Polypyrimidine tract-binding protein 1

Overview
NamePolypyrimidine tract-binding protein 1
Smed IDSMED30009115
Length (bp)2583
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Polypyrimidine tract-binding protein 1 (SMED30009115) t-SNE clustered cells

Violin plots show distribution of expression levels for Polypyrimidine tract-binding protein 1 (SMED30009115) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Polypyrimidine tract-binding protein 1 (SMED30009115) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Polypyrimidine tract-binding protein 1 (SMED30009115) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30009115

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30009115SMESG000033951.1 SmedASXL_016942SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30009115SMESG000033951.1 dd_Smed_v4_14748_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30009115SMESG000033951.1 dd_Smed_v4_14748_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30009115SMESG000033951.1 dd_Smed_v4_14748_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30009115SMESG000033951.1 dd_Smed_v4_14748_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30009115SMESG000033951.1 dd_Smed_v6_14748_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
dorsal ventral margin of the whole animalSMED30009115SMESG000033951.1 dd_Smed_v4_14748_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Polypyrimidine tract-binding protein 1 vs. Ensembl Human
Match: PTBP2 (polypyrimidine tract binding protein 2 [Source:HGNC Symbol;Acc:HGNC:17662])

HSP 1 Score: 315.849 bits (808), Expect = 2.837e-97
Identity = 205/569 (36.03%), Postives = 295/569 (51.85%), Query Frame = 1
Query:  697 GVKRSIQNFNSNSLLGSSYS------IDVDSNESKKSKLEPSTNTEPSKVLHIRNIASRAQESDLSLLAVPFGKIRSMVYAKKTNQALLELEKASEATRMFDYYTRYPPCFNGREMIVQYSKHVSLE----LKLKNSNIDASVDAANKMNEKHRSIVDEWSSENKSDRRILRVVIENLKNYNINHLVILKVFQRFGKVLRIIIFTKNMQCQCLVELDNSISAHVSLLHLNGQDLFNDCCRLKIEFSKNTDSLQIQRQNDKCRDYTVSPLQEDEQFSLHFLDWQAKSVSTVPPQQYPSLSTVPLLQTQVQKPLYSDFLPNNLFYTVMPNVFKSTFQPSPVAIPESLLISDCAINPLYQEPIVKPPSSANAIDSSIILVSNLNYEKVNTDSIFTLFGVYGDVSKVCISPPSVGAALVYMQTNSQAETACRHLNLVPLFGKIISTYLLPGEIVAQSIFNTELNSDIEVKHFTNTPLHRFKKPNSKNHFNIYPPSSVLHLSNIPLSFKEEDLLTLFHDNGFQCSSLRIFQKDKKMALAKMTSLEDAISALISLHNWKLTDSSHLRVSFSKALI 2373
            GVKR      S S+L S  S      +  + N+SKK K E   +  PS+VLHIR +     E+++  L +PFGK+ +++  K  NQA LEL     A  M +YY+   P    + + +QYS H  L+    L  +   +  +V A    N          S+   +   +LR++I+N+  Y +   V+ ++F +FG VL+II FTKN Q Q L++  + ++A  + L L+GQ+++N CC L+I+FSK  + L ++  NDK RDYT   L                          PS    P L   +      +     L    +P         SP+AIP +   +  A       P V      +A  ++++LVSNLN E V   S+FTLFGVYGDV +V I      +AL+ M   +Q++ A  HLN   ++GKII   L   + V   +    L+     K F N+PLHRFKKP SKN  NI+PPS+ LHLSNIP S  EEDL TLF + G    + + FQ+D KMAL +M ++E+AI ALI LHN+ L ++ HLRVSFSK+ I
Sbjct:   11 GVKRGSDELLSGSVLSSPNSNMSSMVVTANGNDSKKFKGEDKMDGAPSRVLHIRKLPGEVTETEVIALGLPFGKVTNILMLKGKNQAFLELATEEAAITMVNYYSAVTPHLRNQPIYIQYSNHKELKTDNTLNQRAQAVLQAVTAVQTANTPLSGTTVSESAVTPAQSPVLRIIIDNMY-YPVTLDVLHQIFSKFGAVLKIITFTKNNQFQALLQYGDPVNAQQAKLALDGQNIYNACCTLRIDFSKLVN-LNVKYNNDKSRDYTRPDL--------------------------PSGDGQPALDPAIAAAFAKETSLLGLPVAAVPGAL------SPLAIPNAAAAAAAAAAGRVGMPGV------SAGGNTVLLVSNLNEEMVTPQSLFTLFGVYGDVQRVKILYNKKDSALIQMADGNQSQLAMNHLNGQKMYGKIIRVTLSKHQTV--QLPREGLDDQGLTKDFGNSPLHRFKKPGSKNFQNIFPPSATLHLSNIPPSVAEEDLRTLFANTGGTVKAFKFFQRDHKMALLQMATVEEAIQALIDLHNYNLGENHHLRVSFSKSTI 537          
BLAST of Polypyrimidine tract-binding protein 1 vs. Ensembl Human
Match: PTBP2 (polypyrimidine tract binding protein 2 [Source:HGNC Symbol;Acc:HGNC:17662])

HSP 1 Score: 313.153 bits (801), Expect = 2.544e-96
Identity = 205/569 (36.03%), Postives = 294/569 (51.67%), Query Frame = 1
Query:  697 GVKRSIQNFNSNSLLGSSYS------IDVDSNESKKSKLEPSTNTEPSKVLHIRNIASRAQESDLSLLAVPFGKIRSMVYAKKTNQALLELEKASEATRMFDYYTRYPPCFNGREMIVQYSKHVSLE----LKLKNSNIDASVDAANKMNEKHRSIVDEWSSENKSDRRILRVVIENLKNYNINHLVILKVFQRFGKVLRIIIFTKNMQCQCLVELDNSISAHVSLLHLNGQDLFNDCCRLKIEFSKNTDSLQIQRQNDKCRDYTVSPLQEDEQFSLHFLDWQAKSVSTVPPQQYPSLSTVPLLQTQVQKPLYSDFLPNNLFYTVMPNVFKSTFQPSPVAIPESLLISDCAINPLYQEPIVKPPSSANAIDSSIILVSNLNYEKVNTDSIFTLFGVYGDVSKVCISPPSVGAALVYMQTNSQAETACRHLNLVPLFGKIISTYLLPGEIVAQSIFNTELNSDIEVKHFTNTPLHRFKKPNSKNHFNIYPPSSVLHLSNIPLSFKEEDLLTLFHDNGFQCSSLRIFQKDKKMALAKMTSLEDAISALISLHNWKLTDSSHLRVSFSKALI 2373
            GVKR      S S+L S  S      +  + N+SKK K E   +  PS+VLHIR +     E+++  L +PFGK+ +++  K  NQA LEL     A  M +YY+   P    + + +QYS H  L+    L  +   +  +V A    N          S+   +   +LR++I+N+  Y +   V+ ++F +FG VL+II FTKN Q Q L++  + ++A  + L L+GQ+++N CC L+I+FSK  + L ++  NDK RDYT   L                          PS    P L      P  +           +P         SP+AIP +   +  A       P V      +A  ++++LVSNLN E V   S+FTLFGVYGDV +V I      +AL+ M   +Q++ A  HLN   ++GKII   L   + V   +    L+     K F N+PLHRFKKP SKN  NI+PPS+ LHLSNIP S  EEDL TLF + G    + + FQ+D KMAL +M ++E+AI ALI LHN+ L ++ HLRVSFSK+ I
Sbjct:   11 GVKRGSDELLSGSVLSSPNSNMSSMVVTANGNDSKKFKGEDKMDGAPSRVLHIRKLPGEVTETEVIALGLPFGKVTNILMLKGKNQAFLELATEEAAITMVNYYSAVTPHLRNQPIYIQYSNHKELKTDNTLNQRAQAVLQAVTAVQTANTPLSGTTVSESAVTPAQSPVLRIIIDNMY-YPVTLDVLHQIFSKFGAVLKIITFTKNNQFQALLQYGDPVNAQQAKLALDGQNIYNACCTLRIDFSKLVN-LNVKYNNDKSRDYTRPDL--------------------------PSGDGQPALD-----PAIAAAFAKETSLLAVPGAL------SPLAIPNAAAAAAAAAAGRVGMPGV------SAGGNTVLLVSNLNEEMVTPQSLFTLFGVYGDVQRVKILYNKKDSALIQMADGNQSQLAMNHLNGQKMYGKIIRVTLSKHQTV--QLPREGLDDQGLTKDFGNSPLHRFKKPGSKNFQNIFPPSATLHLSNIPPSVAEEDLRTLFANTGGTVKAFKFFQRDHKMALLQMATVEEAIQALIDLHNYNLGENHHLRVSFSKSTI 532          
BLAST of Polypyrimidine tract-binding protein 1 vs. Ensembl Human
Match: PTBP2 (polypyrimidine tract binding protein 2 [Source:HGNC Symbol;Acc:HGNC:17662])

HSP 1 Score: 310.457 bits (794), Expect = 3.025e-95
Identity = 205/569 (36.03%), Postives = 294/569 (51.67%), Query Frame = 1
Query:  697 GVKRSIQNFNSNSLLGSSYS------IDVDSNESKKSKLEPSTNTEPSKVLHIRNIASRAQESDLSLLAVPFGKIRSMVYAKKTNQALLELEKASEATRMFDYYTRYPPCFNGREMIVQYSKHVSLE----LKLKNSNIDASVDAANKMNEKHRSIVDEWSSENKSDRRILRVVIENLKNYNINHLVILKVFQRFGKVLRIIIFTKNMQCQCLVELDNSISAHVSLLHLNGQDLFNDCCRLKIEFSKNTDSLQIQRQNDKCRDYTVSPLQEDEQFSLHFLDWQAKSVSTVPPQQYPSLSTVPLLQTQVQKPLYSDFLPNNLFYTVMPNVFKSTFQPSPVAIPESLLISDCAINPLYQEPIVKPPSSANAIDSSIILVSNLNYEKVNTDSIFTLFGVYGDVSKVCISPPSVGAALVYMQTNSQAETACRHLNLVPLFGKIISTYLLPGEIVAQSIFNTELNSDIEVKHFTNTPLHRFKKPNSKNHFNIYPPSSVLHLSNIPLSFKEEDLLTLFHDNGFQCSSLRIFQKDKKMALAKMTSLEDAISALISLHNWKLTDSSHLRVSFSKALI 2373
            GVKR      S S+L S  S      +  + N+SKK K E   +  PS+VLHIR +     E+++  L +PFGK+ +++  K  NQA LEL     A  M +YY+   P    + + +QYS H  L+    L  +   +  +V A    N          S+   +   +LR++I+N+  Y +   V+ ++F +FG VL+II FTKN Q Q L++  + ++A  + L L+GQ+++N CC L+I+FSK  + L ++  NDK RDYT   L                          PS    P L   +      +     L    +P         SP+AIP +   +  A       P V      +A  ++++LVSNLN E V   S+FTLFGVYGDV +V I      +AL+ M   +Q++ A  HLN   ++GKII   L   + V   +    L+     K F N+PLHRFKKP SKN  NI+PPS+ LHLSNIP S  EEDL TLF + G    + + FQ D KMAL +M ++E+AI ALI LHN+ L ++ HLRVSFSK+ I
Sbjct:   11 GVKRGSDELLSGSVLSSPNSNMSSMVVTANGNDSKKFKGEDKMDGAPSRVLHIRKLPGEVTETEVIALGLPFGKVTNILMLKGKNQAFLELATEEAAITMVNYYSAVTPHLRNQPIYIQYSNHKELKTDNTLNQRAQAVLQAVTAVQTANTPLSGTTVSESAVTPAQSPVLRIIIDNMY-YPVTLDVLHQIFSKFGAVLKIITFTKNNQFQALLQYGDPVNAQQAKLALDGQNIYNACCTLRIDFSKLVN-LNVKYNNDKSRDYTRPDL--------------------------PSGDGQPALDPAIAAAFAKETSLLGLPVAAVPGAL------SPLAIPNAAAAAAAAAAGRVGMPGV------SAGGNTVLLVSNLNEEMVTPQSLFTLFGVYGDVQRVKILYNKKDSALIQMADGNQSQLAMNHLNGQKMYGKIIRVTLSKHQTV--QLPREGLDDQGLTKDFGNSPLHRFKKPGSKNFQNIFPPSATLHLSNIPPSVAEEDLRTLFANTGGTVKAFKFFQ-DHKMALLQMATVEEAIQALIDLHNYNLGENHHLRVSFSKSTI 536          
BLAST of Polypyrimidine tract-binding protein 1 vs. Ensembl Human
Match: PTBP2 (polypyrimidine tract binding protein 2 [Source:HGNC Symbol;Acc:HGNC:17662])

HSP 1 Score: 307.76 bits (787), Expect = 2.880e-94
Identity = 205/569 (36.03%), Postives = 293/569 (51.49%), Query Frame = 1
Query:  697 GVKRSIQNFNSNSLLGSSYS------IDVDSNESKKSKLEPSTNTEPSKVLHIRNIASRAQESDLSLLAVPFGKIRSMVYAKKTNQALLELEKASEATRMFDYYTRYPPCFNGREMIVQYSKHVSLE----LKLKNSNIDASVDAANKMNEKHRSIVDEWSSENKSDRRILRVVIENLKNYNINHLVILKVFQRFGKVLRIIIFTKNMQCQCLVELDNSISAHVSLLHLNGQDLFNDCCRLKIEFSKNTDSLQIQRQNDKCRDYTVSPLQEDEQFSLHFLDWQAKSVSTVPPQQYPSLSTVPLLQTQVQKPLYSDFLPNNLFYTVMPNVFKSTFQPSPVAIPESLLISDCAINPLYQEPIVKPPSSANAIDSSIILVSNLNYEKVNTDSIFTLFGVYGDVSKVCISPPSVGAALVYMQTNSQAETACRHLNLVPLFGKIISTYLLPGEIVAQSIFNTELNSDIEVKHFTNTPLHRFKKPNSKNHFNIYPPSSVLHLSNIPLSFKEEDLLTLFHDNGFQCSSLRIFQKDKKMALAKMTSLEDAISALISLHNWKLTDSSHLRVSFSKALI 2373
            GVKR      S S+L S  S      +  + N+SKK K E   +  PS+VLHIR +     E+++  L +PFGK+ +++  K  NQA LEL     A  M +YY+   P    + + +QYS H  L+    L  +   +  +V A    N          S+   +   +LR++I+N+  Y +   V+ ++F +FG VL+II FTKN Q Q L++  + ++A  + L L+GQ+++N CC L+I+FSK  + L ++  NDK RDYT   L                          PS    P L      P  +           +P         SP+AIP +   +  A       P V      +A  ++++LVSNLN E V   S+FTLFGVYGDV +V I      +AL+ M   +Q++ A  HLN   ++GKII   L   + V   +    L+     K F N+PLHRFKKP SKN  NI+PPS+ LHLSNIP S  EEDL TLF + G    + + FQ D KMAL +M ++E+AI ALI LHN+ L ++ HLRVSFSK+ I
Sbjct:   11 GVKRGSDELLSGSVLSSPNSNMSSMVVTANGNDSKKFKGEDKMDGAPSRVLHIRKLPGEVTETEVIALGLPFGKVTNILMLKGKNQAFLELATEEAAITMVNYYSAVTPHLRNQPIYIQYSNHKELKTDNTLNQRAQAVLQAVTAVQTANTPLSGTTVSESAVTPAQSPVLRIIIDNMY-YPVTLDVLHQIFSKFGAVLKIITFTKNNQFQALLQYGDPVNAQQAKLALDGQNIYNACCTLRIDFSKLVN-LNVKYNNDKSRDYTRPDL--------------------------PSGDGQPALD-----PAIAAAFAKETSLLAVPGAL------SPLAIPNAAAAAAAAAAGRVGMPGV------SAGGNTVLLVSNLNEEMVTPQSLFTLFGVYGDVQRVKILYNKKDSALIQMADGNQSQLAMNHLNGQKMYGKIIRVTLSKHQTV--QLPREGLDDQGLTKDFGNSPLHRFKKPGSKNFQNIFPPSATLHLSNIPPSVAEEDLRTLFANTGGTVKAFKFFQ-DHKMALLQMATVEEAIQALIDLHNYNLGENHHLRVSFSKSTI 531          
BLAST of Polypyrimidine tract-binding protein 1 vs. Ensembl Human
Match: PTBP3 (polypyrimidine tract binding protein 3 [Source:HGNC Symbol;Acc:HGNC:10253])

HSP 1 Score: 286.189 bits (731), Expect = 6.302e-86
Identity = 199/577 (34.49%), Postives = 299/577 (51.82%), Query Frame = 1
Query:  697 GVKRSIQNFNSNSLLGSSYSID------VDSNESKKSKLEPSTNTEPSKVLHIRNIASRAQESDLSLLAVPFGKIRSMVYAKKTNQALLELEKASEATRMFDYYTRYPPCFNGREMIVQYSKHVSLELKLKN----SNIDASVDAANKMNEKHRSIVDEWSSENK---SDRRILRVVIENLKNYNINHLVILKVFQRFGKVLRIIIFTKNMQCQCLVELDNSISAHVSLLHLNGQDLFNDCCRLKIEFSKNTDSLQIQRQNDKCRDYTVSPLQEDEQFSLHFLDWQAKSVSTVPPQQY----PSLSTVPLLQTQVQKPLYSDFLPNNLFYTVMPNVFKSTFQPSPVAIPESLLISDCAINPLYQEPIVKPPSSANAIDSSIILVSNLNYEKVNTDSIFTLFGVYGDVSKVCISPPSVGAALVYMQTNSQAETACRHLNLVPLFGKIISTYLLPGEIVAQSIFNTELNSDIEV-KHFTNTPLHRFKKPNSKNHFNIYPPSSVLHLSNIPLSFKEEDLLTLFHDNGFQCSSLRIFQKDKKMALAKMTSLEDAISALISLHNWKLTDSSHLRVSFSKALI 2373
            G+KR      S+ ++   ++++       + N+SKK K +      PS+VLH+R I     E+++  L +PFGK+ +++  K  +QA LE+     A  M +YYT   P    + + +QYS H   ELK  N    +   A++ A + +     ++    S+E         +LR++IENL  Y +   V+ ++F +FG VL+II FTKN Q Q L++  + ++AH + + L+GQ+++N CC L+I+FSK T SL ++  NDK RD+T        +  L   D Q    S  PP       P + + P        P         L    +P          P+ I  S +    AI           P ++    +S++LV+NLN + +    +F LFGVYGDV +V I       ALV M   +QA+ A  HL+   L+GK++   L   + V       E   D  + K F+N+PLHRFKKP SKN  NI+PPS+ LHLSNIP S   +DL  LF + G    + + FQKD+KMAL ++ S+E+AI ALI LHN  L ++ HLRVSFSK+ I
Sbjct:   12 GLKRGSDELLSSGIINGPFTMNSSTPSTANGNDSKKFKRD-RPPCSPSRVLHLRKIPCDVTEAEIISLGLPFGKVTNLLMLKGKSQAFLEMASEEAAVTMVNYYTPITPHLRSQPVYIQYSNH--RELKTDNLPNQARAQAALQAVSAVQSGSLALSGGPSNEGTVLPGQSPVLRIIIENLF-YPVTLEVLHQIFSKFGTVLKIITFTKNNQFQALLQYADPVNAHYAKMALDGQNIYNACCTLRIDFSKLT-SLNVKYNNDKSRDFT--------RLDLPTGDGQP---SLEPPMAAAFGAPGIISSPYAGAAGFAPAIGFPQATGLSVPAVPGAL------GPLTITSSAVTGRMAI-----------PGASGIPGNSVLLVTNLNPDLITPHGLFILFGVYGDVHRVKIMFNKKENALVQMADANQAQLAMNHLSGQRLYGKVLRATLSKHQAVQ---LPREGQEDQGLTKDFSNSPLHRFKKPGSKNFQNIFPPSATLHLSNIPPSVTVDDLKNLFIEAGCSVKAFKFFQKDRKMALIQLGSVEEAIQALIELHNHDLGENHHLRVSFSKSTI 552          
BLAST of Polypyrimidine tract-binding protein 1 vs. Ensembl Celegans
Match: ptb-1 (PTB (HnRNP) homolog; Putative RNA-binding protein PTB-1a [Source:UniProtKB/TrEMBL;Acc:Q18999])

