFVALHIAAKQNHVEFVEMLMSNLCMIDTQTESGFTALHIASIIGSESIAKKLVENNCEIDIPDQFDRTSLHMATIFNHFNIVVYLK 1597
            AAH G++   +  ++   + N+   NG   LH+A K     +++ L+ +GA + A T    T IH+A+  G   +VK L  HGA+ N  +  G T L+MAA+     VV++LL NGA +++   D+ T L +A + G  E V +LL K  + ++   S      PLH+A R+       LLL H     A+L+ A+  GFT LHVAA Y   +  +LLL+  A  D   K  +T LHVAA +   ++  +LL+  A+   + ++G  PLH AA +   +I   L+E  A  N  T+ G+ PLH+ AQ    +LV   + +N+ NVN  + + LTPLH+++  + V VAE L+ HGA V+     G+  LH+A    +++ V  L+ N   I+++T+SG+T LH A+  G   I   L+++    +       T+L +A    + ++V  L+
Sbjct:  328 AAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQADVVRYLLQNGAKVDIKAKDDQTALHIASRLGKAEIVQLLLQKGAWASAATTSG---YTPLHLAVREGHQETASLLLEH----GASLSAATKKGFTPLHVAAKYGQIEAAKLLLQKRAAPDTAGKTGLTPLHVAAHYDNQRVALLLLDHGASPHAAAKNGYTPLHIAAKKNQLEIGTTLLEFGAETNAVTRQGISPLHLAAQEGSVDLVSLLLTKNA-NVNMGNKNGLTPLHLAAQEDRVGVAEVLLNHGAEVDAHTKTGYTPLHVACHYGNMKMVSFLLENQAKINSKTKSGYTPLHQAAQQGHTHIINMLLQHRASANELTLNGNTALSIARRLGYISVVDTLR 770          

HSP 4 Score: 122.865 bits (307), Expect = 3.906e-27
Identity = 110/413 (26.63%), Postives = 177/413 (42.86%), Query Frame = 2
Query: 1280 EVAEALIKHGANVNDRALNGFVALHIAAKQNHVEFVEMLMSNLCMIDTQTESGFTALHIASIIGSESIAKKLVENNCEIDIPDQFDRTSLHMATIFNHFNIVVYLKEHGGSVDKQMKTGETCLMLAIKSEHKAIVEYLINQGASMSVSDSWGLTALHWATL---VVRENILNSNCTDININEAIEIFKFVLDGCSRFDI--------------NR------TTKNGISSLHLAADCGCLEIVHLLLDKGADINIISINGTTPLHIACKXXXXXXXXXXXXXXXXXXXTMAYVSCPWSPMHFSSYFGSVDSTILLISHE-------NDQTSV-------------------REKLRQRTPNGNTCLHLAVQQLQTDIVRVLLENDADFNLENEDGLSAFDMAKIVDDETIINLL 2371
            E A   +K G ++N    NG  ALH+A+K+ HVE V  L+     +D  T+ G TALHIAS+ G   + ++LV N   ++   Q   T L+MA   NH  +V +L EHG S     + G T L +A++  H  +V  L+       V     L ALH A          +L  N  + ++   +  +     G +   I              NR        +N I+ LH+AA  G   +V LLLD+GA I+  + +G TPLH   +   S    V+   L   +  ++      SP+H ++    ++   LL+ H+       ND  +                    +     +  NG T LH+A ++ +  ++ +LL++ A      E GL+   +A  +  E I+  L
Sbjct:    1 EKALDYLKTGVDINICNQNGLNALHLASKEGHVEVVAELLKLGASVDAATKKGNTALHIASLAGQTDVVRELVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLEHGASQSIATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVR----LPALHIAARKDDTKSAALLLQNDHNADVESKVHTYTHTHSGFTPLHIAAHYGNINVATLLLNRGAAVDFMARNDITPLHVAAKRGNGNMVKLLLDRGAKIDAKTKDGLTPLHCGAR---SGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHDVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQL 406          
BLAST of Ankyrin-2 vs. Ensembl Cavefish
Match: ENSAMXT00000017800.2 (pep primary_assembly:Astyanax_mexicanus-2.0:16:21012912:21225385:-1 gene:ENSAMXG00000017269.2 transcript:ENSAMXT00000017800.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 744.191 bits (1920), Expect = 0.000e+0
Identity = 492/1444 (34.07%), Postives = 732/1444 (50.69%), Query Frame = 2
Query:  236 FLRAAHNGYFSKVQEALNSNIDVNSCNSNGLNALHLASKGGHADIVQFLIDNGADIGAKTRKNNTAIHIASLAGSLEVVKILVKHGANINEQSQTGFTPLYMAAQENHVGVVKFLLDNGADINLSTTDNFTPLAVAIQQGHEETVSILLNKSNFLNSNDISNDIKLPPLHIATRKDDYHAVLLLLH--HQEDVQAALTQASLNGFTALHVAAYYNSDKVGRLLLENGAPVDYTSK-NNVTALHVAAKWGRNKMVKVLLEFNANVEMSTRDGIRPLHCAASQGHRDICALLIEHKANCNTRTKNGLVPLHMVAQGNHSELVEFFINQNSVNVNETSLDFLTPLHISSHCNNVEVAEALIKHGANVNDRAL--NGFVALHIAAKQNHVEFVEMLMSNLCMIDTQTESGFT---------------------------------ALHIASIIGSESIAKKLVENNCEIDIPDQFDRTSLHMATIFNHFNIVVYLKEHGGSVDKQMKTGETCLMLAIKSEHKAIVEYLINQGASMSVSDSWGLTALH----WATLVVRENILNSNC----------TDININEAIEIFKFVL----DGCS------------------------------RFDINRTTKNGISSLHLAADCGCLEIVHLLLDKGADINIISINGTTPLHIACKXXXXXXXXXXXXXXXXXXXTMAYVSCPWSPMHFSSYFGSVDSTILLISHENDQTSVREKLRQRTPNGNTCLHLAVQQLQTDIVRVLLENDADFNLENEDGLSAFDMAK------IVD------------------------DETIINLLGIDTTE--MMTTDDKVYLFQRE--EFSDEEQLETLYMDSLNELEFFGIGKNSGEKCELQLSIMSLLDYATTIDSIRRADMSLKINNSLNRYRNITLSEIKTRELLIAAQPASMISTISSTNTEMSPFDVEKWDFHRVTDLPVNSGFLVSFLVDARGGYMQAQRMPQMKIFVPPDAAPAPTRIICHLLRPEGVANLPGMNDCDGFASRILQIHSSCSRFQK-------------------------------PILIEMPYIALLKSNDREIVILKKNADSDTWKKHSNTFTEETLKAEFGSLYESITPVDQLESNRICRIITTDVPTYFSLISQFQRDVNMIGPDGGYIESKTDKRIKLTFPQGALMKKIQIGLEVQHVDPGIINHVVGDNHKISLSPIITVEPKRRKFRDLIEIQMGLPKGVTK-------NDIQDLKLLFSISEYI-TDWEDVTSSTELVLLENTNCMAHSTKISARVWLIYAPNVPNISELANKIYALHCPTPYVGKFLSYARRHDQEECQIRCLLITDDTPDKTLECQESFELIATGPEVEVINKLQYQIECAGNIVAVTKSDEAILFPVQSFVENRITLPIRVRNQDEPFQGKIAFIPHFQS 4090
            FLRAA  G   KV E L   +D+ + N NGLNALHLA+K GH D+VQ L++ G+ + + T+K NTA+HIASLAG  EVVKILVK GA+IN QSQ GFTPLYMA+QENH+ VV++LL+NG + + +T D FTPLA+A+QQGH + VSILL        ND    ++LP LHIA RKDD  +  LLL   H  DVQ      S +GFT LH+AA+Y +  V  LLL  GA VD+T++ N +T LHVA+K G   MV++LL+  + ++  TRDG+ PLHCAA  GH     LL+E  A    RTKNGL PLHM AQG+H E V+  + Q+   V++ +LD+LT LH+++HC +  V + L+   AN N RAL  NGF  LHIA K+N V+ +E+L+     I   TESG T                                 ALH+A+  G   + + L+ N   +D   + D+T LH+A+      IV  L +H    D     G T L ++ +     +   L+  GAS S++   G T LH    + +L V + +L              T +++    +  K  L     G S                                + N  TK G++ LHLA+  G  ++  LLL KGA +N+ + +G T LH+A + +   V  +L+++ +            ++P+  + ++G+      L+       SV  K    T NG T LH A QQ  T I+ VLL+  A  N    +G +A  +A+      +VD                         ET+  +L +   E   MT D   YL   +  E  D+  L   Y+D +N L F   G                           R+D+S  + N  + YR   LS                             +  E  D   ++  PV+S FLVSF+VDARGG M+  R   ++I +PP    APTR+ C L++   +A +P M + +G ASR++++  S ++F K                               P+++E+P+ A L+  +RE+VIL+     ++WK+H   +TEE L      + E + P ++LE  RICRIIT D P YF+++S+ ++D N+IGP+GG + S    +++  FP+GAL K+I++GL+ Q V+  ++  ++G+  K + SPI+T+EP+RRKF   I + + +PK  T         D   L+LL SI+      WED+T +T L  +   +C++ +T +SA  WLI           A ++Y      PY+ KF+ +A+ HD  E ++RC  +TDD  DKTLE QE+F  +A   +VEV+       +C GN+V +TKS +  LF   +F ENR+ L I++R+  +   G+++F+   +S
Sbjct:   36 FLRAARAGNIDKVLEYLKGGVDIGTSNQNGLNALHLAAKEGHMDLVQELLERGSSVDSATKKGNTALHIASLAGQAEVVKILVKQGADINAQSQNGFTPLYMASQENHLDVVRYLLENGGNQSTATEDGFTPLAIALQQGHNQVVSILLE-------NDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQ------SKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARQNGITPLHVASKRGNTNMVRLLLDRGSQIDAKTRDGLTPLHCAARSGHDTAVELLLERGAPILARTKNGLSPLHMAAQGDHVECVKHLL-QHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALLQNGFTPLHIACKKNRVKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVSNIRGETALHMAARAGQVEVVRCLLRNGAMVDARAREDQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQLDVASVLLEAGASHSLATKKGFTPLHVASKYGSLDVAKLLLQRRAPPDSAGKNGLTPLHVAAHYDNQKVALLLLDKGASPHATAKNGYTPLHIAAKKNQMEIATTLLQYEAETNILTKQGVTPLHLASQEGHSDMAALLLQKGAQVNVPTKSGLTALHLAAQEDRVGVAEILVKNGASMDQ---QTKLGYTPLIVACHYGNAKMVNFLL---KSNASVNAK----TKNGYTPLHQAAQQGNTHIINVLLQYGAKPNAITVNGNTALAIARRLGYISVVDTLRVVAEEIITTTTTVTEKHKLNVPETMTEVLDVSDEEDDTMTGDGGEYLRAEDLRELGDD-SLPGQYLDGMNYLRFSLEGG--------------------------RSDVS-SLANERDSYR---LS-----------------------------WGTENLDNIALSSSPVHS-FLVSFMVDARGGAMRGCRHNGLRIIIPPRKCGAPTRVTCRLVKRHRLATMPPMVEGEGLASRLIEVGPSGAQFLKLHLPTAPPPLNEGESLVSRILQLGPPGTKFLPVIVEIPHFAALRGKERELVILRSET-GESWKEHHCEYTEEELNQILNGMDE-LDPPEELERKRICRIITRDFPQYFAVVSRIKQDSNLIGPEGGILSSTVVPQVQAVFPEGALTKRIRVGLQAQSVNMDVVRKILGN--KATFSPIVTLEPRRRKFHKPITMTIPIPKSSTDPVLNGFGGDTPTLRLLCSITGTTPAQWEDITGTTPLTFI--NDCVSFTTNVSA-FWLIDCRQAQESVNFATQVYREIICVPYMAKFVVFAKTHDPIEARLRCFCMTDDKIDKTLEQQENFTEVARSRDVEVLEGKPIYADCFGNLVPLTKSGQHHLFSFFAFKENRLALFIKIRDNTQEPCGRLSFMKEPRS 1387          
BLAST of Ankyrin-2 vs. Ensembl Cavefish
Match: ank1b (ankyrin 1, erythrocytic b [Source:ZFIN;Acc:ZDB-GENE-091113-6])

HSP 1 Score: 711.449 bits (1835), Expect = 0.000e+0
Identity = 448/1372 (32.65%), Postives = 719/1372 (52.41%), Query Frame = 2
Query:  269 KVQEALNSNIDVNSCNSNGLNALHLASKGGHADIVQFLIDNGADIGAKTRKNNTAIHIASLAGSLEVVKILVKHGANINEQSQTGFTPLYMAAQENHVGVVKFLLDNGADINLSTTDNFTPLAVAIQQGHEETVSILLNKSNFLNSNDISNDIKLPPLHIATRKDDYHAVLLLLHHQEDVQAALTQASLNGFTALHVAAYYNSDKVGRLLLENGAPVDYTSKNNVTALHVAAKWGRNKMVKVLLEFNANVEMSTRDGIRPLHCAASQGHRDICALLIEHKANCNTRTKNGLVPLHMVAQGNHSELVEFFINQNSVNVNETSLDFLTPLHISSHCNNVEVAEALIKHGANVNDRALNGFVALHIAAKQNHVEFVEMLMSNLCMIDTQTESGFTALHIASIIGSESIAKKLVE-------NNCEIDIP------------DQF--------------DRTSLHMATIFNHFNIVVYLKEHGGSVDKQMKTGETCLMLAIKSEHKA---------------------------------IVEYLINQGASMSVSDSWGLTALHWAT----------LVVRENILNSNC----TDINI---NEAIEIFKFVLDGCSRFDINRTTKNGISSLHLAADCGCLEIVHLLLDKGADINI-----ISINGTTPLHIACKXXXX--XXXXXXXXXXXXXXXTMAYVSCPWSPMHFSSYFGSVDSTILLI---SHENDQTSVREKLRQRTPNGNTCLHLAVQQLQTDIVRVLLENDADFNLENEDGLSAFDMAKIVDDETIINLLGIDTTEMMTTDDKVYLFQREEFSDEEQLETLYMDSLNELEFFGIGKNSGEKCELQLSIMSLLDYATTIDSIRRADMSLKINNSLNRYRNITLSEIKTRELLIAAQPASMISTISSTNTEMSPFDVEKWDFHRVTDLPVNSGFLVSFLVDARGGYMQAQRMPQMKIFVPPDAAPAPTRIICHLLRPEGVANLPGMNDCDGFASRILQIHSSCSRFQKPILIEMPYIALLKSNDREIVILKKNADSDTWKKHSNTFTEETLKAEFGSLYESITPVDQLESNRICRIITTDVPTYFSLISQFQRDVNMIGPDGGYIESKTDKRIKLTFPQGALMKKIQIGLEVQHVDPGIINHVVGDNHKISLSPIITVEPKRRKFRDLIEIQMGLP-------KGVTKNDIQDLKLLFSI--SEYITDWEDVTSSTELVLLENTNCMAHSTKISARVWLIYAPNVPNISELANKIYALHCPTPYVGKFLSYARRHDQEECQIRCLLITDDTPDKTLECQESFELIATGPEVEVINKLQYQIECAGNIVAVTK-SDEAILFPVQSFVENRITLPIRVRNQDEPFQGKIAFI 4075
            K  + + + I +N+ N NGLN LHLASK GH  +V  L+ +G D+   T+K NTA+HIA+LAG  +VV  LV +GAN+N QSQ GF+PLYMAAQENH+ VVKFLL+NGA+ +L T D FTPLAVA+QQGHE  V++L+N             ++LP LHIA R DD     +LL +  +        S  GFT LH+AA+Y +  V +LLL  GA V++T KN +T LH+AA+ G   MV++LL+  A ++  T+D + PLHCAA  GH  +  +L++  A    +TKNGL P+HM AQG+H + V   +  N+  +++ +LD LTPLH+++HC +  +A+ L+  GA  N RALNGF  LHIA K+NH+  +++L+ +   ++  TESG T LH+A+ +G  +I K L++       +N +++ P             QF              D+T LH A    H  +V  L EH  + D     G T L +A +  H                                   + E L+ +GA+ + +   GLT LH A           LV +    +S      T ++I      +E+   +L  C   + N  +  GI+ LHLAA  G  ++V LL+ K  ++N+       +   TPLH+  +  +     +LV   +  Y +  M Y +     +H + ++G++     L+   +H N +T V          G T LH A QQ  TDIV +LL++ A  N    +G S   +AK +   ++I++L + T E M+         +   S  E ++          E   + ++ G              Y+  I  I           S   +  + L +    + LI + PA+       T+  +SP              P+++GFLVSF+VDARGG M+  R   +++ +PP    APTRI C L++P+ +   P + + +G ASRI+ +  S  +F  P+++E+P+ A L   DRE+V+L ++ +   WK+H N + +E L+     + E +   ++LE  RI RII+TD P YF+++S+ Q++ ++IGP+GG + SK   +++  FP+ A+ K++++GL+ Q +   ++   +G+  + + SP++TVEP+RRKF   I +++ LP       +   + D   L+LL S+        WED+T +T+  L+ + NC   +T +SAR WL   P        AN +Y      PY+ KF+ +A+ ++  E ++RC  +TDD  DKTLE  E+F  +A   ++EV+  +   +EC+GN+V V K + +   F  Q+F +NR+ + ++VR+ ++   G ++F+
Sbjct:    2 KALDHIKNGIAINTANQNGLNGLHLASKEGHVKMVLELLHHGIDLETTTKKGNTALHIAALAGQEKVVAELVHYGANVNAQSQKGFSPLYMAAQENHLEVVKFLLENGANQSLPTEDGFTPLAVALQQGHENVVALLINYGT-------KGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVL----SKTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIAARRGNVIMVRLLLDRGAQIDARTKDELTPLHCAARNGHVRVIEILLDQGAPIQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNA-EIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNLAQVDAKAKDDQTPLHCAARMGHKELVKLLLEHKANPDSATTAGHTPLHIAAREGHAHTTRILLDGNAQQTKMTKKGFTPLHVACKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTPLHIAAKQNQLEVASSLLQ-CG-ANANSESLQGITPLHLAAQEGRPDMVALLISKQGNVNLGNKVRTQLTALTPLHLVAQEGHVGIADMLVKQGASVYSASRMGYTA-----LHVACHYGNIKMVKFLLQQQAHVNCKTRV----------GYTPLHQAAQQGHTDIVTLLLKHGALPNEITTNGTSPLGIAKRLGYISVIDVLKLVTEESMSA--------KHRMSFPETVD----------EILDVSEDEGGP------------YSPAIPRIPCV--------SPETHTPVPLPKEYDEDSLIPSSPAT------ETSDNVSPVAS-----------PIHTGFLVSFMVDARGGSMRGSRHNGLRVIIPPRTCAAPTRITCRLVKPQKLTTPPPLVEGEGLASRIISLGPSSMQFLGPVIVEIPHFASLGRGDRELVVL-RSENGSVWKEHRNRYGDEVLETILNGMDEDLESQEELEKKRIRRIISTDFPLYFAVVSRVQQESDLIGPEGGQLISKLVPQVQAIFPETAVTKRVRLGLQAQPIPDELLTRQLGN--QATFSPVVTVEPRRRKFHRPIGLRIPLPPSWRESQRDAGEGDTTSLRLLCSVIGGTAPAQWEDITGTTK--LMYSNNCANFTTNVSARFWLADCPRTAEAVTFANLLYRELMAVPYMAKFVVFAKMNEAREGRLRCYCMTDDKMDKTLELHENFSEVARSRDIEVMEGMPLHLECSGNLVPVRKATQQPRTFSFQAFRDNRLPVSVKVRDSNKDATGFLSFL 1284          

HSP 2 Score: 308.145 bits (788), Expect = 1.130e-84
Identity = 202/593 (34.06%), Postives = 311/593 (52.45%), Query Frame = 2
Query:  245 AAHNGYFSKVQEALNSNIDVNSCNSNGLNALHLASKGGHADIVQFLIDNGADIGAKTRKNNTAIHIASLAGSLEVVKILVKHGANINEQSQTGFTPLYMAAQENHVGVVKFLLDNGADINLSTTDNFTPLAVAIQQGHEETVSILLNKSNFLNSNDISNDIKLPPLHIATRKDDYHAVLLLLHHQEDVQAALTQASLNGFTALHVAAYYNSDKVGRLLLENGAPVDYTSKNNVTALHVAAKWGRNKMVKVLLEFNANVEMSTRDGIRPLHCAASQGHRDICALLIEHKANCNTRTKNGLVPLHMVAQGNHSELVEFFINQNSVNVNETSLDFLTPLHISSHCNNVEVAEALIKHGANVNDRALNGFVALHIAAKQNHVEFVEMLMSNLCMIDTQTESGFTALHIASIIGSESIAKKLVENNCEIDIPDQFDRTSLHMATIFNHFNIVVYLKEHGGSVD-----KQMKTGETCLMLAIKSEHKAIVEYLINQGASMSVSDSWGLTALHWATLVVRENILNSNCTDININEAIEIFKFVLDGCSRFDINRTTKNGISSLHLAADCGCLEIVHLLLDKGADINIISINGTTPLHIA 2008
            AAH    S  Q  LN   +VN    NG+  LH+A++ G+  +V+ L+D GA I A+T+   T +H A+  G + V++IL+  GA I  +++ G +P++MAAQ +H+  V+ LL   A+I+  T D+ TPL VA   GH     +LL+K    N+  ++      PLHIA +K+   ++ LLL H     A+L   + +G T LHVAA+     + + LL+ GA  + ++    T LH+AA+ G  ++ + LL+  A V+   +D   PLHCAA  GH+++  LL+EHKAN ++ T  G  PLH+ A+  H+      ++ N+     T   F TPLH++     V+VAE L++ GAN N    NG   LH+A   N+++ V++L+S      +   +G+T LHIA+      +A  L++     +       T LH+A      ++V  L    G+V+     +   T  T L L  +  H  I + L+ QGAS+  +   G TALH A            C   N    I++ KF+L    +  +N  T+ G + LH AA  G  +IV LLL  GA  N I+ NGT+PL IA
Sbjct:  188 AAHYENLSVAQLLLNRGANVNFTPKNGITPLHIAARRGNVIMVRLLLDRGAQIDARTKDELTPLHCAARNGHVRVIEILLDQGAPIQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKANARALNG---FTPLHIACKKNHMRSMDLLLKH----SASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNLAQVDAKAKDDQTPLHCAARMGHKELVKLLLEHKANPDSATTAGHTPLHIAAREGHAHTTRILLDGNAQQTKMTKKGF-TPLHVACKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTPLHIAAKQNQLEVASSLLQCGANANSESLQGITPLHLAAQEGRPDMVALLISKQGNVNLGNKVRTQLTALTPLHLVAQEGHVGIADMLVKQGASVYSASRMGYTALHVA------------CHYGN----IKMVKFLLQ--QQAHVNCKTRVGYTPLHQAAQQGHTDIVTLLLKHGALPNEITTNGTSPLGIA 754          

HSP 3 Score: 88.5817 bits (218), Expect = 7.302e-17
Identity = 49/150 (32.67%), Postives = 83/150 (55.33%), Query Frame = 2
Query:  245 AAHNGYFSKVQEALNSNIDVNSCNS-----NGLNALHLASKGGHADIVQFLIDNGADIGAKTRKNNTAIHIASLAGSLEVVKILVKHGANINEQSQTGFTPLYMAAQENHVGVVKFLLDNGADINLSTTDNFTPLAVAIQQGHEETVSIL 679
            AA  G    V   ++   +VN  N        L  LHL ++ GH  I   L+  GA + + +R   TA+H+A   G++++VK L++  A++N +++ G+TPL+ AAQ+ H  +V  LL +GA  N  TT+  +PL +A + G+   + +L
Sbjct:  617 AAQEGRPDMVALLISKQGNVNLGNKVRTQLTALTPLHLVAQEGHVGIADMLVKQGASVYSASRMGYTALHVACHYGNIKMVKFLLQQQAHVNCKTRVGYTPLHQAAQQGHTDIVTLLLKHGALPNEITTNGTSPLGIAKRLGYISVIDVL 766          
BLAST of Ankyrin-2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000093.1 (pep scaffold:Pmarinus_7.0:GL477582:20502:66045:1 gene:ENSPMAG00000000080.1 transcript:ENSPMAT00000000093.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 499.59 bits (1285), Expect = 1.580e-153
Identity = 287/731 (39.26%), Postives = 426/731 (58.28%), Query Frame = 2
Query:  236 FLRAAHNGYFSKVQEALNSNIDVNSCNSNGLNALHLASKGGHADIVQFLIDNGADIGAKTRKNNTAIHIASLAGSLEVVKILVKHGANINEQSQTGFTPLYMAAQENHVGVVKFLLDNGADINLSTTDNFTPLAVAIQQGHEETVSILLNKSNFLNSNDISNDIKLPPLHIATRKDDYHAVLLLLHHQEDV----QAALTQASLNGFTALHVAAYYNSDKVGRLLLENGAPVDYTSKNNVTALHVAAKWGRNKMVKVLLEFNANVEMSTRDGIRPLHCAASQGHRDICALLIEHKANCNTRTKNGLVPLHMVAQGNHSELVEFFINQNSVNVNETSLDFLTPLHISSHCNNVEVAEALIKHGANVNDRALNGFVALHIAAKQNHVEFVEMLMSNLCMIDTQTESGFTALHIASIIGSESIAKKLVENNCEIDIPDQFDRTSLHMATIFNHFNIVVYLKEHGGSVDKQMKTGETCLMLAIKSEHKAIVEYLINQGASMSVSDSWGLTALHWATLVVRENILNSNCTDININEAIEIFKFVLDGCSRFDINRTTKNGISSLHLAADCGCLEIVHLLLDKGADINIISINGTTPLHIACKXXXXXXXXXXXXXXXXXXXTMAYVSCPWSPMHFSSYFGSVDSTILLISHENDQTSVREKLRQRTPNGNTCLHLAVQQLQTDIVRVLLENDADFNLENEDGLSAFDMAKIVDDETIINLLGIDTTEMMTTDDKVY 2416
            FLRAA NG   ++ + L   +D+N+CN NGLNALHLASK GH D+V  L+   A+I   T+  NTA+HIA+LAG  ++V++LV+ GANIN QSQ GFTPLYMAAQENH+ +VKFLLDNGA+ +++T D FTPLAVA+QQGHE+ V +LL        +D    ++LP LHIA RKDD +A  LLL H+ +     +  L Q + +GFT LH+AA+Y +  V  LLL  GA VD+T++N +T LHVAAK G N MVK+LL+  A ++  TRDG+ PLHCAA  GH  +  +L+E  A    +TKNGL PLHM  QG H   V+  + + +  V++ +LD+LTPLH+++HC +  VA+ L+  G   N RALNGF  LHIA K+N ++ +E+L+ +   I T TESG T +H+AS +G  ++ + L++N    +  +    T LHMA+      +V  L + G  V  + +  +T L +A +     IV+ L+ +G+  +   + G T L++A+   RE                ++   +L+  +  DI+  TK G + LH+A+  G LE+  LLL+K A  +    NG TPLH+A   ++  V L+LL+  +    T       ++P+H ++    ++   +L+        +  +    T  G   LHLA Q+   D+V +LL   A  +L  + GL+A  +A   D   +  +L     ++ TT    Y
Sbjct:   14 FLRAARNGNLERLMDHLKGGMDINTCNQNGLNALHLASKEGHVDVVTELLKREAEIDTATKVGNTALHIAALAGQTDIVRVLVEFGANINAQSQNGFTPLYMAAQENHLEIVKFLLDNGANQSVATEDGFTPLAVALQQGHEQVVGLLL-------ESDTKGKVRLPALHIAARKDDTNAAALLLQHEHNADVTSKMMLNQTTESGFTPLHIAAHYGNMNVATLLLNLGAAVDFTARNGITPLHVAAKRGNNNMVKLLLDRGAKIDTKTRDGLTPLHCAARSGHEKVIEMLLERDAPILAKTKNGLSPLHMATQGEHLACVQLLLGRQA-PVDDVTLDYLTPLHVAAHCGHYRVAKLLLDRGGEPNARALNGFTPLHIACKKNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFAS---REG-------------HGDVASLLLENGA--DISPVTKKGFTPLHIASKYGRLEVATLLLEKYASADPKGKNGLTPLHVATHYDHQKVALLLLDKGASPHST---AKNGYTPLHIAAKKNQLEVGKVLL-------ELGAETNMLTQQGVAPLHLAAQEGHADMVALLLGRHASISLATKGGLTAMHLAAQEDKVNVAEILTKHKADVNTTTKLCY 708          

HSP 2 Score: 256.914 bits (655), Expect = 5.268e-71
Identity = 186/621 (29.95%), Postives = 305/621 (49.11%), Query Frame = 2
Query:  326 LNALHLASKGGHADIVQFLI--DNGADIGAK------TRKNNTAIHIASLAGSLEVVKILVKHGANINEQSQTGFTPLYMAAQENHVGVVKFLLDNGADINLSTTDNFTPLAVAIQQGHEETVSILLNKSNFLNSNDISNDIKLPPLHIATRKDDYHAVLLLLHHQEDVQAALTQASLNGFTALHVAAYYNSDKVGRLLLENGAPVDYTSKNNVTALHVAAKWGRNKMVKVLLEFNANVEMSTRDGIRPLHCAASQGHRDICALLIEHKANCNTRTKNGLVPLHMVAQGNHSELVEFFINQNSVNVNETSLDFLTPLHISSHCNNVEVAEALIKHGANVNDRALNGFVALHIAAKQNHVEFVEMLMSNLCMIDTQTESGFTALHIASIIGSESIAKKLVENNCEIDIPDQFDRTSLHMATIFNHFNIVVYLKEHGGSVDKQMKTGETCLMLAIKSE---------------------------------HKAIVEYLINQGASMSVSDSWGLTALHWATLVVREN---ILNSNCTDININEA--------------IEIFKFVLDGCSRFDINRTTKNGISSLHLAADCGCLEIVHLLLDKGADINIISINGTTPLHIACK 2014
            L ALH+A++    +    L+  ++ AD+ +K      T    T +HIA+  G++ V  +L+  GA ++  ++ G TPL++AA+  +  +VK LLD GA I+  T D  TPL  A + GHE+ + +LL +   + +   +    L PLH+AT+ +    V LLL      QA +   +L+  T LHVAA+    +V +LLL+ G   +  + N  T LH+A K  R K++++LL+  A++  +T  G+ P+H A+  GH ++  LL+++ A+ N     G  PLHM ++    E+V+  + Q+   V   + +  TPLHI+S     E+ + L++ G++ N    +G   L+ A+++ H +   +L+ N   I   T+ GFT LHIAS  G   +A  L+E     D   +   T LH+AT ++H  + + L + G S     K G T L +A K                                   H  +V  L+ + AS+S++   GLTA+H A    + N   IL  +  D+N                  I++  F+L   +R  +N  T+NG + LH AA  G   +V+ LL   A  N ++ NG T L IA +
Sbjct:  172 LPALHIAARKDDTNAAALLLQHEHNADVTSKMMLNQTTESGFTPLHIAAHYGNMNVATLLLNLGAAVDFTARNGITPLHVAAKRGNNNMVKLLLDRGAKIDTKTRDGLTPLHCAARSGHEKVIEMLLERDAPILAKTKNG---LSPLHMATQGEHLACVQLLL----GRQAPVDDVTLDYLTPLHVAAHCGHYRVAKLLLDRGGEPNARALNGFTPLHIACKKNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLL-QSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFASREGHGDVASLLLENGADISPVTKKGFTPLHIASKYGRLEVATLLLEKYASADPKGKNGLTPLHVATHYDHQKVALLLLDKGASPHSTAKNGYTPLHIAAKKNQLEVGKVLLELGAETNMLTQQGVAPLHLAAQEGHADMVALLLGRHASISLATKGGLTAMHLAAQEDKVNVAEILTKHKADVNTTTKLCYTPLHVASHYGNIKMVNFLLR--NRALVNAKTRNGYTPLHQAAQQGHTHVVNALLQHEASPNELTANGNTALAIARR 782          

HSP 3 Score: 234.187 bits (596), Expect = 1.729e-63
Identity = 137/380 (36.05%), Postives = 217/380 (57.11%), Query Frame = 2
Query:  257 GYFSKVQEALNSNIDVNSCNSNGLNALHLASKGGHADIVQFLIDNGADIGAKTRKNNTAIHIASLAGSLEVVKILVKHGANINEQSQTGFTPLYMAAQENHVGVVKFLLDNGADINLSTTDNFTPLAVAIQQGHEETVSILLNKSNFLNSNDISNDIKLPPLHIATRKDDYHAVLLLLHHQEDVQAALTQASLNGFTALHVAAYYNSDKVGRLLLENGAPVDYTSKNNVTALHVAAKWGRNKMVKVLLEFNANVEMSTRDGIRPLHCAASQGHRDICALLIEHKANCNTRTKNGLVPLHMVAQGNHSELVEFFINQNSVNVNETSLDFLTPLHISSHCNNVEVAEALIKHGANVNDRALNGFVALHIAAKQNHVEFVEML 1396
            G+ + VQ  L +    N+ N  G   LH+AS+ G  ++V+ L+ +GA +G K R++ T +HIAS  G  E+V++L++ G++ N  + +G TPLY A++E H  V   LL+NGADI+  T   FTPL +A + G  E  ++LL K     S D      L PLH+AT  D     LLLL    D  A+    + NG+T LH+AA  N  +VG++LLE GA  +  ++  V  LH+AA+ G   MV +LL  +A++ ++T+ G+  +H AA +   ++  +L +HKA+ NT TK    PLH+ +   + ++V F + +N   VN  + +  TPLH ++   +  V  AL++H A+ N+   NG  AL IA +  ++  V+ L
Sbjct:  421 GHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFASREGHGDVASLLLENGADISPVTKKGFTPLHIASKYGRLEVATLLLEK---YASADPKGKNGLTPLHVATHYDHQKVALLLL----DKGASPHSTAKNGYTPLHIAAKKNQLEVGKVLLELGAETNMLTQQGVAPLHLAAQEGHADMVALLLGRHASISLATKGGLTAMHLAAQEDKVNVAEILTKHKADVNTTTKLCYTPLHVASHYGNIKMVNFLL-RNRALVNAKTRNGYTPLHQAAQQGHTHVVNALLQHEASPNELTANGNTALAIARRLGYISVVDTL 792          

HSP 4 Score: 231.876 bits (590), Expect = 1.005e-62
Identity = 159/548 (29.01%), Postives = 276/548 (50.36%), Query Frame = 2
Query:  245 AAHNGYFSKVQEALNSNIDVNSCNSNGLNALHLASKGGHADIVQFLIDNGADIGAKTRKNNTAIHIASLAGSLEVVKILVKHGANINEQSQTGFTPLYMAAQENHVGVVKFLLDNGADINLSTTDNFTPLAVAIQQGHEETVSILLNKSNFLNSNDISNDIKLPPLHIATRKDDYHAVLLLLHHQEDVQAALTQASLNGFTALHVAAYYNSDKVGRLLLENGAPVDYTSKNNVTALHVAAKWGRNKMVKVLLEFNANVEMSTRD---------------------------------GIRPLHCAASQGHRDICALLIEHKANCNTRTKNGLVPLHMVAQGNHSELVEFFINQNSVNVNETSLDFLTPLHISSHCNNVEVAEALIKHGANVNDRALNGFVALHIAAKQNHVEFVEMLMSNLCMIDTQTESGFTALHIASIIGSESIAKKLVENNCEIDIPDQFDRTSLHMATIFNHFNIVVYLKEHGGSVDKQMKTGETCLMLAIKSEHKAIVEYLINQGASMSVSDSWGLTALHWATLVVRENILNS 1789
            AAH G  +     LN    V+    NG+  LH+A+K G+ ++V+ L+D GA I  KTR   T +H A+ +G  +V+++L++  A I  +++ G +PL+MA Q  H+  V+ LL   A ++  T D  TPL VA   GH     +LL++    N+  ++      PLHIA +K+    + LLL H     A++   + +G T +HVA++     V +LLL+NGA  + T+    T LH+A++ G+ ++VK LL+  A V +  R+                                 G  PL+ A+ +GH D+ +LL+E+ A+ +  TK G  PLH+ ++    E+    + +   + +    + LTPLH+++H ++ +VA  L+  GA+ +  A NG+  LHIAAK+N +E  ++L+      +  T+ G   LH+A+  G   +   L+  +  I +  +   T++H+A   +  N+   L +H   V+   K   T L +A    +  +V +L+   A ++     G T LH A      +++N+
Sbjct:  219 AAHYGNMNVATLLLNLGAAVDFTARNGITPLHVAAKRGNNNMVKLLLDRGAKIDTKTRDGLTPLHCAARSGHEKVIEMLLERDAPILAKTKNGLSPLHMATQGEHLACVQLLLGRQAPVDDVTLDYLTPLHVAAHCGHYRVAKLLLDRGGEPNARALNG---FTPLHIACKKNRIKVMELLLKHG----ASIHTTTESGLTPIHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFASREGHGDVASLLLENGADISPVTKKGFTPLHIASKYGRLEVATLLL-EKYASADPKGKNGLTPLHVATHYDHQKVALLLLDKGASPHSTAKNGYTPLHIAAKKNQLEVGKVLLELGAETNMLTQQGVAPLHLAAQEGHADMVALLLGRHASISLATKGGLTAMHLAAQEDKVNVAEILTKHKADVNTTTKLCYTPLHVASHYGNIKMVNFLLRNRALVNAKTRNGYTPLHQAAQQGHTHVVNA 758          

HSP 5 Score: 229.565 bits (584), Expect = 5.090e-62
Identity = 145/504 (28.77%), Postives = 261/504 (51.79%), Query Frame = 2
Query:  245 AAHNGYFSKVQEALNSNIDVNSCNSNGLNALHLASKGGHADIVQFLIDNGADIGAKTRKNNTAIHIASLAGSLEVVKILVKHGANINEQSQTGFTPLYMAAQENHVGVVKFLLDNGADINLSTTDNFTPLAVAIQQGHEETVSILLNKSNFLNSNDISNDIKLPPLHIATRKDDYHAVLLLLHHQEDVQAALTQASLNGFTALHVAAYYNSDKVGRLLLENGAPVDYTSKNNVTALHVAAKWGRNKMVKVLLEFNANVEMSTRDGIRPLHCAASQGHRDICALLIEHKANCNTRTKNGLVPLHMVAQGNHSELVEFFINQNSVNVNETSLDFLTPLHISSHCNNVEVAEALIKHGANVNDRALNGFVALHIAAKQNHVEFVEMLMSNLCMIDTQTESGFTALHIASIIGSESIAKKLVENNCEIDIPDQFDRTSLHMATIFNHFNIVVYLKEHGGSVDKQMKTGETCLMLAIKSEHKAIVEYLINQGASMSVSDSWGLTALHWA 1756
            AA +G+   ++  L  +  + +   NGL+ LH+A++G H   VQ L+   A +   T    T +H+A+  G   V K+L+  G   N ++  GFTPL++A ++N + V++ LL +GA I+ +T    TP+ VA   GH   V +LL      N+ ++  +    PLH+A+R      V  LL     V     +      T LH+A+     ++ +LLL+ G+  +  + +  T L+ A++ G   +  +LLE  A++   T+ G  PLH A+  G  ++  LL+E  A+ + + KNGL PLH+    +H ++    +++ + + + T+ +  TPLHI++  N +EV + L++ GA  N     G   LH+AA++ H + V +L+     I   T+ G TA+H+A+     ++A+ L ++  +++   +   T LH+A+ + +  +V +L  +   V+ + + G T L  A +  H  +V  L+   AS +   + G TAL  A
Sbjct:  285 AARSGHEKVIEMLLERDAPILAKTKNGLSPLHMATQGEHLACVQLLLGRQAPVDDVTLDYLTPLHVAAHCGHYRVAKLLLDRGGEPNARALNGFTPLHIACKKNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQNGASSNATNVRGET---PLHMASRAGQLEVVKTLLQSGARVGVKAREDQ----TPLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFASREGHGDVASLLLENGADISPVTKKGFTPLHIASKYGRLEVATLLLEKYASADPKGKNGLTPLHVATHYDHQKVALLLLDKGA-SPHSTAKNGYTPLHIAAKKNQLEVGKVLLELGAETNMLTQQGVAPLHLAAQEGHADMVALLLGRHASISLATKGGLTAMHLAAQEDKVNVAEILTKHKADVNTTTKLCYTPLHVASHYGNIKMVNFLLRNRALVNAKTRNGYTPLHQAAQQGHTHVVNALLQHEASPNELTANGNTALAIA 780          
BLAST of Ankyrin-2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000095.1 (pep scaffold:Pmarinus_7.0:GL477582:20897:60453:1 gene:ENSPMAG00000000080.1 transcript:ENSPMAT00000000095.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 496.893 bits (1278), Expect = 2.645e-153
Identity = 287/729 (39.37%), Postives = 424/729 (58.16%), Query Frame = 2
Query:  236 FLRAAHNGYFSKVQEALNSNIDVNSCNSNGLNALHLASKGGHADIVQFLIDNGADIGAKTRKNNTAIHIASLAGSLEVVKILVKHGANINEQSQTGFTPLYMAAQENHVGVVKFLLDNGADINLSTTDNFTPLAVAIQQGHEETVSILLNKSNFLNSNDISNDIKLPPLHIATRKDDYHAVLLLLHHQEDVQAALTQASLNGFTALHVAAYYNSDKVGRLLLENGAPVDYTSKNNVTALHVAAKWGRNKMVKVLLEFNANVEMSTRDGIRPLHCAASQGHRDICALLIEHKANCNTRTKNGLVPLHMVAQGNHSELVEFFINQNSVNVNETSLDFLTPLHISSHCNNVEVAEALIKHGANVNDRALNGFVALHIAAKQNHVEFVEMLMSNLCMIDTQTESGFTALHIASIIGSESIAKKLVENNCEIDIPDQFDRTSLHMATIFNHFNIVVYLKEHGGSVDKQMKTGETCLMLAIKSEHKAIVEYLINQGASMSVSDSWGLTALHWATLVVRENILNSNCTDININEAIEIFKFVLDGCSRFDINRTTKNGISSLHLAADCGCLEIVHLLLDK--GADINIISINGTTPLHIACKXXXXXXXXXXXXXXXXXXXTMAYVSCPWSPMHFSSYFGSVDSTILLISHENDQTSVREKLRQRTPNGNTCLHLAVQQLQTDIVRVLLENDADFNLENEDGLSAFDMAKIVDDETIINLLGIDTTEMMTTDDKVY 2416
            FLRAA NG   ++ + L   +D+N+CN NGLNALHLASK GH D+V  L+   A+I   T+  NTA+HIA+LAG  ++V++LV+ GANIN QSQ GFTPLYMAAQENH+ +VKFLLDNGA+ +++T D FTPLAVA+QQGHE+ V +LL        +D    ++LP LHIA RKDD +A  LLL H+ +        S +GFT LH+AA+Y +  V  LLL  GA VD+T++N +T LHVAAK G N MVK+LL+  A ++  TRDG+ PLHCAA  GH  +  +L+E  A    +TKNGL PLHM  QG H   V+  + + +  V++ +LD+LTPLH+++HC +  VA+ L+  G   N RALNGF  LHIA K+N ++ +E+L+ +   I T TESG T +H+AS +G  ++ + L++N    +  +    T LHMA+      +V  L + G  V  + +  +T L +A +     IV+ L+ +G+  +   + G T L++A+   RE                ++   +L+  +  DI+  TK G + LH+A+  G LE+  LLL+K   AD  +   NG TPLH+A   ++  V L+LL+  +    T       ++P+H ++    ++   +L+        +  +    T  G   LHLA Q+   D+V +LL   A  +L  + GL+A  +A   D   +  +L     ++ TT    Y
Sbjct:   15 FLRAARNGNLERLMDHLKGGMDINTCNQNGLNALHLASKEGHVDVVTELLKREAEIDTATKVGNTALHIAALAGQTDIVRVLVEFGANINAQSQNGFTPLYMAAQENHLEIVKFLLDNGANQSVATEDGFTPLAVALQQGHEQVVGLLL-------ESDTKGKVRLPALHIAARKDDTNAAALLLQHEHNADV----TSKSGFTPLHIAAHYGNMNVATLLLNLGAAVDFTARNGITPLHVAAKRGNNNMVKLLLDRGAKIDTKTRDGLTPLHCAARSGHEKVIEMLLERDAPILAKTKNGLSPLHMATQGEHLACVQLLLGRQA-PVDDVTLDYLTPLHVAAHCGHYRVAKLLLDRGGEPNARALNGFTPLHIACKKNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFAS---REG-------------HGDVASLLLENGA--DISPVTKKGFTPLHIASKYGRLEVATLLLEKYASADPKVAGQNGLTPLHVATHYDHQKVALLLLDKGASPHST---AKNGYTPLHIAAKKNQLEVGKVLL-------ELGAETNMLTQQGVAPLHLAAQEGHADMVALLLGRHASISLATKGGLTAMHLAAQEDKVNVAEILTKHKADVNTTTKLCY 703          

HSP 2 Score: 256.144 bits (653), Expect = 4.794e-71
Identity = 183/615 (29.76%), Postives = 302/615 (49.11%), Query Frame = 2
Query:  326 LNALHLASKGGHADIVQFLIDNGADIGAKTRKNNTAIHIASLAGSLEVVKILVKHGANINEQSQTGFTPLYMAAQENHVGVVKFLLDNGADINLSTTDNFTPLAVAIQQGHEETVSILLNKSNFLNSNDISNDIKLPPLHIATRKDDYHAVLLLLHHQEDVQAALTQASLNGFTALHVAAYYNSDKVGRLLLENGAPVDYTSKNNVTALHVAAKWGRNKMVKVLLEFNANVEMSTRDGIRPLHCAASQGHRDICALLIEHKANCNTRTKNGLVPLHMVAQGNHSELVEFFINQNSVNVNETSLDFLTPLHISSHCNNVEVAEALIKHGANVNDRALNGFVALHIAAKQNHVEFVEMLMSNLCMIDTQTESGFTALHIASIIGSESIAKKLVENNCEID--IPDQFDRTSLHMATIFNHFNIVVYLKEHGGSVDKQMKTGETCLMLAIKSE---------------------------------HKAIVEYLINQGASMSVSDSWGLTALHWATLVVREN---ILNSNCTDININEA--------------IEIFKFVLDGCSRFDINRTTKNGISSLHLAADCGCLEIVHLLLDKGADINIISINGTTPLHIACK 2014
            L ALH+A++    +    L+ +  +    ++   T +HIA+  G++ V  +L+  GA ++  ++ G TPL++AA+  +  +VK LLD GA I+  T D  TPL  A + GHE+ + +LL +   + +   +    L PLH+AT+ +    V LLL      QA +   +L+  T LHVAA+    +V +LLL+ G   +  + N  T LH+A K  R K++++LL+  A++  +T  G+ P+H A+  GH ++  LL+++ A+ N     G  PLHM ++    E+V+  + Q+   V   + +  TPLHI+S     E+ + L++ G++ N    +G   L+ A+++ H +   +L+ N   I   T+ GFT LHIAS  G   +A  L+E     D  +  Q   T LH+AT ++H  + + L + G S     K G T L +A K                                   H  +V  L+ + AS+S++   GLTA+H A    + N   IL  +  D+N                  I++  F+L   +R  +N  T+NG + LH AA  G   +V+ LL   A  N ++ NG T L IA +
Sbjct:  173 LPALHIAARKDDTNAAALLLQHEHNADVTSKSGFTPLHIAAHYGNMNVATLLLNLGAAVDFTARNGITPLHVAAKRGNNNMVKLLLDRGAKIDTKTRDGLTPLHCAARSGHEKVIEMLLERDAPILAKTKNG---LSPLHMATQGEHLACVQLLL----GRQAPVDDVTLDYLTPLHVAAHCGHYRVAKLLLDRGGEPNARALNGFTPLHIACKKNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLL-QSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFASREGHGDVASLLLENGADISPVTKKGFTPLHIASKYGRLEVATLLLEKYASADPKVAGQNGLTPLHVATHYDHQKVALLLLDKGASPHSTAKNGYTPLHIAAKKNQLEVGKVLLELGAETNMLTQQGVAPLHLAAQEGHADMVALLLGRHASISLATKGGLTAMHLAAQEDKVNVAEILTKHKADVNTTTKLCYTPLHVASHYGNIKMVNFLLR--NRALVNAKTRNGYTPLHQAAQQGHTHVVNALLQHEASPNELTANGNTALAIARR 777          

HSP 3 Score: 232.261 bits (591), Expect = 3.584e-63
Identity = 135/380 (35.53%), Postives = 218/380 (57.37%), Query Frame = 2
Query:  257 GYFSKVQEALNSNIDVNSCNSNGLNALHLASKGGHADIVQFLIDNGADIGAKTRKNNTAIHIASLAGSLEVVKILVKHGANINEQSQTGFTPLYMAAQENHVGVVKFLLDNGADINLSTTDNFTPLAVAIQQGHEETVSILLNKSNFLNSNDISNDIKLPPLHIATRKDDYHAVLLLLHHQEDVQAALTQASLNGFTALHVAAYYNSDKVGRLLLENGAPVDYTSKNNVTALHVAAKWGRNKMVKVLLEFNANVEMSTRDGIRPLHCAASQGHRDICALLIEHKANCNTRTKNGLVPLHMVAQGNHSELVEFFINQNSVNVNETSLDFLTPLHISSHCNNVEVAEALIKHGANVNDRALNGFVALHIAAKQNHVEFVEML 1396
            G+ + VQ  L +    N+ N  G   LH+AS+ G  ++V+ L+ +GA +G K R++ T +HIAS  G  E+V++L++ G++ N  + +G TPLY A++E H  V   LL+NGADI+  T   FTPL +A + G  E  ++LL K    +   ++    L PLH+AT  D     LLLL    D  A+    + NG+T LH+AA  N  +VG++LLE GA  +  ++  V  LH+AA+ G   MV +LL  +A++ ++T+ G+  +H AA +   ++  +L +HKA+ NT TK    PLH+ +   + ++V F + +N   VN  + +  TPLH ++   +  V  AL++H A+ N+   NG  AL IA +  ++  V+ L
Sbjct:  414 GHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFASREGHGDVASLLLENGADISPVTKKGFTPLHIASKYGRLEVATLLLEKYASADPK-VAGQNGLTPLHVATHYDHQKVALLLL----DKGASPHSTAKNGYTPLHIAAKKNQLEVGKVLLELGAETNMLTQQGVAPLHLAAQEGHADMVALLLGRHASISLATKGGLTAMHLAAQEDKVNVAEILTKHKADVNTTTKLCYTPLHVASHYGNIKMVNFLL-RNRALVNAKTRNGYTPLHQAAQQGHTHVVNALLQHEASPNELTANGNTALAIARRLGYISVVDTL 787          

HSP 4 Score: 230.72 bits (587), Expect = 9.615e-63
Identity = 160/549 (29.14%), Postives = 276/549 (50.27%), Query Frame = 2
Query:  245 AAHNGYFSKVQEALNSNIDVNSCNSNGLNALHLASKGGHADIVQFLIDNGADIGAKTRKNNTAIHIASLAGSLEVVKILVKHGANINEQSQTGFTPLYMAAQENHVGVVKFLLDNGADINLSTTDNFTPLAVAIQQGHEETVSILLNKSNFLNSNDISNDIKLPPLHIATRKDDYHAVLLLLHHQEDVQAALTQASLNGFTALHVAAYYNSDKVGRLLLENGAPVDYTSKNNVTALHVAAKWGRNKMVKVLLEFNANVEMSTRD---------------------------------GIRPLHCAASQGHRDICALLIEHKANCNTRTKNGLVPLHMVAQGNHSELVEFFINQ-NSVNVNETSLDFLTPLHISSHCNNVEVAEALIKHGANVNDRALNGFVALHIAAKQNHVEFVEMLMSNLCMIDTQTESGFTALHIASIIGSESIAKKLVENNCEIDIPDQFDRTSLHMATIFNHFNIVVYLKEHGGSVDKQMKTGETCLMLAIKSEHKAIVEYLINQGASMSVSDSWGLTALHWATLVVRENILNS 1789
            AAH G  +     LN    V+    NG+  LH+A+K G+ ++V+ L+D GA I  KTR   T +H A+ +G  +V+++L++  A I  +++ G +PL+MA Q  H+  V+ LL   A ++  T D  TPL VA   GH     +LL++    N+  ++      PLHIA +K+    + LLL H     A++   + +G T +HVA++     V +LLL+NGA  + T+    T LH+A++ G+ ++VK LL+  A V +  R+                                 G  PL+ A+ +GH D+ +LL+E+ A+ +  TK G  PLH+ ++    E+    + +  S +      + LTPLH+++H ++ +VA  L+  GA+ +  A NG+  LHIAAK+N +E  ++L+      +  T+ G   LH+A+  G   +   L+  +  I +  +   T++H+A   +  N+   L +H   V+   K   T L +A    +  +V +L+   A ++     G T LH A      +++N+
Sbjct:  212 AAHYGNMNVATLLLNLGAAVDFTARNGITPLHVAAKRGNNNMVKLLLDRGAKIDTKTRDGLTPLHCAARSGHEKVIEMLLERDAPILAKTKNGLSPLHMATQGEHLACVQLLLGRQAPVDDVTLDYLTPLHVAAHCGHYRVAKLLLDRGGEPNARALNG---FTPLHIACKKNRIKVMELLLKHG----ASIHTTTESGLTPIHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFASREGHGDVASLLLENGADISPVTKKGFTPLHIASKYGRLEVATLLLEKYASADPKVAGQNGLTPLHVATHYDHQKVALLLLDKGASPHSTAKNGYTPLHIAAKKNQLEVGKVLLELGAETNMLTQQGVAPLHLAAQEGHADMVALLLGRHASISLATKGGLTAMHLAAQEDKVNVAEILTKHKADVNTTTKLCYTPLHVASHYGNIKMVNFLLRNRALVNAKTRNGYTPLHQAAQQGHTHVVNA 753          
BLAST of Ankyrin-2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007446.1 (pep scaffold:Pmarinus_7.0:GL478728:200023:240674:1 gene:ENSPMAG00000006704.1 transcript:ENSPMAT00000007446.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 294.278 bits (752), Expect = 4.218e-81
Identity = 238/844 (28.20%), Postives = 387/844 (45.85%), Query Frame = 2
Query: 1031 RDGIRPLHCAASQGHRDICALLIEHKANCNTRTKNGLVPLHMVAQGNHSELVEFFINQNSVNVNETSLDFLTPLHISSHCNNVEVAEALIKHGANVNDRALNGFVALHIAAKQNHVEFVEMLMSNLCMIDTQTESGFT---------------------------------ALHIASIIGSESIAKKLVENNCEIDIPDQFDRTSLHMATIFNHFNIVVYLKEHGGSVDKQMKTGETCLMLAIKSEHKAIVEYLINQGASMSVSDSWG---------------------------------LTALHWAT--------LVVRENILNSNCTDIN---------INEAIEIFKFVLDGCSRFDINRTTKNGISSLHLAADCGCLEIVHLLLDKGADINIISINGTTPLHIACKXXXXXXXXXXXXXXXXXXXTMAYVSCPWSPMHFSSYFGSVDSTILLISHENDQTSVREKLRQRTPNGNTCLHLAVQQLQTDIVRVLLENDADFNLENEDGLSAFDMAKIVDDETIINLLGIDTTEMMTT------DDKV----YLFQREEFSDEEQLETLYMDSLNEL---EFFGIGKNSGEKCE-LQLSI---MSLLDYATTIDSIRRADMSLKINNSLNR---YRNITLSEIKTRELLIA--AQPASMISTISSTNTEMSPFDVEKWDFHRVTDLPVNSGFLVSFLVDARGGYMQAQRMPQMKIFVPPDAAPAPTRIICHLLRPEGVANLPG---------------------------------MNDCDGFASRILQIHSSCSRFQKPILIEMPYIALLKSNDREIVILKKNADSDTWKKHSNTFTEETL 3148
            +DG+ PLHCAA  GH  +  +L+E  A    +TKNGL PLHM  QG+H E V+  + Q    V++ +LD+LT LH+++HC +   A+ L+  GAN N RALNGF  LHIA K+N +  +E+L+     I+  TESG T                                 ALH+A+  G   + + L+ N  ++D   + ++T LH+A       IV  L +H  S D     G T L +A +  H+ +   L+  GAS++V+   G                                 LT LH A+        L++ +   + + T  N           + +EI   +L+  +  + N  T+ G++ LHL A  G  ++  LLL + AD+N  + +G +PLH+A + +  NV  +L++  ++ + T       ++P+  + ++G++     L+ H  D  S       +T NG T LH A QQ  T IV +LL+  A  N    +G +A  +A+ +   ++++ L + T E +T+        +V     + +  E SD+E  +T+  D +  L   +   +G +S      L+ S    M   ++AT   S+R    S   + SL R    R  TL E  T    I   A P              S   +E  D   ++  P++SGFLVSF+VDARGG M+  R   ++I +PP    APTR+ C L++   +A LP                                  +ND +   SRILQ+    + F  P+++E+P+ A L+  +RE+V+L+   + +TW++H +  +EE L
Sbjct:    4 QDGLTPLHCAARSGHEQVVEILLEQGAPILAKTKNGLSPLHMATQGDHVECVQVLM-QYRAPVDDITLDYLTALHVAAHCGHYRTAKVLLDKGANPNVRALNGFTPLHIACKKNRIRVMELLLKYGASIEAVTESGLTPMHVSAFMGNLNIVLILLQGGASPNATNVRGETALHMAARAGQTEVVRSLLRNGAQVDAKAREEQTPLHIAARLGKLEIVQLLLQHMASPDAATSNGYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLHVASKYGKMEVASLLLQRFASPDAAGKNGLTPLHVASHYDNQKVALLLLDQGASPHATAKNGYTPLHIAAKKDQLEIATTLLEYGA--ETNAITRQGVAPLHLGAQEGHADVASLLLARYADVNHATKSGLSPLHLAAQEDKVNVAEILVKHGAHVNAT---TKLGYTPLIVACHYGNIKMVNFLLQHGADVNS-------KTKNGYTPLHQAAQQGHTHIVNLLLKCGARPNDVTVNGNTALAIARRLGYISVVDTLKVVTEETITSTTVSNPSSRVNVPETMTEVLEVSDDEGEDTMTGDGMEYLRAEDLRELGDDSLPSSHFLEGSTGYSMGFGNWATRSGSLR--SFSSDRSYSLGRGPYSREATLIEEFTAATTITQLAAPKEEEEEKGVGGMPTSWAPIEILDNVALSSSPIHSGFLVSFMVDARGGSMRGCRHHGLRIVIPPRKCMAPTRVTCRLVKRHRLAALPPVLEGEGLASRVVEVGPSGGQFLGKLHLPNTPPPLNDGESLVSRILQLGPPGTTFLGPVIVEIPHFASLRGKERELVVLRSE-NGETWREHQSECSEEEL 831          

HSP 2 Score: 254.988 bits (650), Expect = 1.217e-68
Identity = 158/513 (30.80%), Postives = 271/513 (52.83%), Query Frame = 2
Query:  320 NGLNALHLASKGGHADIVQFLIDNGADIGAKTRKNNTAIHIASLAGSLEVVKILVKHGANINEQSQTGFTPLYMAAQENHVGVVKFLLDNGADINLSTTDNFTPLAVAIQQGHEETVSILLNKSNFLNSNDISNDIKLPPLHIATRKDDYHAVLLLLHHQEDVQAALTQASLNGFTALHVAAYYNSDKVGRLLLENGAPVDYTSKNNVTALHVAAKWGRNKMVKVLLEFNANVEMSTRDGIRPLHCAASQGHRDICALLIEHKANCNTRTKNGLVPLHMVAQGNHSELVEFFINQNSVNVNETSLDFLTPLHISSHCNNVEVAEALIKHGANVNDRALNGFVALHIAAKQNHVEFVEMLMSNLCMIDTQTESGFTALHIASIIGSESIAKKLVENNCEIDIPDQFDRTSLHMATIFNHFNIVVYLKEHGGSVDKQMKTGETCLMLAIKSEHKAIVEYLINQGASMSVSDSWGLTALHWATLVVRENILN--------SNCTDININEAIEIFK 1834
            +GL  LH A++ GH  +V+ L++ GA I AKT+   + +H+A+    +E V++L+++ A +++ +    T L++AA   H    K LLD GA+ N+   + FTPL +A ++     + +LL    +  S +   +  L P+H++    + + VL+LL       A+    ++ G TALH+AA     +V R LL NGA VD  ++   T LH+AA+ G+ ++V++LL+  A+ + +T +G  PLH AA +GH D+ A+L+EH A+    TK G  PLH+ ++    E+    + Q   + +    + LTPLH++SH +N +VA  L+  GA+ +  A NG+  LHIAAK++ +E    L+      +  T  G   LH+ +  G   +A  L+    +++   +   + LH+A   +  N+   L +HG  V+   K G T L++A    +  +V +L+  GA ++     G T LH A      +I+N         N   +N N A+ I +
Sbjct:    5 DGLTPLHCAARSGHEQVVEILLEQGAPILAKTKNGLSPLHMATQGDHVECVQVLMQYRAPVDDITLDYLTALHVAAHCGHYRTAKVLLDKGANPNVRALNGFTPLHIACKKNRIRVMELLLK---YGASIEAVTESGLTPMHVSAFMGNLNIVLILLQGG----ASPNATNVRGETALHMAARAGQTEVVRSLLRNGAQVDAKAREEQTPLHIAARLGKLEIVQLLLQHMASPDAATSNGYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLHVASKYGKMEVASLLL-QRFASPDAAGKNGLTPLHVASHYDNQKVALLLLDQGASPHATAKNGYTPLHIAAKKDQLEIATTLLEYGAETNAITRQGVAPLHLGAQEGHADVASLLLARYADVNHATKSGLSPLHLAAQEDKVNVAEILVKHGAHVNATTKLGYTPLIVACHYGNIKMVNFLLQHGADVNSKTKNGYTPLHQAAQQGHTHIVNLLLKCGARPNDVTVNGNTALAIAR 509          

HSP 3 Score: 242.662 bits (618), Expect = 8.513e-65
Identity = 147/488 (30.12%), Postives = 258/488 (52.87%), Query Frame = 2
Query:  245 AAHNGYFSKVQEALNSNIDVNSCNSNGLNALHLASKGGHADIVQFLIDNGADIGAKTRKNNTAIHIASLAGSLEVVKILVKHGANINEQSQTGFTPLYMAAQENHVGVVKFLLDNGADINLSTTDNFTPLAVAIQQGHEETVSILLNKSNFLNSNDISNDIKLPPLHIATRKDDYHAVLLLLHHQEDVQAALTQASLNGFTALHVAAYYNSDKVGRLLLENGAPVDYTSKNNVTALHVAAKWGRNKMVKVLLEFNANVEMSTRDGIRPLHCAASQGHRDICALLIEHKANCNTRTKNGLVPLHMVAQGNHSELVEFFINQNSVNVNETSLDFLTPLHISSHCNNVEVAEALIKHGANVNDRALNGFVALHIAAKQNHVEFVEMLMSNLCMIDTQTESGFTALHIASIIGSESIAKKLVENNCEIDIPDQFDRTSLHMATIFNHFNIVVYLKEHGGSVDKQMKTGETCLMLAIKSEHKAIVEYLINQGA 1708
            AA +G+   V+  L     + +   NGL+ LH+A++G H + VQ L+   A +   T    TA+H+A+  G     K+L+  GAN N ++  GFTPL++A ++N + V++ LL  GA I   T    TP+ V+   G+   V ILL      N+ ++  +     LH+A R      V  LL +   V A   +      T LH+AA     ++ +LLL++ A  D  + N  T LHVAA+ G   +  +LLE  A++ ++T+ G  PLH A+  G  ++ +LL++  A+ +   KNGL PLH+ +  ++ ++    ++Q + + + T+ +  TPLHI++  + +E+A  L+++GA  N     G   LH+ A++ H +   +L++    ++  T+SG + LH+A+     ++A+ LV++   ++   +   T L +A  + +  +V +L +HG  V+ + K G T L  A +  H  IV  L+  GA
Sbjct:   13 AARSGHEQVVEILLEQGAPILAKTKNGLSPLHMATQGDHVECVQVLMQYRAPVDDITLDYLTALHVAAHCGHYRTAKVLLDKGANPNVRALNGFTPLHIACKKNRIRVMELLLKYGASIEAVTESGLTPMHVSAFMGNLNIVLILLQGGASPNATNVRGETA---LHMAARAGQTEVVRSLLRNGAQVDAKAREEQ----TPLHIAARLGKLEIVQLLLQHMASPDAATSNGYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLHVASKYGKMEVASLLLQRFASPDAAGKNGLTPLHVASHYDNQKVALLLLDQGA-SPHATAKNGYTPLHIAAKKDQLEIATTLLEYGAETNAITRQGVAPLHLGAQEGHADVASLLLARYADVNHATKSGLSPLHLAAQEDKVNVAEILVKHGAHVNATTKLGYTPLIVACHYGNIKMVNFLLQHGADVNSKTKNGYTPLHQAAQQGHTHIVNLLLKCGA 492          

HSP 4 Score: 224.172 bits (570), Expect = 4.645e-59
Identity = 127/371 (34.23%), Postives = 207/371 (55.80%), Query Frame = 2
Query:  284 LNSNIDVNSCNSNGLNALHLASKGGHADIVQFLIDNGADIGAKTRKNNTAIHIASLAGSLEVVKILVKHGANINEQSQTGFTPLYMAAQENHVGVVKFLLDNGADINLSTTDNFTPLAVAIQQGHEETVSILLNKSNFLNSNDISNDIKLPPLHIATRKDDYHAVLLLLHHQEDVQAALTQASLNGFTALHVAAYYNSDKVGRLLLENGAPVDYTSKNNVTALHVAAKWGRNKMVKVLLEFNANVEMSTRDGIRPLHCAASQGHRDICALLIEHKANCNTRTKNGLVPLHMVAQGNHSELVEFFINQNSVNVNETSLDFLTPLHISSHCNNVEVAEALIKHGANVNDRALNGFVALHIAAKQNHVEFVEML 1396
            L      N+ N  G  ALH+A++ G  ++V+ L+ NGA + AK R+  T +HIA+  G LE+V++L++H A+ +  +  G+TPL++AA+E H  V   LL++GA + ++T   FTPL VA + G  E  S+LL +     S D +    L PLH+A+  D+    LLLL    D  A+    + NG+T LH+AA  +  ++   LLE GA  +  ++  V  LH+ A+ G   +  +LL   A+V  +T+ G+ PLH AA +   ++  +L++H A+ N  TK G  PL +     + ++V F + Q+  +VN  + +  TPLH ++   +  +   L+K GA  ND  +NG  AL IA +  ++  V+ L
Sbjct:  158 LQGGASPNATNVRGETALHMAARAGQTEVVRSLLRNGAQVDAKAREEQTPLHIAARLGKLEIVQLLLQHMASPDAATSNGYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLHVASKYGKMEVASLLLQR---FASPDAAGKNGLTPLHVASHYDNQKVALLLL----DQGASPHATAKNGYTPLHIAAKKDQLEIATTLLEYGAETNAITRQGVAPLHLGAQEGHADVASLLLARYADVNHATKSGLSPLHLAAQEDKVNVAEILVKHGAHVNATTKLGYTPLIVACHYGNIKMVNFLL-QHGADVNSKTKNGYTPLHQAAQQGHTHIVNLLLKCGARPNDVTVNGNTALAIARRLGYISVVDTL 520          