HSP 1 Score: 159.073 bits (401), Expect = 1.341e-41
Identity = 87/203 (42.86%), Postives = 122/203 (60.10%), Query Frame = 1
Query: 1780 SSIILVSNLNYEKVNTDSIFTLFGVYGDVSKVCISPPSVGAALVYMQTNSQAETACRHLNLVPLFGKIISTYLLPGEIVAQSIFNTELNSDIE-----VKHFTNTPLHRFKKPNSKNHFNIYPPSSVLHLSNIPLSFKEEDLLTLFHDNGFQCSSLRIFQKDKKMALAKMTSLEDAISALISLHNWKLTDSSHLRVSFSKALI 2373
            + +ILVSNL+  KV TD++FTLFGVYGDV +V I       AL+      QA+ A  HL+ V    ++I        +      N ++  + +      + + ++ LHRFKKP SKN+ NIYPP + LHLSNIP S  EE L  +F + GF   + + F KD KMAL ++  +E AI ALI++HN KL +++HLRVSFSK+ I
Sbjct:  258 TPVILVSNLHEMKVTTDALFTLFGVYGDVMRVKILYNKKDNALIQYSEPQQAQLALTHLDKVKWHDRLI-------RVAPSKHTNVQMPKEGQPDAGLTRDYAHSTLHRFKKPGSKNYLNIYPPCATLHLSNIPTSVSEEKLKEMFAEAGFAVKAFKFFPKDHKMALCQLEDIETAIDALIAMHNHKLAENAHLRVSFSKSGI 453          

HSP 2 Score: 82.8037 bits (203), Expect = 3.045e-16
Identity = 47/133 (35.34%), Postives = 76/133 (57.14%), Query Frame = 1
Query: 1078 NIDASVDAANKMNEKHRSIVDEWSSE-----NKSDRRILRVVIENLKNYNINHLVILKVFQRFGKVLRIIIFTKNMQCQCLVELDNSISAHVSLLHLNGQDLFNDCCRLKIEFSKNTDSLQIQRQNDKCRDYT 1461
            N D  V AA+      +S+ +   S       +    +LR +IEN+  + ++  V+ ++F R+GKVLRII F KN   Q LV++  + SA ++   L  Q+++N CC L+I++SK   +L ++  NDK RDYT
Sbjct:   32 NNDVVVGAASTGRAAGKSVANGSVSNFEVGTQQQPNSVLRTIIENMM-FPVSLDVLYQLFTRYGKVLRIITFNKNNTFQALVQMSEANSAQLAKQGLENQNVYNGCCTLRIDYSK-LSTLNVKYNNDKSRDYT 162          
BLAST of Polypyrimidine tract-binding protein 1 vs. Ensembl Celegans
Match: ptb-1 (PTB (HnRNP) homolog; Putative RNA-binding protein PTB-1a [Source:UniProtKB/TrEMBL;Acc:Q18999])

HSP 1 Score: 159.073 bits (401), Expect = 1.341e-41
Identity = 87/203 (42.86%), Postives = 122/203 (60.10%), Query Frame = 1
Query: 1780 SSIILVSNLNYEKVNTDSIFTLFGVYGDVSKVCISPPSVGAALVYMQTNSQAETACRHLNLVPLFGKIISTYLLPGEIVAQSIFNTELNSDIE-----VKHFTNTPLHRFKKPNSKNHFNIYPPSSVLHLSNIPLSFKEEDLLTLFHDNGFQCSSLRIFQKDKKMALAKMTSLEDAISALISLHNWKLTDSSHLRVSFSKALI 2373
            + +ILVSNL+  KV TD++FTLFGVYGDV +V I       AL+      QA+ A  HL+ V    ++I        +      N ++  + +      + + ++ LHRFKKP SKN+ NIYPP + LHLSNIP S  EE L  +F + GF   + + F KD KMAL ++  +E AI ALI++HN KL +++HLRVSFSK+ I
Sbjct:  258 TPVILVSNLHEMKVTTDALFTLFGVYGDVMRVKILYNKKDNALIQYSEPQQAQLALTHLDKVKWHDRLI-------RVAPSKHTNVQMPKEGQPDAGLTRDYAHSTLHRFKKPGSKNYLNIYPPCATLHLSNIPTSVSEEKLKEMFAEAGFAVKAFKFFPKDHKMALCQLEDIETAIDALIAMHNHKLAENAHLRVSFSKSGI 453          

HSP 2 Score: 82.8037 bits (203), Expect = 3.045e-16
Identity = 47/133 (35.34%), Postives = 76/133 (57.14%), Query Frame = 1
Query: 1078 NIDASVDAANKMNEKHRSIVDEWSSE-----NKSDRRILRVVIENLKNYNINHLVILKVFQRFGKVLRIIIFTKNMQCQCLVELDNSISAHVSLLHLNGQDLFNDCCRLKIEFSKNTDSLQIQRQNDKCRDYT 1461
            N D  V AA+      +S+ +   S       +    +LR +IEN+  + ++  V+ ++F R+GKVLRII F KN   Q LV++  + SA ++   L  Q+++N CC L+I++SK   +L ++  NDK RDYT
Sbjct:   32 NNDVVVGAASTGRAAGKSVANGSVSNFEVGTQQQPNSVLRTIIENMM-FPVSLDVLYQLFTRYGKVLRIITFNKNNTFQALVQMSEANSAQLAKQGLENQNVYNGCCTLRIDYSK-LSTLNVKYNNDKSRDYT 162          
BLAST of Polypyrimidine tract-binding protein 1 vs. Ensembl Celegans
Match: ptb-1 (PTB (HnRNP) homolog; Putative RNA-binding protein PTB-1a [Source:UniProtKB/TrEMBL;Acc:Q18999])

HSP 1 Score: 159.073 bits (401), Expect = 1.349e-40
Identity = 87/203 (42.86%), Postives = 122/203 (60.10%), Query Frame = 1
Query: 1780 SSIILVSNLNYEKVNTDSIFTLFGVYGDVSKVCISPPSVGAALVYMQTNSQAETACRHLNLVPLFGKIISTYLLPGEIVAQSIFNTELNSDIE-----VKHFTNTPLHRFKKPNSKNHFNIYPPSSVLHLSNIPLSFKEEDLLTLFHDNGFQCSSLRIFQKDKKMALAKMTSLEDAISALISLHNWKLTDSSHLRVSFSKALI 2373
            + +ILVSNL+  KV TD++FTLFGVYGDV +V I       AL+      QA+ A  HL+ V    ++I        +      N ++  + +      + + ++ LHRFKKP SKN+ NIYPP + LHLSNIP S  EE L  +F + GF   + + F KD KMAL ++  +E AI ALI++HN KL +++HLRVSFSK+ I
Sbjct:  420 TPVILVSNLHEMKVTTDALFTLFGVYGDVMRVKILYNKKDNALIQYSEPQQAQLALTHLDKVKWHDRLI-------RVAPSKHTNVQMPKEGQPDAGLTRDYAHSTLHRFKKPGSKNYLNIYPPCATLHLSNIPTSVSEEKLKEMFAEAGFAVKAFKFFPKDHKMALCQLEDIETAIDALIAMHNHKLAENAHLRVSFSKSGI 615          

HSP 2 Score: 110.153 bits (274), Expect = 1.065e-24
Identity = 71/214 (33.18%), Postives = 114/214 (53.27%), Query Frame = 1
Query:  820 SKVLHIRNIASRAQESDLSLLAVPFGKIRSMVYAKKTNQALLELEKASEATRMFDYYTRYPPCFNGREMIVQYSKHVSLELKLKNSNIDASVDAANKMNEKHRSIVDEWSSENKSDRRILRVVIENLKNYNINHLVILKVFQRFGKVLRIIIFTKNMQCQCLVELDNSISAHVSLLHLNGQDLFNDCCRLKIEFSKNTDSLQIQRQNDKCRDYT 1461
            SKV+H+RNI     + +L  L + +G + + +  K  +QA +E E+ + A       T  P    GR +  QYS H  L+   KN  I  +   AN       S+ +      +    +LR +IEN+  + ++  V+ ++F R+GKVLRII F KN   Q LV++  + SA ++   L  Q+++N CC L+I++SK   +L ++  NDK RDYT
Sbjct:  120 SKVVHVRNIPPDLVDVELMQLCIQYGPVSNYMMLKGKSQAFVEYEEEASAAAFVSGMTAVPIQIRGRTLFAQYSTHRELKFD-KNKAISDTESVANG------SVSNFEVGTQQQPNSVLRTIIENMM-FPVSLDVLYQLFTRYGKVLRIITFNKNNTFQALVQMSEANSAQLAKQGLENQNVYNGCCTLRIDYSK-LSTLNVKYNNDKSRDYT 324          
BLAST of Polypyrimidine tract-binding protein 1 vs. Ensembl Celegans
Match: hrpl-1 (Heterogeneous nuclear RibonucleoProtein (HnRNP) L homolog [Source:UniProtKB/TrEMBL;Acc:Q95QR5])

HSP 1 Score: 87.4261 bits (215), Expect = 2.598e-18
Identity = 89/386 (23.06%), Postives = 153/386 (39.64%), Query Frame = 1
Query:  742 GSSYSIDVDSNESKKSKLEPSTNTEPSKVLHIRNIASRAQESDLSLLAVPFGKIRSMVYAKKTNQALLELEKASEATRMFDYYTRYPPCFNGREMIVQYSKHVSLELKLKNSNIDASVDAANKMNEKHRSIVDEWSSENKSDRRILRVVIENLKNYNINHLVILKVFQRFGKVLRIIIFTKNMQCQCLVELDNSISAHVSLLHLNGQDLFNDCCRLKIEFSKNTDSLQIQRQNDKCRDYTV----SPLQEDE-QFSLHFLDWQAKSVSTVPPQQYPSLSTVPLLQTQVQKPLYSDFLPNNLFYTVMPNVFKSTFQPSPVAIPESLLISDCAINPLYQEPIVKPPSSANAIDSSIILVSNLNYEKVNTDSIFTLFGVYGDVSKVCIS 1884
            G  +  D      +    +P TN  PS V+H+RN+  +  E+DL      FG +        +  AL+E E    A    ++ T       G+  +  YS    +E                               E+ +  ++L V + N + Y I+  VI ++    GKVLR+ +  K    Q LVE ++   A  +   +NG D+++ CC LK+EF+K  D +++QRQ+   RD+T+     P ++D   +  H  D+QA       P  Y   S         +   +SD+   +              +  P   P S    D      Y++     P+        ++++  L + K+N D +F +   YG+V +V  S
Sbjct:    6 GYHHGFDGPKRYRRDDNADP-TNPNPSIVVHVRNLHQKVTEADLLEALSNFGPVAYATCIPHSRMALVEFEDIEGAKACVNFATSNQINVGGQGALFNYSTSQCIE---------------------------RMGFESATPNKVLVVTVLNAQ-YPIDADVIYQISNAQGKVLRVAVMHKPTVVQALVEFESMEVAKAAKHAMNGADIYSGCCTLKVEFAK-PDRVRVQRQDKDQRDFTLPDNRRPYEDDRNHYDRH--DYQA-------PSSYGYSS---------RGGGHSDYYGGD--------------RGGPPHPPPSRYRDD------YEDRGYAQPAGGGP--GCVMMIYGLEHGKINCDMLFNILCQYGNVLRVSSS 321          
BLAST of Polypyrimidine tract-binding protein 1 vs. Ensembl Celegans
Match: hrpl-1 (Heterogeneous nuclear RibonucleoProtein (HnRNP) L homolog [Source:UniProtKB/TrEMBL;Acc:Q95QR5])

HSP 1 Score: 88.9669 bits (219), Expect = 5.494e-18
Identity = 90/415 (21.69%), Postives = 161/415 (38.80%), Query Frame = 1
Query:  742 GSSYSIDVDSNESKKSKLEPSTNTEPSKVLHIRNIASRAQESDLSLLAVPFGKIRSMVYAKKTNQALLELEKASEATRMFDYYTRYPPCFNGREMIVQYSKHVSLELKLKNSNIDASVDAANKMNEKHRSIVDEWSSENKSDRRILRVVIENLKNYNINHLVILKVFQRFGKVLRIIIFTKNMQCQCLVELDNSISAHVSLLHLNGQDLFNDCCRLKIEFSKNTDSLQIQRQNDKCRDYTVSPLQEDEQFSLHFLDWQAKSVSTVPPQQYPSLSTVPLLQTQVQKPLYSDFLPNNLFYTVMPNVFKSTF---QPSPVAIPESLLISDCAINPLYQEPIVKPPSSANAIDSSIILVSNLNYEKVNTDSIFTLFGVYGDVSKVCISPPSVGAALVYMQTNSQAETACRHLNLVPLFG 1977
            G  +  D      +    +P TN  PS V+H+RN+  +  E+DL      FG +        +  AL+E E    A    ++ T       G+  +  YS    +E                               E+ +  ++L V + N + Y I+  VI ++    GKVLR+ +  K    Q LVE ++   A  +   +NG D+++ CC LK+EF+K  D +++QRQ+   RD+T   L ++E F       Q     T+ P +       P    +     +    P++  Y+         +   +  P   P S    D      Y++     P+        ++++  L + K+N D +F +   YG+V ++          ++ + T  + +     L    LFG
Sbjct:    6 GYHHGFDGPKRYRRDDNADP-TNPNPSIVVHVRNLHQKVTEADLLEALSNFGPVAYATCIPHSRMALVEFEDIEGAKACVNFATSNQINVGGQGALFNYSTSQCIE---------------------------RMGFESATPNKVLVVTVLNAQ-YPIDADVIYQISNAQGKVLRVAVMHKPTVVQALVEFESMEVAKAAKHAMNGADIYSGCCTLKVEFAK-PDRVRVQRQDKDQRDFT---LPDNESF-------QDTGRKTLIPAKPDDHYRRPYEDDRNHYDRHDYQAPSSYGYSSRGGGHSDYYGGDRGGPPHPPPSRYRDD------YEDRGYAQPAGGGP--GCVMMIYGLEHGKINCDMLFNILCQYGNVLRISFMRTKTETGIIELGTPEERQNVLDFLQGSALFG 372          
BLAST of Polypyrimidine tract-binding protein 1 vs. Ensembl Fly
Match: heph (gene:FBgn0011224 transcript:FBtr0346192)

HSP 1 Score: 281.952 bits (720), Expect = 3.647e-84
Identity = 201/615 (32.68%), Postives = 314/615 (51.06%), Query Frame = 1
Query:  697 GVKRSIQNFNSNSLLGSSYSIDVDSN-ESKKSKLEPSTN-----TEPSKVLHIRNIASRAQESDLSLLAVPFGKIRSMVYAKKTNQALLELEKASEATRMFDYYTRYPPCFNGREMIVQYSKHVSLELKLKNSNIDASVDAANKMNE-------------------------------KHRSIVDEWSSENKSD--RRILRVVIENLKNYNINHLVILKVFQRFGKVLRIIIFTKNMQCQCLVELDNSISAHVSLLHLNGQDLFNDCCRLKIEFSKNTDSLQIQRQNDKCRDYTVSPLQEDEQFSLHFLDWQAKSVST-----VPPQQYPSLS--------TVPLLQTQVQKPL---YSDFLPNNLFYTVMPNVFKSTFQPSPVAIPESLLISDCAINPLYQEPIVKPPSSANAIDSSIILVSNLNYEKVNTDSIFTLFGVYGDVSKVCISPPSVGAALVYMQTNSQAETACRHLNLVPLFGKIISTYLLPGEIVAQSIFNTELNSDIEV-KHFTNTPLHRFKKPNSKNHFNIYPPSSVLHLSNIPLSFKEEDLLTLFHDNGFQCSSLRIFQKDKKMALAKMTSLEDAISALISLHNWKLTDSSHLRVSFSKALI 2373
            GVKR      S + + +  S + + +  +KK+KLEP T       + SKV+H+RNI + + E+D+  L +PFG++ +++  K  NQA +E+     AT M   YT  PP   GR + VQ+S H  L+    ++N  A  D + +                                  ++ S V+   + N +     +LRV++E+L  Y ++  ++ ++FQR+GKVL+I+ FTKN   Q L++  ++ SA  +   L+GQ+++N CC L+I+ SK T +L ++  NDK RD+T   L   E   +  +      ++T     +  +Q PSLS         +P     +  PL   Y++ LPN   +++  +    T  P+                                  S+++LVSNLN E V  D++FTLFGVYGDV +V I      +AL+ M    QA  A  HL+ + L+GK I       + V       E   D  + + ++  PLHRFKKP SKN+ NIYPPS+ LHLSNIP S  E+D+   F  N F+  + + F KD+KMAL ++ S+E+A+ ALI +HN +L++S+HLRVSFSK+ I
Sbjct:   26 GVKRGSDELLSQAAVMAPASDNNNQDLATKKAKLEPGTVLAGGIAKASKVIHLRNIPNESGEADVIALGIPFGRVTNVLVLKGKNQAFIEMADEISATSMVSCYTVTPPQMRGRMVYVQFSNHRELKTDQGHNNSTAHSDYSVQSPASGSPLPLSAAANATSNNANSSSDSNSAMGILQNTSAVNAGGNTNAAGGPNTVLRVIVESLM-YPVSLDILHQIFQRYGKVLKIVTFTKNNSFQALIQYPDANSAQHAKSLLDGQNIYNGCCTLRIDNSKLT-ALNVKYNNDKSRDFTNPALPPGEP-GVDIMPTAGGLMNTNDLLLIAARQRPSLSVNGLGAPGVLPPFALGLGTPLTGGYNNALPNLAAFSLANSGALQTTAPAMRGY------------------------------SNVLLVSNLNEEMVTPDALFTLFGVYGDVQRVKILYNKKDSALIQMAEPQQAYLAMSHLDKLRLWGKPIRVMASKHQAVQ---LPKEGQPDAGLTRDYSQNPLHRFKKPGSKNYQNIYPPSATLHLSNIPSSCSEDDIKEAFTSNSFEVKAFKFFPKDRKMALLQLLSVEEAVLALIKMHNHQLSESNHLRVSFSKSNI 604          
BLAST of Polypyrimidine tract-binding protein 1 vs. Ensembl Fly
Match: heph (gene:FBgn0011224 transcript:FBtr0112865)

HSP 1 Score: 280.796 bits (717), Expect = 5.017e-84
Identity = 197/573 (34.38%), Postives = 299/573 (52.18%), Query Frame = 1
Query:  778 SKKSKLEPSTN-----TEPSKVLHIRNIASRAQESDLSLLAVPFGKIRSMVYAKKTNQALLELEKASEATRMFDYYTRYPPCFNGREMIVQYSKHVSLELKLKNSNIDASVDAANKMNE-------------------------------KHRSIVDEWSSENKSD--RRILRVVIENLKNYNINHLVILKVFQRFGKVLRIIIFTKNMQCQCLVELDNSISAHVSLLHLNGQDLFNDCCRLKIEFSKNTDSLQIQRQNDKCRDYTVSPLQEDEQFSLHFLDWQAKSVSTVPPQQYPSLSTVPLLQTQVQKP-LYSDFLPNNLFY-TVMPNVFKSTFQPSPVAIPESLLISDCAINPLYQEPIVKPPSSANAIDSSIILVSNLNYEKVNTDSIFTLFGVYGDVSKVCISPPSVGAALVYMQTNSQAETACRHLNLVPLFGKIISTYLLPGEIVAQSIFNTELNSDIEV-KHFTNTPLHRFKKPNSKNHFNIYPPSSVLHLSNIPLSFKEEDLLTLFHDNGFQCSSLRIFQKDKKMALAKMTSLEDAISALISLHNWKLTDSSHLRVSFSKALI 2373
            +KK+KLEP T       + SKV+H+RNI + + E+D+  L +PFG++ +++  K  NQA +E+     AT M   YT  PP   GR + VQ+S H  L+    ++N  A  D + +                                  ++ S V+   + N +     +LRV++E+L  Y ++  ++ ++FQR+GKVL+I+ FTKN   Q L++  ++ SA  +   L+GQ+++N CC L+I+ SK T +L ++  NDK RD+T   L   E             V  +P       +   LL    Q+P L  D + N L    V+P        P       +L   + A   L     ++  + A    S+++LVSNLN E V  D++FTLFGVYGDV +V I      +AL+ M    QA  A  HL+ + L+GK I       + V       E   D  + + ++  PLHRFKKP SKN+ NIYPPS+ LHLSNIP S  E+D+   F  N F+  + + F KD+KMAL ++ S+E+A+ ALI +HN +L++S+HLRVSFSK+ I
Sbjct:   14 TKKAKLEPGTVLAGGIAKASKVIHLRNIPNESGEADVIALGIPFGRVTNVLVLKGKNQAFIEMADEISATSMVSCYTVTPPQMRGRMVYVQFSNHRELKTDQGHNNSTAHSDYSVQSPASGSPLPLSAAANATSNNANSSSDSNSAMGILQNTSAVNAGGNTNAAGGPNTVLRVIVESLM-YPVSLDILHQIFQRYGKVLKIVTFTKNNSFQALIQYPDANSAQHAKSLLDGQNIYNGCCTLRIDNSKLT-ALNVKYNNDKSRDFTNPALPPGE-----------PGVDIMPTAGGLMNTNDLLLIAARQRPSLSGDKIVNGLGAPGVLPPFALGLGTPLTGGYNNAL--PNLAAFSLANSGALQTTAPAMRGYSNVLLVSNLNEEMVTPDALFTLFGVYGDVQRVKILYNKKDSALIQMAEPQQAYLAMSHLDKLRLWGKPIRVMASKHQAVQ---LPKEGQPDAGLTRDYSQNPLHRFKKPGSKNYQNIYPPSATLHLSNIPSSCSEDDIKEAFTSNSFEVKAFKFFPKDRKMALLQLLSVEEAVLALIKMHNHQLSESNHLRVSFSKSNI 568          
BLAST of Polypyrimidine tract-binding protein 1 vs. Ensembl Fly
Match: heph (gene:FBgn0011224 transcript:FBtr0300268)