HSP 5 Score: 112.079 bits (279), Expect = 1.053e-24
Identity = 54/161 (33.54%), Postives = 90/161 (55.90%), Query Frame = 2
Query: 3593 WEDVTSSTELVLLENTNCMAHSTKISARVWLIYAPNVPNISELANKIYALHCPTPYVGKFLSYARRHDQEECQIRCLLITDDTPDKTLECQESFELIATGPEVEVINKLQYQIECAGNIVAVTKSDEAILFPVQSFVENRITLPIRVRNQDEPFQGKIAFI 4075
            WED+T +T L   +   C++ +T +SAR WLI             ++Y      PY+ KF+ +A+ HD  E ++RC  +TDD  DKTLE QE+F  +A   +VEV+      +EC GN+V +TK+ +       +F ENR+   +++R+ ++   G++ F+
Sbjct:  971 WEDITGTTPLTFTKQ--CVSFTTNVSARFWLIDCRQTHEAVNFTTQMYRELVCVPYMAKFVVFAKTHDPVEARLRCFCMTDDKVDKTLEQQENFSEMARSRDVEVLEGKPIYVECFGNLVPLTKAGQQHALSFYAFRENRLPFMVKIRDSNQEACGRLCFM 1129          
BLAST of Ankyrin-2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007449.1 (pep scaffold:Pmarinus_7.0:GL478728:201453:233342:1 gene:ENSPMAG00000006704.1 transcript:ENSPMAT00000007449.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 288.115 bits (736), Expect = 2.165e-80
Identity = 217/773 (28.07%), Postives = 370/773 (47.87%), Query Frame = 2
Query:  896 LLENGAPVDYTSKNNVTALHVAAKWGRNKMVKVLLEFNANVEMSTRDGIRPLHCAASQGHRDICALLIEHKANCNTRTKNGLVPLHMVAQGNHSELVEFFINQNSVNVNETSLDFLTPLHISSHCNNVEVAEALIKHGANVNDRALNGFVALHIAAKQNHVEFVEMLMSNLCMIDTQTESGFTALHIASIIGSESIAKKLVENNCEIDIPDQFDRTSLHMATIFNHFNIVVYLKEHGGSVDKQMKTGETCLMLAIKSEHKAIVEYLINQGASMSVSDSWGLTALHWATLVVRENILNSNCTDININEAIEIFKFVLDGCSRF-DINRTTKNGISSLHLAADCGCLEIVHLLLDKGADINIISINGTTPLHIACKXXXXXXXXXXXXXXXXXXXTMAYVSCPWSPMHFSSYFGSVDSTILLISHENDQTSVREKLRQRTPNGNTCLHLAVQQLQTDIVRVLLENDADFNLENEDGLSAFDMAKIVDDETIINLLGIDTTEMMTTDDKVYLFQRE---------EFSDEEQLETLYMDSLNEL---EFFGIGKNSGEKCE-LQLSI---MSLLDYATTIDSIRRADMSLKINNSLNR---YRNITLSEIKTRELLIA--AQPASMISTISSTNTEMSPFDVEKWDFHRVTDLPVNSGFLVSFLVDARGGYMQAQRMPQMKIFVPPDAAPAPTRIICHLLRPEGVANLPGMNDCDGFASRILQIHSSCSRFQKPILIEMPYIALLKSNDREIVILKKNADSDTWKKHSNTFTEETL 3148
            LL+ GA  +  + N  T LH+A K  R +++++LL++ A++E  T  G+ P+H +A  G+ +I  +L++  A+ N     G   LHM A+   +E+V   + +N   V+  + +  TPLHI++    +E+ + L++H A+ +    NG+  LH+AA++ H +   +L+ +   +   T+ GFT LH+AS  G   +A  L++     D   +   T LH+A+ +++  + + L + G S     K G T L +A K +   I   L+  GA  +     G+  LH   L  +E                ++   +L   +R+ D+N  TK+G+S LHLAA    + +  +L+  GA +N  +  G TPL +AC                                    ++G++     L+ H  D  S       +T NG T LH A QQ  T IV +LL+  A  N    +G +A  +A+ +   ++++ L + T E +T+        R          E SD+E  +T+  D +  L   +   +G +S      L+ S    M   ++AT   S+R    S   + SL R    R  TL E  T    I   A P              S   +E  D   ++  P++SGFLVSF+VDARGG M+  R   ++I +PP    APTR+ C L++   +A LP + + +G ASR++++  S  +F  P+++E+P+ A L+  +RE+V+L+   + +TW++H +  +EE L
Sbjct:    1 LLDKGANPNVRALNGFTPLHIACKKNRIRVMELLLKYGASIEAVTESGLTPMHVSAFMGNLNIVLILLQGGASPNATNVRGETALHMAARAGQTEVVRSLL-RNGAQVDAKAREEQTPLHIAARLGKLEIVQLLLQHMASPDAATSNGYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLHVASKYGKMEVASLLLQRFASPDAAGKNGLTPLHVASHYDNQKVALLLLDQGASPHATAKNGYTPLHIAAKKDQLEIATTLLEYGAETNAITRQGVAPLH---LGAQEG-------------HADVASLLL---ARYADVNHATKSGLSPLHLAAQEDKVNVAEILVKHGAHVNATTKLGYTPLIVAC------------------------------------HYGNIKMVNFLLQHGADVNS-------KTKNGYTPLHQAAQQGHTHIVNLLLKCGARPNDVTVNGNTALAIARRLGYISVVDTLKVVTEETITSTTVSNPSSRNVPETMTEVLEVSDDEGEDTMTGDGMEYLRAEDLRELGDDSLPSSHFLEGSTGYSMGFGNWATRSGSLR--SFSSDRSYSLGRGPYSREATLIEEFTAATTITQLAAPKEEEEEKGVGGMPTSWAPIEILDNVALSSSPIHSGFLVSFMVDARGGSMRGCRHHGLRIVIPPRKCMAPTRVTCRLVKRHRLAALPPVLEGEGLASRVVEVGPSGGQFLGPVIVEIPHFASLRGKERELVVLRSE-NGETWREHQSECSEEEL 707          

HSP 2 Score: 243.817 bits (621), Expect = 5.596e-66
Identity = 140/404 (34.65%), Postives = 227/404 (56.19%), Query Frame = 2
Query:  284 LNSNIDVNSCNSNGLNALHLASKGGHADIVQFLIDNGADIGAKTRKNNTAIHIASLAGSLEVVKILVKHGANINEQSQTGFTPLYMAAQENHVGVVKFLLDNGADINLSTTDNFTPLAVAIQQGHEETVSILLNKSNFLNSNDISNDIKLPPLHIATRKDDYHAVLLLLHHQEDVQAALTQASLNGFTALHVAAYYNSDKVGRLLLENGAPVDYTSKNNVTALHVAAKWGRNKMVKVLLEFNANVEMSTRDGIRPLHCAASQGHRDICALLIEHKANCNTRTKNGLVPLHMVAQGNHSELVEFFINQNSVNVNETSLDFLTPLHISSHCNNVEVAEALIKHGANVNDRALNGFVALHIAAKQNHVEFVEMLMSNLCMIDTQTESGFTALHIASIIGSESIAKKL 1495
            L     + +   +GL  +H+++  G+ +IV  L+  GA   A   +  TA+H+A+ AG  EVV+ L+++GA ++ +++   TPL++AA+   + +V+ LL + A  + +T++ +TPL VA ++GHE+  +ILL     L    ++      PLH+A++        LLL       A    A  NG T LHVA++Y++ KV  LLL+ GA    T+KN  T LH+AAK  + ++   LLE+ A     TR G+ PLH  A +GH D+ +LL+   A+ N  TK+GL PLH+ AQ +   + E  + ++  +VN T+    TPL ++ H  N+++   L++HGA+VN +  NG+  LH AA+Q H   V +L+      +  T +G TAL IA  +G  S+   L
Sbjct:   35 LKYGASIEAVTESGLTPMHVSAFMGNLNIVLILLQGGASPNATNVRGETALHMAARAGQTEVVRSLLRNGAQVDAKAREEQTPLHIAARLGKLEIVQLLLQHMASPDAATSNGYTPLHVAAREGHEDVTAILLEHGASL---AVTTKKGFTPLHVASKYGKMEVASLLLQRFASPDA----AGKNGLTPLHVASHYDNQKVALLLLDQGASPHATAKNGYTPLHIAAKKDQLEIATTLLEYGAETNAITRQGVAPLHLGAQEGHADVASLLLARYADVNHATKSGLSPLHLAAQEDKVNVAEILV-KHGAHVNATTKLGYTPLIVACHYGNIKMVNFLLQHGADVNSKTKNGYTPLHQAAQQGHTHIVNLLLKCGARPNDVTVNGNTALAIARRLGYISVVDTL 430          

HSP 3 Score: 150.599 bits (379), Expect = 1.268e-36
Identity = 110/409 (26.89%), Postives = 181/409 (44.25%), Query Frame = 2
Query:  830 SLNGFTALHVAAYYNSDKVGRLLLENGAPVDYTSKNNV---------------------------------TALHVAAKWGRNKMVKVLLEFNANVEMSTRD---------------------------------GIRPLHCAASQGHRDICALLIEHKANCNTRTKNGLVPLHMVAQGNHSELVEFFINQNSVNVNETSLDFLTPLHISSHCNNVEVAEALIKHGANVNDRALNGFVALHIAAKQNHVEFVEMLMSNLCMIDTQTESGFTALHIASIIGSESIAKKLVENNCEIDIPDQFDRTSLHMATIFNHFNIVVYLKEHGGSVDKQMKTGETCLMLAIKSEHKAIVEYLINQGASMSVSDSWGLTALHWATLVVRENILN--------SNCTDININEAIEIFK 1834
            +LNGFT LH+A   N  +V  LLL+ GA ++  +++ +                                 TALH+AA+ G+ ++V+ LL   A V+   R+                                 G  PLH AA +GH D+ A+L+EH A+    TK G  PLH+ ++    E+    + Q   + +    + LTPLH++SH +N +VA  L+  GA+ +  A NG+  LHIAAK++ +E    L+      +  T  G   LH+ +  G   +A  L+    +++   +   + LH+A   +  N+   L +HG  V+   K G T L++A    +  +V +L+  GA ++     G T LH A      +I+N         N   +N N A+ I +
Sbjct:   12 ALNGFTPLHIACKKNRIRVMELLLKYGASIEAVTESGLTPMHVSAFMGNLNIVLILLQGGASPNATNVRGETALHMAARAGQTEVVRSLLRNGAQVDAKAREEQTPLHIAARLGKLEIVQLLLQHMASPDAATSNGYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLHVASKYGKMEVASLLL-QRFASPDAAGKNGLTPLHVASHYDNQKVALLLLDQGASPHATAKNGYTPLHIAAKKDQLEIATTLLEYGAETNAITRQGVAPLHLGAQEGHADVASLLLARYADVNHATKSGLSPLHLAAQEDKVNVAEILVKHGAHVNATTKLGYTPLIVACHYGNIKMVNFLLQHGADVNSKTKNGYTPLHQAAQQGHTHIVNLLLKCGARPNDVTVNGNTALAIAR 419          

HSP 4 Score: 112.464 bits (280), Expect = 7.080e-25
Identity = 54/162 (33.33%), Postives = 90/162 (55.56%), Query Frame = 2
Query: 3590 DWEDVTSSTELVLLENTNCMAHSTKISARVWLIYAPNVPNISELANKIYALHCPTPYVGKFLSYARRHDQEECQIRCLLITDDTPDKTLECQESFELIATGPEVEVINKLQYQIECAGNIVAVTKSDEAILFPVQSFVENRITLPIRVRNQDEPFQGKIAFI 4075
             WED+T +T L   +   C++ +T +SAR WLI             ++Y      PY+ KF+ +A+ HD  E ++RC  +TDD  DKTLE QE+F  +A   +VEV+      +EC GN+V +TK+ +       +F ENR+   +++R+ ++   G++ F+
Sbjct:  846 QWEDITGTTPLTFTKQ--CVSFTTNVSARFWLIDCRQTHEAVNFTTQMYRELVCVPYMAKFVVFAKTHDPVEARLRCFCMTDDKVDKTLEQQENFSEMARSRDVEVLEGKPIYVECFGNLVPLTKAGQQHALSFYAFRENRLPFMVKIRDSNQEACGRLCFM 1005          
BLAST of Ankyrin-2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006531.1 (pep scaffold:Pmarinus_7.0:GL477280:1359:33855:1 gene:ENSPMAG00000005898.1 transcript:ENSPMAT00000006531.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 232.646 bits (592), Expect = 3.871e-61
Identity = 133/397 (33.50%), Postives = 228/397 (57.43%), Query Frame = 2
Query: 2945 PGMNDCDGFASRILQIHSSCSRFQKPILIEMPYIALLKSNDREIVILKKNADSDTWKKHSNTFTEETLKAEFGSLYESITPVDQLESNRICRIITTDVPTYFSLISQFQRDVNMIGPDGGYIESKTDKRIKLTFPQGALMKKIQIGLEVQHVDPGIINHVVGDNHKISLSPIITVEPKRRKFRDLIEIQMGLPKGVTK----------NDIQD--------LKLLFSISEYIT--DWEDVTSSTELVLLENTNCMAHSTKISARVWLIYAPNVPNISELANKIYALHCPTPYVGKFLSYARRHDQEECQIRCLLITDDTPDKTLECQESFELIATGPEVEVINKLQYQIECAGNIVAVTKSDEAILFPVQSFVENRITLPIRVRNQDEPFQGKIAFI 4075
            P +N+ +   SR+LQ+    + F  P+L+E+P+ A L+  +RE+V+L+ + D  TWK+H N    + L      + E +  +++LE  RICRI+T D P YF+++S+ +++  ++GP+GG +       ++ +FPQGAL K+I++GL+   V   ++  V+G+  K + SPI+TVEP+RRKF   I + + +P+  +           N   +        L+LL SI+  I+   WED+T +T L +  +T  ++ +T +SAR WL+Y    P    LAN++Y      PY+  F+ +++  +  E ++RC  +TDD  DKTLE QE+F  +A   +VEV+      +EC GN+V +TKS +   F   +F ENR+   ++VR+  +   G++ F+
Sbjct:    9 PPLNEGESLVSRLLQLGPEGTSFIGPVLVEIPHFASLRGRERELVVLR-SGDGKTWKEHQNDCKNDDLNDVLNGMDEELDSLEELERKRICRIVTRDFPQYFAVVSRVRQESEVVGPEGGVLSCTVVPDVRASFPQGALTKRIKVGLQAHPVPEDMVRKVLGN--KAAFSPIVTVEPRRRKFHKPITMTIPVPQSTSAITAASADTRVNGFSETVPDTPPPLRLLCSITGGISPAHWEDITGTTPLTITTST--VSFTTNVSARFWLLYCRQPPEAVNLANRLYQEATCVPYLATFVVFSKAVEAVESRLRCFCMTDDRVDKTLEQQENFTEVARSRDVEVMEGKPIYVECFGNLVPLTKSGQQHSFNFYAFKENRLPFYVKVRDVTQEPCGRLCFM 400          
BLAST of Ankyrin-2 vs. Ensembl Yeast
Match: HOS4 (Subunit of the Set3 complex; complex is a meiotic-specific repressor of sporulation specific genes that contains deacetylase activity; potential Cdc28p substrate [Source:SGD;Acc:S000001374])

HSP 1 Score: 79.337 bits (194), Expect = 5.535e-15
Identity = 85/314 (27.07%), Postives = 133/314 (42.36%), Query Frame = 2
Query:  314 NSNGLNALHLASKGGHADIVQFLIDNGA-DIGAKTRKNNTAIHIASLAGSLEVVKILVKHGANINEQS--QTGFTPLYMAAQENHVGVVKFLLDNGADINLSTTDNFTPLAV-------------AIQQGHEETVSILLNKSNFLNSNDISND----------IKLPPLHIATR-KDDYHAVLLLLHHQEDVQAALTQASLNGFTALH-VAAYYNSDKVGRL-----LLENGAPVDYTSKNNVTALHVAAKWGRNKMVKVLLEFNANVEMSTRDG-IRPLHCAASQGHRDICALLIEHKANCNTRTKNGLVPLH 1153
            +S G   L +A   G  D+V+ +I+ G  DI  +    NTA+H A+L G +E+V++L+++GA++N +S    G TPL  A+   H+ VVK+LL NGAD  +      T                  I +  ++ +SI   K  + N   I ND          I  PP    T+ K++  A    +    D +A   +      T+       + + K G L      +ENG  +D  S         + K G   +  + L F   V  ++RD     L  A  +GH     LL+E  A+   R K G   L+
Sbjct:  327 DSGGRTRLQIACDKGKYDVVKKMIEEGGYDINDQDNAGNTALHEAALQGHIEIVELLIENGADVNIKSIEMFGDTPLIDASANGHLDVVKYLLKNGADPTIRNAKGLTAFESVDDESEFDDEEDQKILREIKKRLSIAAKK--WTNRAGIHNDKSKNGNNAHTIDQPPFDNTTKAKNEKAADSPSMASNIDEKAPEEEFYWTDVTSRAGKEKLFKASKEGHLPYVGTYVENGGKIDLRS------FFESVKCGHEDITSIFLAFGFPVNQTSRDNKTSALMVAVGRGHLGTVKLLLEAGADPTKRDKKGRTALY 632          

HSP 2 Score: 53.1434 bits (126), Expect = 6.204e-7
Identity = 32/79 (40.51%), Postives = 50/79 (63.29%), Query Frame = 2
Query:  299 DVNSCNSNGLNALHLASKGGHADIVQFLIDNGADIGAKTRK--NNTAIHIASLAGSLEVVKILVKHGANINEQSQTGFT 529
            D+N  ++ G  ALH A+  GH +IV+ LI+NGAD+  K+ +   +T +  AS  G L+VVK L+K+GA+   ++  G T
Sbjct:  356 DINDQDNAGNTALHEAALQGHIEIVELLIENGADVNIKSIEMFGDTPLIDASANGHLDVVKYLLKNGADPTIRNAKGLT 434          
BLAST of Ankyrin-2 vs. Ensembl Yeast
Match: NAS6 (Evolutionarily conserved 19S regulatory particle assembly-chaperone; proteasome-interacting protein involved in the assembly of the base subcomplex of the 19S proteasomal regulatory particle (RP); ortholog of human oncoprotein gankyrin, also known as p28, which interacts with the Rb tumor suppressor and CDK4/6 [Source:SGD;Acc:S000003464])

HSP 1 Score: 73.559 bits (179), Expect = 1.420e-14
Identity = 59/193 (30.57%), Postives = 88/193 (45.60%), Query Frame = 2
Query:  530 PLYMAAQENHVGVVKFLLDNGADINLST-TDNFTPLAVAIQQGHEETVSILLNKSNFLNSNDISNDIKLPPLHIATRKDDYHAVLLLLHHQEDVQAALTQASLNGFTALHVAAYYNSDKVGRLLLENGAPVDYTSKNNVTALHVAAKWGRNKMVKVLLEFNAN-VEMSTRDGIRPLHCAASQGHRDICALLIE 1102
            PL+ A  EN    V+ LL +   + L    D   PL  ++     E  S LL+K   +N +D  +D    P HIA    +   V  L  +   ++  L + +  G T LH+A      +V + L+ENGA V    K N   LH AA  G  K++++L     + V    + G  PL  A ++GH D   LL+E
Sbjct:    5 PLHQACMENEFFKVQELLHSKPSLLLQKDQDGRIPLHWSVSFQAHEITSFLLSKMENVNLDDYPDDSGWTPFHIACSVGNLEVVKSL--YDRPLKPDLNKITNQGVTCLHLAVGKKWFEVSQFLIENGASVRIKDKFNQIPLHRAASVGSLKLIELLCGLGKSAVNWQDKQGWTPLFHALAEGHGDAAVLLVE 195          

HSP 2 Score: 64.3142 bits (155), Expect = 1.818e-11
Identity = 36/105 (34.29%), Postives = 60/105 (57.14%), Query Frame = 2
Query:  299 DVNSCNSNGLNALHLASKGGHADIVQFLIDNGADIGAKTRKNNTAIHIASLAGSLEVVKILVKHGAN-INEQSQTGFTPLYMAAQENHVGVVKFLLDN-GADINL 607
            D+N   + G+  LHLA      ++ QFLI+NGA +  K + N   +H A+  GSL+++++L   G + +N Q + G+TPL+ A  E H      L++  GA+ +L
Sbjct:   99 DLNKITNQGVTCLHLAVGKKWFEVSQFLIENGASVRIKDKFNQIPLHRAASVGSLKLIELLCGLGKSAVNWQDKQGWTPLFHALAEGHGDAAVLLVEKYGAEYDL 203          

HSP 3 Score: 58.5362 bits (140), Expect = 2.056e-9
Identity = 47/177 (26.55%), Postives = 76/177 (42.94%), Query Frame = 2
Query:  737 PLHIATRKDDYHAVLLLLHHQEDVQAALTQASLNGFTALHVAAYYNSDKVGRLLL---ENGAPVDYTSKNNVTALHVAAKWGRNKMVKVLLE--FNANVEMSTRDGIRPLHCAASQGHRDICALLIEHKANCNTRTKNGLVPLHMVAQGNHSELVEFFINQNSVNVNETSLDFLTPL 1252
            PLH A  ++++  V  LLH +  +   L Q   +G   LH +  + + ++   LL   EN    DY   +  T  H+A   G  ++VK L +     ++   T  G+  LH A  +   ++   LIE+ A+   + K   +PLH  A     +L+E         VN       TPL
Sbjct:    5 PLHQACMENEFFKVQELLHSKPSL---LLQKDQDGRIPLHWSVSFQAHEITSFLLSKMENVNLDDYPDDSGWTPFHIACSVGNLEVVKSLYDRPLKPDLNKITNQGVTCLHLAVGKKWFEVSQFLIENGASVRIKDKFNQIPLHRAASVGSLKLIELLCGLGKSAVNWQDKQGWTPL 178          

HSP 4 Score: 53.1434 bits (126), Expect = 1.142e-7
Identity = 55/207 (26.57%), Postives = 84/207 (40.58%), Query Frame = 2
Query: 1145 PLHMVAQGNHSELVEFFINQNSVNVNETSLDFLTPLHISSHCNNVEVAEALIKHGANVNDRAL---NGFVALHIAAKQNHVEFVEMLMSNLCMIDTQ--TESGFTALHIASIIGSESIAKKLVENNCEIDIPDQFDRTSLHMATIFNHFNIVVYLKEHGGS-VDKQMKTGETCLMLAIKSEHKAIVEYLINQ-GASMSVSDSWGLTA 1744
            PLH     N    V+  ++     + +   D   PLH S      E+   L+    NVN       +G+   HIA    ++E V+ L       D    T  G T LH+A       +++ L+EN   + I D+F++  LH A       ++  L   G S V+ Q K G T L  A+   H      L+ + GA   + D+ G  A
Sbjct:    5 PLHQACMENEFFKVQELLHSKPSLLLQKDQDGRIPLHWSVSFQAHEITSFLLSKMENVNLDDYPDDSGWTPFHIACSVGNLEVVKSLYDRPLKPDLNKITNQGVTCLHLAVGKKWFEVSQFLIENGASVRIKDKFNQIPLHRAASVGSLKLIELLCGLGKSAVNWQDKQGWTPLFHALAEGHGDAAVLLVEKYGAEYDLVDNKGAKA 211          

HSP 5 Score: 51.6026 bits (122), Expect = 3.302e-7
Identity = 35/137 (25.55%), Postives = 69/137 (50.36%), Query Frame = 2
Query:  287 NSNIDVNSCNSNGLNALHLASKGGHADIVQFLIDNG--ADIGAKTRKNNTAIHIASLAGSLEVVKILVKHGANINEQSQTGFTPLYMAAQENHVGVVKFLLDNG-ADINLSTTDNFTPLAVAIQQGHEETVSILLNK 688
            N N+D +  + +G    H+A   G+ ++V+ L D     D+   T +  T +H+A      EV + L+++GA++  + +    PL+ AA    + +++ L   G + +N      +TPL  A+ +GH +   +L+ K
Sbjct:   61 NVNLD-DYPDDSGWTPFHIACSVGNLEVVKSLYDRPLKPDLNKITNQGVTCLHLAVGKKWFEVSQFLIENGASVRIKDKFNQIPLHRAASVGSLKLIELLCGLGKSAVNWQDKQGWTPLFHALAEGHGDAAVLLVEK 196          

HSP 6 Score: 48.521 bits (114), Expect = 4.215e-6
Identity = 41/145 (28.28%), Postives = 68/145 (46.90%), Query Frame = 2
Query:  263 FSKVQEALNSNIDVN-SCNSNGLNALHLASKGGHADIVQFLIDNGADIGAKTRKNN---TAIHIASLAGSLEVVKILVKHG--ANINEQSQTGFTPLYMAAQENHVGVVKFLLDNGADINLSTTDNFTPLAVAIQQGHEETVSIL 679
            F KVQE L+S   +    + +G   LH +      +I  FL+    ++      ++   T  HIA   G+LEVVK L       ++N+ +  G T L++A  +    V +FL++NGA + +    N  PL  A   G  + + +L
Sbjct:   15 FFKVQELLHSKPSLLLQKDQDGRIPLHWSVSFQAHEITSFLLSKMENVNLDDYPDDSGWTPFHIACSVGNLEVVKSLYDRPLKPDLNKITNQGVTCLHLAVGKKWFEVSQFLIENGASVRIKDKFNQIPLHRAASVGSLKLIELL 159          

HSP 7 Score: 47.7506 bits (112), Expect = 8.004e-6
Identity = 55/228 (24.12%), Postives = 92/228 (40.35%), Query Frame = 2
Query: 1346 ALHIAAKQNHVEFV-EMLMSNLCMIDTQTESGFTALHIASIIGSESIAKKLV---ENNCEIDIPDQFDRTSLHMATIFNHFNIV--VYLKEHGGSVDKQMKTGETCLMLAIKSEHKAIVEYLINQGASMSVSDSWGLTALHWATLVVRENILNSNCTDININEAIEIFKFVLDGCSRFDINRTTKNGISSLHLAADCGCLEIVHLLLDK-GADINIISINGTTPLHIA 2008
             LH A  +N    V E+L S   ++  + + G   LH +    +  I   L+   EN    D PD    T  H+A    +  +V  +Y +     ++K    G TCL LA+  +   + ++LI  GAS+ + D +    LH A  V    ++   C                 G  +  +N   K G + L  A   G  +   LL++K GA+ +++   G     +A
Sbjct:    5 PLHQACMENEFFKVQELLHSKPSLLLQKDQDGRIPLHWSVSFQAHEITSFLLSKMENVNLDDYPDDSGWTPFHIACSVGNLEVVKSLYDRPLKPDLNKITNQGVTCLHLAVGKKWFEVSQFLIENGASVRIKDKFNQIPLHRAASVGSLKLIELLC-----------------GLGKSAVNWQDKQGWTPLFHALAEGHGDAAVLLVEKYGAEYDLVDNKGAKAEDVA 215          
BLAST of Ankyrin-2 vs. Ensembl Yeast
Match: AVO2 (Component of a complex containing the Tor2p kinase and other proteins; complex may have a role in regulation of cell growth [Source:SGD;Acc:S000004672])

HSP 1 Score: 62.7734 bits (151), Expect = 3.399e-10
Identity = 46/165 (27.88%), Postives = 83/165 (50.30%), Query Frame = 2
Query:  272 VQEALNSNIDV--NSCNSNGLNALHLASKGGHADIVQFLIDNGADIGA--KTRKNNTAIHIASLAGSLEVVKILVKHGAN-INEQSQTGFTPLYMAAQENHVGVVKFLLDNGADINLSTTDNFTPLAVAIQQGHEETVSILLNKSNFLNSNDISNDIKLPPLHIA 751
            V+  L  N D+  N  + NG ++LH AS  G   I  +LI  G D     KT K NT +H+A + G  + + +L++     IN + + G  P+++A   ++   +  L+  GAD+ +  T+  TPL V ++ G    + +LLN+      +++ +     P+ +A
Sbjct:   21 VKRLLRRNPDLLTNIDSENGWSSLHYASYHGRYLICVYLIQLGHDKHELIKTFKGNTCVHLALMKGHEQTLHLLLQQFPRFINHRGENGRAPIHIACMNDYYQCLSLLIGVGADLWVMDTNGDTPLHVCLEYGSISCMKMLLNEGEVSLDDNVRDKGNWKPIDVA 185          
BLAST of Ankyrin-2 vs. Ensembl Yeast
Match: AKR1 (Palmitoyl transferase involved in protein palmitoylation; acts as a negative regulator of pheromone response pathway; required for endocytosis of pheromone receptors; involved in cell shape control; contains ankyrin repeats; AKR1 has a paralog, AKR2, that arose from the whole genome duplication; any of several human homologs encoding DHHC-type zinc fingers (ZDHHC) can complement temperature sensitivity of yeast akr1 null mutant [Source:SGD;Acc:S000002672])

HSP 1 Score: 63.1586 bits (152), Expect = 4.568e-10
Identity = 57/208 (27.40%), Postives = 96/208 (46.15%), Query Frame = 2
Query:  218 SEKEHIFLR---AAHNGYFSKVQEALNSNI-DVN--SCNSNGLNALHLASKGGHADIVQFLIDNGADIGAKTRK-NNTAIHIASLAGSLEVVKILVKHGANINEQSQTGFTPLYMAAQENHVGVVKFLLDNGA-----DINLSTTDNFTPLAVAIQQGHEETVSILLNKSNFLNSNDISNDIKLPPLHIATRKDDYHAVLLLLHHQED 805
            +E++ +  R   A   G  + V+E ++  + +VN    ++  +  LH AS      +V FL+  GAD+ A+    + T +H A+  G + +V  L+KHGA+       GF  L+++   +++ +V ++L N       DI+       T L  A  QG   TV+ LL    F  S  I++     PLH  T K   H +  L+    D
Sbjct:   68 AEEDPLLTRYHTACQRGDLATVKEMIHGKLLEVNNDGDSTEHITGLHWASINNRLSVVDFLVSQGADVNARAGALHATPLHWAARYGYVYIVDFLLKHGADPTMTDDQGFNLLHLSVNSSNIMLVLYVLFNVVSKGLLDIDCRDPKGRTSLLWAAYQGDSLTVAELL---KFGASIKIADTEGFTPLHWGTVKGQPHVLKYLIQDGAD 272          

HSP 2 Score: 57.3806 bits (137), Expect = 2.592e-8
Identity = 57/214 (26.64%), Postives = 95/214 (44.39%), Query Frame = 2
Query: 1148 LHMVAQGNHSELVEFFINQNSVNVNETSLDFLTPLHISSHCNNVEVAEALIKHGANVNDRA--LNGFVALHIAAKQNHVEFVEMLMSNLCMIDTQTESGFTALHIASIIGSESIAKKLVENNCEIDIPDQFDRTSLHMATIFNHFNIVVYLKEHGGSVDKQMKTGETCLMLAIKSEHKAIVEYLINQGASMSVSDSWGLTALHWATLVVRENIL 1783
            L  V +  H +L+E       VN +  S + +T LH +S  N + V + L+  GA+VN RA  L+    LH AA+  +V  V+ L+ +        + GF  LH++  + S +I                       M  ++  FN+V    +    +D +   G T L+ A        V  L+  GAS+ ++D+ G T LHW T+  + ++L
Sbjct:   86 LATVKEMIHGKLLE-------VNNDGDSTEHITGLHWASINNRLSVVDFLVSQGADVNARAGALHA-TPLHWAARYGYVYIVDFLLKHGADPTMTDDQGFNLLHLS--VNSSNI-----------------------MLVLYVLFNVV---SKGLLDIDCRDPKGRTSLLWAAYQGDSLTVAELLKFGASIKIADTEGFTPLHWGTVKGQPHVL 263          

HSP 3 Score: 55.0694 bits (131), Expect = 1.512e-7
Identity = 37/124 (29.84%), Postives = 56/124 (45.16%), Query Frame = 2
Query:  245 AAHNGYFSKVQEALNSNIDVNSCNSNGLNALHLASKGGHADIVQFLIDNGA-----DIGAKTRKNNTAIHIASLAGSLEVVKILVKHGANINEQSQTGFTPLYMAAQENHVGVVKFLLDNGADI 601
            AA  GY   V   L    D    +  G N LHL+    +  +V +++ N       DI  +  K  T++  A+  G    V  L+K GA+I      GFTPL+    +    V+K+L+ +GAD 
Sbjct:  150 AARYGYVYIVDFLLKHGADPTMTDDQGFNLLHLSVNSSNIMLVLYVLFNVVSKGLLDIDCRDPKGRTSLLWAAYQGDSLTVAELLKFGASIKIADTEGFTPLHWGTVKGQPHVLKYLIQDGADF 273          
BLAST of Ankyrin-2 vs. Ensembl Yeast
Match: PHO81 (Cyclin-dependent kinase (CDK) inhibitor; regulates Pho80p-Pho85p and Pcl7p-Pho85p cyclin-CDK complexes in response to phosphate levels; inhibitory activity for Pho80p-Pho85p requires myo-D-inositol heptakisphosphate (IP7) generated by Vip1p; relative distribution to the nucleus increases upon DNA replication stress [Source:SGD;Acc:S000003465])

HSP 1 Score: 61.6178 bits (148), Expect = 1.399e-9
Identity = 53/155 (34.19%), Postives = 73/155 (47.10%), Query Frame = 2
Query:  314 NSNGLNALHLASK-GGHADIVQFLIDNGADIGAKTRKNN-TAIHIASLAGSLEVVKILVKHGANINEQSQTGFTPLYMAAQENHVGVVKFLLDNGADINLSTTDNFTPLAVAIQQGHEE---TVSILLNKSNF-LNSNDISNDIKLPPLHIATRK 760
            NS GL  LH+ +K GG   ++Q LI  GAD       N  T I  A  +G  EV+  L+KH A ++ +   G +PL+ A  E+HV V+  LL     +NL +     PL     Q   +   T+ +  N   F L+  D   D  LPP  I  RK
Sbjct:  554 NSTGLCTLHIVAKIGGDPQLIQLLIRYGADPNEIDGFNKWTPIFYAVRSGHSEVITELLKHNARLDIEDDNGHSPLFYALWESHVDVLNALLQRP--LNLPS----APLNEINSQSSTQRLNTIDLTPNDDKFDLDIQDSIPDFALPPPIIPLRK 702          

HSP 2 Score: 50.0618 bits (118), Expect = 5.075e-6
Identity = 59/241 (24.48%), Postives = 98/241 (40.66%), Query Frame = 2
Query:  797 QEDVQAALTQASLNGFTALHVAAYYNSDKVGRL----------LLENGAPVDYTSK--------NN----VTALHVAAKWGRNKMVKVLLEFNANVEMSTRDGIRPLHCAASQGHRDICALLIEHKANCNT-----------------RTKNGLVPLHMVAQ-GNHSELVEFFINQNSVNVNETSLDFLTPLHISSHCNNVEVAEALIKHGANVNDRALNGFVALHIAAKQNHVEFVEMLM 1399
            +E VQ  L    ++    LH AA     ++G+L          LLE+  P+D  SK        NN    V  L        + + K +L+++ NV  ST+    PL+ A    + D   LL+E ++  N                  +   GL  LH+VA+ G   +L++  I   +        +  TP+  +    + EV   L+KH A ++    NG   L  A  ++HV+ +  L+
Sbjct:  410 KETVQKLLNAQDIHSRVPLHYAA-----ELGKLEFVHSLLITNLLEDVDPIDSDSKTPLVLAITNNHIDVVRDLLTIGGANASPIEKPILDYSKNVISSTKVQFDPLNVACKFNNHDAAKLLLEIRSKQNADNAKNKSSQHLCQPLFKKNSTGLCTLHIVAKIGGDPQLIQLLIRYGADPNEIDGFNKWTPIFYAVRSGHSEVITELLKHNARLDIEDDNGHSPLFYALWESHVDVLNALL 645          
BLAST of Ankyrin-2 vs. Ensembl Nematostella
Match: EDO45487 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RSW5])

HSP 1 Score: 202.601 bits (514), Expect = 3.021e-56
Identity = 139/435 (31.95%), Postives = 218/435 (50.11%), Query Frame = 2
Query: 2780 PVNSGFLVSFLVDARGGYMQAQRMPQMKIFVPPDAAPAPTRIICHLLRPEGVANLPGMNDCDGFASRILQIHSSCSRFQKPILIEMPYIALLKSNDREIVILKKNADSDTWKKHS-----NTFTEETLKAEFGSLYESITPVDQLESNRICRIITTDVPTYFSLISQFQRDVNMIGPDGGYIESKTDKRIKLTFPQGALMKKIQIGLEVQHVDPGIINHVVGDNHKISLSPIITVEPKRRKFRDLIEIQMGLP--KGVTKNDIQ-DLKLLF---------SISEYITDWEDVTSSTELVLLENTNCMAHSTKISARVWLIYAPNVPNISELANKIYALHCPTPYVGKFLSYAR-RHDQEECQIRCLLITDDTPDKTLECQESFELIATGPEVEVINKLQYQIECAGNIVAVTKSDEAILFPVQSFVENRITLPIR 4030
            PV  GFLVSFLVDAR G M++ +   +KI +PP +   PTRI C LLR      LP + + +  A R+L I  S +RF +P+ +E+PY A L+  +RE+V++K +     W + S            LK E    Y+  +P     S R  +I T  +P  F+++S+ ++++  +G  G  I S     +++  P+GA+    ++ L+VQ VD    N        +++SP++T+EP    F+  + + +  P   G +  DIQ  L+LL          S       W+D+T +T L ++      + +    AR WLI   N  N++  A  IY      PY+ KF+ +A+   D  E ++R   ITDD  DKTLE Q  F  IA   +VEV +     I C GN+  V +    + F   SF ENR+++ +R
Sbjct:   12 PVTGGFLVSFLVDARSGKMESTQT-GIKIVLPPRSCQMPTRITCRLLRINRPTLLPPLREGEALACRVLDIGPSGTRFLQPVYLEVPYFAALRDGERELVVMKTDDGGWNWDEVSVEDMKGKCHAICLKIERVKGYKEDSPDAIFPSRRYAKISTQALPERFAVVSRVKKEIFSVGSRGESIRSAVLPSVQVNVPEGAVASGTKMSLQVQPVDENFNNL----EEWVTVSPVVTLEPADIIFKKPVTVTIPCPVYSGQSNPDIQPSLRLLCCFPKEAKAGSAQTPAYQWQDITGNTPLTVIGAN--ASFTIDRPARYWLIETRNPDNVTADARLIYRKLAAVPYLAKFVVFAKLSADGTEARLRVFCITDDKMDKTLEGQTGFVEIARSRDVEVHDGRPIHIRCLGNLAPVQRDPLHLNF--FSFRENRLSVTVR 437          
BLAST of Ankyrin-2 vs. Ensembl Nematostella
Match: EDO45486 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RSW2])

HSP 1 Score: 118.242 bits (295), Expect = 6.895e-29
Identity = 86/291 (29.55%), Postives = 141/291 (48.45%), Query Frame = 2
Query: 3197 LESNRICRIITTDVPTYFSLISQFQRDVNMIGPDGGYIESKTDKRIKLTFPQGALMKKIQIGLEVQHVDPGIINHVVGDNHKISLSPIITVEPKRRKFRDLIEIQMGLP--KGVTKNDIQ-DLKLLF---------SISEYITDWEDVTSSTELVLLENTNCMAHSTKISARVWLIYAPNVPNISELANKIYALHCPTPYVGKFLSYAR-RHDQEECQIRCLLITDDTPDKTLECQESFELIATGPEVEVINKLQYQIECAGNIVAVTKSDEAILFPVQSFVENRITLPIR 4030
              S R  +I T  +P  F+++S+ ++++  +G  G  I S     +++  P+GA+    ++ L+VQ VD    N        +++SP++T+EP    F+  + + +  P   G +  DIQ  L+LL          S       W+D+T +T L ++      + +    AR WLI   N  N++  A  IY      PY+ KF+ +A+   D  E ++R   ITDD  DKTLE Q  F  IA   +VEV +     I C GN+  V +    + F   SF ENR+++ +R
Sbjct:    7 FPSRRYAKISTQALPERFAVVSRVKKEIFSVGSRGESIRSAVLPSVQVNVPEGAVASGTKMSLQVQPVDENFNNL----EEWVTVSPVVTLEPADIIFKKPVTVTIPCPVYSGQSNPDIQPSLRLLCCFPKEAKAGSAQTPAYQWQDITGNTPLTVIGAN--ASFTIDRPARYWLIETRNPDNVTADARLIYRKLAAVPYLAKFVVFAKLSADGTEARLRVFCITDDKMDKTLEGQTGFVEIARSRDVEVHDGRPIHIRCLGNLAPVQRDPLHLNF--FSFRENRLSVTVR 289          
BLAST of Ankyrin-2 vs. Ensembl Nematostella
Match: EDO38725 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SC11])

HSP 1 Score: 91.6633 bits (226), Expect = 2.401e-20
Identity = 76/243 (31.28%), Postives = 115/243 (47.33%), Query Frame = 2
Query:  302 VNSCNSNGLNALHLASKGGHADIVQFLIDNGA--DIGAKTRKNNTAIHIASLAGSLEVVKILVKHGANINEQSQTGFTPLYMAAQENHVGVVKFLLDNGADINLSTTDNFTPLAVAIQQGHEETVSILLNKSNFLNSNDISNDIKLPPLHIATRKDDYHAVLLLLHHQEDVQAALT--QASLNGFTALHVAAYYNSDKVGRLLLENGAPVDYTSKNNVTALHVAAKWGRNKMVKVLLEFNANV 1018
            +N  +  G +ALH A++    + +  LI NG+  D+       +T +H+A   GS+EV ++LV+ GA +++++  G TPL+MAA       +KFLL  G  I+     + TP   A+  G  E   +LL K     S          PLH+A       A    LH +   +A L+  +    G +ALH+AA     KV   LL  GA ++    N  T L  AAK G  K    LL+  A++
Sbjct:    1 LNKMDDTGFSALHHATRYNRVEAMAELIRNGSIEDL-------STPLHVACKKGSMEVGRLLVEKGAALDKKNDKGETPLHMAACIGSFDALKFLLSKGVAIDERDFSHRTPFLSAVAAGRTENAMLLLEKDENQKS----------PLHLAC------AAGRALHVEALTRAGLSTNERDEEGQSALHMAALSGFRKVVTQLLRYGADINARDSNRWTPLMCAAKTGSVKTCMELLQSGASI 220          

HSP 2 Score: 71.2478 bits (173), Expect = 1.959e-13
Identity = 64/227 (28.19%), Postives = 102/227 (44.93%), Query Frame = 2
Query:  839 GFTALHVAAYYNSDKVGRLLLENGAPVDYTSKNNVTALHVAAKWGRNKMVKVLLEFNANVEMSTRDGIRPLHCAASQGHRDICALLIEHKANCNTRTKNGLVP-LHMVAQGNHSELVEFFINQNSVNVNETSLDFLTPLHISSHCNNVEVAEALIKHGANVNDRALNGFVALHIAAKQNHVEFVEMLMSNLCMIDTQTESGFTALHIASIIGSESIAKKLVENNCEI 1516
            GF+ALH A  YN  +    L+ NG+  D +     T LHVA K G  ++ ++L+E  A ++     G  PLH AA  G  D    L+      + R  +   P L  VA G           +N++ + E   +  +PLH++         EAL + G + N+R   G  ALH+AA     + V  L+     I+ +  + +T L  A+  GS     +L+++   I
Sbjct:    8 GFSALHHATRYNRVEAMAELIRNGSIEDLS-----TPLHVACKKGSMEVGRLLVEKGAALDKKNDKGETPLHMAACIGSFDALKFLLSKGVAIDERDFSHRTPFLSAVAAGR---------TENAMLLLEKDENQKSPLHLACAAGRALHVEALTRAGLSTNERDEEGQSALHMAALSGFRKVVTQLLRYGADINARDSNRWTPLMCAAKTGSVKTCMELLQSGASI 220          

HSP 3 Score: 69.707 bits (169), Expect = 6.822e-13
Identity = 65/232 (28.02%), Postives = 105/232 (45.26%), Query Frame = 2
Query:  719 NDIKLPPLHIATRKDDYHAVLLLLHHQ--EDVQAALTQASLNGFTALHVAAYYNSDKVGRLLLENGAPVDYTSKNNVTALHVAAKWGRNKMVKVLLEFNANVEMSTRDGIRPLHCAASQGHRDICALLIEHKANCNTRTKNGLVPLHMVAQGNHSELVEFFINQNSVNVNETSLDFLTPLHISSHCNNVEVAEALIKHGANVNDRALNGFVALHIAAKQNHVE-FVEMLMSN 1405
            +D     LH ATR +   A+  L+ +   ED+            T LHVA    S +VGRLL+E GA +D  +    T LH+AA  G    +K LL     ++        P   A + G  +   LL+E       + +N   PLH+      +  VE  + +  ++ NE   +  + LH+++     +V   L+++GA++N R  N +  L  AAK   V+  +E+L S 
Sbjct:    5 DDTGFSALHHATRYNRVEAMAELIRNGSIEDLS-----------TPLHVACKKGSMEVGRLLVEKGAALDKKNDKGETPLHMAACIGSFDALKFLLSKGVAIDERDFSHRTPFLSAVAAGRTENAMLLLE-------KDENQKSPLHLACAAGRALHVE-ALTRAGLSTNERDEEGQSALHMAALSGFRKVVTQLLRYGADINARDSNRWTPLMCAAKTGSVKTCMELLQSG 217          

HSP 4 Score: 68.5514 bits (166), Expect = 2.040e-12
Identity = 64/226 (28.32%), Postives = 94/226 (41.59%), Query Frame = 2
Query: 1337 GFVALHIAAKQNHVEFVEMLMSNLCMIDTQTESGFTALHIASIIGSESIAKKLVENNCEIDIPDQFDRTSLHMATIFNHFNIVVYLKEHGGSVDKQMKTGETCLMLAIKSEHKAIVEYLINQGASMSVSDSWGLTALHWATLVVRENILNSNCTDININEAIEIFKFVLDGCSRFDINRTTKNGISSLHLAADCGCLEIVHLLLDKGADINIISINGTTPLHIACK 2014
            GF ALH A + N VE +  L+ N  + D  T      LH+A   GS  + + LVE    +D  +    T LHMA     F+ + +L   G ++D++  +  T  + A+ +        L+ +       D    + LH A    R               A+ +      G S    N   + G S+LH+AA  G  ++V  LL  GADIN    N  TPL  A K
Sbjct:    8 GFSALHHATRYNRVEAMAELIRNGSIEDLSTP-----LHVACKKGSMEVGRLLVEKGAALDKKNDKGETPLHMAACIGSFDALKFLLSKGVAIDERDFSHRTPFLSAVAAGRTENAMLLLEK-------DENQKSPLHLACAAGR---------------ALHVEALTRAGLS---TNERDEEGQSALHMAALSGFRKVVTQLLRYGADINARDSNRWTPLMCAAK 203          

HSP 5 Score: 58.5362 bits (140), Expect = 4.083e-9
Identity = 67/244 (27.46%), Postives = 99/244 (40.57%), Query Frame = 2
Query: 1241 LTPLHISSHCNNVEVAEALIKHGANVNDRALNGFVALHIAAKQNHVEFVEMLMSNLCMIDTQTESGFTALHIASIIGSESIAKKLVENNCEIDIPDQFDRTSLHMATIFNHFNIVVYLKEHGGSVDKQMKTGETCLMLAIKSEHKAIVEYLINQGASMSVSDSWGLTALHWATLVVRENILNSNCTDININEAIEIFKFVLDGCSRF--DINRTTKNGISSLHLAADCGCLEIVHLLLDKGADI 1966
             + LH ++  N VE    LI++G ++ D +      LH+A K+  +E   +L+     +D + + G T LH+A+ IGS    K L+     ID  D   RT    A         + L E     D+  K+    L LA  +     VE L   G S +  D  G +ALH A                    A+  F+ V+    R+  DIN    N  + L  AA  G ++    LL  GA I
Sbjct:    9 FSALHHATRYNRVEAMAELIRNG-SIEDLS----TPLHVACKKGSMEVGRLLVEKGAALDKKNDKGETPLHMAACIGSFDALKFLLSKGVAIDERDFSHRTPFLSAVAAGRTENAMLLLEK----DENQKSP---LHLACAAGRALHVEALTRAGLSTNERDEEGQSALHMA--------------------ALSGFRKVVTQLLRYGADINARDSNRWTPLMCAAKTGSVKTCMELLQSGASI 220          
BLAST of Ankyrin-2 vs. Ensembl Nematostella
Match: EDO37520 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFL9])

HSP 1 Score: 97.0561 bits (240), Expect = 9.122e-20
Identity = 105/448 (23.44%), Postives = 183/448 (40.85%), Query Frame = 2
Query:  323 GLNALHLASKGGHADIVQFLIDNGADIGAKTRKNNTAIHIASLAGSLEVVKILVKHGANINEQSQTGFTPLYMAAQENHVGVVKFLLDNGADINLSTTDNFTPLAVAIQQGHEETVSILLNKSNFLNSNDISNDIKLPPLHIATRKDDYHAVLLLLHHQEDVQAALTQASLNGFTALHVAAYYNSDKVGRLLLENG-APVDYTSKNNVTALHVAAKWGR--NKMVKVLLEFNANVEMSTRDGIRPLHCAASQGHRDICALLIEHKANCNTRTKNGLVPLHMVAQGNHSELVEFFINQNSVNVNETSLDFLTPLHISSHCNNVEVAEALIKHGANVNDRALNGFVALHIAAKQNHVEFVEMLMSNLCMIDTQTESGFTALHIASIIGSESIAKKLVENNCEIDIPDQFDRTSLHMATIFNHFNIVVYLKEHGGSVDKQMKTGETCLMLA 1657
            G + LH A++GGH + V+FL+++     A++   NT + IA+  G + V+++L KHGA  + +      PL  AA   H+  V+FL   G       +D   P   +I   + +     L    +L   + +       LHIA+  +    V  +L   +    ALT     G   LH A  YNS K  +  LE G +P+   +   V + +   K+    +     +  +NA            LH AA  G  ++ A L+E+ A        G   +H+ A  +   ++   + +  V+VN   L   TP H +  C      + L K GAN++     G          N   +V   + +  ++D   E+    + ++S      I+K   ++     I   + +T ++M+ I   F +    K    S  + M    +CL+L 
Sbjct:  890 GYSLLHAAAQGGHVETVKFLLNHKLSKDAESGAGNTPMQIAAQYGRVSVMEVLHKHGAPCDPR------PLRSAAAGGHLPAVRFLHQAG------VSDECVPCKYSISPSYMKQRVGKLVDDEYLWRCETA-------LHIASAMEQPDIVSYILRSND---TALTCYDYLGMRPLHKAVVYNSIKSLKAFLEYGVSPLSRCAPAEVLSTYPEDKYKNIADYFEPCICRYNA------------LHLAARHGRVNMIATLLEYGAKTGVFDACGSQAVHVAACYDQVGVLSLLVAEYKVDVNSRDLIGKTPFHYAVKCKAAGALKRLFKLGANIHAEDDEG----------NKAHYVFEDLQDAILVDPYVENREDKIKLSSEKIDGIISKAFPKHLISFSIIKLYIKTKINMSVIHRVFEVTEVEKNFYFSQGRSM----SCLLLG 1289          

HSP 2 Score: 78.9518 bits (193), Expect = 3.012e-14
Identity = 96/387 (24.81%), Postives = 153/387 (39.53%), Query Frame = 2
Query:  929 SKNNVTALHVAAKWGRNKMVKVLLEFNANVEMSTRDGIRPLHCAASQGHRDICALLIEHKANC-----------NTRTKN----------GLVPLHMVAQGNHSELVEFFINQNSVNVNETSLDFLTPLHISSHCNNVEVAEALIKHGANVNDRALNGFVALHIAAKQNHVEFVEML----MSNLCM-IDTQTESGFTALHIASIIGSESIAKKLVENNCEIDIPDQFDRTSLHMATIFNHFNIVVYLKEHGGSVDKQMKTGETCL-MLAIKSEHKAIVEYLINQGASMSVSDSWGLTALHWATLVVRENILNSNCTDININEAIEIFKFVLDGCSRFDINRTTKNGISSLHLAADCGCLEIVHLLLDKGADINIISINGTTPLHIA 2008
            S  N+TALH AA      ++ +L    + V+   R+   P   AAS G ++I A+L +  AN              R KN          G   LH  AQG H E V+F +N       E+     TP+ I++    V V E L KHGA  + R L        AA   H+  V  L    +S+ C+         +    +  ++  E + +      CE         T+LH+A+     +IV Y       + +   T  TC   L ++  HKA+V    N   S+     +G++ L   +      +L++   D   N    I  +      R++          +LHLAA  G + ++  LL+ GA   +    G+  +H+A
Sbjct:  800 STTNMTALHFAASTSNTGVIGLLANHFSTVDCLDRNSRTPAFIAASTGQKNILAILFQKGANLFHVTNSLSKKHQQRAKNPVKDCKRLMCGYSLLHAAAQGGHVETVKFLLNHKLSKDAESGAGN-TPMQIAAQYGRVSVMEVLHKHGAPCDPRPLRS------AAAGGHLPAVRFLHQAGVSDECVPCKYSISPSYMKQRVGKLVDDEYLWR------CE---------TALHIASAMEQPDIVSY-------ILRSNDTALTCYDYLGMRPLHKAVV---YNSIKSLKAFLEYGVSPL---SRCAPAEVLSTYPEDKYKN----IADYFEPCICRYN----------ALHLAARHGRVNMIATLLEYGAKTGVFDACGSQAVHVA 1137          
BLAST of Ankyrin-2 vs. Ensembl Nematostella
Match: EDO43690 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RXV8])

HSP 1 Score: 90.5077 bits (223), Expect = 2.437e-19
Identity = 69/253 (27.27%), Postives = 121/253 (47.83%), Query Frame = 2
Query:  233 IFLRAAHNGYFSKVQEALNSNIDVNSCNSNGLNALHLASKGGHADIVQFLIDNGADIGAKTRKNNTAIHIASLAGSLEVVKILVKHGANINEQSQTGFTPLYMAAQENHVGVVKFLLDNGADINLSTTDNFTPLAVAIQQGHEETVSILLNKS-NFLNSNDIS---NDIKLPPLHIATRKDDYHAVLLLLHHQEDVQAALTQASLNGFTALHVAAYYNSDKVGRLLLENGAPVDYTSKNNVTALHVAAKWGRN 979
            +FL A  +G   +V++ L    D+N  N +GL ALH A    + D+V+ L+D GA +  +  +  T++H A+  GS+E+ K L+++GA++   +  G  PL +A +E              D+    TD      + +         I+LN + ++LN N I+   +  +   LH+A+ K     + LLL    ++ A       + +T LH AA++       LL ENGA  D+ ++N +  +     W +N
Sbjct:   52 VFLSAVSSGDVDEVKKLLAKGADINYQNVDGLTALHQACIDENFDLVKVLVDKGASMDVRDNEGWTSLHAAASCGSVEIAKYLIENGADVAAVNNEGELPLDLAEEE--------------DMEDLLTDEIENQGIDVDDARAVEEKIMLNDAQSWLNKNCINESKDKTEASALHVASSKGYLKVIGLLLQLGVEINA----KDADNWTPLHAAAHWGQKDACELLSENGA--DFNARNKMVGIDHQQNWLKN 284          

HSP 2 Score: 86.2705 bits (212), Expect = 6.279e-18
Identity = 74/265 (27.92%), Postives = 120/265 (45.28%), Query Frame = 2
Query:  344 ASKGGHADIVQFLIDNGADIGAKTRKNNTAIHIASLAGSLEVVKILVKHGANINEQSQTGFTPLYMAAQENHVGVVKFLLDNGADINLSTTDNFTPLAVAIQQGHEETVSILLNKSNFLNSNDISNDIKLPPLHIATRKDDYHAV--LLLLHHQEDVQAALTQASLNGFTALHVAAYYNSDKVGRLLLENGAPVDYTSKNNVTALHVAAKWGRNKMVKVLLEFNANVEMSTRDGIRPLHCAASQGHRDICALLIEHKANCNTRTK 1132
            A   G  D V+ L+  GADI  +     TA+H A +  + ++VK+LV  GA+++ +   G+T L+ AA    V + K+L++NGAD+     +   PL +A     EE +  LL           +++I+   + +    DD  AV   ++L+   D Q+ L +  +N                           +   K   +ALHVA+  G  K++ +LL+    +     D   PLH AA  G +D C LL E+ A+ N R K
Sbjct:   56 AVSSGDVDEVKKLLAKGADINYQNVDGLTALHQACIDENFDLVKVLVDKGASMDVRDNEGWTSLHAAASCGSVEIAKYLIENGADVAAVNNEGELPLDLA----EEEDMEDLL-----------TDEIENQGIDV----DDARAVEEKIMLN---DAQSWLNKNCIN---------------------------ESKDKTEASALHVASSKGYLKVIGLLLQLGVEINAKDADNWTPLHAAAHWGQKDACELLSENGADFNARNK 271          

HSP 3 Score: 65.855 bits (159), Expect = 4.214e-11
Identity = 66/228 (28.95%), Postives = 99/228 (43.42%), Query Frame = 2
Query: 1331 LNGFVALHIAAKQNHVEFVEMLMSNLCMIDTQTESGFTALHIASIIGSESIAKKLVENNCEIDIPDQFDRTSLHMATIFNHFNIVVYLKEHGGSVDKQMKTGETCLMLAIKSEHKAIV-EYLINQGASMSVSDSWGLTALHWATLVVRENILNSNCTDININEAIEIFKFVLDGCSRFDINRTTKNGISSLHLAADCGCLEIVHLLLDKGADINIISINGTTPLHIAC 2011
             N  +    A     V+ V+ L++    I+ Q   G TALH A I  +  + K LV+    +D+ D    TSLH A       I  YL E+G  V      GE  L LA + + + ++ + + NQG  + V D+  +       L   ++ LN NC    INE+                    K   S+LH+A+  G L+++ LLL  G +IN    +  TPLH A 
Sbjct:   47 FNSGIVFLSAVSSGDVDEVKKLLAKGADINYQNVDGLTALHQACIDENFDLVKVLVDKGASMDVRDNEGWTSLHAAASCGSVEIAKYLIENGADVAAVNNEGELPLDLAEEEDMEDLLTDEIENQG--IDVDDARAVEEK--IMLNDAQSWLNKNC----INES------------------KDKTEASALHVASSKGYLKVIGLLLQLGVEINAKDADNWTPLHAAA 248          

HSP 4 Score: 62.003 bits (149), Expect = 7.260e-10
Identity = 56/228 (24.56%), Postives = 108/228 (47.37%), Query Frame = 2
Query:  839 GFTALHVAAYYNSDKVGRLLLENGAPVDYTSKNNVTALHVAAKWGRNKMVKVLLEFNANVEMSTRDGIRPLHCAASQGHRDICALLIEHKANCNTRTKNGLVPLHMVAQGNHSELVEFFINQNSVNVNETSL--DFLTPLHISSHCNNVEVAEALIKHGANVNDRALNGFVALHIAAKQNHVEFVEMLMSNLCMIDTQTESGFTALHIASIIGSESIAKKLVENNCEI 1516
            G   L   +  + D+V +LL + GA ++Y + + +TALH A       +VKVL++  A++++   +G   LH AAS G  +I   LIE+ A+       G +PL +  + +  +L+   I    ++V++     + +      S  N   + E+  K  A+          ALH+A+ + +++ + +L+     I+ +    +T LH A+  G +   + L EN  + 
Sbjct:   50 GIVFLSAVSSGDVDEVKKLLAK-GADINYQNVDGLTALHQACIDENFDLVKVLVDKGASMDVRDNEGWTSLHAAASCGSVEIAKYLIENGADVAAVNNEGELPLDLAEEEDMEDLLTDEIENQGIDVDDARAVEEKIMLNDAQSWLNKNCINESKDKTEAS----------ALHVASSKGYLKVIGLLLQLGVEINAKDADNWTPLHAAAHWGQKDACELLSENGADF 266          
BLAST of Ankyrin-2 vs. Ensembl Medaka
Match: ENSORLT00000031565.1 (ankyrin 2 [Source:NCBI gene;Acc:101161458])

HSP 1 Score: 792.341 bits (2045), Expect = 0.000e+0
Identity = 527/1551 (33.98%), Postives = 801/1551 (51.64%), Query Frame = 2
Query:  236 FLRAAHNGYFSKVQEALNSNIDVNSCNSNGLNALHLASKGGHADIVQFLIDNGADIGAKTRKNNTAIHIASLAGSLEVVKILVKHGANINEQSQTGFTPLYMAAQENHVGVVKFLLDNGADINLSTTDNFTPLAVAIQQGHEETVSILLNKSNFLNSNDISNDIKLPPLHIATRKDDYHAVLLLLH--HQEDVQAALTQASLNGFTALHVAAYYNSDKVGRLLLENGAPVDYTSKNNVTALHVAAKWGRNKMVKVLLEFNANVEMSTRDGIRPLHCAASQGHRDICALLIEHKANCNTRTKNGLVPLHMVAQGNHSELVEFFINQNSVNVNETSLDFLTPLHISSHCNNVEVAEALIKHGANVNDRALNGFVALHIAAKQNHVEFVEMLMSNLCMIDTQTESGFTALHIASIIGSESIAKKLVENNCEIDIPDQFDRTSLHMATIFNHFNIVVYLKEHGGSVDKQMKTGETCLMLAIKSEHKAIVEYLINQGASMSVSDSWGLTALH---------WATLVVRENILNSNCTDININEAIEIFKFVLDGCSRFDINRTT------KNGISSLHLAADCGCLEIVHLLLDKGADINIISINGTTPLHIACKXXXXXXXXXXXXXXXXXXXTMAYVSCPWSPMHFSSYFGSVDSTILL-------------------ISHENDQTSVREKLRQ----------------------------------------RTPNGNTCLHLAVQQLQTDIVRVLLENDADFNLENEDGLSAFDMAK------IVD------------------------DETIINLLGIDTTE---MMTTDDKVYLFQRE--EFSDEEQLETLYMDSLNELEFFGIGKNSGEKCELQLSIMSLLDYATTIDSIRRADMSLKINNSLNRYRNITLSEIKTRELLIAAQPASMISTISSTNTEMSPFDVEKWDFHRVTDLPVNSG-----------FLVSFLVDARGGYMQAQRMPQMKIFVPPDAAPAPTRIICHLLRPEGVANLPGMNDCDGFASRILQIHSSCSRFQKPILIEMPYIALLKSNDREIVILKKNADSDTWKKHSNTFTEETLKAEFGSLYESITPVDQLESNRICRIITTDVPTYFSLISQFQRDVNMIGPDGGYIESKTDKRIKLTFPQGALMKKIQIGLEVQHVDPGIINHVVGDNHKISLSPIITVEPKRRKFRDLIEIQMGLPKGVTKNDIQD--------LKLLFSISEYIT--DWEDVTSSTELVLLENTNCMAHSTKISARVWLIYAPNVPNISELANKIYALHCPTPYVGKFLSYARRHDQEECQIRCLLITDDTPDKTLECQESFELIATGPEVEVINKLQYQIECAGNIVAVTKSDEAILFPVQSFVENRITLPIRVRNQDEPFQGKIAFIP---HFQSLSKQIVKXXXXXXXXXXXXXXXMVGSFRNPDRKHRVKNATLERIKGCQAIAKTELDLKSVADAVGADWRXXXXXXXXXXDDINLVLNENCTDEEKAFMTLIN-WQTVLGFKATGNE-LNRALRQIGREDVV 4477
            FLRAA  G   KV E L   +D+++CN NGLNALHLA+K GH D+VQ L+D GA + + T+K NTA+HI+SLAG  EVVK LVK GA+IN QSQ GFTPLYMAAQENH+ VV++LL+NG + + +T D FTPLA+A+QQGH + VSILL        ND    ++LP LHIA RKDD  +  LLL   H  DVQ      S +GFT LH+AA+Y +  V  LLL  GA VD+T++N +T LHVA+K G   MV++LL+  + ++  TRDG+ PLHCAA  GH     +L+E  A    RTKNGL PLHM AQG+H E V+  + Q+   V++ +LD+LT LH+++HC +  V + L+   AN N RALNGF  LHIA K+N V+ +E+L+     I   TESG T +H+A+ +G  +I   L++N    D+ +    TSLHMA       +V  L  +G  VD + +  +T L +A +     IV+ L+   A    + + G T LH          A++++     +S  T         + K+     ++  + R        KNG++ LH+AA     ++  LLLDKGA  +  + NG TPLHIA K N  ++  VLL+  +    T A      +P+H +S  G  D   LL                   ++ + D+ +V E L +                                        +T NG T LH A QQ  T I+ VLL++ A  N    +G +A  +A+      +VD                         ET+  +L +   E    MT D   YL   +  E  D+  L   Y+D +N L F   G  +                    DS  R+           R+  + L ++ +++L       S ++  +  ++    +  +  D   ++  PV+SG           FLVSF+VDARGG M+  R   ++I +PP    APTRI C L++   +A +P M + +G ASR++++  S ++F  P+++E+P+ A L+  +RE+VIL+     ++WK+H    T+E L      + E +   ++LE  RICRIIT D P YF+ +S+ ++D ++IGP+GG + S    +++  FP+GAL K+I++GL+ Q V   ++  ++G+  K + SPI+T+EP+RRKF   I + + +P G   + + +        L+LL SI+   T   WED+T +T L  +   +C++ +T +SAR WLI    V      + ++Y      PY+ KF+ +A+ HD  E ++RC  +TDD  DKTLE QE+F  +A   +VEV+       +C GN+V +TKS +  LF   +F ENR+ L I++R+  +   G+++F+    ++++L++  +             +   + S+    R       TLE++   +   K E  L  +AD +G  W  LA +L    + IN + NEN          L+N W       AT    L + L +I R D+V
Sbjct:   51 FLRAARAGNIDKVLEYLKGGVDISTCNQNGLNALHLAAKEGHMDLVQELLDRGAPVDSSTKKGNTALHISSLAGQAEVVKTLVKRGADINAQSQNGFTPLYMAAQENHLDVVRYLLENGGNQSTATEDGFTPLAIALQQGHNQVVSILLE-------NDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQ------SKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVRLLLDRGSQIDAKTRDGLTPLHCAARSGHEASVEVLLEKGAPLLARTKNGLSPLHMAAQGDHVECVKHLL-QHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRVKVMELLVKYGASIQAVTESGLTPIHVAAFMGHLNIVLLLLQNGASPDVSNIRGETSLHMAARAGQAEVVRCLLRNGAMVDARAREDQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQLETASVLLEAGASHSLATKKGFTPLHVVSKYGSLDVAKLLLQRQAPPDSAGKNGLTPLHVAAHYDNQKVALLLLDKGASPHTTAKNGYTPLHIAAKKNQMDIATVLLQYGAE---TNALTKQGVTPLHLASQEGHADMAALLMSKGAQINVPTKSGLTALHLAAQEDRVAVAEILVRNGANLDHQTKLGYTPLIVACHYGNAKMVSFLLQNGASVNAKTKNGYTPLHQAAQQGNTHIINVLLQHGAKPNAVTVNGNTALGIARRLGYISVVDTLRVVTEEVVTTTTTVTEKHKLNVPETMTEVLDVSDEEGDDTMTGDGGEYLRPEDLRELGDDS-LPGQYLDGMNYLHFSLEGGRT--------------------DSAERSFTPTHHGYYSPRHEGV-LEDVLSQQL-------SSLARDNERDSYRLSWCADNLDNVALSSSPVHSGRCSPCHGDHSSFLVSFMVDARGGAMRGCRHNGLRIIIPPRKCSAPTRITCRLVKRHRLATMPPMVEGEGLASRLIEVGPSGAQFLGPVIVEIPHFASLRGRERELVILRSET-GESWKEHHCEHTQEELNQILNGMDEDLDTPEELERKRICRIITRDFPQYFAAVSRIKQDSHLIGPEGGILSSTVVPQVQAVFPEGALTKRIRVGLQAQPVSVNVVRKILGN--KATFSPIVTLEPRRRKFHKPITMTIPVP-GSNSDPVLNGFGGYTPTLRLLCSITGGTTPAQWEDITGTTPLTFI--NDCVSFTTNVSARFWLIDCRQVQESINFSTQVYREIICVPYMAKFVIFAKTHDPIEARLRCFCMTDDKIDKTLEQQENFTEVARSRDVEVLEGKPIYADCFGNLVPLTKSGQHHLFSFYAFKENRLALFIKIRDNTQEPCGRLSFMKEPRNYRALTQNAI-----------CNLNITLPSYSKVSR-------TLEKLDPQEEAEKREQRLAVIADHLGFSWTELARDLGFSEEKINTIRNENPNSLLDQSHALLNQWAQREAQHATAEATLVKQLTKINRMDIV 1531          

HSP 2 Score: 211.46 bits (537), Expect = 4.093e-54
Identity = 157/527 (29.79%), Postives = 266/527 (50.47%), Query Frame = 2
Query:  797 QEDVQAALTQASLNGFTALHVAAYYNSDKVGRLLLENGAPVDYTSKNNVTALHVAAKWGRNKMVKVLLEFNANVEMSTRDGIRPLHCAASQGHRDICALLIEHKANCNTRTKNGLVPLHMVAQGNHSELVEFFINQNSVNVNETSLDFLTPLHISSHCNNVEVAEALIKHGANVNDRALNGFVALHIAAKQNHVEFVEMLMSNLCMIDTQTESGFTALHIASIIGSESIAKKLVENNCEIDIPDQFDRTSLHMATIFNHFNIVVYLKEHGGSVDKQMKTGETCLMLAIKSEHKAIVEYLINQGASMSVSDSWGLTALHWATLVVRENILNSNCTDININEAIEIFKFVLDGCSRFDINRTTKNGISSLHLAADCGCLEIVHLLLDKGADINIISINGTTPLHIACKXXXXXXXXXXXXXXXXXXXTMAYVSCPWSPMHFSSYFGSVDSTILLISH--ENDQTSVREKLRQRTPNGNTCLHLAVQQLQTDIVRVLLENDADFNLENEDGLSAFDMAKIVDDETIINLL 2371
            +E V A +   S   F  L  A   N DKV   L + G  +   ++N + ALH+AAK G   +V+ LL+  A V+ ST+ G   LH ++  G  ++   L++  A+ N +++NG  PL+M AQ NH ++V + + +N  N +  + D  TPL I+    + +V   L+++      R      ALHIAA+++  +   +L+ N    D Q++SGFT LHIA+  G+ ++A  L+     +D   +   T LH+A+   + N+V  L + G  +D + + G T L  A +S H+A VE L+ +GA +      GL+ LH A                   + +E  K +L    +  ++  T + +++LH+AA CG   +  LLLDK A+ N  ++NG TPLHIACK N   V+ +L++  +      A      +P+H +++ G ++  +LL+ +    D +++R         G T LH+A +  Q ++VR LL N A  +    +  +   +A  +    I+ LL
Sbjct:   36 EEHVPAEMLSDSNTSF--LRAARAGNIDKVLEYL-KGGVDISTCNQNGLNALHLAAKEGHMDLVQELLDRGAPVDSSTKKGNTALHISSLAGQAEVVKTLVKRGADINAQSQNGFTPLYMAAQENHLDVVRYLL-ENGGNQSTATEDGFTPLAIALQQGHNQVVSILLENDTKGKVR----LPALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVRLLLDRGSQIDAKTRDGLTPLHCAARSGHEASVEVLLEKGAPLLARTKNGLSPLHMAAQ----------------GDHVECVKHLLQ--HKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRVKVMELLVKYGAS---IQAVTESGLTPIHVAAFMGHLNIVLLLLQNGASPDVSNIR---------GETSLHMAARAGQAEVVRCLLRNGAMVDARAREDQTPLHIASRLGKTEIVQLL 524          
BLAST of Ankyrin-2 vs. Ensembl Medaka
Match: ENSORLT00000039458.1 (ankyrin 2 [Source:NCBI gene;Acc:101161458])