HSP 1 Score: 280.411 bits (716), Expect = 9.881e-84
Identity = 197/573 (34.38%), Postives = 299/573 (52.18%), Query Frame = 1
Query:  778 SKKSKLEPSTN-----TEPSKVLHIRNIASRAQESDLSLLAVPFGKIRSMVYAKKTNQALLELEKASEATRMFDYYTRYPPCFNGREMIVQYSKHVSLELKLKNSNIDASVDAANKMNE-------------------------------KHRSIVDEWSSENKSD--RRILRVVIENLKNYNINHLVILKVFQRFGKVLRIIIFTKNMQCQCLVELDNSISAHVSLLHLNGQDLFNDCCRLKIEFSKNTDSLQIQRQNDKCRDYTVSPLQEDEQFSLHFLDWQAKSVSTVPPQQYPSLSTVPLLQTQVQKP-LYSDFLPNNLFY-TVMPNVFKSTFQPSPVAIPESLLISDCAINPLYQEPIVKPPSSANAIDSSIILVSNLNYEKVNTDSIFTLFGVYGDVSKVCISPPSVGAALVYMQTNSQAETACRHLNLVPLFGKIISTYLLPGEIVAQSIFNTELNSDIEV-KHFTNTPLHRFKKPNSKNHFNIYPPSSVLHLSNIPLSFKEEDLLTLFHDNGFQCSSLRIFQKDKKMALAKMTSLEDAISALISLHNWKLTDSSHLRVSFSKALI 2373
            +KK+KLEP T       + SKV+H+RNI + + E+D+  L +PFG++ +++  K  NQA +E+     AT M   YT  PP   GR + VQ+S H  L+    ++N  A  D + +                                  ++ S V+   + N +     +LRV++E+L  Y ++  ++ ++FQR+GKVL+I+ FTKN   Q L++  ++ SA  +   L+GQ+++N CC L+I+ SK T +L ++  NDK RD+T   L   E             V  +P       +   LL    Q+P L  D + N L    V+P        P       +L   + A   L     ++  + A    S+++LVSNLN E V  D++FTLFGVYGDV +V I      +AL+ M    QA  A  HL+ + L+GK I       + V       E   D  + + ++  PLHRFKKP SKN+ NIYPPS+ LHLSNIP S  E+D+   F  N F+  + + F KD+KMAL ++ S+E+A+ ALI +HN +L++S+HLRVSFSK+ I
Sbjct:   27 TKKAKLEPGTVLAGGIAKASKVIHLRNIPNESGEADVIALGIPFGRVTNVLVLKGKNQAFIEMADEISATSMVSCYTVTPPQMRGRMVYVQFSNHRELKTDQGHNNSTAHSDYSVQSPASGSPLPLSAAANATSNNANSSSDSNSAMGILQNTSAVNAGGNTNAAGGPNTVLRVIVESLM-YPVSLDILHQIFQRYGKVLKIVTFTKNNSFQALIQYPDANSAQHAKSLLDGQNIYNGCCTLRIDNSKLT-ALNVKYNNDKSRDFTNPALPPGE-----------PGVDIMPTAGGLMNTNDLLLIAARQRPSLSGDKIVNGLGAPGVLPPFALGLGTPLTGGYNNAL--PNLAAFSLANSGALQTTAPAMRGYSNVLLVSNLNEEMVTPDALFTLFGVYGDVQRVKILYNKKDSALIQMAEPQQAYLAMSHLDKLRLWGKPIRVMASKHQAVQ---LPKEGQPDAGLTRDYSQNPLHRFKKPGSKNYQNIYPPSATLHLSNIPSSCSEDDIKEAFTSNSFEVKAFKFFPKDRKMALLQLLSVEEAVLALIKMHNHQLSESNHLRVSFSKSNI 581          
BLAST of Polypyrimidine tract-binding protein 1 vs. Ensembl Fly
Match: heph (gene:FBgn0011224 transcript:FBtr0300269)

HSP 1 Score: 280.411 bits (716), Expect = 9.881e-84
Identity = 197/573 (34.38%), Postives = 299/573 (52.18%), Query Frame = 1
Query:  778 SKKSKLEPSTN-----TEPSKVLHIRNIASRAQESDLSLLAVPFGKIRSMVYAKKTNQALLELEKASEATRMFDYYTRYPPCFNGREMIVQYSKHVSLELKLKNSNIDASVDAANKMNE-------------------------------KHRSIVDEWSSENKSD--RRILRVVIENLKNYNINHLVILKVFQRFGKVLRIIIFTKNMQCQCLVELDNSISAHVSLLHLNGQDLFNDCCRLKIEFSKNTDSLQIQRQNDKCRDYTVSPLQEDEQFSLHFLDWQAKSVSTVPPQQYPSLSTVPLLQTQVQKP-LYSDFLPNNLFY-TVMPNVFKSTFQPSPVAIPESLLISDCAINPLYQEPIVKPPSSANAIDSSIILVSNLNYEKVNTDSIFTLFGVYGDVSKVCISPPSVGAALVYMQTNSQAETACRHLNLVPLFGKIISTYLLPGEIVAQSIFNTELNSDIEV-KHFTNTPLHRFKKPNSKNHFNIYPPSSVLHLSNIPLSFKEEDLLTLFHDNGFQCSSLRIFQKDKKMALAKMTSLEDAISALISLHNWKLTDSSHLRVSFSKALI 2373
            +KK+KLEP T       + SKV+H+RNI + + E+D+  L +PFG++ +++  K  NQA +E+     AT M   YT  PP   GR + VQ+S H  L+    ++N  A  D + +                                  ++ S V+   + N +     +LRV++E+L  Y ++  ++ ++FQR+GKVL+I+ FTKN   Q L++  ++ SA  +   L+GQ+++N CC L+I+ SK T +L ++  NDK RD+T   L   E             V  +P       +   LL    Q+P L  D + N L    V+P        P       +L   + A   L     ++  + A    S+++LVSNLN E V  D++FTLFGVYGDV +V I      +AL+ M    QA  A  HL+ + L+GK I       + V       E   D  + + ++  PLHRFKKP SKN+ NIYPPS+ LHLSNIP S  E+D+   F  N F+  + + F KD+KMAL ++ S+E+A+ ALI +HN +L++S+HLRVSFSK+ I
Sbjct:   27 TKKAKLEPGTVLAGGIAKASKVIHLRNIPNESGEADVIALGIPFGRVTNVLVLKGKNQAFIEMADEISATSMVSCYTVTPPQMRGRMVYVQFSNHRELKTDQGHNNSTAHSDYSVQSPASGSPLPLSAAANATSNNANSSSDSNSAMGILQNTSAVNAGGNTNAAGGPNTVLRVIVESLM-YPVSLDILHQIFQRYGKVLKIVTFTKNNSFQALIQYPDANSAQHAKSLLDGQNIYNGCCTLRIDNSKLT-ALNVKYNNDKSRDFTNPALPPGE-----------PGVDIMPTAGGLMNTNDLLLIAARQRPSLSGDKIVNGLGAPGVLPPFALGLGTPLTGGYNNAL--PNLAAFSLANSGALQTTAPAMRGYSNVLLVSNLNEEMVTPDALFTLFGVYGDVQRVKILYNKKDSALIQMAEPQQAYLAMSHLDKLRLWGKPIRVMASKHQAVQ---LPKEGQPDAGLTRDYSQNPLHRFKKPGSKNYQNIYPPSATLHLSNIPSSCSEDDIKEAFTSNSFEVKAFKFFPKDRKMALLQLLSVEEAVLALIKMHNHQLSESNHLRVSFSKSNI 581          
BLAST of Polypyrimidine tract-binding protein 1 vs. Ensembl Fly
Match: heph (gene:FBgn0011224 transcript:FBtr0300267)

HSP 1 Score: 280.411 bits (716), Expect = 9.881e-84
Identity = 197/573 (34.38%), Postives = 299/573 (52.18%), Query Frame = 1
Query:  778 SKKSKLEPSTN-----TEPSKVLHIRNIASRAQESDLSLLAVPFGKIRSMVYAKKTNQALLELEKASEATRMFDYYTRYPPCFNGREMIVQYSKHVSLELKLKNSNIDASVDAANKMNE-------------------------------KHRSIVDEWSSENKSD--RRILRVVIENLKNYNINHLVILKVFQRFGKVLRIIIFTKNMQCQCLVELDNSISAHVSLLHLNGQDLFNDCCRLKIEFSKNTDSLQIQRQNDKCRDYTVSPLQEDEQFSLHFLDWQAKSVSTVPPQQYPSLSTVPLLQTQVQKP-LYSDFLPNNLFY-TVMPNVFKSTFQPSPVAIPESLLISDCAINPLYQEPIVKPPSSANAIDSSIILVSNLNYEKVNTDSIFTLFGVYGDVSKVCISPPSVGAALVYMQTNSQAETACRHLNLVPLFGKIISTYLLPGEIVAQSIFNTELNSDIEV-KHFTNTPLHRFKKPNSKNHFNIYPPSSVLHLSNIPLSFKEEDLLTLFHDNGFQCSSLRIFQKDKKMALAKMTSLEDAISALISLHNWKLTDSSHLRVSFSKALI 2373
            +KK+KLEP T       + SKV+H+RNI + + E+D+  L +PFG++ +++  K  NQA +E+     AT M   YT  PP   GR + VQ+S H  L+    ++N  A  D + +                                  ++ S V+   + N +     +LRV++E+L  Y ++  ++ ++FQR+GKVL+I+ FTKN   Q L++  ++ SA  +   L+GQ+++N CC L+I+ SK T +L ++  NDK RD+T   L   E             V  +P       +   LL    Q+P L  D + N L    V+P        P       +L   + A   L     ++  + A    S+++LVSNLN E V  D++FTLFGVYGDV +V I      +AL+ M    QA  A  HL+ + L+GK I       + V       E   D  + + ++  PLHRFKKP SKN+ NIYPPS+ LHLSNIP S  E+D+   F  N F+  + + F KD+KMAL ++ S+E+A+ ALI +HN +L++S+HLRVSFSK+ I
Sbjct:   27 TKKAKLEPGTVLAGGIAKASKVIHLRNIPNESGEADVIALGIPFGRVTNVLVLKGKNQAFIEMADEISATSMVSCYTVTPPQMRGRMVYVQFSNHRELKTDQGHNNSTAHSDYSVQSPASGSPLPLSAAANATSNNANSSSDSNSAMGILQNTSAVNAGGNTNAAGGPNTVLRVIVESLM-YPVSLDILHQIFQRYGKVLKIVTFTKNNSFQALIQYPDANSAQHAKSLLDGQNIYNGCCTLRIDNSKLT-ALNVKYNNDKSRDFTNPALPPGE-----------PGVDIMPTAGGLMNTNDLLLIAARQRPSLSGDKIVNGLGAPGVLPPFALGLGTPLTGGYNNAL--PNLAAFSLANSGALQTTAPAMRGYSNVLLVSNLNEEMVTPDALFTLFGVYGDVQRVKILYNKKDSALIQMAEPQQAYLAMSHLDKLRLWGKPIRVMASKHQAVQ---LPKEGQPDAGLTRDYSQNPLHRFKKPGSKNYQNIYPPSATLHLSNIPSSCSEDDIKEAFTSNSFEVKAFKFFPKDRKMALLQLLSVEEAVLALIKMHNHQLSESNHLRVSFSKSNI 581          
BLAST of Polypyrimidine tract-binding protein 1 vs. Ensembl Zebrafish
Match: ptbp2b (polypyrimidine tract binding protein 2b [Source:ZFIN;Acc:ZDB-GENE-060810-49])

HSP 1 Score: 301.982 bits (772), Expect = 2.817e-92
Identity = 206/570 (36.14%), Postives = 302/570 (52.98%), Query Frame = 1
Query:  697 GVKRSIQNFNSNSLLGS-SYSIDVDSNESKKSKLEPSTNTEPSKVLHIRNIASRAQESDLSLLAVPFGKIRSMVYAKKTNQALLELEKASEATRMFDYYTRYPPCFNGREMIVQYSKHVSLELKLK-NSNIDASVDAANKMNEKHRSIVDEWSSE--NKSDRRILRVVIENLKNYNINHLVILKVFQRFGKVLRIIIFTKNMQCQCLVELDNSISAHVSLLHLNGQDLFNDCCRLKIEFSKNTDSLQIQRQNDKCRDYTVSPLQEDEQFSLHFLDWQAKSVSTVPPQQYPSLS--TVPLLQTQVQKPLYSDFLPNNLFYTVMPNVFKSTFQPSPVAIPESLLISDCAINPLYQEPIV-----KPPSSANAIDSSIILVSNLNYEKVNTDSIFTLFGVYGDVSKVCISPPSVGAALVYMQTNSQAETACRHLNLVPLFGKIISTYLLPGEIVAQSIFNTELNSDIEVKHFTNTPLHRFKKPNSKNHFNIYPPSSVLHLSNIPLSFKEEDLLTLFHDNGFQCSSLRIFQKDKKMALAKMTSLEDAISALISLHNWKLTDSSHLRVSFSKALI 2373
            GVKRS  +  S SL  S + S+  + ++SKK ++E S ++ PS+V+HIR + +   E+++  L +PFGK+ +++  K  NQA LEL     A  M +YYT   P      + +QYS H  L+     N    A + A + + E      D  S      +   +LR++I+N+  Y +   V+ ++F +FG V++II FTKN Q Q L++  + ++A  + L L+GQ+++N CC L+I+FSK  + L ++  NDK RDYT   L           D Q      V P    +LS  +  LL T           P+ +           T   S    P SL     AI+PL           +   S +++   ++LVSNLN E V   S+FTLFGVYGDV +V I      +AL+ M   +QA+ A  HLN   ++GKII   L   + V   +    L+     K FT++PLHRFKKP SKN  NI+PPS+ LHLSNIP +  EEDL  LF ++G    + + FQ D+KM+L +M + E+AI ALI LHN+ +     LRVSFSK+ I
Sbjct:   11 GVKRSSDDLLSGSLYSSPNSSVTANGSDSKKLRVEDSMDSPPSRVIHIRKLPNEVSETEVIALGLPFGKVTNILMLKGKNQAFLELGTEEAAVTMVNYYTAVTPQVRNVPVFIQYSNHKELKTDSALNQRAQAVLQAVSAVQEGGSPSSDMASKSVLTPAPSPVLRIIIDNMF-YPVTLDVLQQIFSKFGTVMKIITFTKNNQFQALLQFSDPVNAQQAKLSLDGQNIYNSCCTLRIDFSKLVN-LNVKYNNDKSRDYTRPELPAG--------DGQPP----VDPSMAAALSKDSPSLLGT-----------PSGMV----------TSYSSGGGFPSSL----GAISPLSAAAAAAAAAGRVALSGHSVPGGVLLVSNLNDEMVTPQSLFTLFGVYGDVQRVKILYNKKDSALIQMSDGNQAQLAMSHLNGQKMYGKIIRVTLSKHQTV--QLPREGLDDQGLTKDFTSSPLHRFKKPGSKNFQNIFPPSATLHLSNIPDNVTEEDLRLLFSNSGGTVKAFKFFQ-DRKMSLLQMATAEEAIQALIDLHNYDMGRGHRLRVSFSKSTI 538          
BLAST of Polypyrimidine tract-binding protein 1 vs. Ensembl Zebrafish
Match: ptbp3 (polypyrimidine tract binding protein 3 [Source:ZFIN;Acc:ZDB-GENE-091116-1])

HSP 1 Score: 298.516 bits (763), Expect = 4.173e-91
Identity = 196/554 (35.38%), Postives = 294/554 (53.07%), Query Frame = 1
Query:  745 SSYSIDVDSNESKKSKLEPSTNTEPSKVLHIRNIASRAQESDLSLLAVPFGKIRSMVYAKKTNQALLELEKASEATRMFDYYTRYPPCFNGREMIVQYSKHVSLELKLKN----SNIDASVDAANKMNEKHRSIVDEWSSENKS----DRRILRVVIENLKNYNINHLVILKVFQRFGKVLRIIIFTKNMQCQCLVELDNSISAHVSLLHLNGQDLFNDCCRLKIEFSKNTDSLQIQRQNDKCRDYTVSPL-QEDEQFSLHFLDWQAKSVSTVPPQQYPSLST-VPLLQTQVQKPLYSDFLPNNLFYTVMPNVFKSTFQPSPVAIPESLLISDCAINPLYQEPIVKPPSSANAIDSSIILVSNLNYEKVNTDSIFTLFGVYGDVSKVCISPPSVGAALVYMQTNSQAETACRHLNLVPLFGKIISTYLLPGEIVAQSIFNTELNSDIEV-KHFTNTPLHRFKKPNSKNHFNIYPPSSVLHLSNIPLSFKEEDLLTLFHDNGFQCSSLRIFQKDKKMALAKMTSLEDAISALISLHNWKLTDSSHLRVSFSKALI 2373
            S+ S   +  +SK+ K + S    PS+VLH+R +     E+++  L VPFGK+ +++  K  NQA +E+     A  M +YYT   P    + + +QYS H   ELK  N        A++ A N ++  + S+    ++ +         +LR+++ENL  Y ++  V+ ++F +FG VL+II FTKN Q Q L++  + ++AH + + L+GQ+++N CC L++EFSK T SL ++  NDK RD+T   L   D Q +L      A     +    YP  +   P +           F    L    MP          P+ IP S +    AI+ +    I            S++LVSNLN + ++   +F LFGVYGDV +V I       AL+ M   +QA+ A  HLN   L+GK+I   +   + V       E   D  + K F+ +PLHRFKKP SKN  NI+PPS+ LHLSNIP S  ++ L  LF  +G+   + + FQKD+KMAL ++ S+E+AI ALI LHN  L ++ HLRVSFSK+ I
Sbjct:    4 STPSTTANGTDSKQYKGDRSP-CAPSRVLHVRKVPIEVSEAEVVSLGVPFGKVTNLLMLKGKNQAFIEMASEEAAMTMVNYYTTATPHVRNQPVYIQYSNH--RELKTDNLPNQGRAQAALQAVNAVHTGNMSLSGTATASDGGMMPGQSPVLRIIVENLY-YPVSLEVLHQIFSKFGTVLKIITFTKNNQFQALLQYADPMNAHHAKVALDGQNIYNGCCTLRVEFSKLT-SLNVKYNNDKSRDFTRLDLPSGDGQPTLDPTMQTAFGAPGIISSPYPGAAGFAPAI----------GFPQAGLSMQAMPGAL------GPLTIPSSAMTGRMAIHGMTPTAI-----------HSVLLVSNLNPDSISPHELFILFGVYGDVHRVKILFNKKENALIQMADATQAQLAMSHLNGQRLYGKVIRVTISKHQTVQ---LPREGQEDQGLTKDFSGSPLHRFKKPGSKNFQNIFPPSATLHLSNIPPSTTDDFLKDLFASSGYTVKAFKFFQKDRKMALIQLGSVEEAIQALIHLHNHDLGENHHLRVSFSKSTI 522          
BLAST of Polypyrimidine tract-binding protein 1 vs. Ensembl Zebrafish
Match: ptbp3 (polypyrimidine tract binding protein 3 [Source:ZFIN;Acc:ZDB-GENE-091116-1])

HSP 1 Score: 298.516 bits (763), Expect = 4.173e-91
Identity = 196/554 (35.38%), Postives = 294/554 (53.07%), Query Frame = 1
Query:  745 SSYSIDVDSNESKKSKLEPSTNTEPSKVLHIRNIASRAQESDLSLLAVPFGKIRSMVYAKKTNQALLELEKASEATRMFDYYTRYPPCFNGREMIVQYSKHVSLELKLKN----SNIDASVDAANKMNEKHRSIVDEWSSENKS----DRRILRVVIENLKNYNINHLVILKVFQRFGKVLRIIIFTKNMQCQCLVELDNSISAHVSLLHLNGQDLFNDCCRLKIEFSKNTDSLQIQRQNDKCRDYTVSPL-QEDEQFSLHFLDWQAKSVSTVPPQQYPSLST-VPLLQTQVQKPLYSDFLPNNLFYTVMPNVFKSTFQPSPVAIPESLLISDCAINPLYQEPIVKPPSSANAIDSSIILVSNLNYEKVNTDSIFTLFGVYGDVSKVCISPPSVGAALVYMQTNSQAETACRHLNLVPLFGKIISTYLLPGEIVAQSIFNTELNSDIEV-KHFTNTPLHRFKKPNSKNHFNIYPPSSVLHLSNIPLSFKEEDLLTLFHDNGFQCSSLRIFQKDKKMALAKMTSLEDAISALISLHNWKLTDSSHLRVSFSKALI 2373
            S+ S   +  +SK+ K + S    PS+VLH+R +     E+++  L VPFGK+ +++  K  NQA +E+     A  M +YYT   P    + + +QYS H   ELK  N        A++ A N ++  + S+    ++ +         +LR+++ENL  Y ++  V+ ++F +FG VL+II FTKN Q Q L++  + ++AH + + L+GQ+++N CC L++EFSK T SL ++  NDK RD+T   L   D Q +L      A     +    YP  +   P +           F    L    MP          P+ IP S +    AI+ +    I            S++LVSNLN + ++   +F LFGVYGDV +V I       AL+ M   +QA+ A  HLN   L+GK+I   +   + V       E   D  + K F+ +PLHRFKKP SKN  NI+PPS+ LHLSNIP S  ++ L  LF  +G+   + + FQKD+KMAL ++ S+E+AI ALI LHN  L ++ HLRVSFSK+ I
Sbjct:    4 STPSTTANGTDSKQYKGDRSP-CAPSRVLHVRKVPIEVSEAEVVSLGVPFGKVTNLLMLKGKNQAFIEMASEEAAMTMVNYYTTATPHVRNQPVYIQYSNH--RELKTDNLPNQGRAQAALQAVNAVHTGNMSLSGTATASDGGMMPGQSPVLRIIVENLY-YPVSLEVLHQIFSKFGTVLKIITFTKNNQFQALLQYADPMNAHHAKVALDGQNIYNGCCTLRVEFSKLT-SLNVKYNNDKSRDFTRLDLPSGDGQPTLDPTMQTAFGAPGIISSPYPGAAGFAPAI----------GFPQAGLSMQAMPGAL------GPLTIPSSAMTGRMAIHGMTPTAI-----------HSVLLVSNLNPDSISPHELFILFGVYGDVHRVKILFNKKENALIQMADATQAQLAMSHLNGQRLYGKVIRVTISKHQTVQ---LPREGQEDQGLTKDFSGSPLHRFKKPGSKNFQNIFPPSATLHLSNIPPSTTDDFLKDLFASSGYTVKAFKFFQKDRKMALIQLGSVEEAIQALIHLHNHDLGENHHLRVSFSKSTI 522          
BLAST of Polypyrimidine tract-binding protein 1 vs. Ensembl Zebrafish
Match: ptbp3 (polypyrimidine tract binding protein 3 [Source:ZFIN;Acc:ZDB-GENE-091116-1])

HSP 1 Score: 296.59 bits (758), Expect = 1.807e-90
Identity = 194/548 (35.40%), Postives = 291/548 (53.10%), Query Frame = 1
Query:  763 VDSNESKKSKLEPSTNTEPSKVLHIRNIASRAQESDLSLLAVPFGKIRSMVYAKKTNQALLELEKASEATRMFDYYTRYPPCFNGREMIVQYSKHVSLELKLKN----SNIDASVDAANKMNEKHRSIVDEWSSENKS----DRRILRVVIENLKNYNINHLVILKVFQRFGKVLRIIIFTKNMQCQCLVELDNSISAHVSLLHLNGQDLFNDCCRLKIEFSKNTDSLQIQRQNDKCRDYTVSPL-QEDEQFSLHFLDWQAKSVSTVPPQQYPSLST-VPLLQTQVQKPLYSDFLPNNLFYTVMPNVFKSTFQPSPVAIPESLLISDCAINPLYQEPIVKPPSSANAIDSSIILVSNLNYEKVNTDSIFTLFGVYGDVSKVCISPPSVGAALVYMQTNSQAETACRHLNLVPLFGKIISTYLLPGEIVAQSIFNTELNSDIEV-KHFTNTPLHRFKKPNSKNHFNIYPPSSVLHLSNIPLSFKEEDLLTLFHDNGFQCSSLRIFQKDKKMALAKMTSLEDAISALISLHNWKLTDSSHLRVSFSKALI 2373
             +  +SK+ K + S    PS+VLH+R +     E+++  L VPFGK+ +++  K  NQA +E+     A  M +YYT   P    + + +QYS H   ELK  N        A++ A N ++  + S+    ++ +         +LR+++ENL  Y ++  V+ ++F +FG VL+II FTKN Q Q L++  + ++AH + + L+GQ+++N CC L++EFSK T SL ++  NDK RD+T   L   D Q +L      A     +    YP  +   P +           F    L    MP          P+ IP S +    AI+ +    I            S++LVSNLN + ++   +F LFGVYGDV +V I       AL+ M   +QA+ A  HLN   L+GK+I   +   + V       E   D  + K F+ +PLHRFKKP SKN  NI+PPS+ LHLSNIP S  ++ L  LF  +G+   + + FQKD+KMAL ++ S+E+AI ALI LHN  L ++ HLRVSFSK+ I
Sbjct:    2 ANGTDSKQYKGDRSP-CAPSRVLHVRKVPIEVSEAEVVSLGVPFGKVTNLLMLKGKNQAFIEMASEEAAMTMVNYYTTATPHVRNQPVYIQYSNH--RELKTDNLPNQGRAQAALQAVNAVHTGNMSLSGTATASDGGMMPGQSPVLRIIVENLY-YPVSLEVLHQIFSKFGTVLKIITFTKNNQFQALLQYADPMNAHHAKVALDGQNIYNGCCTLRVEFSKLT-SLNVKYNNDKSRDFTRLDLPSGDGQPTLDPTMQTAFGAPGIISSPYPGAAGFAPAI----------GFPQAGLSMQAMPGAL------GPLTIPSSAMTGRMAIHGMTPTAI-----------HSVLLVSNLNPDSISPHELFILFGVYGDVHRVKILFNKKENALIQMADATQAQLAMSHLNGQRLYGKVIRVTISKHQTVQ---LPREGQEDQGLTKDFSGSPLHRFKKPGSKNFQNIFPPSATLHLSNIPPSTTDDFLKDLFASSGYTVKAFKFFQKDRKMALIQLGSVEEAIQALIHLHNHDLGENHHLRVSFSKSTI 514          
BLAST of Polypyrimidine tract-binding protein 1 vs. Ensembl Zebrafish
Match: ptbp1b (polypyrimidine tract binding protein 1b [Source:ZFIN;Acc:ZDB-GENE-030131-9796])

HSP 1 Score: 294.664 bits (753), Expect = 3.577e-89
Identity = 195/545 (35.78%), Postives = 285/545 (52.29%), Query Frame = 1
Query:  763 VDSNESKKSKLEPSTNTEPSKVLHIRNIASRAQESDLSLLAVPFGKIRSMVYAKKTNQALLELEKASEATRMFDYYTRYPPCFNGREMIVQYSKHVSLELKLKNS----NIDASVDAANKMNEKHRSIVDEWSSENKSDRRILRVVIENLKNYNINHLVILKVFQRFGKVLRIIIFTKNMQCQCLVELDNSISAHVSLLHLNGQDLFNDCCRLKIEFSKNTDSLQIQRQNDKCRDYTVSPL-QEDEQFSL--HFLDWQAKSVSTVPPQQYPSLSTVPLLQTQVQKPLYSDFLPNNLFYTVMPNVFKSTFQPSPVAIPESLLISDCAINPLYQEPIVKPPSSANAIDSSIILVSNLNYEKVNTDSIFTLFGVYGDVSKVCISPPSVGAALVYMQTNSQAETACRHLNLVPLFGKIISTYLLPGEIVAQSIFNTELNSDIEV-KHFTNTPLHRFKKPNSKNHFNIYPPSSVLHLSNIPLSFKEEDLLTLFHDNGFQCSSLRIFQKDKKMALAKMTSLEDAISALISLHNWKLTDSSHLRVSFSKALI 2373
             + N+SKK K +  +   PS+V+H+R + +   E+++  L +PFGK+ +++  K  NQA LE+     A  M  YY+   P      + +QYS H   ELK  NS       A++ A N +     ++     S       +LRV++ENL  Y +   V+ ++F +FG VL++I FTKN Q Q L++  + ++A  + L L+GQ+++N CC L+I FSK T SL ++  NDK RDYT   L   D Q +L  H +     +   +    Y S    P      Q  L    +P  L    +P    +    S +  P +L  + C                       ++LVSNLN E+V    +F LFGVYGDV +V I       AL+ M   +QA+ A  HLN   L+G+ +   L     V       E + D  + K ++N+PLHRFKKP SKN+ NI+PPSS LHLSNIP S  E+DL  LF  +G    + + FQKD+KMAL +M+S+E+AI +LI  HN  L ++ HLRVSFSK+ I
Sbjct:   51 ANGNDSKKFKGDIRSPAVPSRVIHVRKLPNDINEAEVIALGLPFGKVTNLLMLKGKNQAFLEMNSEEAAQTMVTYYSSVTPVIRNHPIFMQYSNHK--ELKTDNSPNQVRAQAALQAVNAVQTGSLTLGGVDPSGMTGPSPVLRVIVENLF-YPVTLDVLHQIFSKFGTVLKVITFTKNNQFQALLQFTDGLTAQHAKLALDGQNIYNGCCTLRISFSKLT-SLNVKYNNDKSRDYTRPDLPTGDSQPALEHHAVAAAFAAPGIISAAPYASAHAFPPAFAIQQAGLTIPGVPGALASLTIPGAAAAAAAASRLGFP-TLTGTHC-----------------------VMLVSNLNPERVTPHCLFILFGVYGDVLRVKIMFNKKENALIQMSDGTQAQLAMSHLNGQKLYGRPLRITLSKHTTVQMP---REGHEDQGLTKDYSNSPLHRFKKPGSKNYSNIFPPSSTLHLSNIPPSVVEDDLKLLFGSSGALVKNFKFFQKDRKMALIQMSSVEEAIESLIQFHNHDLGENHHLRVSFSKSTI 564          
BLAST of Polypyrimidine tract-binding protein 1 vs. Ensembl Xenopus
Match: ptbp1 (polypyrimidine tract binding protein 1 [Source:NCBI gene;Acc:496557])

HSP 1 Score: 288.5 bits (737), Expect = 1.394e-86
Identity = 198/549 (36.07%), Postives = 286/549 (52.09%), Query Frame = 1
Query:  766 DSNESKKSKLEPSTNTEPSKVLHIRNIASRAQESDLSLLAVPFGKIRSMVYAKKTNQALLELEKASEATRMFDYYTRYPPCFNGREMIVQYSKHVSLELKLKNS-----------NIDASVDAANKMNEKHRSIVDEWSSENKSDRRILRVVIENLKNYNINHLVILKVFQRFGKVLRIIIFTKNMQCQCLVELDNSISAHVSLLHLNGQDLFNDCCRLKIEFSKNTDSLQIQRQNDKCRDYTVSPL-QEDEQFSLHFLDWQAKSVSTVPPQQYPSLSTVPLLQTQVQKPLYSDFLPNNLFYTVMPNVFKSTFQPSPVAIPESLLISDCAINPLYQEPIVKPPSSANAIDSSIILVSNLNYEKVNTDSIFTLFGVYGDVSKVCISPPSVGAALVYMQTNSQAETACRHLNLVPLFGKIISTYLLPGEIVAQSIFNTELNSDIEV-KHFTNTPLHRFKKPNSKNHFNIYPPSSVLHLSNIPLSFKEEDLLTLFHDNGFQCSSLRIFQKDKKMALAKMTSLEDAISALISLHNWKLTDSSHLRVSFSKALI 2373
            + N+SKK K +  +    S+V+H+R +     E+++  L +PFGK+ +++  K  NQA LE+     A  M +YYT   P    + + +QYS H   ELK  NS            +++ V     ++    ++    +   +S   +LR+++ENL  Y +   V+ ++F +FG VL+II FTKN Q Q L++  + +SA  + L L+GQ+++N CC L+I+FSK T SL ++  NDK RDYT   L   D Q SL        +   +    Y S    P        PLY     N LF    PN +      +   +      +  A     +  I       N    S++LVSNLN E+V    +F LFGVYGDV +V I       ALV M   +QA+ A  HLN   L GK +   +   + V       E   D  + K ++ +PLHRFKKP SKN  NI+PPS+ LHLSNIP S  EEDL  LF +NG+     + FQKD+KMAL +M S+E+AI +LI LHN  + ++ HLRVSFSK+ I
Sbjct:   44 NGNDSKKFKGDSRSVAVGSRVIHVRKLPGDVTEAEVISLGLPFGKVTNLLMLKGKNQAFLEMNTEEAANTMINYYTNVAPVLRSQPIYIQYSNHK--ELKTDNSPNQARAQAALQAVNSVVSGTTALSASAAAVDAGMAMSGQSP--VLRIIVENLF-YPVTLDVLQQIFSKFGTVLKIITFTKNNQFQALLQYGDPVSAQHAKLSLDGQNIYNACCTLRIDFSKLT-SLNVKYNNDKSRDYTRPDLPSGDGQPSLDQTIAAFGAPGLISANPYASAGFPPAF-----APLY-----NPLFNINYPNAYVLGVHGTLAPLALPSAAAAAAAAAAGRLGIPGLGIPGN----SVLLVSNLNPERVTPQCLFILFGVYGDVHRVKILFNKKENALVQMADGNQAQLAMSHLNGQRLHGKPLRITVSKHQTVQ---LPREGQEDQGLTKDYSTSPLHRFKKPGSKNFQNIFPPSATLHLSNIPPSVSEEDLKMLFSNNGYTVKGFKFFQKDRKMALIQMGSVEEAIESLIELHNHDMGENHHLRVSFSKSTI 569          
BLAST of Polypyrimidine tract-binding protein 1 vs. Ensembl Xenopus
Match: taco1 (translational activator of mitochondrially encoded cytochrome c oxidase I [Source:Xenbase;Acc:XB-GENE-986962])

HSP 1 Score: 286.574 bits (732), Expect = 1.737e-86
Identity = 198/546 (36.26%), Postives = 287/546 (52.56%), Query Frame = 1
Query:  763 VDSNESKKSKLEPSTNTEPSKVLHIRNIASRAQESDLSLLAVPFGKIRSMVYAKKTNQALLELEKASEATRMFDYYTRYPPCFNGREMIVQYSKHVSLELKLKN----SNIDASVDAANKMNEKHRSIVDEWSSEN---KSDRRILRVVIENLKNYNINHLVILKVFQRFGKVLRIIIFTKNMQCQCLVELDNSISAHVSLLHLNGQDLFNDCCRLKIEFSKNTDSLQIQRQNDKCRDYTVSPLQEDEQFSLHFLDWQAKSVSTVPPQ-QYPSLSTVPLLQTQVQKPLYSDFLPNNLFYTVMPNVFKSTFQPSPVAIPESLLISDCAINPLYQEPIVKPPSSANAIDSSIILVSNLNYEKVNTDSIFTLFGVYGDVSKVCISPPSVGAALVYMQTNSQAETACRHLNLVPLFGKIISTYLLPGEIVAQSIFNTELNSDIEV-KHFTNTPLHRFKKPNSKNHFNIYPPSSVLHLSNIPLSFKEEDLLTLFHDNGFQCSSLRIFQKDKKMALAKMTSLEDAISALISLHNWKLTDSSHLRVSFSKALI 2373
             + N+SKK K + S    PS+VLHIR I +   ES++  L +PFGK+ +++  K  +QA LE+     A  M +YYT  PP    + + +QYS H   ELK  N    +   A++ A N +     ++      E         +LR+++ENL  Y +   V+ ++F +FG V++II FTKN Q Q L++  + ++AH + + L+GQ+++N CC L+IEFSK T SL ++  NDK RD+T        +  L   D Q    +T+      P + + P        P    F    L    +P +        P+A+  S +    AI           P        S++LVSNLN + +    +F LFGVYGDV +V I       ALV M   +QA+ A  HLN   L G+++   L   + V       E + D  + K +TN+PLHRFKKP SKN  NI+PPS+ LHLSNIP    +EDL  LF   G      + FQKD+KMAL ++ S+E+AI ALI LHN  L ++ HLRVSFSK++I
Sbjct:    9 ANGNDSKKFKGDRSP-CSPSRVLHIRKIPNDVTESEIISLGLPFGKVTNLLMLKGKSQAFLEMASEEAAVSMVNYYTPVPPHVRSQPVYIQYSNH--RELKTDNLPNQARAQAALQAVNTLQSGGLTLTSVPGGEGLVLSGQSPVLRIIVENLF-YPVTLEVLHQIFSKFGTVIKIITFTKNNQFQALLQYADPMNAHHAKVALDGQNIYNACCTLRIEFSKLT-SLNVKYNNDKSRDFT--------RLDLPTGDGQPSLDTTMAAAFGAPGIISSPYAGAAGFAPAIG-FPQAGLSVPGVPGL-------GPLALTTSAITGRMAI-----------PGMTAIPGHSVLLVSNLNPDAILPHGLFILFGVYGDVQRVKILFNKKENALVQMTDATQAQLAMSHLNGQRLHGRVLRITLSKHQSVQ---LPREGHEDQGLTKDYTNSPLHRFKKPGSKNFQNIFPPSATLHLSNIPPLVTDEDLKRLFASTGCSVKGFKFFQKDRKMALIQLGSVEEAILALIELHNHDLGENHHLRVSFSKSMI 519          
BLAST of Polypyrimidine tract-binding protein 1 vs. Ensembl Xenopus
Match: taco1 (translational activator of mitochondrially encoded cytochrome c oxidase I [Source:Xenbase;Acc:XB-GENE-986962])

HSP 1 Score: 286.574 bits (732), Expect = 1.919e-86
Identity = 198/548 (36.13%), Postives = 288/548 (52.55%), Query Frame = 1
Query:  757 IDVDSNESKKSKLEPSTNTEPSKVLHIRNIASRAQESDLSLLAVPFGKIRSMVYAKKTNQALLELEKASEATRMFDYYTRYPPCFNGREMIVQYSKHVSLELKLKN----SNIDASVDAANKMNEKHRSIVDEWSSEN---KSDRRILRVVIENLKNYNINHLVILKVFQRFGKVLRIIIFTKNMQCQCLVELDNSISAHVSLLHLNGQDLFNDCCRLKIEFSKNTDSLQIQRQNDKCRDYTVSPLQEDEQFSLHFLDWQAKSVSTVPPQ-QYPSLSTVPLLQTQVQKPLYSDFLPNNLFYTVMPNVFKSTFQPSPVAIPESLLISDCAINPLYQEPIVKPPSSANAIDSSIILVSNLNYEKVNTDSIFTLFGVYGDVSKVCISPPSVGAALVYMQTNSQAETACRHLNLVPLFGKIISTYLLPGEIVAQSIFNTELNSDIEV-KHFTNTPLHRFKKPNSKNHFNIYPPSSVLHLSNIPLSFKEEDLLTLFHDNGFQCSSLRIFQKDKKMALAKMTSLEDAISALISLHNWKLTDSSHLRVSFSKALI 2373
            +  + N+SKK K + S    PS+VLHIR I +   ES++  L +PFGK+ +++  K  +QA LE+     A  M +YYT  PP    + + +QYS H   ELK  N    +   A++ A N +     ++      E         +LR+++ENL  Y +   V+ ++F +FG V++II FTKN Q Q L++  + ++AH + + L+GQ+++N CC L+IEFSK T SL ++  NDK RD+T        +  L   D Q    +T+      P + + P        P    F    L    +P +        P+A+  S +    AI           P        S++LVSNLN + +    +F LFGVYGDV +V I       ALV M   +QA+ A  HLN   L G+++   L   + V       E + D  + K +TN+PLHRFKKP SKN  NI+PPS+ LHLSNIP    +EDL  LF   G      + FQKD+KMAL ++ S+E+AI ALI LHN  L ++ HLRVSFSK++I
Sbjct:   18 LQANGNDSKKFKGDRSP-CSPSRVLHIRKIPNDVTESEIISLGLPFGKVTNLLMLKGKSQAFLEMASEEAAVSMVNYYTPVPPHVRSQPVYIQYSNH--RELKTDNLPNQARAQAALQAVNTLQSGGLTLTSVPGGEGLVLSGQSPVLRIIVENLF-YPVTLEVLHQIFSKFGTVIKIITFTKNNQFQALLQYADPMNAHHAKVALDGQNIYNACCTLRIEFSKLT-SLNVKYNNDKSRDFT--------RLDLPTGDGQPSLDTTMAAAFGAPGIISSPYAGAAGFAPAIG-FPQAGLSVPGVPGL-------GPLALTTSAITGRMAI-----------PGMTAIPGHSVLLVSNLNPDAILPHGLFILFGVYGDVQRVKILFNKKENALVQMTDATQAQLAMSHLNGQRLHGRVLRITLSKHQSVQ---LPREGHEDQGLTKDYTNSPLHRFKKPGSKNFQNIFPPSATLHLSNIPPLVTDEDLKRLFASTGCSVKGFKFFQKDRKMALIQLGSVEEAILALIELHNHDLGENHHLRVSFSKSMI 530          
BLAST of Polypyrimidine tract-binding protein 1 vs. Ensembl Xenopus
Match: taco1 (translational activator of mitochondrially encoded cytochrome c oxidase I [Source:Xenbase;Acc:XB-GENE-986962])