HSP 1 Score: 791.186 bits (2042), Expect = 0.000e+0
Identity = 527/1551 (33.98%), Postives = 801/1551 (51.64%), Query Frame = 2
Query:  236 FLRAAHNGYFSKVQEALNSNIDVNSCNSNGLNALHLASKGGHADIVQFLIDNGADIGAKTRKNNTAIHIASLAGSLEVVKILVKHGANINEQSQTGFTPLYMAAQENHVGVVKFLLDNGADINLSTTDNFTPLAVAIQQGHEETVSILLNKSNFLNSNDISNDIKLPPLHIATRKDDYHAVLLLLH--HQEDVQAALTQASLNGFTALHVAAYYNSDKVGRLLLENGAPVDYTSKNNVTALHVAAKWGRNKMVKVLLEFNANVEMSTRDGIRPLHCAASQGHRDICALLIEHKANCNTRTKNGLVPLHMVAQGNHSELVEFFINQNSVNVNETSLDFLTPLHISSHCNNVEVAEALIKHGANVNDRALNGFVALHIAAKQNHVEFVEMLMSNLCMIDTQTESGFTALHIASIIGSESIAKKLVENNCEIDIPDQFDRTSLHMATIFNHFNIVVYLKEHGGSVDKQMKTGETCLMLAIKSEHKAIVEYLINQGASMSVSDSWGLTALH---------WATLVVRENILNSNCTDININEAIEIFKFVLDGCSRFDINRTT------KNGISSLHLAADCGCLEIVHLLLDKGADINIISINGTTPLHIACKXXXXXXXXXXXXXXXXXXXTMAYVSCPWSPMHFSSYFGSVDS-------------------TILLISHENDQTSVREKLRQ----------------------------------------RTPNGNTCLHLAVQQLQTDIVRVLLENDADFNLENEDGLSAFDMAK------IVD------------------------DETIINLLGIDTTE---MMTTDDKVYLFQRE--EFSDEEQLETLYMDSLNELEFFGIGKNSGEKCELQLSIMSLLDYATTIDSIRRADMSLKINNSLNRYRNITLSEIKTRELLIAAQPASMISTISSTNTEMSPFDVEKWDFHRVTDLPVNSG-----------FLVSFLVDARGGYMQAQRMPQMKIFVPPDAAPAPTRIICHLLRPEGVANLPGMNDCDGFASRILQIHSSCSRFQKPILIEMPYIALLKSNDREIVILKKNADSDTWKKHSNTFTEETLKAEFGSLYESITPVDQLESNRICRIITTDVPTYFSLISQFQRDVNMIGPDGGYIESKTDKRIKLTFPQGALMKKIQIGLEVQHVDPGIINHVVGDNHKISLSPIITVEPKRRKFRDLIEIQMGLPKGVTKNDIQD--------LKLLFSISEYIT--DWEDVTSSTELVLLENTNCMAHSTKISARVWLIYAPNVPNISELANKIYALHCPTPYVGKFLSYARRHDQEECQIRCLLITDDTPDKTLECQESFELIATGPEVEVINKLQYQIECAGNIVAVTKSDEAILFPVQSFVENRITLPIRVRNQDEPFQGKIAFIP---HFQSLSKQIVKXXXXXXXXXXXXXXXMVGSFRNPDRKHRVKNATLERIKGCQAIAKTELDLKSVADAVGADWRXXXXXXXXXXDDINLVLNENCTDEEKAFMTLIN-WQTVLGFKATGNE-LNRALRQIGREDVV 4477
            FLRAA  G   KV E L   +D+++CN NGLNALHLA+K GH D+VQ L+D GA + + T+K NTA+HI+SLAG  EVVK LVK GA+IN QSQ GFTPLYMAAQENH+ VV++LL+NG + + +T D FTPLA+A+QQGH + VSILL        ND    ++LP LHIA RKDD  +  LLL   H  DVQ      S +GFT LH+AA+Y +  V  LLL  GA VD+T++N +T LHVA+K G   MV++LL+  + ++  TRDG+ PLHCAA  GH     +L+E  A    RTKNGL PLHM AQG+H E V+  + Q+   V++ +LD+LT LH+++HC +  V + L+   AN N RALNGF  LHIA K+N V+ +E+L+     I   TESG T +H+A+ +G  +I   L++N    D+ +    TSLHMA       +V  L  +G  VD + +  +T L +A +     IV+ L+   A    + + G T LH          A++++     +S  T         + K+     ++  + R        KNG++ LH+AA     ++  LLLDKGA  +  + NG TPLHIA K N  ++  VLL+  +    T A      +P+H +S  G  D                    T L ++ + D+ +V E L +                                        +T NG T LH A QQ  T I+ VLL++ A  N    +G +A  +A+      +VD                         ET+  +L +   E    MT D   YL   +  E  D+  L   Y+D +N L F   G  +                    DS  R+           R+  + L ++ +++L       S ++  +  ++    +  +  D   ++  PV+SG           FLVSF+VDARGG M+  R   ++I +PP    APTRI C L++   +A +P M + +G ASR++++  S ++F  P+++E+P+ A L+  +RE+VIL+     ++WK+H    T+E L      + E +   ++LE  RICRIIT D P YF+ +S+ ++D ++IGP+GG + S    +++  FP+GAL K+I++GL+ Q V   ++  ++G+  K + SPI+T+EP+RRKF   I + + +P G   + + +        L+LL SI+   T   WED+T +T L  +   +C++ +T +SAR WLI    V      + ++Y      PY+ KF+ +A+ HD  E ++RC  +TDD  DKTLE QE+F  +A   +VEV+       +C GN+V +TKS +  LF   +F ENR+ L I++R+  +   G+++F+    ++++L++  +             +   + S+    R       TLE++   +   K E  L  +AD +G  W  LA +L    + IN + NEN          L+N W       AT    L + L +I R D+V
Sbjct:   36 FLRAARAGNIDKVLEYLKGGVDISTCNQNGLNALHLAAKEGHMDLVQELLDRGAPVDSSTKKGNTALHISSLAGQAEVVKTLVKRGADINAQSQNGFTPLYMAAQENHLDVVRYLLENGGNQSTATEDGFTPLAIALQQGHNQVVSILLE-------NDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQ------SKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVRLLLDRGSQIDAKTRDGLTPLHCAARSGHEASVEVLLEKGAPLLARTKNGLSPLHMAAQGDHVECVKHLL-QHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRVKVMELLVKYGASIQAVTESGLTPIHVAAFMGHLNIVLLLLQNGASPDVSNIRGETSLHMAARAGQAEVVRCLLRNGAMVDARAREDQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQLETASVLLEAGASHSLATKKGFTPLHVVSKYGSLDVAKLLLQRQAPPDSAGKNGLTPLHVAAHYDNQKVALLLLDKGASPHTTAKNGYTPLHIAAKKNQMDIATVLLQYGAE---TNALTKQGVTPLHLASQEGHADMAALLMSKGAQINVPTKSGLTALHLAAQEDRVAVAEILVRNGANLDHQTKLGYTPLIVACHYGNAKMVSFLLQNGASVNAKTKNGYTPLHQAAQQGNTHIINVLLQHGAKPNAVTVNGNTALGIARRLGYISVVDTLRVVTEEVVTTTTTVTEKHKLNVPETMTEVLDVSDEEGDDTMTGDGGEYLRPEDLRELGDDS-LPGQYLDGMNYLHFSLEGGRT--------------------DSAERSFTPTHHGYYSPRHEGV-LEDVLSQQL-------SSLARDNERDSYRLSWCADNLDNVALSSSPVHSGRCSPCHGDHSSFLVSFMVDARGGAMRGCRHNGLRIIIPPRKCSAPTRITCRLVKRHRLATMPPMVEGEGLASRLIEVGPSGAQFLGPVIVEIPHFASLRGRERELVILRSET-GESWKEHHCEHTQEELNQILNGMDEDLDTPEELERKRICRIITRDFPQYFAAVSRIKQDSHLIGPEGGILSSTVVPQVQAVFPEGALTKRIRVGLQAQPVSVNVVRKILGN--KATFSPIVTLEPRRRKFHKPITMTIPVP-GSNSDPVLNGFGGYTPTLRLLCSITGGTTPAQWEDITGTTPLTFI--NDCVSFTTNVSARFWLIDCRQVQESINFSTQVYREIICVPYMAKFVIFAKTHDPIEARLRCFCMTDDKIDKTLEQQENFTEVARSRDVEVLEGKPIYADCFGNLVPLTKSGQHHLFSFYAFKENRLALFIKIRDNTQEPCGRLSFMKEPRNYRALTQNAI-----------CNLNITLPSYSKVSR-------TLEKLDPQEEAEKREQRLAVIADHLGFSWTELARDLGFSEEKINTIRNENPNSLLDQSHALLNQWAQREAQHATAEATLVKQLTKINRMDIV 1516          

HSP 2 Score: 348.591 bits (893), Expect = 3.257e-96
Identity = 243/737 (32.97%), Postives = 366/737 (49.66%), Query Frame = 2
Query:  410 KTRKNNTAIHIASLAGSLEVVKILVKHGANINEQSQTGFTPLYMAAQENHVGVVKFLLD---------------------------------NGADINLSTTDNFTP---------------------------------LAVAIQQGHEETVSILLNKSNFLNSNDISNDIKLPPLHIATRKDDYHAVLLLLH--HQEDVQAALTQASLNGFTALHVAAYYNSDKVGRLLLENGAPVDYTSKNNVTALHVAAKWGRNKMVKVLLEFNANVEMSTRDGIRPLHCAASQGHRDICALLIEHKANCNTRTKNGLVPLHMVAQGNHSELVEFFINQNSVNVNETSLDFLTPLHISSHCNNVEVAEALIKHGANVNDRALNGFVALHIAAKQNHVEFVEMLMSNLCMIDTQTESGFTALHIASIIGSESIAKKLVENNCEIDIPDQFDRTSLHMATIFNHFNIVVYLKEHGGSVDKQMKTGETCLMLAIKSEHKAIVEYLINQGASMSVSDSWGLTALH---------WATLVVRENILNSNCTDININEAIEIFKFVLDGCSRFDINRTT------KNGISSLHLAADCGCLEIVHLLLDKGADINIISINGTTPLHIACKXXXXXXXXXXXXXXXXXXXTMAYVSCPWSPMHFSSYFGSVDSTILLISHENDQTSVREKLRQRTPNGNTCLHLAVQQLQTDIVRVLLENDADFNLENEDGLSAFDMAKIVDDETIINLL 2371
            K   +NT+   A+ AG+++ V   +K G +I+  +Q G   L++AA+E H+ +V+ LLD                                  GADIN  + + FTP                                 LA+A+QQGH + VSILL        ND    ++LP LHIA RKDD  +  LLL   H  DVQ      S +GFT LH+AA+Y +  V  LLL  GA VD+T++N +T LHVA+K G   MV++LL+  + ++  TRDG+ PLHCAA  GH     +L+E  A    RTKNGL PLHM AQG+H E V+  + Q+   V++ +LD+LT LH+++HC +  V + L+   AN N RALNGF  LHIA K+N V+ +E+L+     I   TESG T +H+A+ +G  +I   L++N    D+ +    TSLHMA       +V  L  +G  VD + +  +T L +A +     IV+ L+   A    + + G T LH          A++++     +S  T         + K+     ++  + R        KNG++ LH+AA     ++  LLLDKGA  +  + NG TPLHIA K    N + +    L Y + T A      +P+H +S  G  D   LL+S +  Q +V  K      +G T LHLA Q+ +  +  +L+ N A+ + + + G +   +A    +  +++ L
Sbjct:   28 KKSDSNTSFLRAARAGNIDKVLEYLKGGVDISTCNQNGLNALHLAAKEGHMDLVQELLDRGAPVDSSTKKGNTALHISSLAGQAEVVKTLVKRGADINAQSQNGFTPLYMAAQENHLDVVRYLLENGGNQSTATEDGFTPLAIALQQGHNQVVSILLE-------NDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQ------SKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVRLLLDRGSQIDAKTRDGLTPLHCAARSGHEASVEVLLEKGAPLLARTKNGLSPLHMAAQGDHVECVKHLL-QHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRVKVMELLVKYGASIQAVTESGLTPIHVAAFMGHLNIVLLLLQNGASPDVSNIRGETSLHMAARAGQAEVVRCLLRNGAMVDARAREDQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQLETASVLLEAGASHSLATKKGFTPLHVVSKYGSLDVAKLLLQRQAPPDSAGKNGLTPLHVAAHYDNQKVALLLLDKGASPHTTAKNGYTPLHIAAK---KNQMDIATVLLQYGAETNALTKQGVTPLHLASQEGHADMAALLMS-KGAQINVPTK------SGLTALHLAAQEDRVAVAEILVRNGANLDHQTKLGYTPLIVACHYGNAKMVSFL 740          
BLAST of Ankyrin-2 vs. Ensembl Medaka
Match: ank1b (ankyrin-1 [Source:NCBI gene;Acc:101157380])

HSP 1 Score: 757.673 bits (1955), Expect = 0.000e+0
Identity = 493/1532 (32.18%), Postives = 789/1532 (51.50%), Query Frame = 2
Query:  197 IFISFS*SEKEHIFLRAAHNGYFSKVQEALNSNIDVNSCNSNGLNALHLASKGGHADIVQFLIDNGADIGAKTRKNNTAIHIASLAGSLEVVKILVKHGANINEQSQTGFTPLYMAAQENHVGVVKFLLDNGADINLSTTDNFTPLAVAIQQGHEETVSILLNKSNFLNSNDISNDIKLPPLHIATRKDDYHAVLLLLHHQEDVQAALTQASLNGFTALHVAAYYNSDKVGRLLLENGAPVDYTSKNNVTALHVAAKWGRNKMVKVLLEFNANVEMSTRDGIRPLHCAASQGHRDICALLIEHKANCNTRTKNGLVPLHMVAQGNHSELVEFFINQNSVNVNETSLDFLTPLHISSHCNNVEVAEALIKHGANVNDRALNGFVALHIAAKQNHVEFVEMLMSNLCMIDTQTESGFTALHIASIIGSESIAKKLVE-------NNCEIDIP------------DQF--------------DRTSLHMATIFNHFNIVVYLKEHGGSVDKQMKTGETCLMLAIKSEHKAIVEYLINQGASMSVSDSWGLTALHWATL--------VVRENILNSNCTDIN----INEAI-----EIFKFVLDGCSRFDINRTTKNGISSLHLAADCGCLEIVHLLLDKGADINIISINGTTPLHIACKXXXXXXXXXXXXXXX------------------------------XXXXTMAYVSCPWSPMHFSSYFGSVDSTILLISHENDQTSVREKLRQRTPNGNTCLHLAVQQLQTDIVRVLLENDADFNLENEDGLSAFDMAKIVDDETIINLLGIDTTEMMTTDDKVYLFQREEFSDEEQLETLYMDSLNELEFFGIGKNSGEKCEL-QLSIMSLLDYATTIDSIRRADMSLKINNSLNRYRNITLSEIKTRELLIAAQPASMISTISSTNTEMSPFDVEKWDFHRVTDLPVNSGFLVSFLVDARGGYMQAQRMPQMKIFVPPDAAPAPTRIICHLLRPEGVANLPGMNDCDGFASRILQIHSSCSRFQKPILIEMPYIALLKSNDREIVILKKNADSDTWKKHSNTFTEETLKAEFGSLYESITPVDQLESNRICRIITTDVPTYFSLISQFQRDVNMIGPDGGYIESKTDKRIKLTFPQGALMKKIQIGLEVQHVDPGIINHVVGDNHKISLSPIITVEPKRRKFRDLIEIQMGL-------PKGVTKNDIQDLKLLFSI--SEYITDWEDVTSSTELVLLENTNCMAHSTKISARVWLIYAPNVPNISELANKIYALHCPTPYVGKFLSYARRHDQEECQIRCLLITDDTPDKTLECQESFELIATGPEVEVINKLQYQIECAGNIVAVTK-SDEAILFPVQSFVENRITLPIRVRNQDEPFQGKIAFIPHFQSLSKQIVKXXXXXXXXXXXXXXXMVGSFRNPDRKHRVKNATLERIKGCQAIAKTE--------LDLKSVADAVGADWRXXXXXXXXXXDDINLVLNENCTDEEKAFMTLIN-WQTVLGFKATGNELNRALRQIGREDVVKSCIG 4492
            +F  F  ++    FLRAA +G   K  + + + I++N  N NGLN LHLASK GH  +V  L+ +G ++ A T+K NTA+HIA+LAG  +VV  LV +GAN+N QS  GF+PLYMAAQENH+ VVKFLL+NGA+ +L T D FTPLAVA+QQGHE  V++L+N             ++LP LHIA R DD     +LL +  +        S  GFT LH+AA+Y +  V +LLL  GA V++T KN +T LH+A++ G   MV++LL+  A ++  T+D + PLHCAA  GH  I  +L+EH A    +TKNGL P+HM AQG+H + V   +  N+  +++ +LD LTPLH+++HC +  +A+ L+  GA  N RALNGF  LHIA K+NH+  +++L+ +   ++  TESG T LH+A+ +G  +I K L++       +N +++ P             QF              D+T LH A    H  +V  L +H  + D     G T L +A +  H   +  L++ GA        G T LH A+         ++ E   N N    N    ++ A+     ++ K ++        + T +NG + LH+AA    +E+  +LL  GA  N  S+ G TPLH+A +    +++ +L+   +                                +   A     ++P+H + ++G++     L+     Q  V  K R     G T LH A QQ  TDIV +LL++ A  N    +G S   +AK +   ++I++L + T E ++T    +    +E  D  + E +       L FF       E+ EL    + ++L Y+  I  I            L+++  I L +    + LI + PA+       T+  +SP              P+++GFLVSF+VDARGG M+  R   +++ +PP    APTRI C L++P+ +   P + + +G ASRI+ +  S  +F  P+++E+P+ A L   DRE+V+L+   +   WK+H N + +E L+     + E +   ++LE  RI RII+TD P YF+++S+ Q++ ++IGP+GG + SK    ++  FP+ A+ K++++GL+ Q +   ++   +G+  + + SP++T+EP+RRKF   I +++ L       P+   + D   L+LL S+        WED+T +T+L+     NC + +T +SAR WL   P        AN +Y      PY+ KF+ +A+ ++  E ++RC  +TDD  DKTLE  E+F  +A   ++E++  +   +EC+GN+V + K + +   F  Q+F +NR+ + ++VR+ ++   G ++F+       ++  K                       D +H + N  +  +  C  +A +E        L L+    A+      LA EL+   DDIN +  EN         TL+N W +  G KA    L  ALR I R D+V S  G
Sbjct:    1 MFFLFLQADAATSFLRAARSGNLDKALDHIKNGININIANQNGLNGLHLASKEGHVKMVLELLHSGIELEATTKKGNTALHIAALAGQEKVVAELVNYGANVNAQSHKGFSPLYMAAQENHLEVVKFLLENGANQSLPTEDGFTPLAVALQQGHENVVALLINYGT-------KGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVL----SKTGFTPLHIAAHYENMSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVMMVRLLLDRGAQIDAQTKDELTPLHCAARNGHVRIIEILLEHGAPIQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNA-EIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKNLLQRGASPNASNVKVETPLHMASRAGHCEVAQFLLQNAAQVDARAKDDQTPLHCAARMGHKELVKLLLDHKANPDSATTAGHTPLHIAAREGHIHTIRILLDAGAQQVKMTKKGFTPLHVASKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGG--SAHSTARNGYTPLHIAAKQNQIEVASVLLQNGASPNCESLQGITPLHLASQEGRPDMVAMLISKQANVNLGNKNGLTPLHLVAQEGHVGIADTLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLL---QQQAHVNAKTRM----GYTPLHQAAQQGHTDIVTLLLKHGALPNEITSNGTSPLGIAKRLGYISVIDVLKLVTEESVSTHRMSFPETVDEILDVSEDEVIL-----SLLFF-----LQEEAELLDFVLQNILPYSPAIPRIPCVSPE---TVQLDQHTPIPLPKEYDEDSLIPSSPAT------ETSDNVSPVAS-----------PIHTGFLVSFMVDARGGSMRGSRHHGLRVIIPPRTCAAPTRITCRLVKPQKLTTPPPLVEGEGLASRIISLGPSSMQFLGPVIVEIPHFASLGRGDRELVVLRSE-NGSVWKEHRNRYGDEVLETILNGMDEDLESQEELEKKRIRRIISTDFPLYFAVVSRIQQESDLIGPEGGRLTSKLVPHVEAIFPESAVTKRVRLGLQAQPIPDELLTRQLGN--QATFSPVVTIEPRRRKFHRPIGLRIPLPPSWRESPRDAGEGDTTSLRLLCSVIGGTAPAQWEDITGTTKLMYAH--NCASFTTNVSARFWLADCPRTAEAVTFANLLYKELMAIPYMAKFVIFAKMNEAREGRLRCYCMTDDKMDKTLELHENFSEVARSRDIELMEGMPLHLECSGNLVPIRKATQQPRSFSFQAFRDNRLPVSVKVRDSNKEATGFLSFL-------RKCTKYE---------------------DAQHVLCNLNIT-MPPCVKVAGSEERRRTLTPLALRERYSALNDPAAELARELQFGVDDINRIRVENPNSLLDQSSTLLNLWASREGKKAKMESLYTALRNIDRADIVASLEG 1447          
BLAST of Ankyrin-2 vs. Ensembl Medaka
Match: ank1a (ankyrin-1 [Source:NCBI gene;Acc:101174837])

HSP 1 Score: 559.296 bits (1440), Expect = 2.971e-165
Identity = 415/1432 (28.98%), Postives = 712/1432 (49.72%), Query Frame = 2
Query:  443 ASLAGSLEVVKILVKHGANINEQSQTGFTPLYMAAQENHVGVVKFLLDNGADINLSTTDNFTPLAVAIQQGHEETVSILLNKSNFLNSNDISNDIKLPPLHIATRKDDYHAVLLLLHHQEDVQAALTQASLNGFTALHVAAYYNSDKVGRLLLENG--------APVDYT---SKNNVTALHVAAKWGRNKMVKVLLEFNANVEMSTRDGIRPLHCAASQGHRDICALLIEHKANCNTRTKNGLVPLHMVAQGNHSELVEFFINQNSVNVNETSLDFLTPLHISSHCNNVEVAEALIKHGANVNDRALNGFVALHIAAKQNHVEFVEMLMSNLCMIDTQTESGFTALHIASIIGSESIAKKLVENNCEIDIPDQFDRTSLHMATIFNHFNIVVYLKEHGGSVDKQMKTGETCLMLAIKSEHKAIVEYLINQGASMSVSDSWGLTALHWATL-----VVR---------ENILNSNCTDININEA---IEIFKFVLDGCSRFDINRTTKNGISSLHLAADCGCLEIVHLLLDKGADINIISINGTTPLHIACKXXXXXXXXXXXXXXXXX-XXTMAYVSCPWSPMHFSSYFGSVDSTILLISHEND-------------------QTSVREKLRQR-------TPNGNTCLHLAVQQLQTDIVRVLLENDADFNLEN---------EDGLSAFDMAKIVDDETIINLLGIDTTEMMTTDDKVYLFQREEFSDE-EQLETLYMDSLNELEFFGIGKNSGEKCELQLSIMSLLDYATTIDSIRRADMSLKI--NNSLNRYRNITLSEIKTRELLIAAQPASMISTISSTNTEMSPFDVEKWDFHRVTDLPVNSGFLVSFLVDARGGYMQAQRMPQMKIFVPPDAAPAPTRIICHLLRPEGVANLPGMNDCDGFASRILQIHSSCSRFQKPILIEMPYIALLKSNDREIVILKKNADSDTWKKHSNTFTEETLKAEFGSLYESITPVDQLESNRICRIITTDVPTYFSLISQFQRDVNMIGPDGGYIESKTDKRIKLTFPQGALMKKIQIGLEVQHVDPGIINHVVGDNHKISLSPIITVEPKRRKFRDLIEIQMGL-------PKGVTKNDIQDLKLLFSI--SEYITDWEDVTSSTELVLLENTNCMAHSTKISARVWLIYAPNVPNISELANKIYALHCPTPYVGKFLSYARRHDQEECQIRCLLITDDTPDKTLECQESFELIATGPEVEVINKLQYQIECAGNIVAVTK-SDEAILFPVQSFVENRITLPIRVRNQDEPFQGKIAFIPHFQSLSKQIVKXXXXXXXXXXXXXXXMVGSFRNPDRKHRVKNATL-ER--------IKGCQAIAKTELDLKSVADAVGADWRXXXXXXXXXXDDINLVLNENCTDEEKAFMTLIN-WQTVLGFKATGNELNRALRQIGREDVV 4477
            A+ +G+L+     +K+G +IN  +Q G   L++A++E HV +V  LL NG  +  +T    T L +A   G E+ V+ L+N    +N+          PL++A +++    V  LL +  + Q+  T+   +GFT L VA     + V  LL+  G        A  D+    S    T LH+AA +    + ++LL   AN E++      PLHCAA  GH  I  +L+++ A    +TKNGL P+HM AQG+H + V+  +  N+  +++ +LD LTPLH+++HC +  +A+ L+  GA  N RALNGF  LHIA K+NH+  +++L+ +   I+  TESG T LH+AS +G  +I K L++        +    T LHMA+   HF +  +L ++   VD + K  +T L  A +  HK +V+ L+   A+ + + + G + LH A        VR           +     T +++      +++ + +L+  +  + N   KNG++ LH+A     L++V+LL+ KG   +  + NG T LHIA K N   V   LL+  +   + ++  V+    P+H +S  G  D   LLIS + +                      + + L ++       T  G T LH+A       +V+ LL+  A+ N +          +D    +     +     +  + +     + T++ V +  R  F +  +++  +  D    L  F    N     E+        +Y+  I  I R      I     + +Y           + LI + PA+       T+  +SP              P+++GFLVSF+VDARGG M+  R   +++ +PP    APTRI C L++P+ + + P + + +G ASRI+ +  +  +F  P+++E+P+ A L   DRE+V+L ++ +   WK+H N + +E L+     + E +   ++L   RI RII+TD P YF+++S+ Q++ ++IGP+GG + SK    ++ TFP+ A+ K++++GL+ Q V   ++  ++G+  + + SP++TVEP+RRKF   I +++ L       P+   + D   L+LL S+        WED+T +T+L+     +C + +T +SAR WL   P        AN +Y      PY+ KF+ +A+ ++  E ++RC  +TDD  DKTLE  E+F  +A   ++EV+  +   +EC+GN++ V K + +   F  Q+F +NR+ + ++VR+  +   G ++F+   +S   +  + +     I     I M GS    DR+  +    L ER        +    A+ +TEL +  +A+ +G  W  LA EL+L  DDIN +  EN     +    L+N W T  G +A    L  AL+ I R D++
Sbjct:   14 AARSGNLDKALEHIKNGIDINTANQNGLNALHLASKEGHVKMVLELLHNGIVLETTTKKGNTALHIAALAGQEQVVTELVNYGTNVNAQSQKG---FTPLYMAAQENHLEVVKFLLENGAN-QSIPTE---DGFTPLAVALQQGHENVVALLISYGTKGKVRLPALTDFCFFLSVTGFTPLHIAAHYENLNVAQLLLNRGANDELT------PLHCAARNGHFRIIEILLDNGAPIQAKTKNGLSPIHMAAQGDHMDCVKQLLQYNA-EIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKPNSRALNGFTPLHIACKKNHLRVMDLLLKHSASIEAVTESGLTPLHVASFMGHLNIVKILLQKGASPSASNVKVETPLHMASRSGHFEVAEFLLQNAAPVDAKAKDDQTPLHCAARMGHKELVKLLLEHKANPNSTTTAGHSPLHIAAREGHVQTVRLLLDMEAQQTKMTKKGFTPLHVASKYGKVDVAELLLERGA--NPNAAGKNGLTPLHVAVHHNNLDVVNLLVSKGGSPHSAARNGYTALHIAAKQNQVEVANSLLQHGASANAESLQGVT----PLHLASQEGRPDIVSLLISKQANVNLGNKSGLTPLHLVAQEGHVGIADILVKQGASVYAATRMGYTPLHVACHYGNIKMVKFLLQQQANVNSKTRVEYIQCHYKDHYCEYKHTTPLHTHLWLGYISVIDVLKLVTEETVSMKHRMSFPETVDEILDVSEDEGTALRIFFSDVNKCIISEVLFLFFLNRNYSPAIPRIPRVSPETVILKEQEITQY---------DEDSLIPSSPAT------ETSDNVSPVAS-----------PIHTGFLVSFMVDARGGSMRGSRHNGLRVIIPPRTCAAPTRITCRLVKPQKLTSPPPLVEGEGLASRIISLGPAGMQFLGPVIVEIPHFAALGRGDRELVVL-RSENGSVWKEHRNRYGDEVLETILNGMDEELESQEELGKKRIRRIISTDFPLYFAVVSRVQQESDLIGPEGGSLTSKLVPMVQATFPETAVTKRVRLGLQAQPVPDELVAKLLGN--QANFSPVVTVEPRRRKFHRPIGLRIPLPPSWRDSPRDSGEGDTTSLRLLCSVIGGTASAQWEDITGTTKLIYA--NDCASFTTNVSARFWLADCPRTAEAVSFANLLYRELSAVPYMAKFVVFAKMNELREGRLRCYCMTDDKMDKTLEQHENFAEVARSRDIEVMEGMPLHLECSGNLLPVRKATQQPRCFSFQAFRDNRLPVTVKVRDSSKEPTGFLSFL--RKSTKYEDSQHVLCNLNITMPPCITMRGS---EDRRRTLTPLALRERYNALNEPAMASMSAMERTELKMAVIAEQLGLSWAELARELQLSVDDINKIRVENPNSLLEQSSALLNLWATREGKRAKMESLYTALKSIDRMDII 1389          

HSP 2 Score: 359.762 bits (922), Expect = 6.624e-100
Identity = 226/657 (34.40%), Postives = 339/657 (51.60%), Query Frame = 2
Query:  236 FLRAAHNGYFSKVQEALNSNIDVNSCNSNGLNALHLASKGGHADIVQFLIDNGADIGAKTRKNNTAIHIASLAGSLEVVKILVKHGANINEQSQTGFTPLYMAAQENHVGVVKFLLDNGADINLSTTDNFTPLAVAIQQGHEETVSILLNKSN--------------FLNS----------------------NDISNDIKLPPLHIATRKDDYHAVLLLLHHQEDVQAALTQA-----------------------------SLNGFTALHVAAYYNSDKVGRLLLENGAPVDYTSKNNVTALHVAAKWGRNKMVKVLLEFNANVEMSTRDGIRPLHCAASQGHRDICALLIEHKANCNTRTKNGLVPLHMVAQGNHSELVEFFINQNSVNVNETSLDFLTPLHISSHCNNVEVAEALIKHGANVNDRALNGFVALHIAAKQNHVEFVEMLMSNLCMIDTQTESGFTALHIASIIGSESIAKKLVENNCEIDIPDQFDRTSLHMATIFNHFNIVVYLKEHGGSVDKQMKTGETCLMLAIKSEHKAIVEYLINQGASMSVSDSWGLTALHWATLVVRENILNSNCTDININEAIEIFKFVLDGCSRFDINRTTKNGISSLHLAADCGCLEIVHLLLDKGADINIISINGTTPLHIAC 2011
            FLRAA +G   K  E + + ID+N+ N NGLNALHLASK GH  +V  L+ NG  +   T+K NTA+HIA+LAG  +VV  LV +G N+N QSQ GFTPLYMAAQENH+ VVKFLL+NGA+ ++ T D FTPLAVA+QQGHE  V++L++                 FL+                       N  +ND +L PLH A R   +  + +LL +   +QA                                  +L+  T LHVAA+    ++ ++LL+ GA  +  + N  T LH+A K    +++ +LL+ +A++E  T  G+ PLH A+  GH +I  +L++  A+ +        PLHM ++  H E+ EF + QN+  V+  + D  TPLH ++   + E+ + L++H AN N     G   LHIAA++ HV+ V +L+         T+ GFT LH+AS  G   +A+ L+E     +   +   T LH+A   N+ ++V  L   GGS     + G T L +A K     +   L+  GAS +     G+T LH A+   R +I+           ++ I K       + ++N   K+G++ LHL A  G + I  +L+ +GA +   +  G TPLH+AC
Sbjct:   11 FLRAARSGNLDKALEHIKNGIDINTANQNGLNALHLASKEGHVKMVLELLHNGIVLETTTKKGNTALHIAALAGQEQVVTELVNYGTNVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQSIPTEDGFTPLAVALQQGHENVVALLISYGTKGKVRLPALTDFCFFLSVTGFTPLHIAAHYENLNVAQLLLNRGAND-ELTPLHCAARNGHFRIIEILLDNGAPIQAKTKNGLSPIHMAAQGDHMDCVKQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKPNSRALNGFTPLHIACKKNHLRVMDLLLKHSASIEAVTESGLTPLHVASFMGHLNIVKILLQKGASPSASNVKVETPLHMASRSGHFEVAEFLL-QNAAPVDAKAKDDQTPLHCAARMGHKELVKLLLEHKANPNSTTTAGHSPLHIAAREGHVQTVRLLLDMEAQQTKMTKKGFTPLHVASKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVNLLVSKGGSPHSAARNGYTALHIAAKQNQVEVANSLLQHGASANAESLQGVTPLHLASQEGRPDIV-----------SLLISK-------QANVNLGNKSGLTPLHLVAQEGHVGIADILVKQGASVYAATRMGYTPLHVAC 647          

HSP 3 Score: 254.988 bits (650), Expect = 1.603e-67
Identity = 166/509 (32.61%), Postives = 264/509 (51.87%), Query Frame = 2
Query:  188 DHLIFISFS*SEKEHIFLRAAHNGYFSKVQEALNSNIDVNSCNSNGLNALHLASKGGHADIVQFLIDNGADIGAKTRKNNTAIHIASLAGSLEVVKILVKHGANINEQSQTGFTPLYMAAQENHVGVVKFLLDNGADINLSTTDNFTPLAVAIQQGHEETVSILLNKSNFLNSNDISNDIKLPPLHIATRKDDYHAVLLLLHHQEDVQAALTQASLNGFTALHVAAYYNSDKVGRLLLENGAPVDYTSKNNVTALHVAAKWGRNKMVKVLLEFNANVEMSTRDGIRPLHCAASQGHRDICALLIEHKANCNTRTKNGLVPLHMVAQGNHSELVEFFINQNSVNVNETSLDFLTPLHISSHCNNVEVAEALIKHGANVNDRALNGFVALHIAAKQNHVEFVEMLMSNLCMIDTQTESGFTALHIASIIGSESIAKKLVENNCEIDIPDQFDRTSLHMATIFNHFNIVVYLKEHGGSVDKQMKTGETCLMLAIKSEHKAIVEYLINQGASM 1714
            D   F+S +     HI   AAH    +  Q  LN   +      + L  LH A++ GH  I++ L+DNGA I AKT+   + IH+A+    ++ VK L+++ A I++ +    TPL++AA   H  + K LLD GA  N    + FTPL +A ++ H   + +LL  S    S +   +  L PLH+A+     + V +LL       A+ + +++   T LH+A+     +V   LL+N APVD  +K++ T LH AA+ G  ++VK+LLE  AN   +T  G  PLH AA +GH     LL++ +A     TK G  PLH+ ++    ++ E  + + + N N    + LTPLH++ H NN++V   L+  G + +  A NG+ ALHIAAKQN VE    L+ +    + ++  G T LH+AS  G   I   L+     +++ ++   T LH+     H  I   L + G SV    + G T L +A    +  +V++L+ Q A++
Sbjct:  174 DFCFFLSVTGFTPLHI---AAHYENLNVAQLLLNRGAN------DELTPLHCAARNGHFRIIEILLDNGAPIQAKTKNGLSPIHMAAQGDHMDCVKQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKPNSRALNGFTPLHIACKKNHLRVMDLLLKHSA---SIEAVTESGLTPLHVASFMGHLNIVKILLQKG----ASPSASNVKVETPLHMASRSGHFEVAEFLLQNAAPVDAKAKDDQTPLHCAARMGHKELVKLLLEHKANPNSTTTAGHSPLHIAAREGHVQTVRLLLDMEAQQTKMTKKGFTPLHVASKYGKVDVAELLLERGA-NPNAAGKNGLTPLHVAVHHNNLDVVNLLVSKGGSPHSAARNGYTALHIAAKQNQVEVANSLLQHGASANAESLQGVTPLHLASQEGRPDIVSLLISKQANVNLGNKSGLTPLHLVAQEGHVGIADILVKQGASVYAATRMGYTPLHVACHYGNIKMVKFLLQQQANV 665          