HSP 1 Score: 286.574 bits (732), Expect = 2.938e-86
Identity = 198/546 (36.26%), Postives = 287/546 (52.56%), Query Frame = 1
Query:  763 VDSNESKKSKLEPSTNTEPSKVLHIRNIASRAQESDLSLLAVPFGKIRSMVYAKKTNQALLELEKASEATRMFDYYTRYPPCFNGREMIVQYSKHVSLELKLKN----SNIDASVDAANKMNEKHRSIVDEWSSEN---KSDRRILRVVIENLKNYNINHLVILKVFQRFGKVLRIIIFTKNMQCQCLVELDNSISAHVSLLHLNGQDLFNDCCRLKIEFSKNTDSLQIQRQNDKCRDYTVSPLQEDEQFSLHFLDWQAKSVSTVPPQ-QYPSLSTVPLLQTQVQKPLYSDFLPNNLFYTVMPNVFKSTFQPSPVAIPESLLISDCAINPLYQEPIVKPPSSANAIDSSIILVSNLNYEKVNTDSIFTLFGVYGDVSKVCISPPSVGAALVYMQTNSQAETACRHLNLVPLFGKIISTYLLPGEIVAQSIFNTELNSDIEV-KHFTNTPLHRFKKPNSKNHFNIYPPSSVLHLSNIPLSFKEEDLLTLFHDNGFQCSSLRIFQKDKKMALAKMTSLEDAISALISLHNWKLTDSSHLRVSFSKALI 2373
             + N+SKK K + S    PS+VLHIR I +   ES++  L +PFGK+ +++  K  +QA LE+     A  M +YYT  PP    + + +QYS H   ELK  N    +   A++ A N +     ++      E         +LR+++ENL  Y +   V+ ++F +FG V++II FTKN Q Q L++  + ++AH + + L+GQ+++N CC L+IEFSK T SL ++  NDK RD+T        +  L   D Q    +T+      P + + P        P    F    L    +P +        P+A+  S +    AI           P        S++LVSNLN + +    +F LFGVYGDV +V I       ALV M   +QA+ A  HLN   L G+++   L   + V       E + D  + K +TN+PLHRFKKP SKN  NI+PPS+ LHLSNIP    +EDL  LF   G      + FQKD+KMAL ++ S+E+AI ALI LHN  L ++ HLRVSFSK++I
Sbjct:   36 ANGNDSKKFKGDRSP-CSPSRVLHIRKIPNDVTESEIISLGLPFGKVTNLLMLKGKSQAFLEMASEEAAVSMVNYYTPVPPHVRSQPVYIQYSNH--RELKTDNLPNQARAQAALQAVNTLQSGGLTLTSVPGGEGLVLSGQSPVLRIIVENLF-YPVTLEVLHQIFSKFGTVIKIITFTKNNQFQALLQYADPMNAHHAKVALDGQNIYNACCTLRIEFSKLT-SLNVKYNNDKSRDFT--------RLDLPTGDGQPSLDTTMAAAFGAPGIISSPYAGAAGFAPAIG-FPQAGLSVPGVPGL-------GPLALTTSAITGRMAI-----------PGMTAIPGHSVLLVSNLNPDAILPHGLFILFGVYGDVQRVKILFNKKENALVQMTDATQAQLAMSHLNGQRLHGRVLRITLSKHQSVQ---LPREGHEDQGLTKDYTNSPLHRFKKPGSKNFQNIFPPSATLHLSNIPPLVTDEDLKRLFASTGCSVKGFKFFQKDRKMALIQLGSVEEAILALIELHNHDLGENHHLRVSFSKSMI 546          
BLAST of Polypyrimidine tract-binding protein 1 vs. Ensembl Xenopus
Match: taco1 (translational activator of mitochondrially encoded cytochrome c oxidase I [Source:Xenbase;Acc:XB-GENE-986962])

HSP 1 Score: 286.574 bits (732), Expect = 4.702e-86
Identity = 200/548 (36.50%), Postives = 289/548 (52.74%), Query Frame = 1
Query:  763 VDSNESKKSKLEPSTNTEPSKVLHIRNIASRAQESDLSLLAVPFGKIRSMVYAKKTNQALLELEKASEATRMFDYYTRYPPCFNGREMIVQYSKHVSLELKLKN----SNIDASVDAANKMNEKHRSIVDEWSSEN---KSDRRILRVVIENLKNYNINHLVILKVFQRFGKVLRIIIFTKNMQCQCLVELDNSISAHVSLLHLNGQDLFNDCCRLKIEFSKNTDSLQIQRQNDKCRDYTVSPLQEDEQFSLHFLDWQAKSVSTVPPQ-QYPSLSTVPLLQTQVQKPLYSDFLPNNLFYTVM--PNVFKSTFQPSPVAIPESLLISDCAINPLYQEPIVKPPSSANAIDSSIILVSNLNYEKVNTDSIFTLFGVYGDVSKVCISPPSVGAALVYMQTNSQAETACRHLNLVPLFGKIISTYLLPGEIVAQSIFNTELNSDIEV-KHFTNTPLHRFKKPNSKNHFNIYPPSSVLHLSNIPLSFKEEDLLTLFHDNGFQCSSLRIFQKDKKMALAKMTSLEDAISALISLHNWKLTDSSHLRVSFSKALI 2373
             + N+SKK K + S    PS+VLHIR I +   ES++  L +PFGK+ +++  K  +QA LE+     A  M +YYT  PP    + + +QYS H   ELK  N    +   A++ A N +     ++      E         +LR+++ENL  Y +   V+ ++F +FG V++II FTKN Q Q L++  + ++AH + + L+GQ+++N CC L+IEFSK T SL ++  NDK RD+T        +  L   D Q    +T+      P + + P        P      P  +F T +  P V        P+A+  S +    AI           P        S++LVSNLN + +    +F LFGVYGDV +V I       ALV M   +QA+ A  HLN   L G+++   L   + V       E + D  + K +TN+PLHRFKKP SKN  NI+PPS+ LHLSNIP    +EDL  LF   G      + FQKD+KMAL ++ S+E+AI ALI LHN  L ++ HLRVSFSK++I
Sbjct:   50 ANGNDSKKFKGDRSP-CSPSRVLHIRKIPNDVTESEIISLGLPFGKVTNLLMLKGKSQAFLEMASEEAAVSMVNYYTPVPPHVRSQPVYIQYSNH--RELKTDNLPNQARAQAALQAVNTLQSGGLTLTSVPGGEGLVLSGQSPVLRIIVENLF-YPVTLEVLHQIFSKFGTVIKIITFTKNNQFQALLQYADPMNAHHAKVALDGQNIYNACCTLRIEFSKLT-SLNVKYNNDKSRDFT--------RLDLPTGDGQPSLDTTMAAAFGAPGIISSPYAGAAGFAPAIG--FPQIVFSTGLSVPGVPGL----GPLALTTSAITGRMAI-----------PGMTAIPGHSVLLVSNLNPDAILPHGLFILFGVYGDVQRVKILFNKKENALVQMTDATQAQLAMSHLNGQRLHGRVLRITLSKHQSVQ---LPREGHEDQGLTKDYTNSPLHRFKKPGSKNFQNIFPPSATLHLSNIPPLVTDEDLKRLFASTGCSVKGFKFFQKDRKMALIQLGSVEEAILALIELHNHDLGENHHLRVSFSKSMI 564          
BLAST of Polypyrimidine tract-binding protein 1 vs. Ensembl Mouse
Match: Ptbp2 (polypyrimidine tract binding protein 2 [Source:MGI Symbol;Acc:MGI:1860489])

HSP 1 Score: 315.849 bits (808), Expect = 1.859e-97
Identity = 205/569 (36.03%), Postives = 294/569 (51.67%), Query Frame = 1
Query:  697 GVKRSIQNFNSNSLLGSSYS------IDVDSNESKKSKLEPSTNTEPSKVLHIRNIASRAQESDLSLLAVPFGKIRSMVYAKKTNQALLELEKASEATRMFDYYTRYPPCFNGREMIVQYSKHVSLE----LKLKNSNIDASVDAANKMNEKHRSIVDEWSSENKSDRRILRVVIENLKNYNINHLVILKVFQRFGKVLRIIIFTKNMQCQCLVELDNSISAHVSLLHLNGQDLFNDCCRLKIEFSKNTDSLQIQRQNDKCRDYTVSPLQEDEQFSLHFLDWQAKSVSTVPPQQYPSLSTVPLLQTQVQKPLYSDFLPNNLFYTVMPNVFKSTFQPSPVAIPESLLISDCAINPLYQEPIVKPPSSANAIDSSIILVSNLNYEKVNTDSIFTLFGVYGDVSKVCISPPSVGAALVYMQTNSQAETACRHLNLVPLFGKIISTYLLPGEIVAQSIFNTELNSDIEVKHFTNTPLHRFKKPNSKNHFNIYPPSSVLHLSNIPLSFKEEDLLTLFHDNGFQCSSLRIFQKDKKMALAKMTSLEDAISALISLHNWKLTDSSHLRVSFSKALI 2373
            GVKR      S S+L S  S      +  + N+SKK K E   +  PS+VLHIR +     E+++  L +PFGK+ +++  K  NQA LEL     A  M +YY+   P    + + +QYS H  L+    L  +   +  +V A    N          S+   +   +LR++I+N+  Y +   V+ ++F +FG VL+II FTKN Q Q L++  + ++A  + L L+GQ+++N CC L+I+FSK  + L ++  NDK RDYT   L                          PS    P L      P  +           +P         SP+AIP +   +  A       P V      +A  ++++LVSNLN E V   S+FTLFGVYGDV +V I      +AL+ M   +Q++ A  HLN   ++GKII   L   + V   +    L+     K F N+PLHRFKKP SKN  NI+PPS+ LHLSNIP S  EEDL TLF + G    + + FQ+D KMAL +M ++E+AI ALI LHN+ L ++ HLRVSFSK+ I
Sbjct:   11 GVKRGSDELLSGSVLSSPNSNMSGMVVTANGNDSKKFKGEDKMDGAPSRVLHIRKLPGEVTETEVIALGLPFGKVTNILMLKGKNQAFLELATEEAAITMVNYYSAVTPHLRNQPIYIQYSNHKELKTDNTLNQRAQVVLQAVTAVQTANTPLSGTTVSESAVTPAQSPVLRIIIDNMY-YPVTLDVLHQIFSKFGAVLKIITFTKNNQFQALLQYGDPVNAQQAKLALDGQNIYNACCTLRIDFSKLVN-LNVKYNNDKSRDYTRPDL--------------------------PSGDGQPALD-----PAIAAAFAKETSLLAVPGAL------SPLAIPNAAAAAAAAAAGRVGMPGV------SAGGNTVLLVSNLNEEMVTPQSLFTLFGVYGDVQRVKILYNKKDSALIQMADGNQSQLAMNHLNGQKMYGKIIRVTLSKHQTV--QLPREGLDDQGLTKDFGNSPLHRFKKPGSKNFQNIFPPSATLHLSNIPPSVAEEDLRTLFANTGGTVKAFKFFQRDHKMALLQMATVEEAIQALIDLHNYNLGENHHLRVSFSKSTI 532          
BLAST of Polypyrimidine tract-binding protein 1 vs. Ensembl Mouse
Match: Ptbp2 (polypyrimidine tract binding protein 2 [Source:MGI Symbol;Acc:MGI:1860489])

HSP 1 Score: 310.071 bits (793), Expect = 2.772e-95
Identity = 205/569 (36.03%), Postives = 293/569 (51.49%), Query Frame = 1
Query:  697 GVKRSIQNFNSNSLLGSSYS------IDVDSNESKKSKLEPSTNTEPSKVLHIRNIASRAQESDLSLLAVPFGKIRSMVYAKKTNQALLELEKASEATRMFDYYTRYPPCFNGREMIVQYSKHVSLE----LKLKNSNIDASVDAANKMNEKHRSIVDEWSSENKSDRRILRVVIENLKNYNINHLVILKVFQRFGKVLRIIIFTKNMQCQCLVELDNSISAHVSLLHLNGQDLFNDCCRLKIEFSKNTDSLQIQRQNDKCRDYTVSPLQEDEQFSLHFLDWQAKSVSTVPPQQYPSLSTVPLLQTQVQKPLYSDFLPNNLFYTVMPNVFKSTFQPSPVAIPESLLISDCAINPLYQEPIVKPPSSANAIDSSIILVSNLNYEKVNTDSIFTLFGVYGDVSKVCISPPSVGAALVYMQTNSQAETACRHLNLVPLFGKIISTYLLPGEIVAQSIFNTELNSDIEVKHFTNTPLHRFKKPNSKNHFNIYPPSSVLHLSNIPLSFKEEDLLTLFHDNGFQCSSLRIFQKDKKMALAKMTSLEDAISALISLHNWKLTDSSHLRVSFSKALI 2373
            GVKR      S S+L S  S      +  + N+SKK K E   +  PS+VLHIR +     E+++  L +PFGK+ +++  K  NQA LEL     A  M +YY+   P    + + +QYS H  L+    L  +   +  +V A    N          S+   +   +LR++I+N+  Y +   V+ ++F +FG VL+II FTKN Q Q L++  + ++A  + L L+GQ+++N CC L+I+FSK  + L ++  NDK RDYT   L                          PS    P L      P  +           +P         SP+AIP +   +  A       P V      +A  ++++LVSNLN E V   S+FTLFGVYGDV +V I      +AL+ M   +Q++ A  HLN   ++GKII   L   + V   +    L+     K F N+PLHRFKKP SKN  NI+PPS+ LHLSNIP S  EEDL TLF + G    + + FQ D KMAL +M ++E+AI ALI LHN+ L ++ HLRVSFSK+ I
Sbjct:   11 GVKRGSDELLSGSVLSSPNSNMSGMVVTANGNDSKKFKGEDKMDGAPSRVLHIRKLPGEVTETEVIALGLPFGKVTNILMLKGKNQAFLELATEEAAITMVNYYSAVTPHLRNQPIYIQYSNHKELKTDNTLNQRAQVVLQAVTAVQTANTPLSGTTVSESAVTPAQSPVLRIIIDNMY-YPVTLDVLHQIFSKFGAVLKIITFTKNNQFQALLQYGDPVNAQQAKLALDGQNIYNACCTLRIDFSKLVN-LNVKYNNDKSRDYTRPDL--------------------------PSGDGQPALD-----PAIAAAFAKETSLLAVPGAL------SPLAIPNAAAAAAAAAAGRVGMPGV------SAGGNTVLLVSNLNEEMVTPQSLFTLFGVYGDVQRVKILYNKKDSALIQMADGNQSQLAMNHLNGQKMYGKIIRVTLSKHQTV--QLPREGLDDQGLTKDFGNSPLHRFKKPGSKNFQNIFPPSATLHLSNIPPSVAEEDLRTLFANTGGTVKAFKFFQ-DHKMALLQMATVEEAIQALIDLHNYNLGENHHLRVSFSKSTI 531          
BLAST of Polypyrimidine tract-binding protein 1 vs. Ensembl Mouse
Match: Ptbp3 (polypyrimidine tract binding protein 3 [Source:MGI Symbol;Acc:MGI:1923334])

HSP 1 Score: 284.263 bits (726), Expect = 2.265e-85
Identity = 200/578 (34.60%), Postives = 298/578 (51.56%), Query Frame = 1
Query:  694 SGVKRSIQNFNSNSLLGSSYSIDVDSNESKKSKLEPSTNTEPSKVLHIRNIASRAQESDLSLLAVPFGKIRSMVYAKKTNQALLELEKASEATRMFDYYTRYPPCFNGREMIVQYSKHVSLELKLKN-------SNIDASVDAANKMNEKHRSIVDEWSSENKSDRRILRVVIENLKNYNINHLVILKVFQRFGKVLRIIIFTKNMQCQCLVELDNSISAHVSLLHLNGQDLFNDCCRLKIEFSKNTDSLQIQRQNDKCRDYTVSPLQEDEQFSLHFLDWQAKSVSTVPPQQYPSLSTVPLLQTQVQKPLYSDFLPNNLFYTVMPNVFKSTFQPSPVAIPESLLISDCAINPLYQEPI----------VKPPSSANAIDSSIILVSNLNYEKVNTDSIFTLFGVYGDVSKVCISPPSVGAALVYMQTNSQAETACRHLNLVPLFGKIISTYLLPGEIVAQSIFNTELNSDIEV-KHFTNTPLHRFKKPNSKNHFNIYPPSSVLHLSNIPLSFKEEDLLTLFHDNGFQCSSLRIFQKDKKMALAKMTSLEDAISALISLHNWKLTDSSHLRVSFSKALI 2373
            SGV       NS++    S  +  + N++KK K +      PS+VLH+R I     E+++  L +PFGK+ +++  K  +QA LE+     A  M +YYT   P    + + +QYS H   ELK  N            +V A    N           +       +LR++IENL  Y +   V+ ++F +FG VL+II FTKN Q Q L++  + ++A  + + L+GQ+++N CC L+I+FSK T SL ++  NDK RD+T        +  L   D Q            PSL          + P+ + F    +  +  P    + F P+ +A P++  +S  A+ P    P+          +  P ++    +S++LV+NLN + +    +F LFGVYGDV +V I       ALV M   SQA+ A  HL+   L+GK++   L   + V       E   D  + K F+N+PLHRFKKP SKN  NI+PPS+ LHLSNIP S   +DL  LF + G    + + FQKD+KMAL ++ S+E+AI ALI LHN  L ++ HLRVSFSK+ I
Sbjct:   23 SGVINGPSTMNSST----SAGVYANGNDNKKFKGD-RPPCSPSRVLHLRKIPCDVTEAEVISLGLPFGKVTNLLMLKGKSQAFLEMASEEAAVTMINYYTPVTPHLRSQPVYIQYSNH--RELKTDNLPNQARAQAALQAVSAVQSGNLSLPGATANEGTLLPGQSPVLRIIIENLF-YPVTLEVLHQIFSKFGTVLKIITFTKNNQFQALLQYADPVNAQYAKMALDGQNIYNACCTLRIDFSKLT-SLNVKYNNDKSRDFT--------RLDLPTGDGQ------------PSL----------EPPMAAAFGAPGIMSS--PYAGAAGFAPA-IAFPQAAGLSVPAV-PGALGPLTLTSSAVSGRMAIPGASGMPGNSVLLVTNLNPDFITPHGLFILFGVYGDVHRVKIMFNKKENALVQMADASQAQLAMNHLSGQRLYGKVLRATLSKHQAVQ---LPREGQEDQGLTKDFSNSPLHRFKKPGSKNFQNIFPPSATLHLSNIPPSVTMDDLKNLFTEAGCSVKAFKFFQKDRKMALIQLGSVEEAIQALIELHNHDLGENHHLRVSFSKSTI 554          
BLAST of Polypyrimidine tract-binding protein 1 vs. Ensembl Mouse
Match: Ptbp3 (polypyrimidine tract binding protein 3 [Source:MGI Symbol;Acc:MGI:1923334])

HSP 1 Score: 283.108 bits (723), Expect = 2.406e-85
Identity = 195/561 (34.76%), Postives = 292/561 (52.05%), Query Frame = 1
Query:  745 SSYSIDVDSNESKKSKLEPSTNTEPSKVLHIRNIASRAQESDLSLLAVPFGKIRSMVYAKKTNQALLELEKASEATRMFDYYTRYPPCFNGREMIVQYSKHVSLELKLKN-------SNIDASVDAANKMNEKHRSIVDEWSSENKSDRRILRVVIENLKNYNINHLVILKVFQRFGKVLRIIIFTKNMQCQCLVELDNSISAHVSLLHLNGQDLFNDCCRLKIEFSKNTDSLQIQRQNDKCRDYTVSPLQEDEQFSLHFLDWQAKSVSTVPPQQYPSLSTVPLLQTQVQKPLYSDFLPNNLFYTVMPNVFKSTFQPSPVAIPESLLISDCAINPLYQEPI----------VKPPSSANAIDSSIILVSNLNYEKVNTDSIFTLFGVYGDVSKVCISPPSVGAALVYMQTNSQAETACRHLNLVPLFGKIISTYLLPGEIVAQSIFNTELNSDIEV-KHFTNTPLHRFKKPNSKNHFNIYPPSSVLHLSNIPLSFKEEDLLTLFHDNGFQCSSLRIFQKDKKMALAKMTSLEDAISALISLHNWKLTDSSHLRVSFSKALI 2373
            +S  +  + N++KK K +      PS+VLH+R I     E+++  L +PFGK+ +++  K  +QA LE+     A  M +YYT   P    + + +QYS H   ELK  N            +V A    N           +       +LR++IENL  Y +   V+ ++F +FG VL+II FTKN Q Q L++  + ++A  + + L+GQ+++N CC L+I+FSK T SL ++  NDK RD+T        +  L   D Q            PSL          + P+ + F    +  +  P    + F P+ +A P++  +S  A+ P    P+          +  P ++    +S++LV+NLN + +    +F LFGVYGDV +V I       ALV M   SQA+ A  HL+   L+GK++   L   + V       E   D  + K F+N+PLHRFKKP SKN  NI+PPS+ LHLSNIP S   +DL  LF + G    + + FQKD+KMAL ++ S+E+AI ALI LHN  L ++ HLRVSFSK+ I
Sbjct:    5 TSAGVYANGNDNKKFKGD-RPPCSPSRVLHLRKIPCDVTEAEVISLGLPFGKVTNLLMLKGKSQAFLEMASEEAAVTMINYYTPVTPHLRSQPVYIQYSNH--RELKTDNLPNQARAQAALQAVSAVQSGNLSLPGATANEGTLLPGQSPVLRIIIENLF-YPVTLEVLHQIFSKFGTVLKIITFTKNNQFQALLQYADPVNAQYAKMALDGQNIYNACCTLRIDFSKLT-SLNVKYNNDKSRDFT--------RLDLPTGDGQ------------PSL----------EPPMAAAFGAPGIMSS--PYAGAAGFAPA-IAFPQAAGLSVPAV-PGALGPLTLTSSAVSGRMAIPGASGMPGNSVLLVTNLNPDFITPHGLFILFGVYGDVHRVKIMFNKKENALVQMADASQAQLAMNHLSGQRLYGKVLRATLSKHQAVQ---LPREGQEDQGLTKDFSNSPLHRFKKPGSKNFQNIFPPSATLHLSNIPPSVTMDDLKNLFTEAGCSVKAFKFFQKDRKMALIQLGSVEEAIQALIELHNHDLGENHHLRVSFSKSTI 523          
BLAST of Polypyrimidine tract-binding protein 1 vs. Ensembl Mouse
Match: Ptbp3 (polypyrimidine tract binding protein 3 [Source:MGI Symbol;Acc:MGI:1923334])

HSP 1 Score: 283.108 bits (723), Expect = 6.139e-85
Identity = 199/568 (35.04%), Postives = 295/568 (51.94%), Query Frame = 1
Query:  724 NSNSLLGSSYSIDVDSNESKKSKLEPSTNTEPSKVLHIRNIASRAQESDLSLLAVPFGKIRSMVYAKKTNQALLELEKASEATRMFDYYTRYPPCFNGREMIVQYSKHVSLELKLKN-------SNIDASVDAANKMNEKHRSIVDEWSSENKSDRRILRVVIENLKNYNINHLVILKVFQRFGKVLRIIIFTKNMQCQCLVELDNSISAHVSLLHLNGQDLFNDCCRLKIEFSKNTDSLQIQRQNDKCRDYTVSPLQEDEQFSLHFLDWQAKSVSTVPPQQYPSLSTVPLLQTQVQKPLYSDFLPNNLFYTVMPNVFKSTFQPSPVAIPESLLISDCAINPLYQEPI----------VKPPSSANAIDSSIILVSNLNYEKVNTDSIFTLFGVYGDVSKVCISPPSVGAALVYMQTNSQAETACRHLNLVPLFGKIISTYLLPGEIVAQSIFNTELNSDIEV-KHFTNTPLHRFKKPNSKNHFNIYPPSSVLHLSNIPLSFKEEDLLTLFHDNGFQCSSLRIFQKDKKMALAKMTSLEDAISALISLHNWKLTDSSHLRVSFSKALI 2373
            N  S + SS S   + N++KK K +      PS+VLH+R I     E+++  L +PFGK+ +++  K  +QA LE+     A  M +YYT   P    + + +QYS H   ELK  N            +V A    N           +       +LR++IENL  Y +   V+ ++F +FG VL+II FTKN Q Q L++  + ++A  + + L+GQ+++N CC L+I+FSK T SL ++  NDK RD+T        +  L   D Q            PSL          + P+ + F    +  +  P    + F P+ +A P++  +S  A+ P    P+          +  P ++    +S++LV+NLN + +    +F LFGVYGDV +V I       ALV M   SQA+ A  HL+   L+GK++   L   + V       E   D  + K F+N+PLHRFKKP SKN  NI+PPS+ LHLSNIP S   +DL  LF + G    + + FQKD+KMAL ++ S+E+AI ALI LHN  L ++ HLRVSFSK+ I
Sbjct:   27 NGPSTMNSSTSA-ANGNDNKKFKGD-RPPCSPSRVLHLRKIPCDVTEAEVISLGLPFGKVTNLLMLKGKSQAFLEMASEEAAVTMINYYTPVTPHLRSQPVYIQYSNH--RELKTDNLPNQARAQAALQAVSAVQSGNLSLPGATANEGTLLPGQSPVLRIIIENLF-YPVTLEVLHQIFSKFGTVLKIITFTKNNQFQALLQYADPVNAQYAKMALDGQNIYNACCTLRIDFSKLT-SLNVKYNNDKSRDFT--------RLDLPTGDGQ------------PSL----------EPPMAAAFGAPGIMSS--PYAGAAGFAPA-IAFPQAAGLSVPAV-PGALGPLTLTSSAVSGRMAIPGASGMPGNSVLLVTNLNPDFITPHGLFILFGVYGDVHRVKIMFNKKENALVQMADASQAQLAMNHLSGQRLYGKVLRATLSKHQAVQ---LPREGQEDQGLTKDFSNSPLHRFKKPGSKNFQNIFPPSATLHLSNIPPSVTMDDLKNLFTEAGCSVKAFKFFQKDRKMALIQLGSVEEAIQALIELHNHDLGENHHLRVSFSKSTI 551          
BLAST of Polypyrimidine tract-binding protein 1 vs. UniProt/SwissProt
Match: sp|Q66H20|PTBP2_RAT (Polypyrimidine tract-binding protein 2 OS=Rattus norvegicus OX=10116 GN=Ptbp2 PE=1 SV=1)

HSP 1 Score: 310.071 bits (793), Expect = 1.939e-94
Identity = 205/569 (36.03%), Postives = 293/569 (51.49%), Query Frame = 1
Query:  697 GVKRSIQNFNSNSLLGSSYS------IDVDSNESKKSKLEPSTNTEPSKVLHIRNIASRAQESDLSLLAVPFGKIRSMVYAKKTNQALLELEKASEATRMFDYYTRYPPCFNGREMIVQYSKHVSLE----LKLKNSNIDASVDAANKMNEKHRSIVDEWSSENKSDRRILRVVIENLKNYNINHLVILKVFQRFGKVLRIIIFTKNMQCQCLVELDNSISAHVSLLHLNGQDLFNDCCRLKIEFSKNTDSLQIQRQNDKCRDYTVSPLQEDEQFSLHFLDWQAKSVSTVPPQQYPSLSTVPLLQTQVQKPLYSDFLPNNLFYTVMPNVFKSTFQPSPVAIPESLLISDCAINPLYQEPIVKPPSSANAIDSSIILVSNLNYEKVNTDSIFTLFGVYGDVSKVCISPPSVGAALVYMQTNSQAETACRHLNLVPLFGKIISTYLLPGEIVAQSIFNTELNSDIEVKHFTNTPLHRFKKPNSKNHFNIYPPSSVLHLSNIPLSFKEEDLLTLFHDNGFQCSSLRIFQKDKKMALAKMTSLEDAISALISLHNWKLTDSSHLRVSFSKALI 2373
            GVKR      S S+L S  S      +  + N+SKK K E   +  PS+VLHIR +     E+++  L +PFGK+ +++  K  NQA LEL     A  M +YY+   P    + + +QYS H  L+    L  +   +  +V A    N          S+   +   +LR++I+N+  Y +   V+ ++F +FG VL+II FTKN Q Q L++  + ++A  + L L+GQ+++N CC L+I+FSK  + L ++  NDK RDYT   L                          PS    P L      P  +           +P         SP+AIP +   +  A       P V      +A  ++++LVSNLN E V   S+FTLFGVYGDV +V I      +AL+ M   +Q++ A  HLN   ++GKII   L   + V   +    L+     K F N+PLHRFKKP SKN  NI+PPS+ LHLSNIP S  EEDL TLF + G    + + FQ D KMAL +M ++E+AI ALI LHN+ L ++ HLRVSFSK+ I
Sbjct:   11 GVKRGSDELLSGSVLSSPNSNMSGMVVTANGNDSKKFKGEDKMDGAPSRVLHIRKLPGEVTETEVIALGLPFGKVTNILMLKGKNQAFLELATEEAAITMVNYYSAVTPHLRNQPIYIQYSNHKELKTDNTLNQRAQVVLQAVTAVQTANTPLSGTTVSESAVTPAQSPVLRIIIDNMY-YPVTLDVLHQIFSKFGAVLKIITFTKNNQFQALLQYGDPVNAQQAKLALDGQNIYNACCTLRIDFSKLVN-LNVKYNNDKSRDYTRPDL--------------------------PSGDGQPALD-----PAIAAAFAKETSLLAVPGAL------SPLAIPNAAAAAAAAAAGRVGMPGV------SAGGNTVLLVSNLNEEMVTPQSLFTLFGVYGDVQRVKILYNKKDSALIQMADGNQSQLAMNHLNGQKMYGKIIRVTLSKHQTV--QLPREGLDDQGLTKDFGNSPLHRFKKPGSKNFQNIFPPSATLHLSNIPPSVAEEDLRTLFANTGGTVKAFKFFQ-DHKMALLQMATVEEAIQALIDLHNYNLGENHHLRVSFSKSTI 531          
BLAST of Polypyrimidine tract-binding protein 1 vs. UniProt/SwissProt
Match: sp|Q91Z31|PTBP2_MOUSE (Polypyrimidine tract-binding protein 2 OS=Mus musculus OX=10090 GN=Ptbp2 PE=1 SV=2)

HSP 1 Score: 310.071 bits (793), Expect = 1.939e-94
Identity = 205/569 (36.03%), Postives = 293/569 (51.49%), Query Frame = 1
Query:  697 GVKRSIQNFNSNSLLGSSYS------IDVDSNESKKSKLEPSTNTEPSKVLHIRNIASRAQESDLSLLAVPFGKIRSMVYAKKTNQALLELEKASEATRMFDYYTRYPPCFNGREMIVQYSKHVSLE----LKLKNSNIDASVDAANKMNEKHRSIVDEWSSENKSDRRILRVVIENLKNYNINHLVILKVFQRFGKVLRIIIFTKNMQCQCLVELDNSISAHVSLLHLNGQDLFNDCCRLKIEFSKNTDSLQIQRQNDKCRDYTVSPLQEDEQFSLHFLDWQAKSVSTVPPQQYPSLSTVPLLQTQVQKPLYSDFLPNNLFYTVMPNVFKSTFQPSPVAIPESLLISDCAINPLYQEPIVKPPSSANAIDSSIILVSNLNYEKVNTDSIFTLFGVYGDVSKVCISPPSVGAALVYMQTNSQAETACRHLNLVPLFGKIISTYLLPGEIVAQSIFNTELNSDIEVKHFTNTPLHRFKKPNSKNHFNIYPPSSVLHLSNIPLSFKEEDLLTLFHDNGFQCSSLRIFQKDKKMALAKMTSLEDAISALISLHNWKLTDSSHLRVSFSKALI 2373
            GVKR      S S+L S  S      +  + N+SKK K E   +  PS+VLHIR +     E+++  L +PFGK+ +++  K  NQA LEL     A  M +YY+   P    + + +QYS H  L+    L  +   +  +V A    N          S+   +   +LR++I+N+  Y +   V+ ++F +FG VL+II FTKN Q Q L++  + ++A  + L L+GQ+++N CC L+I+FSK  + L ++  NDK RDYT   L                          PS    P L      P  +           +P         SP+AIP +   +  A       P V      +A  ++++LVSNLN E V   S+FTLFGVYGDV +V I      +AL+ M   +Q++ A  HLN   ++GKII   L   + V   +    L+     K F N+PLHRFKKP SKN  NI+PPS+ LHLSNIP S  EEDL TLF + G    + + FQ D KMAL +M ++E+AI ALI LHN+ L ++ HLRVSFSK+ I
Sbjct:   11 GVKRGSDELLSGSVLSSPNSNMSGMVVTANGNDSKKFKGEDKMDGAPSRVLHIRKLPGEVTETEVIALGLPFGKVTNILMLKGKNQAFLELATEEAAITMVNYYSAVTPHLRNQPIYIQYSNHKELKTDNTLNQRAQVVLQAVTAVQTANTPLSGTTVSESAVTPAQSPVLRIIIDNMY-YPVTLDVLHQIFSKFGAVLKIITFTKNNQFQALLQYGDPVNAQQAKLALDGQNIYNACCTLRIDFSKLVN-LNVKYNNDKSRDYTRPDL--------------------------PSGDGQPALD-----PAIAAAFAKETSLLAVPGAL------SPLAIPNAAAAAAAAAAGRVGMPGV------SAGGNTVLLVSNLNEEMVTPQSLFTLFGVYGDVQRVKILYNKKDSALIQMADGNQSQLAMNHLNGQKMYGKIIRVTLSKHQTV--QLPREGLDDQGLTKDFGNSPLHRFKKPGSKNFQNIFPPSATLHLSNIPPSVAEEDLRTLFANTGGTVKAFKFFQ-DHKMALLQMATVEEAIQALIDLHNYNLGENHHLRVSFSKSTI 531          
BLAST of Polypyrimidine tract-binding protein 1 vs. UniProt/SwissProt
Match: sp|Q9UKA9|PTBP2_HUMAN (Polypyrimidine tract-binding protein 2 OS=Homo sapiens OX=9606 GN=PTBP2 PE=1 SV=1)

HSP 1 Score: 307.76 bits (787), Expect = 1.383e-93
Identity = 205/569 (36.03%), Postives = 293/569 (51.49%), Query Frame = 1
Query:  697 GVKRSIQNFNSNSLLGSSYS------IDVDSNESKKSKLEPSTNTEPSKVLHIRNIASRAQESDLSLLAVPFGKIRSMVYAKKTNQALLELEKASEATRMFDYYTRYPPCFNGREMIVQYSKHVSLE----LKLKNSNIDASVDAANKMNEKHRSIVDEWSSENKSDRRILRVVIENLKNYNINHLVILKVFQRFGKVLRIIIFTKNMQCQCLVELDNSISAHVSLLHLNGQDLFNDCCRLKIEFSKNTDSLQIQRQNDKCRDYTVSPLQEDEQFSLHFLDWQAKSVSTVPPQQYPSLSTVPLLQTQVQKPLYSDFLPNNLFYTVMPNVFKSTFQPSPVAIPESLLISDCAINPLYQEPIVKPPSSANAIDSSIILVSNLNYEKVNTDSIFTLFGVYGDVSKVCISPPSVGAALVYMQTNSQAETACRHLNLVPLFGKIISTYLLPGEIVAQSIFNTELNSDIEVKHFTNTPLHRFKKPNSKNHFNIYPPSSVLHLSNIPLSFKEEDLLTLFHDNGFQCSSLRIFQKDKKMALAKMTSLEDAISALISLHNWKLTDSSHLRVSFSKALI 2373
            GVKR      S S+L S  S      +  + N+SKK K E   +  PS+VLHIR +     E+++  L +PFGK+ +++  K  NQA LEL     A  M +YY+   P    + + +QYS H  L+    L  +   +  +V A    N          S+   +   +LR++I+N+  Y +   V+ ++F +FG VL+II FTKN Q Q L++  + ++A  + L L+GQ+++N CC L+I+FSK  + L ++  NDK RDYT   L                          PS    P L      P  +           +P         SP+AIP +   +  A       P V      +A  ++++LVSNLN E V   S+FTLFGVYGDV +V I      +AL+ M   +Q++ A  HLN   ++GKII   L   + V   +    L+     K F N+PLHRFKKP SKN  NI+PPS+ LHLSNIP S  EEDL TLF + G    + + FQ D KMAL +M ++E+AI ALI LHN+ L ++ HLRVSFSK+ I
Sbjct:   11 GVKRGSDELLSGSVLSSPNSNMSSMVVTANGNDSKKFKGEDKMDGAPSRVLHIRKLPGEVTETEVIALGLPFGKVTNILMLKGKNQAFLELATEEAAITMVNYYSAVTPHLRNQPIYIQYSNHKELKTDNTLNQRAQAVLQAVTAVQTANTPLSGTTVSESAVTPAQSPVLRIIIDNMY-YPVTLDVLHQIFSKFGAVLKIITFTKNNQFQALLQYGDPVNAQQAKLALDGQNIYNACCTLRIDFSKLVN-LNVKYNNDKSRDYTRPDL--------------------------PSGDGQPALD-----PAIAAAFAKETSLLAVPGAL------SPLAIPNAAAAAAAAAAGRVGMPGV------SAGGNTVLLVSNLNEEMVTPQSLFTLFGVYGDVQRVKILYNKKDSALIQMADGNQSQLAMNHLNGQKMYGKIIRVTLSKHQTV--QLPREGLDDQGLTKDFGNSPLHRFKKPGSKNFQNIFPPSATLHLSNIPPSVAEEDLRTLFANTGGTVKAFKFFQ-DHKMALLQMATVEEAIQALIDLHNYNLGENHHLRVSFSKSTI 531          
BLAST of Polypyrimidine tract-binding protein 1 vs. UniProt/SwissProt
Match: sp|Q29099|PTBP1_PIG (Polypyrimidine tract-binding protein 1 OS=Sus scrofa OX=9823 GN=PTBP1 PE=2 SV=1)