HSP 4 Score: 243.817 bits (621), Expect = 4.190e-64
Identity = 145/462 (31.39%), Postives = 248/462 (53.68%), Query Frame = 2
Query:  245 AAHNGYFSKVQEALNSNIDVNSCNSNGLNALHLASKGGHADIVQFLIDNGADIGAKTRKNNTAIHIASLAGSLEVVKILVKHGANINEQSQTGFTPLYMAAQENHVGVVKFLLDNGADINLSTTDNFTPLAVAIQQGHEETVSILLNKSNFLNSNDISNDIKLPPLHIATRKDDYHAVLLLLHHQEDVQAALTQASLNGFTALHVAAYYNSDKVGRLLLENGAPVDYTSKNNVTALHVAAKWGRNKMVKVLLEFNANVEMSTRDGIRPLHCAASQGHRDICALLIEHKANCNTRTKNGLVPLHMVAQGNHSELVEFFINQNSVNVNETSLDFLTPLHISSHCNNVEVAEALIKHGANVNDRALNGFVALHIAAKQNHVEFVEMLMSNLCMIDTQTESGFTALHIASIIGSESIAKKLVENNCEIDIPDQFDRTSLHMATIFNHFNIVVYLKEHGGSVDKQMK 1630
            AA NG+F  ++  L++   + +   NGL+ +H+A++G H D V+ L+   A+I   T  + T +H+A+  G   + K+L+  GA  N ++  GFTPL++A ++NH+ V+  LL + A I   T    TPL VA   GH   V ILL K    +++++  +    PLH+A+R   +     LL +   V A     + +  T LH AA     ++ +LLLE+ A  + T+    + LH+AA+ G  + V++LL+  A     T+ G  PLH A+  G  D+  LL+E  AN N   KNGL PLH+    N+ ++V   +++   + +  + +  T LHI++  N VEVA +L++HGA+ N  +L G   LH+A+++   + V +L+S    ++   +SG T LH+ +  G   IA  LV+    +    +   T LH+A  + +  +V +L +   +V+ + +
Sbjct:  217 AARNGHFRIIEILLDNGAPIQAKTKNGLSPIHMAAQGDHMDCVKQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKPNSRALNGFTPLHIACKKNHLRVMDLLLKHSASIEAVTESGLTPLHVASFMGHLNIVKILLQKGASPSASNVKVET---PLHMASRSGHFEVAEFLLQNAAPVDAK----AKDDQTPLHCAARMGHKELVKLLLEHKANPNSTTTAGHSPLHIAAREGHVQTVRLLLDMEAQQTKMTKKGFTPLHVASKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVNLLVSKGG-SPHSAARNGYTALHIAAKQNQVEVANSLLQHGASANAESLQGVTPLHLASQEGRPDIVSLLISKQANVNLGNKSGLTPLHLVAQEGHVGIADILVKQGASVYAATRMGYTPLHVACHYGNIKMVKFLLQQQANVNSKTR 670          

HSP 5 Score: 222.246 bits (565), Expect = 1.843e-57
Identity = 134/403 (33.25%), Postives = 209/403 (51.86%), Query Frame = 2
Query:  245 AAHNGYFSKVQEALNSNIDVNSCNSNGLNALHLASKGGHADIVQFLIDNGADIGAKTRKNNTAIHIASLAGSLEVVKILVKHGANINEQSQTGFTPLYMAAQENHVGVVKFLLDNGADINLSTTDNFTPLAVAIQQGHEETVSILLNKSNFLNSNDISNDIKLPPLHIATRKDDYHAVLLLLHHQEDVQAALTQASLNGFTALHVAAYYNSDKVGRLLLENGAPVDYTSKNNVTALHVAAKWGRNKMVKVLLEFNANVEMSTRDGIRPLHCAASQGHRDICALLIEHKANCNTRTKNGLVPLHMVAQGNHSELVEFFINQNSVNVNETSLDFLTPLHISSHCNNVEVAEALIKHGANVNDRALNGFVALHIAAKQNHVEFVEMLMSNLCMIDTQTESGFTALH 1453
            AAH G+    +  L+     NS   NG   LH+A K  H  ++  L+ + A I A T    T +H+AS  G L +VKIL++ GA+ +  +    TPL+MA++  H  V +FLL N A ++    D+ TPL  A + GH+E V +LL      NS   +      PLHIA R+     V LLL    D++A  T+ +  GFT LHVA+ Y    V  LLLE GA  +   KN +T LHVA       +V +L+    +   + R+G   LH AA Q   ++   L++H A+ N  +  G+ PLH+ +Q    ++V   I++ + NVN  +   LTPLH+ +   +V +A+ L+K GA+V      G+  LH+A    +++ V+ L+     ++++T   +   H
Sbjct:  283 AAHCGHHRMAKVLLDKGAKPNSRALNGFTPLHIACKKNHLRVMDLLLKHSASIEAVTESGLTPLHVASFMGHLNIVKILLQKGASPSASNVKVETPLHMASRSGHFEVAEFLLQNAAPVDAKAKDDQTPLHCAARMGHKELVKLLLEHKANPNSTTTAGH---SPLHIAAREGHVQTVRLLL----DMEAQQTKMTKKGFTPLHVASKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVNLLVSKGGSPHSAARNGYTALHIAAKQNQVEVANSLLQHGASANAESLQGVTPLHLASQEGRPDIVSLLISKQA-NVNLGNKSGLTPLHLVAQEGHVGIADILVKQGASVYAATRMGYTPLHVACHYGNIKMVKFLLQQQANVNSKTRVEYIQCH 677          

HSP 6 Score: 188.348 bits (477), Expect = 4.088e-47
Identity = 113/343 (32.94%), Postives = 186/343 (54.23%), Query Frame = 2
Query:  245 AAHNGYFSKVQEALNSNIDVNSCNSNGLNALHLASKGGHADIVQFLIDNGADIGAKTRKNNTAIHIASLAGSLEVVKILVKHGANINEQSQTGFTPLYMAAQENHVGVVKFLLDNGADINLSTTDNFTPLAVAIQQGHEETVSILLNKSNFLNSNDISNDIKLPPLHIATRKDDYHAVLLLLHHQEDVQAALTQASLNGFTALHVAAYYNSDKVGRLLLENGAPVDYTSKNNVTALHVAAKWGRNKMVKVLLEFNANVEMSTRDGIRPLHCAASQGHRDICALLIEHKANCNTRTKNGLVPLHMVAQGNHSELVEFFINQNSVNVN-ETSLDFLTPLHISSHC 1270
            A+  G+ + V+  L      ++ N      LH+AS+ GH ++ +FL+ N A + AK + + T +H A+  G  E+VK+L++H AN N  +  G +PL++AA+E HV  V+ LLD  A     T   FTPL VA + G  +   +LL +    N N    +  L PLH+A   ++   V LL+       +A    + NG+TALH+AA  N  +V   LL++GA  +  S   VT LH+A++ GR  +V +L+   ANV +  + G+ PLH  A +GH  I  +L++  A+    T+ G  PLH+     + ++V+F + Q + NVN +T ++++   +   +C
Sbjct:  349 ASFMGHLNIVKILLQKGASPSASNVKVETPLHMASRSGHFEVAEFLLQNAAPVDAKAKDDQTPLHCAARMGHKELVKLLLEHKANPNSTTTAGHSPLHIAAREGHVQTVRLLLDMEAQQTKMTKKGFTPLHVASKYGKVDVAELLLERG--ANPNAAGKN-GLTPLHVAVHHNNLDVVNLLVSKGGSPHSA----ARNGYTALHIAAKQNQVEVANSLLQHGASANAESLQGVTPLHLASQEGRPDIVSLLISKQANVNLGNKSGLTPLHLVAQEGHVGIADILVKQGASVYAATRMGYTPLHVACHYGNIKMVKFLLQQQA-NVNSKTRVEYIQCHYKDHYC 683          
BLAST of Ankyrin-2 vs. Ensembl Medaka
Match: ENSORLT00000039903.1 (pep primary_assembly:ASM223467v1:15:18469388:18484014:-1 gene:ENSORLG00000030042.1 transcript:ENSORLT00000039903.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 403.29 bits (1035), Expect = 5.095e-125
Identity = 207/423 (48.94%), Postives = 283/423 (66.90%), Query Frame = 2
Query:  236 FLRAAHNGYFSKVQEALNSNIDVNSCNSNGLNALHLASKGGHADIVQFLIDNGADIGAKTRKNNTAIHIASLAGSLEVVKILVKHGANINEQSQTGFTPLYMAAQENHVGVVKFLLDNGADINLSTTDNFTPLAVAIQQGHEETVSILLNKSNFLNSNDISNDIKLPPLHIATRKDDYHAVLLLLH--HQEDVQAALTQASLNGFTALHVAAYYNSDKVGRLLLENGAPVDYTSKNNVTALHVAAKWGRNKMVKVLLEFNANVEMSTRDGIRPLHCAASQGHRDICALLIEHKANCNTRTKNGLVPLHMVAQGNHSELVEFFINQNSVNVNETSLDFLTPLHISSHCNNVEVAEALIKHGANVNDRALNGFVALHIAAKQNHVEFVEMLMSNLCMIDTQTESGFTALHIASIIGSESIAKKLV 1498
            +LRAA  G   KV + L S +++N CN NGLNALHLASK GH ++V  L+  GA + A T+K NTA+HI+SLAG  EVV  LV +GAN+N QSQ GFTPLYMAAQENH+ VV+FLL+N A  +++T D FTPLAVA+QQGH++ VS+LL        ND    ++LP LHIA RKDD  A  LLL   H  DV+      S +GFT LH+AA+Y +  V  LLL   A VD+ ++N++T LHVAAK G + MVK+LL+  A +E  T+DG+ PLHC A  GH  +  +L++  A   ++TKNGL PLHM  QG+H   V+  + Q+ V V++ + D+LT LH+++HC + +VA+ ++   AN N +ALNGF  LHIA K+N V  +E+L+ +   I   TESG T +H+A+ +G E+I   L+
Sbjct:   21 YLRAARAGNLEKVLDYLKSGVEINICNQNGLNALHLASKEGHVEVVAELLKLGASVDAATKKGNTALHISSLAGQAEVVTELVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLENSASQSIATEDGFTPLAVALQQGHDQVVSLLL-------ENDTKGKVRLPALHIAARKDDTKAAALLLQNDHNADVE------SKSGFTPLHIAAHYGNINVATLLLNRAAAVDFMARNDITPLHVAAKRGNSNMVKLLLDRGARIEAKTKDGLTPLHCGARSGHEQVVEILLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLL-QHDVPVDDVTNDYLTALHVAAHCGHYKVAKLIVDKKANPNAKALNGFTPLHIACKKNRVRVMELLLKHGASIQAVTESGLTPIHVAAFMGHENIVSALI 429          

HSP 2 Score: 184.882 bits (468), Expect = 1.650e-49
Identity = 130/439 (29.61%), Postives = 233/439 (53.08%), Query Frame = 2
Query:  860 AAYYNSDKVGRL-----LLENGAPVDYTSKNNVTALHVAAKWGRNKMVKVLLEFNANVEMSTRDGIRPLHCAASQGHRDICALLIEHKANCNTRTKNGLVPLHMVAQGNHSELVEFFINQNSVNVNETSLDFLTPLHISSHCNNVEVAEALIKHGANVNDRALNGFVALHIAAKQNHVEFVEMLMSNLCMIDTQTESGFTALHIASIIGSESIAKKLVENNCEIDIPDQFDRTSLHMATIFNHFNIVVYLKEHGGSVDKQMKTGETCLMLAIKSEHKAIVEYLINQGASMSVSDSWGLTALHWATLVVRENILNSNCTDININEAIEIFKFVLDGCSRFDINRTTKNGISSLHLAADCGCLEIVHLLLDKGADINIISINGTTPLHIACKXXXXXXXXXXXXXXXXXXXTMAYVSCPWSPMHFSSYFGSVDSTILLISH 2161
            A+Y  + + G L      L++G  ++  ++N + ALH+A+K G  ++V  LL+  A+V+ +T+ G   LH ++  G  ++   L+ + AN N +++NG  PL+M AQ NH E+V F + +NS + +  + D  TPL ++    + +V   L+++      R      ALHIAA+++  +   +L+ N    D +++SGFT LHIA+  G+ ++A  L+     +D   + D T LH+A    + N+V  L + G  ++ + K G T L    +S H+ +VE L+++GA +      GL+ LH AT   + + LN  C  + +   + +             +  T + +++LH+AA CG  ++  L++DK A+ N  ++NG TPLHIACK    N + V+   L + +   A      +P+H +++ G  +    LI+H
Sbjct:   19 ASYLRAARAGNLEKVLDYLKSGVEINICNQNGLNALHLASKEGHVEVVAELLKLGASVDAATKKGNTALHISSLAGQAEVVTELVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLL-ENSASQSIATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVR----LPALHIAARKDDTKAAALLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFMARNDITPLHVAAKRGNSNMVKLLLDRGARIEAKTKDGLTPLHCGARSGHEQVVEILLDRGAPILSKTKNGLSPLHMAT---QGDHLN--CVQLLLQHDVPV-------------DDVTNDYLTALHVAAHCGHYKVAKLIVDKKANPNAKALNGFTPLHIACK---KNRVRVMELLLKHGASIQAVTESGLTPIHVAAFMGHENIVSALINH 431          

HSP 3 Score: 158.303 bits (399), Expect = 1.927e-40
Identity = 125/425 (29.41%), Postives = 210/425 (49.41%), Query Frame = 2
Query:  710 DISNDIKLPPLHIATRKDDYHAVLLLLHHQEDVQAALTQASLNGFTALHVAAYYNSDKVGRLLLENGAPVDYTSKNNVTALHVAAKWGRNKMVKVLLEFNANVEMSTRDGIRPLHCAASQGHRDICALLIEHKANCNTRTKNGLVPLHMVAQGNHSELVEFFINQNSVNVNETSLDFLTPLHISSHCNNVEVAEALIKHGANVNDRALNGFVALHIAAKQNHVEFVEMLMSNLCMIDTQTESGFTALHIASIIGSESIAKKLVENNCEIDIPDQFDRTSLHMATIFNHFNIVVYLKEHGGSVDKQMKTGETCLMLAIKSEHKAIVEYLINQGASMSVSDSWGLTALHWATLVVRENILNSNCTDININEAIEIFKFVLD-GCSRFDINRTTKNGISSLHLAADCGCLEIVHLLLDKGADINIISI 1981
            +I N   L  LH+A+++     V  LL     + A++  A+  G TALH+++     +V   L+ NGA V+  S+N  T L++AA+    ++V+ LLE +A+  ++T DG  PL  A  QGH  + +LL+E+    +T+ K  L  LH+ A+ + ++     + QN  N +  S    TPLHI++H  N+ VA  L+   A V+  A N    LH+AAK+ +   V++L+     I+ +T+ G T LH  +  G E + + L++    I    +   + LHMAT  +H N V  L +H   VD       T L +A    H  + + ++++ A+ +     G T LH A    R                + + + +L  G S   I   T++G++ +H+AA  G   IV  L++ GA  N  ++
Sbjct:   44 NICNQNGLNALHLASKEGHVEVVAELL----KLGASVDAATKKGNTALHISSLAGQAEVVTELVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLENSASQSIATEDGFTPLAVALQQGHDQVVSLLLEN----DTKGKVRLPALHIAARKDDTKAAALLL-QNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFMARNDITPLHVAAKRGNSNMVKLLLDRGARIEAKTKDGLTPLHCGARSGHEQVVEILLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHDVPVDDVTNDYLTALHVAAHCGHYKVAKLIVDKKANPNAKALNGFTPLHIACKKNR----------------VRVMELLLKHGAS---IQAVTESGLTPIHVAAFMGHENIVSALINHGASPNTTNV 440          

HSP 4 Score: 111.309 bits (277), Expect = 8.582e-25
Identity = 107/414 (25.85%), Postives = 177/414 (42.75%), Query Frame = 2
Query: 1259 SSHCNNVEVAEALIKHGANVNDRALNGFVALHIAAKQNHVEFVEMLMSNLCMIDTQTESGFTALHIASIIGSESIAKKLVENNCEIDIPDQFDRTSLHMATIFNHFNIVVYLKEHGGSVDKQMKTGETCLMLAIKSEHKAIVEYLINQGASMSVSDSWGLTALHWA-----TLVVRENILNSNCTDININEA------------IEIFKFVLDGCSRFDINRTTKNGISSLHLAADCGCLEIVHLLLDKGADINIISINGTTPLHIACKXXXXXXXXXXXXXXXXXXXTMAYVSCPWSPMHFSSYFGSVDSTILLISHE-------NDQTSV-------------------REKLRQRTPNGNTCLHLAVQQLQTDIVRVLLENDADFNLENEDGLSAFDMAKIVDDETIINLL 2371
            ++   N+E     +K G  +N    NG  ALH+A+K+ HVE V  L+     +D  T+ G TALHI+S+ G   +  +LV N   ++   Q   T L+MA   NH  +V +L E+  S     + G T L +A++  H  +V  L+       V     L ALH A     T      + N +  D+                 I +   +L+  +  D     +N I+ LH+AA  G   +V LLLD+GA I   + +G TPLH   +   S    V+   L   +  ++      SP+H ++    ++   LL+ H+       ND  +                    +     +  NG T LH+A ++ +  ++ +LL++ A      E GL+   +A  +  E I++ L
Sbjct:   24 AARAGNLEKVLDYLKSGVEINICNQNGLNALHLASKEGHVEVVAELLKLGASVDAATKKGNTALHISSLAGQAEVVTELVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLENSASQSIATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVR----LPALHIAARKDDTKAAALLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDF--MARNDITPLHVAAKRGNSNMVKLLLDRGARIEAKTKDGLTPLHCGAR---SGHEQVVEILLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHDVPVDDVTNDYLTALHVAAHCGHYKVAKLIVDKKANPNAKALNGFTPLHIACKKNRVRVMELLLKHGASIQAVTESGLTPIHVAAFMGHENIVSAL 428          

HSP 5 Score: 95.9005 bits (237), Expect = 1.023e-19
Identity = 55/157 (35.03%), Postives = 88/157 (56.05%), Query Frame = 2
Query:  245 AAHNGYFSKVQEALNSNIDVNSCNSNGLNALHLASKGGHADIVQFLIDNGADIGAKTRKNNTAIHIASLAGSLEVVKILVKHGANINEQSQTGFTPLYMAAQENHVGVVKFLLDNGADINLSTTDNFTPLAVAIQQGHEETVSILLNKSNFLNSNDI 715
             A +G+   V+  L+    + S   NGL+ LH+A++G H + VQ L+ +   +   T    TA+H+A+  G  +V K++V   AN N ++  GFTPL++A ++N V V++ LL +GA I   T    TP+ VA   GHE  VS L+N     N+ ++
Sbjct:  284 GARSGHEQVVEILLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHDVPVDDVTNDYLTALHVAAHCGHYKVAKLIVDKKANPNAKALNGFTPLHIACKKNRVRVMELLLKHGASIQAVTESGLTPIHVAAFMGHENIVSALINHGASPNTTNV 440          
BLAST of Ankyrin-2 vs. Planmine SMEST
Match: SMESG000058557.1 (SMESG000058557.1)

HSP 1 Score: 4452.12 bits (11546), Expect = 0.000e+0
Identity = 2316/2355 (98.34%), Postives = 2316/2355 (98.34%), Query Frame = 2
Query:   14 MFSCFGKNDHKLPPEDPGNISPISNENSLASPNLKKNSKASNVSRXXXXXXXXXXXXIDHLIFISFS*SEKEHIFLRAAHNGYFSKVQEALNSNIDVNSCNSNGLNALHLASKGGHADIVQFLIDNGADIGAKTRKNNTAIHIASLAGSLEVVKILVKHGANINEQSQTGFTPLYMAAQENHVGVVKFLLDNGADINLSTTDNFTPLAVAIQQGHEETVSILLNKSNFLNSNDISNDIKLPPLHIATRKDDYHAVLLLLHHQEDVQAALTQASLNGFTALHVAAYYNSDKVGRLLLENGAPVDYTSKNNVTALHVAAKWGRNKMVKVLLEFNANVEMSTRDGIRPLHCAASQGHRDICALLIEHKANCNTRTKNGLVPLHMVAQGNHSELVEFFINQNSVNVNETSLDFLTPLHISSHCNNVEVAEALIKHGANVNDRALNGFVALHIAAKQNHVEFVEMLMSNLCMIDTQTESGFTALHIASIIGSESIAKKLVENNCEIDIPDQFDRTSLHMATIFNHFNIVVYLKEHGGSVDKQMKTGETCLMLAIKSEHKAIVEYLINQGASMSVSDSWGLTALHWATLVVRENILNSNCTDININEAIEIFKFVLDGCSRFDINRTTKNGISSLHLAADCGCLEIVHLLLDKGADINIISINGTTPLHIACKXXXXXXXXXXXXXXXXXXXTMAYVSCPWSPMHFSSYFGSVDSTILLISHENDQTSVREKLRQRTPNGNTCLHLAVQQLQTDIVRVLLENDADFNLENEDGLSAFDMAKIVDDETIINLLGIDTTEMMTTDDKVYLFQREEFSDEEQLETLYMDSLNELEFFGIGKNSGEKCELQLSIMSLLDYATTIDSIRRADMSLKINNSLNRYRNITLSEIKTRELLIAAQPASMISTISSTNTEMSPFDVEKWDFHRVTDLPVNSGFLVSFLVDARGGYMQAQRMPQMKIFVPPDAAPAPTRIICHLLRPEGVANLPGMNDCDGFASRILQIHSSCSRFQKPILIEMPYIALLKSNDREIVILKKNADSDTWKKHSNTFTEETLKAEFGSLYESITPVDQLESNRICRIITTDVPTYFSLISQFQRDVNMIGPDGGYIESKTDKRIKLTFPQGALMKKIQIGLEVQHVDPGIINHVVGDNHKISLSPIITVEPKRRKFRDLIEIQMGLPKGVTKNDIQDLKLLFSISEYITDWEDVTSSTELVLLENTNCMAHSTKISARVWLIYAPNVPNISELANKIYALHCPTPYVGKFLSYARRHDQEECQIRCLLITDDTPDKTLECQESFELIATGPEVEVINKLQYQIECAGNIVAVTKSDEAILFPVQSFVENRITLPIRVRNQDEPFQGKIAFIPHFQSLSKQIVKXXXXXXXXXXXXXXXMVGSFRNPDRKHRVKNATLERIKGCQAIAKTELDLKSVADAVGADWRXXXXXXXXXXDDINLVLNENCTDEEKAFMTLINWQTVLGFKATGNELNRALRQIGREDVVKSCIGDISFVEDEAEVKSAIEQLNNDDKKTHDECWDDIIASKGKPSGYNESVDDSMIVETGDDWSQSHREXXXXXXXXXXXXVGESTHDSESEIKPLVDPSKAVTLIDRTSSEKTAAFLLLVNQLDEVLPHPVIHESYNSADKIEACEESVVKSFKTDKQVANVDQTISLLNLINCQINDDFVHVDTVIDLDDFFPEPQEIDVDTLSQSDLNDYGENRDQNEFVLEVCIPEDKVEGLIKNYEGCEITNTLMNMSRDENPKVNDKILQIDLLKRRRYTLDKARLLQHNETFHFHAPVSSLRRCFSVDSRRGRGIFSLCSQVNSLHEASILERGDWPSNEDLKNIQTLQIGVEDSDSPLDTLDNKNDIEISEIIQTDIKTEEENSKIESKSYLKDILPDSPITXXXXXXXXXXXXQSNEKKEVLEPRIVAGPLMSTMPSHLDIDLDTISPVTAGNFVYTQPVLFDDDKIVAENDYDTEKKEDINICYKNENPDNFKVDNSEVHSTSRYSVAGQTACNAPFTEDKTVVNKDFELLNQQNTNLKETEITYNEPVDGKENVCDNYYKNLELETKMNVNQNFECPIQMKADVEIDSEHSGQFHNTDTDVKGVLNQLATDVVDQELLKDDLQSLDKECVKPYDCNIDINACTNESLSYAEPYSTDYQFXXXXXXXXXXXXXXXXXXRTPESYRDDENINESKVNNNPQFETEKEISIRSDNFVYDPISDEFVTLDNDEALNQPEKHSVLHEVIESDPQIQTXXXXXXXXLPDGRIVNRKITRKQISRIITEKVTRDIEPENEENIDSKVTFXXXXXXXXXXXXXXDGTILXXXXXXXXXXXXXXXXXXXEKEISKDENSADSAAMRQSEALTDN 7078
            MFSCFGKNDHKLPPEDPGNISPISNENSLASPNLKKNSKASN                          SEKEHIFLRAAHNGYFSKVQEALNSNIDVNSCNSNGLNALHLASKGGHADIVQFLIDNGADIGAKTRKNNTAIHIASLAGSLEVVKILVKHGANINEQSQTGFTPLYMAAQENHVGVVKFLLDNGADINLSTTDNFTPLAVAIQQGHEETVSILLNKSNFLNSNDISNDIKLPPLHIATRKDDYHAVLLLLHHQEDVQAALTQASLNGFTALHVAAYYNSDKVGRLLLENGAPVDYTSKNNVTALHVAAKWGRNKMVKVLLEFNANVEMSTRDGIRPLHCAASQGHRDICALLIEHKANCNTRTKNGLVPLHMVAQGNHSELVEFFINQNSVNVNETSLDFLTPLHISSHCNNVEVAEALIKHGANVNDRALNGFVALHIAAKQNHVEFVEMLMSNLCMIDTQTESGFTALHIASIIGSESIAKKLVENNCEIDIPDQFDRTSLHMATIFNHFNIVVYLKEHGGSVDKQMKTGETCLMLAIKSEHKAIVEYLINQGASMSVSDSWGLTALHWATLVVRENILNSNCTDININEAIEIFKFVLDGCSRFDINRTTKNGISSLHLAADCGCLEIVHLLLDKGADINIISINGTTPLHIACKNNNSNVLLVLLESLSYDSLTMAYVSCPWSPMHFSSYFGSVDSTILLISHENDQTSVREKLRQRTPNGNTCLHLAVQQLQTDIVRVLLENDADFNLENEDGLSAFDMAKIVDDETIINLLGIDTTEMMTTDDKVYLFQREEFSDEEQLETLYMDSLNELEFFGIGKNSGEKCELQLSIMSLLDYATTIDSIRRADMSLKINNSLNRYRNITLSEIKTRELLIAAQPASMISTISSTNTEMSPFDVEKWDFHRVTDLPVNSGFLVSFLVDARGGYMQAQRMPQMKIFVPPDAAPAPTRIICHLLRPEGVANLPGMNDCDGFASRILQIHSSCSRFQKPILIEMPYIALLKSNDREIVILKKNADSDTWKKHSNTFTEETLKAEFGSLYESITPVDQLESNRICRIITTDVPTYFSLISQFQRDVNMIGPDGGYIESKTDKRIKLTFPQGALMKKIQIGLEVQHVDPGIINHVVGDNHKISLSPIITVEPKRRKFRDLIEIQMGLPKGVTKNDIQDLKLLFSISEYITDWEDVTSSTELVLLENTNCMAHSTKISARVWLIYAPNVPNISELANKIYALHCPTPYVGKFLSYARRHDQEECQIRCLLITDDTPDKTLECQESFELIATGPEVEVINKLQYQIECAGNIVAVTKSDEAILFPVQSFVENRITLPIRVRNQDEPFQGKIAFIPHFQSLSKQIVKPITTLDIIIPEIIIDMVGSFRNPDRKHRVKNATLERIKGCQAIAKTELDLKSVADAVGADWRALAEELELEADDINLVLNENCTDEEKAFMTLINWQTVLGFKATGNELNRALRQIGREDVVKSCIGDISFVEDEAEVKSAIEQLNNDDKKTHDECWDDIIASKGKPSGYNESVDDSMIVETGDDWSQSHRESKLSDISDDKSLVGESTHDSESEIKPLVDPSKAVTLIDRTSSEKTAAFLLLVNQLDEVLPHPVIHESYNSADKIEACEESVVKSFKTDKQVANVDQTISLLNLINCQINDDFVHVDTVIDLDDFFPEPQEIDVDTLSQSDLNDYGENRDQNEFVLEVCIPEDKVEGLIKNYEGCEITNTLMNMSRDENPKVNDKILQIDLLKRRRYTLDKARLLQHNETFHFHAPVSSLRRCFSVDSRRGRGIFSLCSQVNSLHEASILERGDWPSNEDLKNIQTLQIGVEDSDSPLDTLDNKNDIEISEIIQTDIKTEEENSKIESKSYLKDILPDSPITDLDDLSLCDELEQSNEKKEVLEPRIVAGPLMSTMPSHLDIDLDTISPVTAGNFVYTQPVLFDDDKIVAENDYDTEKKEDINICYKNENPDNFKVDNSEVHSTSRYSVAGQTACNAPFTEDKTVVNKDFELLNQQNTNLKETEITYNEPVD             ELETKMNVNQNFECPIQMKADVEIDSEHSGQFHNTDTDVKGVLNQLATDVVDQELLKDDLQSLDKECVKPYDCNIDINACTNESLSYAEPYSTDYQFIEKNIVEKEESEKNVENERTPESYRDDENINESKVNNNPQFETEKEISIRSDNFVYDPISDEFVTLDNDEALNQPEKHSVLHEVIESDPQIQTEVEEEVEVLPDGRIVNRKITRKQISRIITEKVTRDIEPENEENIDSKVTFESPPEVIETEEELPDGTILKRTISTSMKTTSTTAKTVTEKEISKDENSADSAAMRQSEALTDN
Sbjct:    1 MFSCFGKNDHKLPPEDPGNISPISNENSLASPNLKKNSKASN--------------------------SEKEHIFLRAAHNGYFSKVQEALNSNIDVNSCNSNGLNALHLASKGGHADIVQFLIDNGADIGAKTRKNNTAIHIASLAGSLEVVKILVKHGANINEQSQTGFTPLYMAAQENHVGVVKFLLDNGADINLSTTDNFTPLAVAIQQGHEETVSILLNKSNFLNSNDISNDIKLPPLHIATRKDDYHAVLLLLHHQEDVQAALTQASLNGFTALHVAAYYNSDKVGRLLLENGAPVDYTSKNNVTALHVAAKWGRNKMVKVLLEFNANVEMSTRDGIRPLHCAASQGHRDICALLIEHKANCNTRTKNGLVPLHMVAQGNHSELVEFFINQNSVNVNETSLDFLTPLHISSHCNNVEVAEALIKHGANVNDRALNGFVALHIAAKQNHVEFVEMLMSNLCMIDTQTESGFTALHIASIIGSESIAKKLVENNCEIDIPDQFDRTSLHMATIFNHFNIVVYLKEHGGSVDKQMKTGETCLMLAIKSEHKAIVEYLINQGASMSVSDSWGLTALHWATLVVRENILNSNCTDININEAIEIFKFVLDGCSRFDINRTTKNGISSLHLAADCGCLEIVHLLLDKGADINIISINGTTPLHIACKNNNSNVLLVLLESLSYDSLTMAYVSCPWSPMHFSSYFGSVDSTILLISHENDQTSVREKLRQRTPNGNTCLHLAVQQLQTDIVRVLLENDADFNLENEDGLSAFDMAKIVDDETIINLLGIDTTEMMTTDDKVYLFQREEFSDEEQLETLYMDSLNELEFFGIGKNSGEKCELQLSIMSLLDYATTIDSIRRADMSLKINNSLNRYRNITLSEIKTRELLIAAQPASMISTISSTNTEMSPFDVEKWDFHRVTDLPVNSGFLVSFLVDARGGYMQAQRMPQMKIFVPPDAAPAPTRIICHLLRPEGVANLPGMNDCDGFASRILQIHSSCSRFQKPILIEMPYIALLKSNDREIVILKKNADSDTWKKHSNTFTEETLKAEFGSLYESITPVDQLESNRICRIITTDVPTYFSLISQFQRDVNMIGPDGGYIESKTDKRIKLTFPQGALMKKIQIGLEVQHVDPGIINHVVGDNHKISLSPIITVEPKRRKFRDLIEIQMGLPKGVTKNDIQDLKLLFSISEYITDWEDVTSSTELVLLENTNCMAHSTKISARVWLIYAPNVPNISELANKIYALHCPTPYVGKFLSYARRHDQEECQIRCLLITDDTPDKTLECQESFELIATGPEVEVINKLQYQIECAGNIVAVTKSDEAILFPVQSFVENRITLPIRVRNQDEPFQGKIAFIPHFQSLSKQIVKPITTLDIIIPEIIIDMVGSFRNPDRKHRVKNATLERIKGCQAIAKTELDLKSVADAVGADWRALAEELELEADDINLVLNENCTDEEKAFMTLINWQTVLGFKATGNELNRALRQIGREDVVKSCIGDISFVEDEAEVKSAIEQLNNDDKKTHDECWDDIIASKGKPSGYNESVDDSMIVETGDDWSQSHRESKLSDISDDKSLVGESTHDSESEIKPLVDPSKAVTLIDRTSSEKTAAFLLLVNQLDEVLPHPVIHESYNSADKIEACEESVVKSFKTDKQVANVDQTISLLNLINCQINDDFVHVDTVIDLDDFFPEPQEIDVDTLSQSDLNDYGENRDQNEFVLEVCIPEDKVEGLIKNYEGCEITNTLMNMSRDENPKVNDKILQIDLLKRRRYTLDKARLLQHNETFHFHAPVSSLRRCFSVDSRRGRGIFSLCSQVNSLHEASILERGDWPSNEDLKNIQTLQIGVEDSDSPLDTLDNKNDIEISEIIQTDIKTEEENSKIESKSYLKDILPDSPITDLDDLSLCDELEQSNEKKEVLEPRIVAGPLMSTMPSHLDIDLDTISPVTAGNFVYTQPVLFDDDKIVAENDYDTEKKEDINICYKNENPDNFKVDNSEVHSTSRYSVAGQTACNAPFTEDKTVVNKDFELLNQQNTNLKETEITYNEPVD-------------ELETKMNVNQNFECPIQMKADVEIDSEHSGQFHNTDTDVKGVLNQLATDVVDQELLKDDLQSLDKECVKPYDCNIDINACTNESLSYAEPYSTDYQFIEKNIVEKEESEKNVENERTPESYRDDENINESKVNNNPQFETEKEISIRSDNFVYDPISDEFVTLDNDEALNQPEKHSVLHEVIESDPQIQTEVEEEVEVLPDGRIVNRKITRKQISRIITEKVTRDIEPENEENIDSKVTFESPPEVIETEEELPDGTILKRTISTSMKTTSTTAKTVTEKEISKDENSADSAAMRQSEALTDN 2316          
BLAST of Ankyrin-2 vs. Planmine SMEST
Match: SMESG000058557.1 (SMESG000058557.1)