HSP 1 Score: 286.574 bits (732), Expect = 2.077e-85
Identity = 205/574 (35.71%), Postives = 289/574 (50.35%), Query Frame = 1
Query:  736 LLGSSYSIDVDSNESKKSKLEPSTNTEPSKVLHIRNIASRAQESDLSLLAVPFGKIRSMVYAKKTNQALLELEKASEATRMFDYYTRYPPCFNGREMIVQYSKHVSLELKLKNS----------NIDASVDAANKMNEKHRSIVDEWSSENKSDRRILRVVIENLKNYNINHLVILKVFQRFGKVLRIIIFTKNMQCQCLVELDNSISAHVSLLHLNGQDLFNDCCRLKIEFSKNTDSLQIQRQNDKCRDYTVSPL-QEDEQFSLHFLDWQAKSVSTVPPQQYPSLSTVPLLQTQVQKPLYSDFLPNNLFYTVMPNVFKSTFQPSPVAIPESLLIS----DCAINPLYQEPIVKPPSSAN--------AIDSSIILVSNLNYEKVNTDSIFTLFGVYGDVSKVCISPPSVGAALVYMQTNSQAETACRHLNLVPLFGKIISTYLLPGEIVAQSIFNTELNSDIE-----VKHFTNTPLHRFKKPNSKNHFNIYPPSSVLHLSNIPLSFKEEDLLTLFHDNGFQCSSLRIFQKDKKMALAKMTSLEDAISALISLHNWKLTDSSHLRVSFSKALI 2373
            ++ S+ +   + N+SKK K +  +   PS+V+HIR + S   E ++  L +PFGK+ +++  K  NQA +E+     A  M +YYT   P   G+ + +Q+S H   ELK  +S              SV + N +     +   +          +LR+++ENL  Y +   V+ ++F +FG VL+II FTKN Q Q L++  + +SA  + L L+GQ+++N CC L+I+FSK T SL ++  NDK RDYT   L   D Q SL   D    +    P      +S  P                           +     P   AIP++  +S      A+ PL         ++A            +S++LVSNLN E+V   S+F LFGVY DV +V I       ALV M   SQA+ A  HLN   L GK       P  I      N +L  + +      K + N+PLHRFKKP SKN  NI+PPS+ LHLSNIP S  EEDL  LF  NG      + FQKD+KMAL +M S+E+AI ALI LHN  L ++ HLRVSFSK+ I
Sbjct:   30 IMSSNSASTANGNDSKKFKGDNRSAGVPSRVIHIRKLPSDVTEGEVISLGLPFGKVTNLLMLKGKNQAFIEMNTEEAANTMVNYYTSVTPVLRGQPIYIQFSNHK--ELKTDSSPNQARAQAALQAVNSVQSGN-LALAASAAAVDAGMAMAGQSPVLRIIVENLF-YPVTLDVLHQIFSKFGTVLKIITFTKNNQFQALLQYADPVSAQHAKLSLDGQNIYNACCTLRIDFSKLT-SLNVKYNNDKSRDYTRPDLPSGDNQPSL---DQTMAAAFGAPG----IMSASP---------------------------YAGAGFPPTFAIPQAATVSVPNVHGALAPLAIPSAAARAAAAGRIAIPGLAGAGNSVLLVSNLNPERVTPQSLFILFGVYCDVQRVKILFNKKENALVQMADGSQAQLAMSHLNGHKLHGK-------PVRITLSKHQNVQLPREGQEDQGLTKDYGNSPLHRFKKPGSKNFQNIFPPSATLHLSNIPPSISEEDLKILFSSNGGIVKGFKFFQKDRKMALIQMGSVEEAIQALIDLHNHDLGENHHLRVSFSKSTI 557          
BLAST of Polypyrimidine tract-binding protein 1 vs. UniProt/SwissProt
Match: sp|O95758|PTBP3_HUMAN (Polypyrimidine tract-binding protein 3 OS=Homo sapiens OX=9606 GN=PTBP3 PE=1 SV=2)

HSP 1 Score: 286.189 bits (731), Expect = 3.026e-85
Identity = 199/577 (34.49%), Postives = 299/577 (51.82%), Query Frame = 1
Query:  697 GVKRSIQNFNSNSLLGSSYSID------VDSNESKKSKLEPSTNTEPSKVLHIRNIASRAQESDLSLLAVPFGKIRSMVYAKKTNQALLELEKASEATRMFDYYTRYPPCFNGREMIVQYSKHVSLELKLKN----SNIDASVDAANKMNEKHRSIVDEWSSENK---SDRRILRVVIENLKNYNINHLVILKVFQRFGKVLRIIIFTKNMQCQCLVELDNSISAHVSLLHLNGQDLFNDCCRLKIEFSKNTDSLQIQRQNDKCRDYTVSPLQEDEQFSLHFLDWQAKSVSTVPPQQY----PSLSTVPLLQTQVQKPLYSDFLPNNLFYTVMPNVFKSTFQPSPVAIPESLLISDCAINPLYQEPIVKPPSSANAIDSSIILVSNLNYEKVNTDSIFTLFGVYGDVSKVCISPPSVGAALVYMQTNSQAETACRHLNLVPLFGKIISTYLLPGEIVAQSIFNTELNSDIEV-KHFTNTPLHRFKKPNSKNHFNIYPPSSVLHLSNIPLSFKEEDLLTLFHDNGFQCSSLRIFQKDKKMALAKMTSLEDAISALISLHNWKLTDSSHLRVSFSKALI 2373
            G+KR      S+ ++   ++++       + N+SKK K +      PS+VLH+R I     E+++  L +PFGK+ +++  K  +QA LE+     A  M +YYT   P    + + +QYS H   ELK  N    +   A++ A + +     ++    S+E         +LR++IENL  Y +   V+ ++F +FG VL+II FTKN Q Q L++  + ++AH + + L+GQ+++N CC L+I+FSK T SL ++  NDK RD+T        +  L   D Q    S  PP       P + + P        P         L    +P          P+ I  S +    AI           P ++    +S++LV+NLN + +    +F LFGVYGDV +V I       ALV M   +QA+ A  HL+   L+GK++   L   + V       E   D  + K F+N+PLHRFKKP SKN  NI+PPS+ LHLSNIP S   +DL  LF + G    + + FQKD+KMAL ++ S+E+AI ALI LHN  L ++ HLRVSFSK+ I
Sbjct:   12 GLKRGSDELLSSGIINGPFTMNSSTPSTANGNDSKKFKRD-RPPCSPSRVLHLRKIPCDVTEAEIISLGLPFGKVTNLLMLKGKSQAFLEMASEEAAVTMVNYYTPITPHLRSQPVYIQYSNH--RELKTDNLPNQARAQAALQAVSAVQSGSLALSGGPSNEGTVLPGQSPVLRIIIENLF-YPVTLEVLHQIFSKFGTVLKIITFTKNNQFQALLQYADPVNAHYAKMALDGQNIYNACCTLRIDFSKLT-SLNVKYNNDKSRDFT--------RLDLPTGDGQP---SLEPPMAAAFGAPGIISSPYAGAAGFAPAIGFPQATGLSVPAVPGAL------GPLTITSSAVTGRMAI-----------PGASGIPGNSVLLVTNLNPDLITPHGLFILFGVYGDVHRVKIMFNKKENALVQMADANQAQLAMNHLSGQRLYGKVLRATLSKHQAVQ---LPREGQEDQGLTKDFSNSPLHRFKKPGSKNFQNIFPPSATLHLSNIPPSVTVDDLKNLFIEAGCSVKAFKFFQKDRKMALIQLGSVEEAIQALIELHNHDLGENHHLRVSFSKSTI 552          
BLAST of Polypyrimidine tract-binding protein 1 vs. TrEMBL
Match: A0A3Q0KMW9 (Polypyrimidine tract binding protein, putative OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 358.607 bits (919), Expect = 1.650e-109
Identity = 219/588 (37.24%), Postives = 328/588 (55.78%), Query Frame = 1
Query:  754 SIDVDSNESKKSKLEPSTNTEPSKVLHIRNIASRAQESDLSLLAVPFGKIRSMVYAKKTNQALLELEKASEATRMFDYYTRYPPCFNGREMIVQYSKHVSLELKLKNSNIDASVDAANKMNEKHRSIVDEWSSENKSDRRILRVVIENLKNYNINHLVILKVFQRFGKVLRIIIFTKNMQCQCLVELDNSISAHVSLLHLNGQDLFNDCCRLKIEFSKNTDSLQIQRQNDKCRDYTVSPLQEDEQFSLHFLDWQAKSV---STVPPQQYPSLS-TVPLLQ-----TQVQKPLYSDFLPNNL-------------------------FYTVMPNVFKSTFQPSPVAI--------PESLLISDCAINPLYQEPIVKPPSSANAIDSSIIL-VSNLNYEKVNTDSIFTLFGVYGDVSKVCISPPSVGAALVYMQTNSQAETACRHLNLVPLFGKIISTYLLPGEIVAQSIFNT-----ELNSDIEVKHFTNTPLHRFKKPNSKNHFNIYPPSSVLHLSNIPLSFKEEDLLTLFHDNGFQCSSLRIFQKDKKMALAKMTSLEDAISALISLHNWKLTDSSHLRVSFSKALI 2373
            S+D+++ ++KKS+++      PS+V+HIRN+   A E++++L A+PFG +++MV +K+ NQAL+E+    EA ++  +Y +YP   +G+ +I Q+S H  LEL  +N  I  ++  AN++ ++     D   ++      +L VVI+N+    INH+++ K+F RFG +LR++IF +N Q +CL+E  N I A V++L LNGQ+++  CC L++EF K    L+++R+NDKCRDYT+SPL +DE  SL  L     +    ST+     PS+   +PL       T V +   S    N+L                         F  +      S   P+P  +        P + L +      L    I +  S+     +S +L VSNLN EKV  D++FTLFGVYGDV++V I       ALV      QA TA  HLN  PL+GK +         +A S FN      E N     K +TN+PLHRF+KPNSKN  NIY P+ VLHLSNIP +  EE++  +F   G+  +  +   KDKKMAL ++ +++ AI ALI LHN +LT++SHLR+SFSK  I
Sbjct:   32 SMDLETVDTKKSRVD-RLEASPSRVIHIRNMPGDATENEIALFAIPFGLLKNMVLSKRNNQALIEMHVLEEAVQLVAHYLKYPVTLHGKHLIFQFSTHSHLELISENDAIVNAIKNANRVVQQ-----DLPGAQTGVPNTVLHVVIDNIMGQQINHVILYKIFHRFGTILRVLIFLRNNQYRCLLEFQNHIQAFVAMLLLNGQNIYTGCCSLQVEFWKARGPLEVRRENDKCRDYTISPLTDDELNSLQALPGGVTASTNNSTINSISQPSIGQNIPLGNPTAAFTAVPQAAASGI--NDLAIQLTLLAQQSGLALTPAAAAATASFMALTAQGGNSAINPTPGTVLNAASLQGPRAALPTVQNQTQLLPNLINQSVSNLGQTGASTVLIVSNLNEEKVYPDALFTLFGVYGDVTRVKIMFNKKSTALVQFSDPQQALTALYHLNGQPLYGKPLK--------IAVSRFNIVQLPKEDNDVGLTKDYTNSPLHRFRKPNSKNFTNIYAPNHVLHLSNIPSAITEEEVRMIFETKGYHVTDFKFMMKDKKMALIQLENVDMAIQALIDLHNCQLTENSHLRISFSKTAI 603          
BLAST of Polypyrimidine tract-binding protein 1 vs. TrEMBL
Match: A0A183QYD0 (Uncharacterized protein OS=Schistosoma rodhaini OX=6188 PE=4 SV=1)

HSP 1 Score: 358.221 bits (918), Expect = 1.962e-109
Identity = 217/584 (37.16%), Postives = 329/584 (56.34%), Query Frame = 1
Query:  754 SIDVDSNESKKSKLEPSTNTEPSKVLHIRNIASRAQESDLSLLAVPFGKIRSMVYAKKTNQALLELEKASEATRMFDYYTRYPPCFNGREMIVQYSKHVSLELKLKNSNIDASVDAANKMNEKHRSIVDEWSSENKSDRRILRVVIENLKNYNINHLVILKVFQRFGKVLRIIIFTKNMQCQCLVELDNSISAHVSLLHLNGQDLFNDCCRLKIEFSKNTDSLQIQRQNDKCRDYTVSPLQEDEQFSLHFLDWQAKSV---STVPPQQYPSLS-TVPLLQ-----TQVQKPLYSDFLPNNL-------------------------FYTVMPNVFKSTFQPSPVAI--------PESLLISDCAINPLYQEPIVKPPSSANAIDSSIIL-VSNLNYEKVNTDSIFTLFGVYGDVSKVCISPPSVGAALVYMQTNSQAETACRHLNLVPLFGKIISTYLLPGEIVAQSIFNTELNSDIEV-KHFTNTPLHRFKKPNSKNHFNIYPPSSVLHLSNIPLSFKEEDLLTLFHDNGFQCSSLRIFQKDKKMALAKMTSLEDAISALISLHNWKLTDSSHLRVSFSKALI 2373
            S+D+++ ++KKS+++      PS+V+HIRN+   A E++++L A+PFG +++MV +K+ NQAL+E+    EA ++  +Y +YP   +G+ +I Q+S H  LEL  +N  I  ++  AN++ ++     D   ++      +L VVI+N+    INH+++ K+F RFG +LR++IF +N Q +CL+E  N I A V++L LNGQ+++  CC L++EF K    L+++R+NDKCRDYT+SPL +DE  SL  L     +    ST+     PS+   +PL       T V +   S    N+L                         F  +      S   P+P  +        P + L +      L    I +  S+     +S +L VSNLN EKV  D++FTLFGVYGDV++V I       ALV      QA TA  HLN  PL+GK +    LP E           ++D+ + K +TN+PLHRF+KPNSKN  NIY P+ VLHLSNIP +  EE++  +F   G+  +  +   KDKKMAL ++ +++ AI ALI LHN +LT++SHLR+SFSK  I
Sbjct:   32 SMDLETVDTKKSRVD-RLEASPSRVIHIRNMPGDATENEIALFAIPFGLLKNMVLSKRNNQALIEMHVLEEAVQLVAHYLKYPVTLHGKHLIFQFSTHSHLELISENDAIVNAIKNANRVVQQ-----DLPGAQTGVPNTVLHVVIDNIMGQQINHVILYKIFHRFGTILRVLIFLRNNQYRCLLEFQNHIQAFVAMLLLNGQNIYTGCCSLQVEFWKARGPLEVRRENDKCRDYTISPLTDDELNSLQALPGGVTASTNNSTINSISQPSIGQNIPLGNPTAAFTAVPQATASGI--NDLAIQLTLLAQQSGLALTPAAAAATASFMALTAQGGNSAINPTPGTVLNAASLQGPRAALPTVQNQTQLLPNLINQSVSNLGQTGASTVLIVSNLNEEKVYPDALFTLFGVYGDVTRVKIMFNKKSTALVQFSDPQQALTALYHLNGQPLYGKPLKIA-LPKE-----------DNDVGLTKDYTNSPLHRFRKPNSKNFTNIYAPNHVLHLSNIPSAITEEEVRMIFETKGYHVTDFKFMMKDKKMALIQLENVDMAIQALIDLHNCQLTENSHLRISFSKTAI 595          
BLAST of Polypyrimidine tract-binding protein 1 vs. TrEMBL
Match: A0A267FSF7 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig010779g2 PE=4 SV=1)

HSP 1 Score: 345.51 bits (885), Expect = 3.833e-105
Identity = 215/546 (39.38%), Postives = 317/546 (58.06%), Query Frame = 1
Query:  739 LGSSYSIDVDSNESKKSKLEPST-NTEPSKVLHIRNIASRAQESDLSLLAVPFGKIRSMVYAKKTNQALLELEKASEATRMFDYYTRYPPCFNGREMIVQYSKHVSLELKLKNSNIDASVDAANKMNEKHRSIVDEWSSENKSDRRILRVVIENLKNYNINHLVILKVFQRFGKVLRIIIFTKNMQCQCLVELDNSISAHVSLLHLNGQDLFNDCCRLKIEFSKNTDSLQIQRQNDKCRDYTVSPLQEDEQFSLHFLDWQAKSVSTVPPQQYPSLSTVPLLQTQVQKPLYSDFLPNNLFYTVMPNVFKSTFQPSPVAIPESLLISDCAINPLYQEPIVKPPSSANAIDSSIILVSNLNYEKVNTDSIFTLFGVYGDVSKVCISPPSVGAALVYMQTNSQAETACRHLNLVPLFGKIISTYLLPGEIVAQSIFNTELNSDIEVKHFTNTPLHRFKKPNSKNHFNIYPPSSVLHLSNIPLSFKEEDLLTLFHDNGFQCSSLRIFQKDKKMALAKMTSLEDAISALISLHNWKLTDSSHLRVSFSKALI 2373
            LGS     ++ N++KK +LE      EPSKV+HIRN+   A E+D+  L VPFG++ +MV AKK NQALLE++    AT+M DYY ++P    GR +I+QYS H  L+ +  N+  D ++ +AN +   ++   DE  S       +LRV++ENL    +   V+ K+F RFG V +I+IF+KN   Q L+++ +S  A  + L LN Q+++N CC L+I+FSK  ++L ++  N+K RD+TV+    D   +    +      +T+ P   P L          Q P+ +  L         PN+    F P+   +P   + S  +    + + I+ P +S N    SI+LVSNL+ EK+  D++FTLFGVYGDV +V I       AL+     SQA+ A ++LN V LFG+ +          AQ     E       K FTN+PLHRFKKP+SKN  NI+PPS +LHLSNIPL   EE +  +F D GF   +++ FQK+KKMAL +M ++ED++ ALI LHN++L+ + HLRVSFSK++I
Sbjct:   44 LGSPME-HLEINDAKKVRLENHVPEPEPSKVVHIRNVPQDAIENDIVQLGVPFGQMTNMVLAKKKNQALLEMKTQETATKMVDYYAQHPVTIRGRTVIIQYSNHAELKTEQPNAAADNALSSANGLVSTYQQ--DEPPS-------VLRVIVENLM-APVTIEVLHKIFSRFGMVQKIVIFSKNNTFQALIQMGSSTEALAAKLVLNDQNIYNGCCTLRIDFSK-LNTLNVKFNNEKSRDFTVNRAPGDNPLAYFDPNLAPHLGATLFPAMIPGLEFA-------QAPILAQTLDGQ------PNL--GIF-PAAAQLPAMSMHSLTSPVAPFGQAIMAPQASVN----SILLVSNLDDEKITPDALFTLFGVYGDVQRVKIMYNKKDNALIQFTDASQAQQALQNLNGVRLFGRPLKIAF---SRHAQVALPKEGADAGLTKIFTNSPLHRFKKPHSKNFQNIFPPSQILHLSNIPLEVPEEKIKAIFEDFGFNVVAIKFFQKEKKMALVQMPTVEDSVIALIKLHNYQLSANYHLRVSFSKSVI 554          
BLAST of Polypyrimidine tract-binding protein 1 vs. TrEMBL
Match: A0A267E2T6 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig010779g1 PE=4 SV=1)

HSP 1 Score: 340.502 bits (872), Expect = 2.682e-103
Identity = 213/546 (39.01%), Postives = 316/546 (57.88%), Query Frame = 1
Query:  739 LGSSYSIDVDSNESKKSKLEPST-NTEPSKVLHIRNIASRAQESDLSLLAVPFGKIRSMVYAKKTNQALLELEKASEATRMFDYYTRYPPCFNGREMIVQYSKHVSLELKLKNSNIDASVDAANKMNEKHRSIVDEWSSENKSDRRILRVVIENLKNYNINHLVILKVFQRFGKVLRIIIFTKNMQCQCLVELDNSISAHVSLLHLNGQDLFNDCCRLKIEFSKNTDSLQIQRQNDKCRDYTVSPLQEDEQFSLHFLDWQAKSVSTVPPQQYPSLSTVPLLQTQVQKPLYSDFLPNNLFYTVMPNVFKSTFQPSPVAIPESLLISDCAINPLYQEPIVKPPSSANAIDSSIILVSNLNYEKVNTDSIFTLFGVYGDVSKVCISPPSVGAALVYMQTNSQAETACRHLNLVPLFGKIISTYLLPGEIVAQSIFNTELNSDIEVKHFTNTPLHRFKKPNSKNHFNIYPPSSVLHLSNIPLSFKEEDLLTLFHDNGFQCSSLRIFQKDKKMALAKMTSLEDAISALISLHNWKLTDSSHLRVSFSKALI 2373
            LGS     ++ N++KK +LE      EPSKV+HIRN+   A E+D+  L VPFG++ +MV AKK NQALLE++    AT+M DYY ++P    GR +I+QYS H  L+ +  N+  + ++ +AN +   ++   DE  S       +LRV++ENL    +   V+ K+F RFG V +I+IF+KN   Q L+++ +S  A  + L LN Q+++N CC L+I+FSK  ++L ++  N+K RD+TV+    D   +    +      +T+ P   P L          Q P+ +  L         PN+    F P+   +P   + S  +    + + I+ P +S N    SI+LVSNL+ EK+  D++FTLFGVYGDV +V I       AL+     SQA+ A ++LN V LFG+ +          AQ     E       K FTN+PLHRFKKP+SKN  NI+PPS +LHLSNIP    EE +  +F D GF   +++ FQK+KKMAL +M ++ED++ ALI LHN++L+ + HLRVSFSK++I
Sbjct:   44 LGSPME-HLEINDAKKVRLENHVPEPEPSKVVHIRNVPQDAIENDIVQLGVPFGQMTNMVLAKKKNQALLEMKTQETATKMVDYYAQHPVTIRGRTVIIQYSNHAELKTEQPNAAAENALSSANGLVSTYQQ--DEPPS-------VLRVIVENLM-APVTIEVLHKIFSRFGMVQKIVIFSKNNTFQALIQMGSSTEALAAKLVLNDQNIYNGCCTLRIDFSK-LNTLNVKFNNEKSRDFTVNRAPGDNPLAYFDPNLAPHLGATLFPAMIPGLEFA-------QAPILAQTLDGQ------PNL--GIF-PAAAQLPAMSMHSLTSPVAPFGQAIMAPQASVN----SILLVSNLDDEKITPDALFTLFGVYGDVQRVKIMYNKKDNALIQFTDASQAQQALQNLNGVRLFGRPLKIAF---SRHAQVALPKEGADAGLTKIFTNSPLHRFKKPHSKNFQNIFPPSQILHLSNIPQEVPEEKIKAIFEDFGFNVVAIKFFQKEKKMALVQMPTVEDSVIALIKLHNYQLSANYHLRVSFSKSVI 554          
BLAST of Polypyrimidine tract-binding protein 1 vs. TrEMBL
Match: G4LZU3 (Polypyrimidine tract binding protein, putative OS=Schistosoma mansoni OX=6183 GN=Smp_138050.2 PE=4 SV=1)