HSP 1 Score: 2724.12 bits (7060), Expect = 0.000e+0
Identity = 1465/1498 (97.80%), Postives = 1466/1498 (97.86%), Query Frame = 2
Query: 2795 FLVSFLVDARGGYMQAQRMPQMKIFVPPDAAPAPTRIICHLLRPEGVANLPGMNDCDGFASRILQIHSSCSRFQKPILIEMPYIALLKSNDREIVILKKNADSDTWKKHSNTFTEETLKAEFGSLYESITPVDQLESNRICRIITTDVPTYFSLISQFQRDVNMIGPDGGYIESKTDKRIKLTFPQGALMKKIQIGLEVQHVDPGIINHVVGDNHKISLSPIITVEPKRRKFRDLIEIQMGLPKGVTKNDIQDLKLLFSISEYITDWEDVTSSTELVLLENTNCMAHSTKISARVWLIYAPNVPNISELANKIYALHCPTPYVGKFLSYARRHDQEECQIRCLLITDDTPDKTLECQESFELIATGPEVEVINKLQYQIECAGNIVAVTKSDEAILFPVQSFVENRITLPIRVRNQDEPFQGKIAFIPHFQSLSKQIVKXXXXXXXXXXXXXXXMVGSFRNPDRKHRVKNATLERIKGCQAIAKTELDLKSVADAVGADWRXXXXXXXXXXDDINLVLNENCTDEEKAFMTLINWQTVLGFKATGNELNRALRQIGREDVVKSCIGDISFVEDEAEVKSAIEQLNNDDKKTHDECWDDIIASKGKPSGYNESVDDSMIVETGDDWSQSHREXXXXXXXXXXXXVGESTHDSESEIKPLVDPSKAVTLIDRTSSEKTAAFLLLVNQLDEVLPHPVIHESYNSADKIEACEESVVKSFKTDKQVANVDQTISLLNLINCQINDDFVHVDTVIDLDDFFPEPQEIDVDTLSQSDLNDYGENRDQNEFVLEVCIPEDKVEGLIKNYEGCEITNTLMNMSRDENPKVNDKILQIDLLKRRRYTLDKARLLQHNETFHFHAPVSSLRRCFSVDSRRGRGIFSLCSQVNSLHEASILERGDWPSNEDLKNIQTLQIGVEDSDSPLDTLDNKNDIEISEIIQTDIKTEEENSKIESKSYLKDILPDSPITXXXXXXXXXXXXQSNEKKEVLEPRIVAGPLMSTMPSHLDIDLDTISPVTAGNFVYTQPVLFDDDKIVAENDYDTEKKEDINICYKNENPDNFKVDNSEVHSTSRYSVAGQTACNAPFTEDKTVVNKDFELLNQQNTNLKETEITYNEPVDGKENVCDNYYKNLELETKMNVNQNFECPIQMKADVEIDSEHSGQFHNTDTDVKGVLNQLATDVVDQELLKDDLQSLDKECVKPYDCNIDINACTNESLSYAEPYSTDYQFXXXXXXXXXXXXXXXXXXRTPESYRDDENINESKVNNNPQFETEKEISIRSDNFVYDPISDEFVTLDNDEALNQPEKHSVLHEVIESDPQIQTXXXXXXXXLPDGRIVNRKITRKQISRIITEKVTRDIEPENEENIDSKVTFXXXXXXXXXXXXXXDGTILXXXXXXXXXXXXXXXXXXXEKEISKDENSADSAAMRQSEALTDNGMDSSNTVSS-------------LISDSAMYGPEESESDSRSTMTIEENLSNLDLTFEEYETADESFESD 7249
            FLVSFLVDARGGYMQAQRMPQMKIFVPPDAAPAPTRIICHLLRPEGVANLPGMNDCDGFASRILQIHSSCSRFQKPILIEMPYIALLKSNDREIVILKKNADSDTWKKHSNTFTEETLKAEFGSLYESITPVDQLESNRICRIITTDVPTYFSLISQFQRDVNMIGPDGGYIESKTDKRIKLTFPQGALMKKIQIGLEVQHVDPGIINHVVGDNHKISLSPIITVEPKRRKFRDLIEIQMGLPKGVTKNDIQDLKLLFSISEYITDWEDVTSSTELVLLENTNCMAHSTKISARVWLIYAPNVPNISELANKIYALHCPTPYVGKFLSYARRHDQEECQIRCLLITDDTPDKTLECQESFELIATGPEVEVINKLQYQIECAGNIVAVTKSDEAILFPVQSFVENRITLPIRVRNQDEPFQGKIAFIPHFQSLSKQIVKPITTLDIIIPEIIIDMVGSFRNPDRKHRVKNATLERIKGCQAIAKTELDLKSVADAVGADWRALAEELELEADDINLVLNENCTDEEKAFMTLINWQTVLGFKATGNELNRALRQIGREDVVKSCIGDISFVEDEAEVKSAIEQLNNDDKKTHDECWDDIIASKGKPSGYNESVDDSMIVETGDDWSQSHRESKLSDISDDKSLVGESTHDSESEIKPLVDPSKAVTLIDRTSSEKTAAFLLLVNQLDEVLPHPVIHESYNSADKIEACEESVVKSFKTDKQVANVDQTISLLNLINCQINDDFVHVDTVIDLDDFFPEPQEIDVDTLSQSDLNDYGENRDQNEFVLEVCIPEDKVEGLIKNYEGCEITNTLMNMSRDENPKVNDKILQIDLLKRRRYTLDKARLLQHNETFHFHAPVSSLRRCFSVDSRRGRGIFSLCSQVNSLHEASILERGDWPSNEDLKNIQTLQIGVEDSDSPLDTLDNKNDIEISEIIQTDIKTEEENSKIESKSYLKDILPDSPITDLDDLSLCDELEQSNEKKEVLEPRIVAGPLMSTMPSHLDIDLDTISPVTAGNFVYTQPVLFDDDKIVAENDYDTEKKEDINICYKNENPDNFKVDNSEVHSTSRYSVAGQTACNAPFTEDKTVVNKDFELLNQQNTNLKETEITYNEPVD             ELETKMNVNQNFECPIQMKADVEIDSEHSGQFHNTDTDVKGVLNQLATDVVDQELLKDDLQSLDKECVKPYDCNIDINACTNESLSYAEPYSTDYQFIEKNIVEKEESEKNVENERTPESYRDDENINESKVNNNPQFETEKEISIRSDNFVYDPISDEFVTLDNDEALNQPEKHSVLHEVIESDPQIQTEVEEEVEVLPDGRIVNRKITRKQISRIITEKVTRDIEPENEENIDSKVTFESPPEVIETEEELPDGTILKRTISTSMKTTSTTAKTVTEKEISKDENSADSAAMRQSEALTDN +    TV S             LISDSAMYGPEESESDSRSTMTIEENLSNLDLTFEEYETADESFESD
Sbjct:   10 FLVSFLVDARGGYMQAQRMPQMKIFVPPDAAPAPTRIICHLLRPEGVANLPGMNDCDGFASRILQIHSSCSRFQKPILIEMPYIALLKSNDREIVILKKNADSDTWKKHSNTFTEETLKAEFGSLYESITPVDQLESNRICRIITTDVPTYFSLISQFQRDVNMIGPDGGYIESKTDKRIKLTFPQGALMKKIQIGLEVQHVDPGIINHVVGDNHKISLSPIITVEPKRRKFRDLIEIQMGLPKGVTKNDIQDLKLLFSISEYITDWEDVTSSTELVLLENTNCMAHSTKISARVWLIYAPNVPNISELANKIYALHCPTPYVGKFLSYARRHDQEECQIRCLLITDDTPDKTLECQESFELIATGPEVEVINKLQYQIECAGNIVAVTKSDEAILFPVQSFVENRITLPIRVRNQDEPFQGKIAFIPHFQSLSKQIVKPITTLDIIIPEIIIDMVGSFRNPDRKHRVKNATLERIKGCQAIAKTELDLKSVADAVGADWRALAEELELEADDINLVLNENCTDEEKAFMTLINWQTVLGFKATGNELNRALRQIGREDVVKSCIGDISFVEDEAEVKSAIEQLNNDDKKTHDECWDDIIASKGKPSGYNESVDDSMIVETGDDWSQSHRESKLSDISDDKSLVGESTHDSESEIKPLVDPSKAVTLIDRTSSEKTAAFLLLVNQLDEVLPHPVIHESYNSADKIEACEESVVKSFKTDKQVANVDQTISLLNLINCQINDDFVHVDTVIDLDDFFPEPQEIDVDTLSQSDLNDYGENRDQNEFVLEVCIPEDKVEGLIKNYEGCEITNTLMNMSRDENPKVNDKILQIDLLKRRRYTLDKARLLQHNETFHFHAPVSSLRRCFSVDSRRGRGIFSLCSQVNSLHEASILERGDWPSNEDLKNIQTLQIGVEDSDSPLDTLDNKNDIEISEIIQTDIKTEEENSKIESKSYLKDILPDSPITDLDDLSLCDELEQSNEKKEVLEPRIVAGPLMSTMPSHLDIDLDTISPVTAGNFVYTQPVLFDDDKIVAENDYDTEKKEDINICYKNENPDNFKVDNSEVHSTSRYSVAGQTACNAPFTEDKTVVNKDFELLNQQNTNLKETEITYNEPVD-------------ELETKMNVNQNFECPIQMKADVEIDSEHSGQFHNTDTDVKGVLNQLATDVVDQELLKDDLQSLDKECVKPYDCNIDINACTNESLSYAEPYSTDYQFIEKNIVEKEESEKNVENERTPESYRDDENINESKVNNNPQFETEKEISIRSDNFVYDPISDEFVTLDNDEALNQPEKHSVLHEVIESDPQIQTEVEEEVEVLPDGRIVNRKITRKQISRIITEKVTRDIEPENEENIDSKVTFESPPEVIETEEELPDGTILKRTISTSMKTTSTTAKTVTEKEISKDENSADSAAMRQSEALTDN-VSGKPTVKSRKNKNKKKSNKKYLISDSAMYGPEESESDSRSTMTIEENLSNLDLTFEEYETADESFESD 1493          
BLAST of Ankyrin-2 vs. Planmine SMEST
Match: SMESG000058557.1 (SMESG000058557.1)

HSP 1 Score: 2715.64 bits (7038), Expect = 0.000e+0
Identity = 1460/1493 (97.79%), Postives = 1463/1493 (97.99%), Query Frame = 2
Query: 2795 FLVSFLVDARGGYMQAQRMPQMKIFVPPDAAPAPTRIICHLLRPEGVANLPGMNDCDGFASRILQIHSSCSRFQKPILIEMPYIALLKSNDREIVILKKNADSDTWKKHSNTFTEETLKAEFGSLYESITPVDQLESNRICRIITTDVPTYFSLISQFQRDVNMIGPDGGYIESKTDKRIKLTFPQGALMKKIQIGLEVQHVDPGIINHVVGDNHKISLSPIITVEPKRRKFRDLIEIQMGLPKGVTKNDIQDLKLLFSISEYITDWEDVTSSTELVLLENTNCMAHSTKISARVWLIYAPNVPNISELANKIYALHCPTPYVGKFLSYARRHDQEECQIRCLLITDDTPDKTLECQESFELIATGPEVEVINKLQYQIECAGNIVAVTKSDEAILFPVQSFVENRITLPIRVRNQDEPFQGKIAFIPHFQSLSKQIVKXXXXXXXXXXXXXXXMVGSFRNPDRKHRVKNATLERIKGCQAIAKTELDLKSVADAVGADWRXXXXXXXXXXDDINLVLNENCTDEEKAFMTLINWQTVLGFKATGNELNRALRQIGREDVVKSCIGDISFVEDEAEVKSAIEQLNNDDKKTHDECWDDIIASKGKPSGYNESVDDSMIVETGDDWSQSHREXXXXXXXXXXXXVGESTHDSESEIKPLVDPSKAVTLIDRTSSEKTAAFLLLVNQLDEVLPHPVIHESYNSADKIEACEESVVKSFKTDKQVANVDQTISLLNLINCQINDDFVHVDTVIDLDDFFPEPQEIDVDTLSQSDLNDYGENRDQNEFVLEVCIPEDKVEGLIKNYEGCEITNTLMNMSRDENPKVNDKILQIDLLKRRRYTLDKARLLQHNETFHFHAPVSSLRRCFSVDSRRGRGIFSLCSQVNSLHEASILERGDWPSNEDLKNIQTLQIGVEDSDSPLDTLDNKNDIEISEIIQTDIKTEEENSKIESKSYLKDILPDSPITXXXXXXXXXXXXQSNEKKEVLEPRIVAGPLMSTMPSHLDIDLDTISPVTAGNFVYTQPVLFDDDKIVAENDYDTEKKEDINICYKNENPDNFKVDNSEVHSTSRYSVAGQTACNAPFTEDKTVVNKDFELLNQQNTNLKETEITYNEPVDGKENVCDNYYKNLELETKMNVNQNFECPIQMKADVEIDSEHSGQFHNTDTDVKGVLNQLATDVVDQELLKDDLQSLDKECVKPYDCNIDINACTNESLSYAEPYSTDYQFXXXXXXXXXXXXXXXXXXRTPESYRDDENINESKVNNNPQFETEKEISIRSDNFVYDPISDEFVTLDNDEALNQPEKHSVLHEVIESDPQIQTXXXXXXXXLPDGRIVNRKITRKQISRIITEKVTRDIEPENEENIDSKVTFXXXXXXXXXXXXXXDGTILXXXXXXXXXXXXXXXXXXXEKEISKDENSADSAAMRQSEALTDNGMDSSNTVSSLISDS--------AMYGPEESESDSRSTMTIEENLSNLDLTFEEYETADESFESD 7249
            FLVSFLVDARGGYMQAQRMPQMKIFVPPDAAPAPTRIICHLLRPEGVANLPGMNDCDGFASRILQIHSSCSRFQKPILIEMPYIALLKSNDREIVILKKNADSDTWKKHSNTFTEETLKAEFGSLYESITPVDQLESNRICRIITTDVPTYFSLISQFQRDVNMIGPDGGYIESKTDKRIKLTFPQGALMKKIQIGLEVQHVDPGIINHVVGDNHKISLSPIITVEPKRRKFRDLIEIQMGLPKGVTKNDIQDLKLLFSISEYITDWEDVTSSTELVLLENTNCMAHSTKISARVWLIYAPNVPNISELANKIYALHCPTPYVGKFLSYARRHDQEECQIRCLLITDDTPDKTLECQESFELIATGPEVEVINKLQYQIECAGNIVAVTKSDEAILFPVQSFVENRITLPIRVRNQDEPFQGKIAFIPHFQSLSKQIVKPITTLDIIIPEIIIDMVGSFRNPDRKHRVKNATLERIKGCQAIAKTELDLKSVADAVGADWRALAEELELEADDINLVLNENCTDEEKAFMTLINWQTVLGFKATGNELNRALRQIGREDVVKSCIGDISFVEDEAEVKSAIEQLNNDDKKTHDECWDDIIASKGKPSGYNESVDDSMIVETGDDWSQSHRESKLSDISDDKSLVGESTHDSESEIKPLVDPSKAVTLIDRTSSEKTAAFLLLVNQLDEVLPHPVIHESYNSADKIEACEESVVKSFKTDKQVANVDQTISLLNLINCQINDDFVHVDTVIDLDDFFPEPQEIDVDTLSQSDLNDYGENRDQNEFVLEVCIPEDKVEGLIKNYEGCEITNTLMNMSRDENPKVNDKILQIDLLKRRRYTLDKARLLQHNETFHFHAPVSSLRRCFSVDSRRGRGIFSLCSQVNSLHEASILERGDWPSNEDLKNIQTLQIGVEDSDSPLDTLDNKNDIEISEIIQTDIKTEEENSKIESKSYLKDILPDSPITDLDDLSLCDELEQSNEKKEVLEPRIVAGPLMSTMPSHLDIDLDTISPVTAGNFVYTQPVLFDDDKIVAENDYDTEKKEDINICYKNENPDNFKVDNSEVHSTSRYSVAGQTACNAPFTEDKTVVNKDFELLNQQNTNLKETEITYNEPVD             ELETKMNVNQNFECPIQMKADVEIDSEHSGQFHNTDTDVKGVLNQLATDVVDQELLKDDLQSLDKECVKPYDCNIDINACTNESLSYAEPYSTDYQFIEKNIVEKEESEKNVENERTPESYRDDENINESKVNNNPQFETEKEISIRSDNFVYDPISDEFVTLDNDEALNQPEKHSVLHEVIESDPQIQTEVEEEVEVLPDGRIVNRKITRKQISRIITEKVTRDIEPENEENIDSKVTFESPPEVIETEEELPDGTILKRTISTSMKTTSTTAKTVTEKEISKDENSADSAAMRQSEALTDN +    TV S  + +        AMYGPEESESDSRSTMTIEENLSNLDLTFEEYETADESFESD
Sbjct:   10 FLVSFLVDARGGYMQAQRMPQMKIFVPPDAAPAPTRIICHLLRPEGVANLPGMNDCDGFASRILQIHSSCSRFQKPILIEMPYIALLKSNDREIVILKKNADSDTWKKHSNTFTEETLKAEFGSLYESITPVDQLESNRICRIITTDVPTYFSLISQFQRDVNMIGPDGGYIESKTDKRIKLTFPQGALMKKIQIGLEVQHVDPGIINHVVGDNHKISLSPIITVEPKRRKFRDLIEIQMGLPKGVTKNDIQDLKLLFSISEYITDWEDVTSSTELVLLENTNCMAHSTKISARVWLIYAPNVPNISELANKIYALHCPTPYVGKFLSYARRHDQEECQIRCLLITDDTPDKTLECQESFELIATGPEVEVINKLQYQIECAGNIVAVTKSDEAILFPVQSFVENRITLPIRVRNQDEPFQGKIAFIPHFQSLSKQIVKPITTLDIIIPEIIIDMVGSFRNPDRKHRVKNATLERIKGCQAIAKTELDLKSVADAVGADWRALAEELELEADDINLVLNENCTDEEKAFMTLINWQTVLGFKATGNELNRALRQIGREDVVKSCIGDISFVEDEAEVKSAIEQLNNDDKKTHDECWDDIIASKGKPSGYNESVDDSMIVETGDDWSQSHRESKLSDISDDKSLVGESTHDSESEIKPLVDPSKAVTLIDRTSSEKTAAFLLLVNQLDEVLPHPVIHESYNSADKIEACEESVVKSFKTDKQVANVDQTISLLNLINCQINDDFVHVDTVIDLDDFFPEPQEIDVDTLSQSDLNDYGENRDQNEFVLEVCIPEDKVEGLIKNYEGCEITNTLMNMSRDENPKVNDKILQIDLLKRRRYTLDKARLLQHNETFHFHAPVSSLRRCFSVDSRRGRGIFSLCSQVNSLHEASILERGDWPSNEDLKNIQTLQIGVEDSDSPLDTLDNKNDIEISEIIQTDIKTEEENSKIESKSYLKDILPDSPITDLDDLSLCDELEQSNEKKEVLEPRIVAGPLMSTMPSHLDIDLDTISPVTAGNFVYTQPVLFDDDKIVAENDYDTEKKEDINICYKNENPDNFKVDNSEVHSTSRYSVAGQTACNAPFTEDKTVVNKDFELLNQQNTNLKETEITYNEPVD-------------ELETKMNVNQNFECPIQMKADVEIDSEHSGQFHNTDTDVKGVLNQLATDVVDQELLKDDLQSLDKECVKPYDCNIDINACTNESLSYAEPYSTDYQFIEKNIVEKEESEKNVENERTPESYRDDENINESKVNNNPQFETEKEISIRSDNFVYDPISDEFVTLDNDEALNQPEKHSVLHEVIESDPQIQTEVEEEVEVLPDGRIVNRKITRKQISRIITEKVTRDIEPENEENIDSKVTFESPPEVIETEEELPDGTILKRTISTSMKTTSTTAKTVTEKEISKDENSADSAAMRQSEALTDN-VSGKPTVKSRKNKNKKKSNKKYAMYGPEESESDSRSTMTIEENLSNLDLTFEEYETADESFESD 1488          
BLAST of Ankyrin-2 vs. Planmine SMEST
Match: SMESG000058557.1 (SMESG000058557.1)

HSP 1 Score: 2642.84 bits (6849), Expect = 0.000e+0
Identity = 1415/1428 (99.09%), Postives = 1415/1428 (99.09%), Query Frame = 2
Query: 2795 FLVSFLVDARGGYMQAQRMPQMKIFVPPDAAPAPTRIICHLLRPEGVANLPGMNDCDGFASRILQIHSSCSRFQKPILIEMPYIALLKSNDREIVILKKNADSDTWKKHSNTFTEETLKAEFGSLYESITPVDQLESNRICRIITTDVPTYFSLISQFQRDVNMIGPDGGYIESKTDKRIKLTFPQGALMKKIQIGLEVQHVDPGIINHVVGDNHKISLSPIITVEPKRRKFRDLIEIQMGLPKGVTKNDIQDLKLLFSISEYITDWEDVTSSTELVLLENTNCMAHSTKISARVWLIYAPNVPNISELANKIYALHCPTPYVGKFLSYARRHDQEECQIRCLLITDDTPDKTLECQESFELIATGPEVEVINKLQYQIECAGNIVAVTKSDEAILFPVQSFVENRITLPIRVRNQDEPFQGKIAFIPHFQSLSKQIVKXXXXXXXXXXXXXXXMVGSFRNPDRKHRVKNATLERIKGCQAIAKTELDLKSVADAVGADWRXXXXXXXXXXDDINLVLNENCTDEEKAFMTLINWQTVLGFKATGNELNRALRQIGREDVVKSCIGDISFVEDEAEVKSAIEQLNNDDKKTHDECWDDIIASKGKPSGYNESVDDSMIVETGDDWSQSHREXXXXXXXXXXXXVGESTHDSESEIKPLVDPSKAVTLIDRTSSEKTAAFLLLVNQLDEVLPHPVIHESYNSADKIEACEESVVKSFKTDKQVANVDQTISLLNLINCQINDDFVHVDTVIDLDDFFPEPQEIDVDTLSQSDLNDYGENRDQNEFVLEVCIPEDKVEGLIKNYEGCEITNTLMNMSRDENPKVNDKILQIDLLKRRRYTLDKARLLQHNETFHFHAPVSSLRRCFSVDSRRGRGIFSLCSQVNSLHEASILERGDWPSNEDLKNIQTLQIGVEDSDSPLDTLDNKNDIEISEIIQTDIKTEEENSKIESKSYLKDILPDSPITXXXXXXXXXXXXQSNEKKEVLEPRIVAGPLMSTMPSHLDIDLDTISPVTAGNFVYTQPVLFDDDKIVAENDYDTEKKEDINICYKNENPDNFKVDNSEVHSTSRYSVAGQTACNAPFTEDKTVVNKDFELLNQQNTNLKETEITYNEPVDGKENVCDNYYKNLELETKMNVNQNFECPIQMKADVEIDSEHSGQFHNTDTDVKGVLNQLATDVVDQELLKDDLQSLDKECVKPYDCNIDINACTNESLSYAEPYSTDYQFXXXXXXXXXXXXXXXXXXRTPESYRDDENINESKVNNNPQFETEKEISIRSDNFVYDPISDEFVTLDNDEALNQPEKHSVLHEVIESDPQIQTXXXXXXXXLPDGRIVNRKITRKQISRIITEKVTRDIEPENEENIDSKVTFXXXXXXXXXXXXXXDGTILXXXXXXXXXXXXXXXXXXXEKEISKDENSADSAAMRQSEALTDN 7078
            FLVSFLVDARGGYMQAQRMPQMKIFVPPDAAPAPTRIICHLLRPEGVANLPGMNDCDGFASRILQIHSSCSRFQKPILIEMPYIALLKSNDREIVILKKNADSDTWKKHSNTFTEETLKAEFGSLYESITPVDQLESNRICRIITTDVPTYFSLISQFQRDVNMIGPDGGYIESKTDKRIKLTFPQGALMKKIQIGLEVQHVDPGIINHVVGDNHKISLSPIITVEPKRRKFRDLIEIQMGLPKGVTKNDIQDLKLLFSISEYITDWEDVTSSTELVLLENTNCMAHSTKISARVWLIYAPNVPNISELANKIYALHCPTPYVGKFLSYARRHDQEECQIRCLLITDDTPDKTLECQESFELIATGPEVEVINKLQYQIECAGNIVAVTKSDEAILFPVQSFVENRITLPIRVRNQDEPFQGKIAFIPHFQSLSKQIVKPITTLDIIIPEIIIDMVGSFRNPDRKHRVKNATLERIKGCQAIAKTELDLKSVADAVGADWRALAEELELEADDINLVLNENCTDEEKAFMTLINWQTVLGFKATGNELNRALRQIGREDVVKSCIGDISFVEDEAEVKSAIEQLNNDDKKTHDECWDDIIASKGKPSGYNESVDDSMIVETGDDWSQSHRESKLSDISDDKSLVGESTHDSESEIKPLVDPSKAVTLIDRTSSEKTAAFLLLVNQLDEVLPHPVIHESYNSADKIEACEESVVKSFKTDKQVANVDQTISLLNLINCQINDDFVHVDTVIDLDDFFPEPQEIDVDTLSQSDLNDYGENRDQNEFVLEVCIPEDKVEGLIKNYEGCEITNTLMNMSRDENPKVNDKILQIDLLKRRRYTLDKARLLQHNETFHFHAPVSSLRRCFSVDSRRGRGIFSLCSQVNSLHEASILERGDWPSNEDLKNIQTLQIGVEDSDSPLDTLDNKNDIEISEIIQTDIKTEEENSKIESKSYLKDILPDSPITDLDDLSLCDELEQSNEKKEVLEPRIVAGPLMSTMPSHLDIDLDTISPVTAGNFVYTQPVLFDDDKIVAENDYDTEKKEDINICYKNENPDNFKVDNSEVHSTSRYSVAGQTACNAPFTEDKTVVNKDFELLNQQNTNLKETEITYNEPVD             ELETKMNVNQNFECPIQMKADVEIDSEHSGQFHNTDTDVKGVLNQLATDVVDQELLKDDLQSLDKECVKPYDCNIDINACTNESLSYAEPYSTDYQFIEKNIVEKEESEKNVENERTPESYRDDENINESKVNNNPQFETEKEISIRSDNFVYDPISDEFVTLDNDEALNQPEKHSVLHEVIESDPQIQTEVEEEVEVLPDGRIVNRKITRKQISRIITEKVTRDIEPENEENIDSKVTFESPPEVIETEEELPDGTILKRTISTSMKTTSTTAKTVTEKEISKDENSADSAAMRQSEALTDN
Sbjct:   10 FLVSFLVDARGGYMQAQRMPQMKIFVPPDAAPAPTRIICHLLRPEGVANLPGMNDCDGFASRILQIHSSCSRFQKPILIEMPYIALLKSNDREIVILKKNADSDTWKKHSNTFTEETLKAEFGSLYESITPVDQLESNRICRIITTDVPTYFSLISQFQRDVNMIGPDGGYIESKTDKRIKLTFPQGALMKKIQIGLEVQHVDPGIINHVVGDNHKISLSPIITVEPKRRKFRDLIEIQMGLPKGVTKNDIQDLKLLFSISEYITDWEDVTSSTELVLLENTNCMAHSTKISARVWLIYAPNVPNISELANKIYALHCPTPYVGKFLSYARRHDQEECQIRCLLITDDTPDKTLECQESFELIATGPEVEVINKLQYQIECAGNIVAVTKSDEAILFPVQSFVENRITLPIRVRNQDEPFQGKIAFIPHFQSLSKQIVKPITTLDIIIPEIIIDMVGSFRNPDRKHRVKNATLERIKGCQAIAKTELDLKSVADAVGADWRALAEELELEADDINLVLNENCTDEEKAFMTLINWQTVLGFKATGNELNRALRQIGREDVVKSCIGDISFVEDEAEVKSAIEQLNNDDKKTHDECWDDIIASKGKPSGYNESVDDSMIVETGDDWSQSHRESKLSDISDDKSLVGESTHDSESEIKPLVDPSKAVTLIDRTSSEKTAAFLLLVNQLDEVLPHPVIHESYNSADKIEACEESVVKSFKTDKQVANVDQTISLLNLINCQINDDFVHVDTVIDLDDFFPEPQEIDVDTLSQSDLNDYGENRDQNEFVLEVCIPEDKVEGLIKNYEGCEITNTLMNMSRDENPKVNDKILQIDLLKRRRYTLDKARLLQHNETFHFHAPVSSLRRCFSVDSRRGRGIFSLCSQVNSLHEASILERGDWPSNEDLKNIQTLQIGVEDSDSPLDTLDNKNDIEISEIIQTDIKTEEENSKIESKSYLKDILPDSPITDLDDLSLCDELEQSNEKKEVLEPRIVAGPLMSTMPSHLDIDLDTISPVTAGNFVYTQPVLFDDDKIVAENDYDTEKKEDINICYKNENPDNFKVDNSEVHSTSRYSVAGQTACNAPFTEDKTVVNKDFELLNQQNTNLKETEITYNEPVD-------------ELETKMNVNQNFECPIQMKADVEIDSEHSGQFHNTDTDVKGVLNQLATDVVDQELLKDDLQSLDKECVKPYDCNIDINACTNESLSYAEPYSTDYQFIEKNIVEKEESEKNVENERTPESYRDDENINESKVNNNPQFETEKEISIRSDNFVYDPISDEFVTLDNDEALNQPEKHSVLHEVIESDPQIQTEVEEEVEVLPDGRIVNRKITRKQISRIITEKVTRDIEPENEENIDSKVTFESPPEVIETEEELPDGTILKRTISTSMKTTSTTAKTVTEKEISKDENSADSAAMRQSEALTDN 1424          
BLAST of Ankyrin-2 vs. Planmine SMEST
Match: SMESG000058557.1 (SMESG000058557.1)

HSP 1 Score: 1796.17 bits (4651), Expect = 0.000e+0
Identity = 901/927 (97.20%), Postives = 901/927 (97.20%), Query Frame = 2
Query:   14 MFSCFGKNDHKLPPEDPGNISPISNENSLASPNLKKNSKASNVSRXXXXXXXXXXXXIDHLIFISFS*SEKEHIFLRAAHNGYFSKVQEALNSNIDVNSCNSNGLNALHLASKGGHADIVQFLIDNGADIGAKTRKNNTAIHIASLAGSLEVVKILVKHGANINEQSQTGFTPLYMAAQENHVGVVKFLLDNGADINLSTTDNFTPLAVAIQQGHEETVSILLNKSNFLNSNDISNDIKLPPLHIATRKDDYHAVLLLLHHQEDVQAALTQASLNGFTALHVAAYYNSDKVGRLLLENGAPVDYTSKNNVTALHVAAKWGRNKMVKVLLEFNANVEMSTRDGIRPLHCAASQGHRDICALLIEHKANCNTRTKNGLVPLHMVAQGNHSELVEFFINQNSVNVNETSLDFLTPLHISSHCNNVEVAEALIKHGANVNDRALNGFVALHIAAKQNHVEFVEMLMSNLCMIDTQTESGFTALHIASIIGSESIAKKLVENNCEIDIPDQFDRTSLHMATIFNHFNIVVYLKEHGGSVDKQMKTGETCLMLAIKSEHKAIVEYLINQGASMSVSDSWGLTALHWATLVVRENILNSNCTDININEAIEIFKFVLDGCSRFDINRTTKNGISSLHLAADCGCLEIVHLLLDKGADINIISINGTTPLHIACKXXXXXXXXXXXXXXXXXXXTMAYVSCPWSPMHFSSYFGSVDSTILLISHENDQTSVREKLRQRTPNGNTCLHLAVQQLQTDIVRVLLENDADFNLENEDGLSAFDMAKIVDDETIINLLGIDTTEMMTTDDKVYLFQREEFSDEEQLETLYMDSLNELEFFGIGKNSGEKCELQLSIMSLLDYATTIDSIRRADMSLKINNSLNRYRNITLSEIKTRELLIAAQPASMISTISSTNTEMSPFDVEKWDFHRVTDLPVNSG 2794
            MFSCFGKNDHKLPPEDPGNISPISNENSLASPNLKKNSKASN                          SEKEHIFLRAAHNGYFSKVQEALNSNIDVNSCNSNGLNALHLASKGGHADIVQFLIDNGADIGAKTRKNNTAIHIASLAGSLEVVKILVKHGANINEQSQTGFTPLYMAAQENHVGVVKFLLDNGADINLSTTDNFTPLAVAIQQGHEETVSILLNKSNFLNSNDISNDIKLPPLHIATRKDDYHAVLLLLHHQEDVQAALTQASLNGFTALHVAAYYNSDKVGRLLLENGAPVDYTSKNNVTALHVAAKWGRNKMVKVLLEFNANVEMSTRDGIRPLHCAASQGHRDICALLIEHKANCNTRTKNGLVPLHMVAQGNHSELVEFFINQNSVNVNETSLDFLTPLHISSHCNNVEVAEALIKHGANVNDRALNGFVALHIAAKQNHVEFVEMLMSNLCMIDTQTESGFTALHIASIIGSESIAKKLVENNCEIDIPDQFDRTSLHMATIFNHFNIVVYLKEHGGSVDKQMKTGETCLMLAIKSEHKAIVEYLINQGASMSVSDSWGLTALHWATLVVRENILNSNCTDININEAIEIFKFVLDGCSRFDINRTTKNGISSLHLAADCGCLEIVHLLLDKGADINIISINGTTPLHIACKNNNSNVLLVLLESLSYDSLTMAYVSCPWSPMHFSSYFGSVDSTILLISHENDQTSVREKLRQRTPNGNTCLHLAVQQLQTDIVRVLLENDADFNLENEDGLSAFDMAKIVDDETIINLLGIDTTEMMTTDDKVYLFQREEFSDEEQLETLYMDSLNELEFFGIGKNSGEKCELQLSIMSLLDYATTIDSIRRADMSLKINNSLNRYRNITLSEIKTRELLIAAQPASMISTISSTNTEMSPFDVEKWDFHRVTDLPVNSG
Sbjct:    1 MFSCFGKNDHKLPPEDPGNISPISNENSLASPNLKKNSKASN--------------------------SEKEHIFLRAAHNGYFSKVQEALNSNIDVNSCNSNGLNALHLASKGGHADIVQFLIDNGADIGAKTRKNNTAIHIASLAGSLEVVKILVKHGANINEQSQTGFTPLYMAAQENHVGVVKFLLDNGADINLSTTDNFTPLAVAIQQGHEETVSILLNKSNFLNSNDISNDIKLPPLHIATRKDDYHAVLLLLHHQEDVQAALTQASLNGFTALHVAAYYNSDKVGRLLLENGAPVDYTSKNNVTALHVAAKWGRNKMVKVLLEFNANVEMSTRDGIRPLHCAASQGHRDICALLIEHKANCNTRTKNGLVPLHMVAQGNHSELVEFFINQNSVNVNETSLDFLTPLHISSHCNNVEVAEALIKHGANVNDRALNGFVALHIAAKQNHVEFVEMLMSNLCMIDTQTESGFTALHIASIIGSESIAKKLVENNCEIDIPDQFDRTSLHMATIFNHFNIVVYLKEHGGSVDKQMKTGETCLMLAIKSEHKAIVEYLINQGASMSVSDSWGLTALHWATLVVRENILNSNCTDININEAIEIFKFVLDGCSRFDINRTTKNGISSLHLAADCGCLEIVHLLLDKGADINIISINGTTPLHIACKNNNSNVLLVLLESLSYDSLTMAYVSCPWSPMHFSSYFGSVDSTILLISHENDQTSVREKLRQRTPNGNTCLHLAVQQLQTDIVRVLLENDADFNLENEDGLSAFDMAKIVDDETIINLLGIDTTEMMTTDDKVYLFQREEFSDEEQLETLYMDSLNELEFFGIGKNSGEKCELQLSIMSLLDYATTIDSIRRADMSLKINNSLNRYRNITLSEIKTRELLIAAQPASMISTISSTNTEMSPFDVEKWDFHRVTDLPVNSG 901          
The following BLAST results are available for this feature:
BLAST of Ankyrin-2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ANK20.000e+035.65ankyrin 2 [Source:HGNC Symbol;Acc:HGNC:493][more]
ANK20.000e+035.77ankyrin 2 [Source:HGNC Symbol;Acc:HGNC:493][more]
ANK20.000e+035.77ankyrin 2 [Source:HGNC Symbol;Acc:HGNC:493][more]
ANK20.000e+035.65ankyrin 2 [Source:HGNC Symbol;Acc:HGNC:493][more]
ANK20.000e+035.65ankyrin 2 [Source:HGNC Symbol;Acc:HGNC:493][more]
back to top
BLAST of Ankyrin-2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
unc-445.928e-6330.80AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
unc-445.928e-6330.80AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
unc-441.023e-6230.74AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
unc-441.023e-6230.74AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
unc-442.087e-14039.09AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
back to top
BLAST of Ankyrin-2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ank0.000e+033.59gene:FBgn0011747 transcript:FBtr0089172[more]
Ank0.000e+033.59gene:FBgn0011747 transcript:FBtr0300497[more]
Ank0.000e+033.59gene:FBgn0011747 transcript:FBtr0089171[more]
Ank0.000e+033.59gene:FBgn0011747 transcript:FBtr0089173[more]
Ank21.562e-6531.58gene:FBgn0261788 transcript:FBtr0303122[more]
back to top
BLAST of Ankyrin-2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ank3a0.000e+033.31ankyrin 3a [Source:ZFIN;Acc:ZDB-GENE-060621-1][more]
ank3a0.000e+033.31ankyrin 3a [Source:ZFIN;Acc:ZDB-GENE-060621-1][more]
ank2b0.000e+033.98ankyrin 2b, neuronal [Source:ZFIN;Acc:ZDB-GENE-041... [more]
BX469921.10.000e+032.73ankyrin 3a [Source:NCBI gene;Acc:103909035][more]
ank3a0.000e+034.21ankyrin 3a [Source:ZFIN;Acc:ZDB-GENE-060621-1][more]
back to top
BLAST of Ankyrin-2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tpm40.000e+034.35tropomyosin 4 [Source:Xenbase;Acc:XB-GENE-6077097][more]
tpm40.000e+034.35tropomyosin 4 [Source:Xenbase;Acc:XB-GENE-6077097][more]
tpm41.113e-9634.00tropomyosin 4 [Source:Xenbase;Acc:XB-GENE-6077097][more]
tpm41.821e-9634.11tropomyosin 4 [Source:Xenbase;Acc:XB-GENE-6077097][more]
tpm40.000e+034.11tropomyosin 4 [Source:Xenbase;Acc:XB-GENE-6077097][more]
back to top
BLAST of Ankyrin-2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ank20.000e+035.78ankyrin 2, brain [Source:MGI Symbol;Acc:MGI:88025][more]
Ank30.000e+033.46ankyrin 3, epithelial [Source:MGI Symbol;Acc:MGI:8... [more]
Ank30.000e+033.59ankyrin 3, epithelial [Source:MGI Symbol;Acc:MGI:8... [more]
Ank30.000e+033.77ankyrin 3, epithelial [Source:MGI Symbol;Acc:MGI:8... [more]
Ank30.000e+033.77ankyrin 3, epithelial [Source:MGI Symbol;Acc:MGI:8... [more]
back to top
BLAST of Ankyrin-2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|G5E8K5|ANK3_MOUSE0.000e+033.53Ankyrin-3 OS=Mus musculus OX=10090 GN=Ank3 PE=1 SV... [more]
sp|Q12955|ANK3_HUMAN0.000e+034.21Ankyrin-3 OS=Homo sapiens OX=9606 GN=ANK3 PE=1 SV=... [more]
sp|O70511|ANK3_RAT0.000e+034.07Ankyrin-3 OS=Rattus norvegicus OX=10116 GN=Ank3 PE... [more]
sp|P16157|ANK1_HUMAN0.000e+033.05Ankyrin-1 OS=Homo sapiens OX=9606 GN=ANK1 PE=1 SV=... [more]
sp|Q02357|ANK1_MOUSE8.635e-2933.29Ankyrin-1 OS=Mus musculus OX=10090 GN=Ank1 PE=1 SV... [more]
back to top
BLAST of Ankyrin-2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4Z2D3Q50.000e+034.67Ankyrin-3 isoform 1 (Fragment) OS=Schistosoma japo... [more]
A0A087TAX50.000e+035.20Ankyrin-2 (Fragment) OS=Stegodyphus mimosarum OX=4... [more]
T1J7N37.505e-6035.03Uncharacterized protein OS=Strigamia maritima OX=1... [more]
A0A2J7QN880.000e+035.42Ankyrin-3 (Fragment) OS=Cryptotermes secundus OX=1... [more]
A0A3Q0GJA50.000e+034.88ankyrin-3 isoform X27 OS=Alligator sinensis OX=386... [more]
back to top
BLAST of Ankyrin-2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ank3a0.000e+032.97ankyrin 3a [Source:ZFIN;Acc:ZDB-GENE-060621-1][more]
ank3b4.187e-6833.51ankyrin 3b [Source:ZFIN;Acc:ZDB-GENE-060621-2][more]
ank3a3.998e-7433.67ankyrin 3a [Source:ZFIN;Acc:ZDB-GENE-060621-1][more]
ENSAMXT00000017800.20.000e+034.07pep primary_assembly:Astyanax_mexicanus-2.0:16:210... [more]
ank1b1.130e-8432.65ankyrin 1, erythrocytic b [Source:ZFIN;Acc:ZDB-GEN... [more]
back to top
BLAST of Ankyrin-2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000000093.11.580e-15339.26pep scaffold:Pmarinus_7.0:GL477582:20502:66045:1 g... [more]
ENSPMAT00000000095.12.645e-15339.37pep scaffold:Pmarinus_7.0:GL477582:20897:60453:1 g... [more]
ENSPMAT00000007446.14.218e-8128.20pep scaffold:Pmarinus_7.0:GL478728:200023:240674:1... [more]
ENSPMAT00000007449.12.165e-8028.07pep scaffold:Pmarinus_7.0:GL478728:201453:233342:1... [more]
ENSPMAT00000006531.13.871e-6133.50pep scaffold:Pmarinus_7.0:GL477280:1359:33855:1 ge... [more]
back to top
BLAST of Ankyrin-2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
HOS45.535e-1527.07Subunit of the Set3 complex; complex is a meiotic-... [more]
NAS61.420e-1430.57Evolutionarily conserved 19S regulatory particle a... [more]
AVO23.399e-1027.88Component of a complex containing the Tor2p kinase... [more]
AKR14.568e-1027.40Palmitoyl transferase involved in protein palmitoy... [more]
PHO811.399e-934.19Cyclin-dependent kinase (CDK) inhibitor; regulates... [more]
back to top
BLAST of Ankyrin-2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO454873.021e-5631.95Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO454866.895e-2929.55Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO387252.401e-2031.28Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO375209.122e-2023.44Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO436902.437e-1927.27Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Ankyrin-2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000031565.14.093e-5433.98ankyrin 2 [Source:NCBI gene;Acc:101161458][more]
ENSORLT00000039458.13.257e-9633.98ankyrin 2 [Source:NCBI gene;Acc:101161458][more]
ank1b0.000e+032.18ankyrin-1 [Source:NCBI gene;Acc:101157380][more]
ank1a2.971e-16528.98ankyrin-1 [Source:NCBI gene;Acc:101174837][more]
ENSORLT00000039903.15.095e-12548.94pep primary_assembly:ASM223467v1:15:18469388:18484... [more]
back to top
BLAST of Ankyrin-2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000058557.10.000e+098.34SMESG000058557.1[more]
SMESG000058557.10.000e+097.80SMESG000058557.1[more]
SMESG000058557.10.000e+097.79SMESG000058557.1[more]
SMESG000058557.10.000e+099.09SMESG000058557.1[more]
SMESG000058557.10.000e+097.20SMESG000058557.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30009119 ID=SMED30009119|Name=Ankyrin-2|organism=Schmidtea mediterranea sexual|type=transcript|length=7276bp
GAAATTCAGTTTCATGTTTAGTTGTTTTGGGAAAAACGATCACAAGCTGC
CTCCAGAAGATCCAGGAAATATTTCTCCGATTTCTAATGAAAATTCTCTG
GCATCACCAAATTTGAAAAAGAATTCCAAAGCCTCTAATGTCAGTCGTTT
TTAATGTTTTCTTTAATTTTTATCTACCTTTTTTATTGATCATTTAATTT
TTATTTCGTTTTCCTAGAGTGAAAAAGAACACATTTTTCTCCGAGCTGCG
CACAATGGGTATTTTAGCAAAGTCCAAGAAGCTCTCAATTCAAATATAGA
TGTTAATTCTTGTAATTCGAATGGCCTAAATGCTCTTCATTTGGCGTCAA
AAGGTGGACATGCTGATATTGTTCAATTCCTTATCGACAATGGGGCAGAT
ATCGGAGCTAAAACCAGGAAGAATAACACAGCTATTCACATTGCAAGTTT
GGCTGGTTCTTTAGAAGTTGTAAAAATACTTGTAAAACATGGAGCAAACA
TCAACGAGCAATCACAGACTGGATTCACTCCTCTTTATATGGCAGCTCAG
GAAAACCACGTTGGCGTTGTGAAATTCTTATTGGACAATGGGGCAGATAT
TAACTTGTCAACAACAGATAACTTCACTCCATTAGCAGTAGCGATTCAAC
AAGGTCATGAAGAGACAGTGTCGATTCTTCTAAACAAGTCGAACTTTTTA
AATTCAAACGACATCTCGAATGATATTAAACTACCTCCTTTACATATTGC
CACAAGAAAAGATGACTATCACGCCGTTCTGCTATTGTTGCACCACCAAG
AAGACGTACAGGCAGCTCTGACTCAAGCATCTTTAAATGGATTTACCGCA
TTACACGTAGCTGCTTACTATAATAGTGATAAAGTCGGAAGATTGCTATT
AGAAAATGGCGCTCCAGTTGATTATACGTCAAAGAACAATGTTACTGCTC
TTCATGTTGCTGCAAAATGGGGAAGAAATAAAATGGTCAAAGTACTTTTA
GAGTTTAATGCCAACGTAGAAATGTCGACTCGCGATGGAATTCGTCCGCT
GCATTGTGCTGCTTCCCAGGGTCATAGAGATATATGTGCGTTGCTTATTG
AACACAAGGCCAACTGCAACACAAGAACAAAAAATGGACTTGTTCCTCTT
CACATGGTGGCACAGGGAAATCATTCTGAACTCGTTGAATTCTTCATAAA
TCAGAATTCAGTTAATGTTAACGAAACAAGTCTTGATTTTCTAACTCCTC
TACATATTAGCAGCCATTGTAATAATGTTGAAGTTGCAGAAGCACTCATC
AAACATGGTGCTAATGTCAATGATAGAGCCTTGAATGGGTTTGTTGCTTT
GCACATCGCAGCCAAACAGAATCACGTGGAATTCGTGGAAATGTTGATGT
CTAATTTGTGTATGATCGACACACAAACCGAGAGCGGATTCACAGCTTTG
CATATTGCCAGTATTATTGGATCAGAATCAATTGCTAAAAAATTGGTTGA
AAACAATTGTGAAATTGACATACCGGATCAGTTTGATCGTACAAGTTTAC
ACATGGCTACAATATTCAATCATTTCAATATTGTCGTTTATTTGAAGGAA
CACGGAGGTAGCGTTGATAAACAAATGAAGACTGGTGAAACGTGCCTCAT
GCTAGCCATAAAATCAGAACACAAAGCCATTGTGGAATATTTAATCAATC
AAGGGGCATCAATGTCTGTTTCAGATTCGTGGGGTCTCACAGCTCTACAT
TGGGCAACATTAGTCGTAAGGGAAAATATTCTCAATTCAAATTGCACCGA
TATTAATATTAATGAAGCTATTGAAATATTTAAATTTGTCCTCGATGGAT
GCAGTAGATTTGATATCAACAGAACGACAAAAAATGGGATTTCTAGCTTA
CACTTAGCAGCAGATTGTGGATGTTTGGAAATCGTTCATCTCCTATTGGA
CAAAGGTGCCGATATCAATATAATATCAATCAATGGAACAACGCCATTGC
ATATCGCGTGTAAAAATAATAATAGCAATGTTTTATTGGTTCTCCTTGAA
TCTCTAAGCTATGATTCATTGACAATGGCATATGTCAGTTGTCCATGGTC
TCCAATGCATTTCTCGTCGTATTTTGGAAGCGTTGATTCAACGATCTTGT
TGATCAGTCATGAAAATGACCAAACATCCGTTAGGGAAAAATTGCGACAA
CGTACACCAAATGGAAATACTTGTCTTCATTTAGCAGTGCAGCAGCTACA
GACAGATATTGTCAGAGTATTATTGGAAAACGATGCCGATTTCAATTTAG
AAAATGAAGATGGATTGTCTGCATTTGACATGGCAAAGATTGTTGATGAT
GAAACCATTATTAACTTATTGGGAATCGACACGACAGAGATGATGACTAC
TGACGACAAGGTATACCTATTCCAAAGAGAAGAATTCTCTGATGAAGAAC
AGCTTGAGACACTTTATATGGACTCCTTGAATGAATTAGAATTTTTTGGT
ATTGGGAAAAACTCAGGTGAGAAATGTGAACTGCAATTGTCAATTATGAG
CTTACTGGATTATGCTACAACAATAGATTCGATCCGGCGGGCAGACATGA
GTCTAAAAATCAACAATTCCCTCAACAGGTACAGAAACATCACGCTTTCC
GAAATTAAAACAAGAGAACTTCTAATTGCGGCTCAACCTGCCAGCATGAT
CTCAACGATCTCGTCAACAAACACCGAAATGAGTCCATTTGACGTGGAAA
AATGGGACTTTCACCGTGTAACAGATTTGCCTGTAAATTCAGGATTTTTG
GTATCATTTCTTGTTGATGCAAGAGGGGGATACATGCAAGCGCAGAGGAT
GCCACAAATGAAAATATTTGTTCCACCAGATGCTGCTCCAGCACCAACTA
GAATTATCTGTCATCTACTTCGACCAGAAGGTGTTGCAAATTTACCCGGA
ATGAATGATTGCGACGGATTTGCGAGCAGGATTTTACAAATTCATAGCAG
TTGCTCTCGATTCCAGAAACCAATTTTAATAGAGATGCCTTACATTGCTT
TACTGAAAAGTAATGACAGAGAGATTGTCATATTGAAAAAGAATGCCGAT
AGCGACACCTGGAAAAAACATTCAAATACTTTTACTGAGGAAACTTTGAA
AGCAGAATTTGGATCCCTTTACGAATCTATTACGCCAGTTGACCAGCTGG
AGTCAAATCGTATTTGCAGAATTATTACAACAGATGTACCGACTTATTTT
TCTTTGATTTCTCAATTCCAAAGAGACGTCAATATGATCGGACCGGATGG
AGGATACATTGAATCAAAAACGGATAAAAGAATAAAGCTAACATTTCCTC
AAGGAGCTTTAATGAAAAAGATTCAAATTGGCTTGGAGGTGCAACATGTT
GATCCAGGAATTATTAATCATGTAGTTGGAGACAATCATAAAATTTCGTT
ATCTCCGATTATTACTGTCGAACCGAAGCGCAGGAAATTCAGAGATTTGA
TTGAAATTCAAATGGGTTTACCAAAAGGAGTAACCAAGAATGATATTCAA
GATTTAAAATTGCTATTTAGCATATCGGAATATATAACTGATTGGGAAGA
TGTAACTAGTTCAACCGAACTTGTTCTATTAGAAAATACCAATTGCATGG
CACATTCCACCAAAATATCAGCAAGAGTGTGGTTAATTTATGCACCGAAT
GTACCCAATATATCGGAATTGGCCAATAAAATATATGCTCTCCACTGCCC
TACTCCATATGTAGGAAAGTTTCTTTCATATGCTCGGCGGCATGATCAAG
AAGAATGTCAAATTAGATGTCTACTAATAACCGATGACACTCCTGATAAA
ACGTTGGAATGCCAAGAAAGTTTTGAATTGATAGCAACCGGTCCTGAAGT
TGAGGTAATAAACAAGTTGCAATATCAAATTGAATGTGCAGGAAACATTG
TTGCTGTTACAAAATCGGACGAAGCGATATTATTCCCAGTTCAGTCATTT
GTTGAAAATAGAATCACATTGCCTATTCGGGTGCGAAATCAAGACGAACC
TTTCCAAGGAAAAATTGCCTTTATACCACATTTCCAATCTTTGAGCAAAC
AAATTGTTAAACCTATTACAACTCTTGACATTATTATTCCTGAAATTATT
ATTGATATGGTTGGATCGTTCAGAAATCCAGATCGAAAACATAGAGTAAA
AAATGCAACTCTTGAACGAATCAAAGGTTGTCAAGCGATCGCCAAAACTG
AATTGGATCTTAAATCAGTTGCTGATGCAGTTGGTGCCGATTGGCGTGCA
TTAGCTGAAGAATTAGAACTAGAGGCTGATGATATCAATTTAGTTTTGAA
TGAAAATTGTACCGACGAAGAAAAAGCTTTTATGACTCTTATTAACTGGC
AAACTGTACTTGGTTTCAAAGCAACTGGAAATGAATTGAACAGGGCTTTG
AGACAAATAGGTCGAGAGGATGTGGTAAAATCTTGTATTGGTGATATCAG
TTTTGTTGAAGATGAGGCTGAAGTTAAATCGGCAATTGAGCAATTGAACA
ACGACGATAAGAAAACACATGATGAATGCTGGGATGACATAATTGCTTCA
AAGGGTAAGCCTTCTGGATACAATGAATCAGTAGATGACTCGATGATTGT
TGAAACTGGAGACGATTGGTCTCAAAGTCACAGAGAATCAAAACTTTCTG
ATATTTCCGATGACAAATCATTGGTTGGCGAGTCGACACATGATAGTGAG
AGTGAAATAAAACCATTGGTTGATCCATCGAAAGCTGTTACTTTGATTGA
TAGGACGTCTTCGGAAAAAACTGCAGCTTTTCTTTTATTGGTAAATCAGC
TAGACGAGGTTCTCCCTCACCCAGTTATTCATGAATCTTATAATTCAGCT
GACAAAATCGAGGCGTGTGAAGAGTCTGTGGTAAAGTCGTTCAAAACAGA
TAAGCAGGTAGCAAATGTAGATCAAACCATATCATTATTGAATTTGATCA
ATTGTCAAATTAATGATGATTTTGTTCATGTTGATACTGTCATAGATTTA
GATGATTTTTTCCCTGAACCACAGGAAATAGACGTGGACACTTTGTCACA
ATCCGATTTGAATGACTACGGTGAAAATCGAGATCAAAATGAATTCGTTT
TAGAAGTTTGTATTCCAGAAGATAAAGTAGAGGGTTTGATCAAGAATTAC
GAAGGCTGTGAAATTACGAACACATTGATGAACATGAGTAGAGATGAAAA
TCCTAAGGTCAATGACAAGATCTTACAGATAGACCTATTGAAAAGAAGAA
GATACACCTTAGATAAGGCACGATTATTACAACATAATGAAACATTTCAT
TTTCACGCCCCGGTTTCTTCTTTAAGAAGATGCTTCTCTGTCGATAGTAG
GCGTGGAAGAGGAATTTTTAGTCTTTGTTCTCAAGTCAATAGTCTTCACG
AAGCGTCAATTTTAGAAAGGGGTGATTGGCCGTCTAATGAAGATTTGAAA
AATATTCAAACTCTTCAAATTGGCGTTGAAGATTCTGATAGTCCACTCGA
TACATTGGATAATAAAAATGATATTGAAATAAGTGAAATCATTCAAACTG
ACATAAAAACCGAAGAGGAAAATTCTAAAATAGAATCAAAAAGTTATTTA
AAAGATATTTTACCCGATTCTCCAATAACAGACCTGGATGATCTGAGTTT
GTGTGATGAATTGGAACAGTCCAATGAAAAAAAAGAAGTCCTTGAACCAC
GCATTGTTGCTGGACCTTTGATGTCAACCATGCCAAGCCATTTAGACATC
GATCTAGATACTATTTCCCCCGTGACTGCCGGAAACTTCGTATATACCCA
GCCAGTCCTGTTTGATGATGATAAAATCGTTGCTGAAAATGACTACGATA
CAGAAAAGAAAGAAGATATCAACATTTGCTATAAGAATGAAAACCCGGAC
AACTTTAAAGTTGATAATTCTGAGGTTCATTCAACTTCTAGATATTCAGT
AGCTGGTCAAACTGCCTGTAATGCTCCATTCACAGAAGATAAGACCGTTG
TAAATAAAGACTTCGAATTATTGAATCAACAAAATACTAATTTGAAAGAA
ACCGAAATTACTTATAATGAGCCCGTTGATGGTAAAGAAAATGTCTGTGA
CAATTATTATAAAAATTTAGAATTAGAGACAAAAATGAATGTAAATCAAA
ATTTTGAGTGCCCAATTCAAATGAAAGCAGATGTAGAAATTGATTCTGAG
CATAGTGGACAATTTCACAATACGGATACTGATGTTAAGGGAGTTCTTAA
TCAGCTGGCGACAGATGTAGTTGACCAAGAATTATTAAAGGATGATCTTC
AGTCATTAGACAAAGAATGTGTTAAACCCTATGACTGTAACATTGATATA
AATGCTTGTACAAACGAAAGTTTAAGTTACGCTGAACCATATTCCACTGA
CTATCAATTCATCGAAAAAAATATCGTAGAAAAGGAAGAAAGTGAAAAGA
ATGTAGAAAATGAAAGAACCCCTGAATCGTATCGTGATGATGAAAATATA
AATGAATCAAAAGTTAATAACAATCCACAATTTGAAACTGAGAAAGAAAT
AAGCATTCGTTCTGACAATTTTGTTTATGATCCTATTTCCGACGAATTTG
TAACACTAGATAATGATGAAGCGTTAAATCAACCTGAAAAACATTCTGTT
CTACATGAGGTCATTGAAAGTGATCCTCAAATTCAAACAGAAGTGGAAGA
AGAAGTCGAAGTACTTCCAGATGGAAGAATTGTTAATAGGAAAATCACTC
GAAAACAAATTTCTCGAATTATTACTGAAAAGGTTACTCGTGACATTGAG
CCAGAAAATGAAGAAAATATAGATTCAAAAGTAACTTTCGAAAGTCCACC
AGAGGTCATTGAAACTGAAGAAGAGCTTCCAGATGGAACAATTTTAAAAA
GAACAATTTCAACTTCCATGAAAACTACGTCTACAACAGCAAAGACTGTG
ACTGAAAAAGAAATTTCAAAGGATGAAAATTCAGCTGATTCTGCAGCTAT
GAGACAAAGTGAAGCTTTAACAGACAACGGAATGGATTCATCTAATACTG
TGTCAAGTTTAATTTCGGATAGTGCTATGTATGGTCCAGAGGAATCAGAG
TCCGATAGCAGATCGACTATGACCATAGAAGAAAATCTTTCGAATTTAGA
TTTAACATTTGAAGAATATGAGACTGCTGATGAGTCCTTTGAAAGCGATT
GACGAATAATATAGACCTAATTCAGA
back to top

protein sequence of SMED30009119-orf-1

>SMED30009119-orf-1 ID=SMED30009119-orf-1|Name=SMED30009119-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=2238bp
MAAQENHVGVVKFLLDNGADINLSTTDNFTPLAVAIQQGHEETVSILLNK
SNFLNSNDISNDIKLPPLHIATRKDDYHAVLLLLHHQEDVQAALTQASLN
GFTALHVAAYYNSDKVGRLLLENGAPVDYTSKNNVTALHVAAKWGRNKMV
KVLLEFNANVEMSTRDGIRPLHCAASQGHRDICALLIEHKANCNTRTKNG
LVPLHMVAQGNHSELVEFFINQNSVNVNETSLDFLTPLHISSHCNNVEVA
EALIKHGANVNDRALNGFVALHIAAKQNHVEFVEMLMSNLCMIDTQTESG
FTALHIASIIGSESIAKKLVENNCEIDIPDQFDRTSLHMATIFNHFNIVV
YLKEHGGSVDKQMKTGETCLMLAIKSEHKAIVEYLINQGASMSVSDSWGL
TALHWATLVVRENILNSNCTDININEAIEIFKFVLDGCSRFDINRTTKNG
ISSLHLAADCGCLEIVHLLLDKGADINIISINGTTPLHIACKNNNSNVLL
VLLESLSYDSLTMAYVSCPWSPMHFSSYFGSVDSTILLISHENDQTSVRE
KLRQRTPNGNTCLHLAVQQLQTDIVRVLLENDADFNLENEDGLSAFDMAK
IVDDETIINLLGIDTTEMMTTDDKVYLFQREEFSDEEQLETLYMDSLNEL
EFFGIGKNSGEKCELQLSIMSLLDYATTIDSIRRADMSLKINNSLNRYRN
ITLSEIKTRELLIAAQPASMISTISSTNTEMSPFDVEKWDFHRVTDLPVN
SGFLVSFLVDARGGYMQAQRMPQMKIFVPPDAAPAPTRIICHLLRPEGVA
NLPGMNDCDGFASRILQIHSSCSRFQKPILIEMPYIALLKSNDREIVILK
KNADSDTWKKHSNTFTEETLKAEFGSLYESITPVDQLESNRICRIITTDV
PTYFSLISQFQRDVNMIGPDGGYIESKTDKRIKLTFPQGALMKKIQIGLE
VQHVDPGIINHVVGDNHKISLSPIITVEPKRRKFRDLIEIQMGLPKGVTK
NDIQDLKLLFSISEYITDWEDVTSSTELVLLENTNCMAHSTKISARVWLI
YAPNVPNISELANKIYALHCPTPYVGKFLSYARRHDQEECQIRCLLITDD
TPDKTLECQESFELIATGPEVEVINKLQYQIECAGNIVAVTKSDEAILFP
VQSFVENRITLPIRVRNQDEPFQGKIAFIPHFQSLSKQIVKPITTLDIII
PEIIIDMVGSFRNPDRKHRVKNATLERIKGCQAIAKTELDLKSVADAVGA
DWRALAEELELEADDINLVLNENCTDEEKAFMTLINWQTVLGFKATGNEL
NRALRQIGREDVVKSCIGDISFVEDEAEVKSAIEQLNNDDKKTHDECWDD
IIASKGKPSGYNESVDDSMIVETGDDWSQSHRESKLSDISDDKSLVGEST
HDSESEIKPLVDPSKAVTLIDRTSSEKTAAFLLLVNQLDEVLPHPVIHES
YNSADKIEACEESVVKSFKTDKQVANVDQTISLLNLINCQINDDFVHVDT
VIDLDDFFPEPQEIDVDTLSQSDLNDYGENRDQNEFVLEVCIPEDKVEGL
IKNYEGCEITNTLMNMSRDENPKVNDKILQIDLLKRRRYTLDKARLLQHN
ETFHFHAPVSSLRRCFSVDSRRGRGIFSLCSQVNSLHEASILERGDWPSN
EDLKNIQTLQIGVEDSDSPLDTLDNKNDIEISEIIQTDIKTEEENSKIES
KSYLKDILPDSPITDLDDLSLCDELEQSNEKKEVLEPRIVAGPLMSTMPS
HLDIDLDTISPVTAGNFVYTQPVLFDDDKIVAENDYDTEKKEDINICYKN
ENPDNFKVDNSEVHSTSRYSVAGQTACNAPFTEDKTVVNKDFELLNQQNT
NLKETEITYNEPVDGKENVCDNYYKNLELETKMNVNQNFECPIQMKADVE
IDSEHSGQFHNTDTDVKGVLNQLATDVVDQELLKDDLQSLDKECVKPYDC
NIDINACTNESLSYAEPYSTDYQFIEKNIVEKEESEKNVENERTPESYRD
DENINESKVNNNPQFETEKEISIRSDNFVYDPISDEFVTLDNDEALNQPE
KHSVLHEVIESDPQIQTEVEEEVEVLPDGRIVNRKITRKQISRIITEKVT
RDIEPENEENIDSKVTFESPPEVIETEEELPDGTILKRTISTSMKTTSTT
AKTVTEKEISKDENSADSAAMRQSEALTDNGMDSSNTVSSLISDSAMYGP
EESESDSRSTMTIEENLSNLDLTFEEYETADESFESD*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000026gut
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR040745Ankyrin_UPA
IPR036770Ankyrin_rpt-contain_sf
IPR002110Ankyrin_rpt
IPR000488Death_domain
IPR000906ZU5_dom
IPR020683Ankyrin_rpt-contain_dom
IPR011029DEATH-like_dom_sf
IPR005456Prepro-melanin_conc_hormone
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0030354melanin-concentrating hormone activity
Vocabulary: biological process
TermDefinition
GO:0007165signal transduction
GO:0007268chemical synaptic transmission
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 1972..1992
NoneNo IPR availableGENE3DG3DSA:1.10.533.10coord: 1228..1326
e-value: 3.5E-16
score: 60.7
NoneNo IPR availableGENE3DG3DSA:2.60.220.30coord: 909..1068
e-value: 2.4E-35
score: 123.5
NoneNo IPR availableGENE3DG3DSA:2.60.40.2660coord: 1071..1227
e-value: 1.4E-41
score: 143.6
NoneNo IPR availableGENE3DG3DSA:2.60.220.30coord: 749..908
e-value: 6.8E-45
score: 154.6
NoneNo IPR availablePFAMPF13637Ank_4coord: 236..286
e-value: 3.3E-6
score: 27.5
coord: 452..503
e-value: 2.5E-11
score: 43.9
NoneNo IPR availablePFAMPF13857Ank_5coord: 555..599
e-value: 6.1E-8
score: 32.8
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1375..1406
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 2147..2237
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1376..1406
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 2166..2223
NoneNo IPR availablePANTHERPTHR24133:SF33ANKYRIN, ISOFORM Bcoord: 737..818
NoneNo IPR availablePANTHERPTHR24133FAMILY NOT NAMEDcoord: 1..616
coord: 737..818
NoneNo IPR availablePANTHERPTHR24133FAMILY NOT NAMEDcoord: 822..1323
NoneNo IPR availablePANTHERPTHR24133:SF33ANKYRIN, ISOFORM Bcoord: 1..616
coord: 822..1323
IPR002110Ankyrin repeatPRINTSPR01415ANKYRINcoord: 465..479
score: 44.79
coord: 167..182
score: 39.7
IPR002110Ankyrin repeatSMARTSM00248ANK_2acoord: 133..162
e-value: 3.0E-4
score: 30.1
coord: 27..56
e-value: 0.071
score: 22.2
coord: 266..295
e-value: 0.18
score: 20.9
coord: 482..513
e-value: 0.041
score: 23.0
coord: 518..547
e-value: 2600.0
score: 1.9
coord: 166..195
e-value: 3.2E-4
score: 30.0
coord: 558..587
e-value: 1.9E-5
score: 34.1
coord: 1..23
e-value: 320.0
score: 8.7
coord: 365..394
e-value: 0.0013
score: 28.0
coord: 199..229
e-value: 0.087
score: 21.9
coord: 449..478
e-value: 5.2E-6
score: 36.0
coord: 299..328
e-value: 0.017
score: 24.3
coord: 332..361
e-value: 0.073
score: 22.2
coord: 398..445
e-value: 1800.0
score: 3.0
coord: 233..262
e-value: 4.3E-5
score: 32.9
coord: 63..92
e-value: 55.0
score: 12.6
coord: 100..129
e-value: 0.0072
score: 25.5
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 133..165
score: 11.594
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 558..590
score: 13.037
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 233..265
score: 10.766
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 266..298
score: 9.831
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 166..198
score: 11.274
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 100..132
score: 12.315
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 365..397
score: 11.22
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 27..59
score: 9.084
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 1..26
score: 10.633
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 482..504
score: 9.912
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 299..331
score: 10.74
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 449..481
score: 13.33
IPR000906ZU5 domainSMARTSM00218zu_1coord: 751..855
e-value: 8.6E-14
score: 61.8
IPR000906ZU5 domainPFAMPF00791ZU5coord: 755..851
e-value: 6.2E-16
score: 58.5
IPR000906ZU5 domainPROSITEPS51145ZU5coord: 911..1050
score: 11.036
IPR000906ZU5 domainPROSITEPS51145ZU5coord: 753..909
score: 15.094
IPR000488Death domainSMARTSM00005DEATH_4coord: 1227..1320
e-value: 7.2E-10
score: 48.8
IPR000488Death domainPFAMPF00531Deathcoord: 1241..1316
e-value: 1.2E-10
score: 41.4
IPR000488Death domainPROSITEPS50017DEATH_DOMAINcoord: 1237..1320
score: 17.863
IPR020683Ankyrin repeat-containing domainPFAMPF12796Ank_2coord: 304..396
e-value: 1.9E-14
score: 54.0
coord: 2..51
e-value: 7.2E-7
score: 29.7
coord: 105..196
e-value: 1.6E-16
score: 60.6
IPR020683Ankyrin repeat-containing domainPROSITEPS50297ANK_REP_REGIONcoord: 1..611
score: 131.215
IPR040745Ankyrin, UPA domainPFAMPF17809UPA_2coord: 1073..1202
e-value: 1.4E-34
score: 118.8
IPR036770Ankyrin repeat-containing domain superfamilyGENE3DG3DSA:1.25.40.20coord: 1..95
e-value: 8.1E-19
score: 69.6
IPR036770Ankyrin repeat-containing domain superfamilyGENE3DG3DSA:1.25.40.20coord: 270..645
e-value: 6.1E-75
score: 254.4
IPR036770Ankyrin repeat-containing domain superfamilyGENE3DG3DSA:1.25.40.20coord: 96..269
e-value: 1.4E-47
score: 164.5
IPR036770Ankyrin repeat-containing domain superfamilySUPERFAMILYSSF48403Ankyrin repeatcoord: 1..319
IPR036770Ankyrin repeat-containing domain superfamilySUPERFAMILYSSF48403Ankyrin repeatcoord: 227..611
IPR011029Death-like domain superfamilySUPERFAMILYSSF47986DEATH domaincoord: 1237..1318