HSP 1 Score: 337.035 bits (863), Expect = 2.069e-101
Identity = 212/588 (36.05%), Postives = 319/588 (54.25%), Query Frame = 1
Query:  754 SIDVDSNESKKSKLEPSTNTEPSKVLHIRNIASRAQESDLSLLAVPFGKIRSMVYAKKTNQALLELEKASEATRMFDYYTRYPPCFNGREMIVQYSKHVSLELKLKNSNIDASVDAANKMNEKHRSIVDEWSSENKSDRRILRVVIENLKNYNINHLVILKVFQRFGKVLRIIIFTKNMQCQCLVELDNSISAHVSLLHLNGQDLFNDCCRLKIEFSKNTDSLQIQRQNDKCRDYTVSPLQEDEQFSLHFLDWQAKSV---STVPPQQYPSLS-TVPLLQ-----TQVQKPLYSDFLPNNL-------------------------FYTVMPNVFKSTFQPSPVAI--------PESLLISDCAINPLYQEPIVKPPSSANAIDSSIIL-VSNLNYEKVNTDSIFTLFGVYGDVSKVCISPPSVGAALVYMQTNSQAETACRHLNLVPLFGKIISTYLLPGEIVAQSIFNT-----ELNSDIEVKHFTNTPLHRFKKPNSKNHFNIYPPSSVLHLSNIPLSFKEEDLLTLFHDNGFQCSSLRIFQKDKKMALAKMTSLEDAISALISLHNWKLTDSSHLRVSFSKALI 2373
            S+D+++ ++KKS+++      PS+V+HIRN+   A E++++L A+PFG +++MV +K+ NQAL+E+    EA ++  +Y +YP   +G+ +I Q+S H  LEL  +N  I  ++  AN++ ++     D   ++      +L VVI+N+    INH+++ K+F RFG +LR++IF +N Q +CL+E  N I A V++L LNGQ+++  CC L++EF K    L+++R+NDKCRDYT+SPL +DE  SL  L     +    ST+     PS+   +PL       T V +   S    N+L                         F  +      S   P+P  +        P + L +      L    I +  S+     +S +L VSNLN E           GVYGDV++V I       ALV      QA TA  HLN  PL+GK +         +A S FN      E N     K +TN+PLHRF+KPNSKN  NIY P+ VLHLSNIP +  EE++  +F   G+  +  +   KDKKMAL ++ +++ AI ALI LHN +LT++SHLR+SFSK  I
Sbjct:   32 SMDLETVDTKKSRVD-RLEASPSRVIHIRNMPGDATENEIALFAIPFGLLKNMVLSKRNNQALIEMHVLEEAVQLVAHYLKYPVTLHGKHLIFQFSTHSHLELISENDAIVNAIKNANRVVQQ-----DLPGAQTGVPNTVLHVVIDNIMGQQINHVILYKIFHRFGTILRVLIFLRNNQYRCLLEFQNHIQAFVAMLLLNGQNIYTGCCSLQVEFWKARGPLEVRRENDKCRDYTISPLTDDELNSLQALPGGVTASTNNSTINSISQPSIGQNIPLGNPTAAFTAVPQAAASGI--NDLAIQLTLLAQQSGLALTPAAAAATASFMALTAQGGNSAINPTPGTVLNAASLQGPRAALPTVQNQTQLLPNLINQSVSNLGQTGASTVLIVSNLNEE-----------GVYGDVTRVKIMFNKKSTALVQFSDPQQALTALYHLNGQPLYGKPLK--------IAVSRFNIVQLPKEDNDVGLTKDYTNSPLHRFRKPNSKNFTNIYAPNHVLHLSNIPSAITEEEVRMIFETKGYHVTDFKFMMKDKKMALIQLENVDMAIQALIDLHNCQLTENSHLRISFSKTAI 592          
BLAST of Polypyrimidine tract-binding protein 1 vs. Ensembl Cavefish
Match: ptbp2b (polypyrimidine tract-binding protein 2-like [Source:NCBI gene;Acc:103030091])

HSP 1 Score: 299.286 bits (765), Expect = 2.436e-91
Identity = 204/570 (35.79%), Postives = 301/570 (52.81%), Query Frame = 1
Query:  697 GVKRSIQNFNSNSLLGS-SYSIDVDSNESKKSKLEPSTNTEPSKVLHIRNIASRAQESDLSLLAVPFGKIRSMVYAKKTNQALLELEKASEATRMFDYYTRYPPCFNGREMIVQYSKHVSLELKLK-NSNIDASVDAANKMNEKHRSIVDEWSSE--NKSDRRILRVVIENLKNYNINHLVILKVFQRFGKVLRIIIFTKNMQCQCLVELDNSISAHVSLLHLNGQDLFNDCCRLKIEFSKNTDSLQIQRQNDKCRDYTVSPLQEDEQFSLHFLDWQAKSVSTVPPQQYPSLS--TVPLLQTQVQKPLYSDFLPNNLFYTVMPNVFKSTFQPSPVAIPESLLISDCAINPLYQEPIV-----KPPSSANAIDSSIILVSNLNYEKVNTDSIFTLFGVYGDVSKVCISPPSVGAALVYMQTNSQAETACRHLNLVPLFGKIISTYLLPGEIVAQSIFNTELNSDIEVKHFTNTPLHRFKKPNSKNHFNIYPPSSVLHLSNIPLSFKEEDLLTLFHDNGFQCSSLRIFQKDKKMALAKMTSLEDAISALISLHNWKLTDSSHLRVSFSKALI 2373
            GVKRS  +  S SL  S + S+  + ++SKK ++E S ++ PS+V+HIR + +   E+++  L +PFGK+ +++  K  NQA LEL     A  M +YYT   P      + +QYS H  L+     N    A + A + + E      D       + +   +LR++I+N+  Y +   V+ ++F +FG V++II FTKN Q Q L++  + ++A  + L L+GQ+++N CC L+I+FSK  + L ++  NDK RDYT   L           D Q      V P    +LS  +  LL +           P+ +           T   S  A P SL     AI+PL           +   S ++    ++L SNLN E V   S+FTLFGVYGDV +V I      +AL+ M   +QA+ A  HLN   ++GKII   L   + V   +    L+     K FTN+PLHRFKKP SKN  NI+PPS+ LHLSN+     EEDL  LF ++G    + + FQ D+KMAL +M+++E+AI ALI LHN+ +     LRVSFSK+ I
Sbjct:   11 GVKRSSDDLLSGSLYNSPNSSVTANGSDSKKLRVEDSMDSPPSRVIHIRKLPNEVSETEVIALGLPFGKVTNILMLKGKNQAFLELGTEEAAVTMVNYYTAVTPQVRNVPVFIQYSNHKELKTDSALNQRAQAVLQAVSAVQEGGSPSSDTAGDSILSPAPSPVLRIIIDNMF-YPVTLDVLQQIFSKFGTVMKIITFTKNNQFQALLQFSDPVNAQQAKLSLDGQNIYNSCCTLRIDFSKLVN-LNVKYNNDKSRDYTRPELPAG--------DGQPP----VDPSMAAALSKDSTSLLGS-----------PSGMV----------TSYSSAGAYPSSL----GAISPLSAAAAAAAAAGRVALSGHSGGGGVLLASNLNDEMVTPQSLFTLFGVYGDVQRVKILYNKKDSALIQMADGNQAQLAMSHLNGQKMYGKIIRVTLSKHQTV--QLPREGLDDQGLTKDFTNSPLHRFKKPGSKNFQNIFPPSATLHLSNVRDDVTEEDLRLLFSNSGGTVKAFKFFQ-DRKMALLQMSTVEEAIQALIDLHNYDMGRGHRLRVSFSKSTI 538          
BLAST of Polypyrimidine tract-binding protein 1 vs. Ensembl Cavefish
Match: ptbp1b (polypyrimidine tract binding protein 1 [Source:NCBI gene;Acc:103035814])

HSP 1 Score: 294.664 bits (753), Expect = 2.440e-89
Identity = 201/544 (36.95%), Postives = 286/544 (52.57%), Query Frame = 1
Query:  763 VDSNESKKSKLEPSTNTEPSKVLHIRNIASRAQESDLSLLAVPFGKIRSMVYAKKTNQALLELEKASEATRMFDYYTRYPPCFNGREMIVQYSKHVSLELKLKNS----NIDASVDAANKMNEKHRSIVDEWSSENKSDRRILRVVIENLKNYNINHLVILKVFQRFGKVLRIIIFTKNMQCQCLVELDNSISAHVSLLHLNGQDLFNDCCRLKIEFSKNTDSLQIQRQNDKCRDYTVSPL-QEDEQFSLHFLDWQAKSVSTVPPQQYPSL-STVPLLQTQVQKPLYSDFLPNNLFYTVMPNVFKSTFQPSPVAIPESLLISDCAINPLYQEPIVKPPSSANAIDSSIILVSNLNYEKVNTDSIFTLFGVYGDVSKVCISPPSVGAALVYMQTNSQAETACRHLNLVPLFGKIISTYLLPGEIVAQSIFNTELNSDIEV-KHFTNTPLHRFKKPNSKNHFNIYPPSSVLHLSNIPLSFKEEDLLTLFHDNGFQCSSLRIFQKDKKMALAKMTSLEDAISALISLHNWKLTDSSHLRVSFSKALI 2373
             + N+SKK K +  +   PS+V+H+R + S   E+++  L +PFGK+ +++  K  NQA LE+     A  M  YY+   P      + +QYS H   ELK  NS       A++ A N +     +I     S       +LRV++ENL  Y +   V+ ++F +FG VL++I FTKN Q Q L++  + ++A  + L L+GQ+++N CC L+I FSK T SL ++  NDK RDYT   L   D Q ++        + +T      P + S  P        P ++      L    MP V      P  +A   SL I   A        +  P  S       ++LVSNLN E+V    +F LFGVYGDV +V I       ALV M   +QA+ A  HLN   L+G+ +   L     V       E + D  + K ++N+PLHRFKKP SKN+ NI+PPSS LHLSNIP S  E+DL  LF  +G    + + FQKD+KMAL +M S+E+AI +LI  HN  L ++ HLRVSFSK+ I
Sbjct:   40 ANGNDSKKFKGDIRSPGIPSRVIHVRKLPSDINEAEVISLGLPFGKVTNLLMLKGKNQAFLEMNTEEAAQTMVSYYSSVTPVIRNHPIFMQYSNHK--ELKTDNSPNQVRAQAALQAVNAVQTGSMAIAGVDPSGVTGPSPVLRVIVENLF-YPVTLDVLHQIFSKFGTVLKVITFTKNNQFQALLQFADGLTAQHAKLALDGQNIYNACCTLRISFSKLT-SLNVKYNNDKSRDYTRPDLPTGDSQPAIEHHAMAGAAFAT------PGIISAAPYAGAHAFPPAFAFQQAAGL---TMPGV------PGALA---SLAIPGAAAAAAAAGRLGFPTLSGG---HCVMLVSNLNPERVTPQCLFILFGVYGDVIRVKIMFNKKENALVQMSDGTQAQLAMSHLNGQKLYGRALRITLSKHTTVQ---LPREGHEDQGLTKDYSNSPLHRFKKPGSKNYSNIFPPSSTLHLSNIPPSVVEDDLKMLFSTSGALVKNFKFFQKDRKMALIQMGSVEEAIESLIEFHNHDLGENHHLRVSFSKSTI 555          
BLAST of Polypyrimidine tract-binding protein 1 vs. Ensembl Cavefish
Match: ptbp1b (polypyrimidine tract binding protein 1 [Source:NCBI gene;Acc:103035814])

HSP 1 Score: 294.278 bits (752), Expect = 4.272e-89
Identity = 201/544 (36.95%), Postives = 286/544 (52.57%), Query Frame = 1
Query:  763 VDSNESKKSKLEPSTNTEPSKVLHIRNIASRAQESDLSLLAVPFGKIRSMVYAKKTNQALLELEKASEATRMFDYYTRYPPCFNGREMIVQYSKHVSLELKLKNS----NIDASVDAANKMNEKHRSIVDEWSSENKSDRRILRVVIENLKNYNINHLVILKVFQRFGKVLRIIIFTKNMQCQCLVELDNSISAHVSLLHLNGQDLFNDCCRLKIEFSKNTDSLQIQRQNDKCRDYTVSPL-QEDEQFSLHFLDWQAKSVSTVPPQQYPSL-STVPLLQTQVQKPLYSDFLPNNLFYTVMPNVFKSTFQPSPVAIPESLLISDCAINPLYQEPIVKPPSSANAIDSSIILVSNLNYEKVNTDSIFTLFGVYGDVSKVCISPPSVGAALVYMQTNSQAETACRHLNLVPLFGKIISTYLLPGEIVAQSIFNTELNSDIEV-KHFTNTPLHRFKKPNSKNHFNIYPPSSVLHLSNIPLSFKEEDLLTLFHDNGFQCSSLRIFQKDKKMALAKMTSLEDAISALISLHNWKLTDSSHLRVSFSKALI 2373
             + N+SKK K +  +   PS+V+H+R + S   E+++  L +PFGK+ +++  K  NQA LE+     A  M  YY+   P      + +QYS H   ELK  NS       A++ A N +     +I     S       +LRV++ENL  Y +   V+ ++F +FG VL++I FTKN Q Q L++  + ++A  + L L+GQ+++N CC L+I FSK T SL ++  NDK RDYT   L   D Q ++        + +T      P + S  P        P ++      L    MP V      P  +A   SL I   A        +  P  S       ++LVSNLN E+V    +F LFGVYGDV +V I       ALV M   +QA+ A  HLN   L+G+ +   L     V       E + D  + K ++N+PLHRFKKP SKN+ NI+PPSS LHLSNIP S  E+DL  LF  +G    + + FQKD+KMAL +M S+E+AI +LI  HN  L ++ HLRVSFSK+ I
Sbjct:   51 ANGNDSKKFKGDIRSPGIPSRVIHVRKLPSDINEAEVISLGLPFGKVTNLLMLKGKNQAFLEMNTEEAAQTMVSYYSSVTPVIRNHPIFMQYSNHK--ELKTDNSPNQVRAQAALQAVNAVQTGSMAIAGVDPSGVTGPSPVLRVIVENLF-YPVTLDVLHQIFSKFGTVLKVITFTKNNQFQALLQFADGLTAQHAKLALDGQNIYNACCTLRISFSKLT-SLNVKYNNDKSRDYTRPDLPTGDSQPAIEHHAMAGAAFAT------PGIISAAPYAGAHAFPPAFAFQQAAGL---TMPGV------PGALA---SLAIPGAAAAAAAAGRLGFPTLSGG---HCVMLVSNLNPERVTPQCLFILFGVYGDVIRVKIMFNKKENALVQMSDGTQAQLAMSHLNGQKLYGRALRITLSKHTTVQ---LPREGHEDQGLTKDYSNSPLHRFKKPGSKNYSNIFPPSSTLHLSNIPPSVVEDDLKMLFSTSGALVKNFKFFQKDRKMALIQMGSVEEAIESLIEFHNHDLGENHHLRVSFSKSTI 566          
BLAST of Polypyrimidine tract-binding protein 1 vs. Ensembl Cavefish
Match: ptbp1b (polypyrimidine tract binding protein 1 [Source:NCBI gene;Acc:103035814])

HSP 1 Score: 289.656 bits (740), Expect = 4.398e-88
Identity = 196/542 (36.16%), Postives = 279/542 (51.48%), Query Frame = 1
Query:  763 VDSNESKKSKLEPSTNTEPSKVLHIRNIASRAQESDLSLLAVPFGKIRSMVYAKKTNQALLELEKASEATRMFDYYTRYPPCFNGREMIVQYSKHVSLELKLKNS----NIDASVDAANKMNEKHRSIVDEWSSENKSDRRILRVVIENLKNYNINHLVILKVFQRFGKVLRIIIFTKNMQCQCLVELDNSISAHVSLLHLNGQDLFNDCCRLKIEFSKNTDSLQIQRQNDKCRDYTVSPLQEDEQFSLHFLDWQAKSVSTVPPQQYPSLSTVPLLQTQVQKPLYSDFLPNNLFYTVMPNVFKSTFQPSPVAIPESLLISDCAINPLYQEPIVKPPSSANAIDSSIILVSNLNYEKVNTDSIFTLFGVYGDVSKVCISPPSVGAALVYMQTNSQAETACRHLNLVPLFGKIISTYLLPGEIVAQSIFNTELNSDIEV-KHFTNTPLHRFKKPNSKNHFNIYPPSSVLHLSNIPLSFKEEDLLTLFHDNGFQCSSLRIFQKDKKMALAKMTSLEDAISALISLHNWKLTDSSHLRVSFSKALI 2373
             + N+SKK K +  +   PS+V+H+R + S   E+++  L +PFGK+ +++  K  NQA LE+     A  M  YY+   P      + +QYS H   ELK  NS       A++ A N +     +I     S       +LRV++ENL  Y +   V+ ++F +FG VL++I FTKN Q Q L++  + ++A  + L L+GQ+++N CC L+I FSK T SL ++  NDK RDYT   L                          P+  + P ++           +    F   MP V      P  +A   SL I   A        +  P  S       ++LVSNLN E+V    +F LFGVYGDV +V I       ALV M   +QA+ A  HLN   L+G+ +   L     V       E + D  + K ++N+PLHRFKKP SKN+ NI+PPSS LHLSNIP S  E+DL  LF  +G    + + FQKD+KMAL +M S+E+AI +LI  HN  L ++ HLRVSFSK+ I
Sbjct:   11 ANGNDSKKFKGDIRSPGIPSRVIHVRKLPSDINEAEVISLGLPFGKVTNLLMLKGKNQAFLEMNTEEAAQTMVSYYSSVTPVIRNHPIFMQYSNHK--ELKTDNSPNQVRAQAALQAVNAVQTGSMAIAGVDPSGVTGPSPVLRVIVENLF-YPVTLDVLHQIFSKFGTVLKVITFTKNNQFQALLQFADGLTAQHAKLALDGQNIYNACCTLRISFSKLT-SLNVKYNNDKSRDYTRPDL--------------------------PTGDSQPAIEHHA--------MAGAAFGLTMPGV------PGALA---SLAIPGAAAAAAAAGRLGFPTLSGG---HCVMLVSNLNPERVTPQCLFILFGVYGDVIRVKIMFNKKENALVQMSDGTQAQLAMSHLNGQKLYGRALRITLSKHTTVQ---LPREGHEDQGLTKDYSNSPLHRFKKPGSKNYSNIFPPSSTLHLSNIPPSVVEDDLKMLFSTSGALVKNFKFFQKDRKMALIQMGSVEEAIESLIEFHNHDLGENHHLRVSFSKSTI 499          
BLAST of Polypyrimidine tract-binding protein 1 vs. Ensembl Cavefish
Match: ptbp3 (polypyrimidine tract binding protein 3 [Source:ZFIN;Acc:ZDB-GENE-091116-1])

HSP 1 Score: 227.639 bits (579), Expect = 4.231e-65
Identity = 172/530 (32.45%), Postives = 264/530 (49.81%), Query Frame = 1
Query:  817 PSKVLHIRNIASRAQESDLSLLAVPFGKIRSMVYAKKTNQALLELEKASEATRMFDYYTRYPPCFNGREMIVQYSKHVSLELKLKNSNI-DASVDAANKMNEKHRSIVDEWSS---ENKSDRRILRV--VIENLKNYNINHLVILKVFQRFGKVLRIIIFTKNMQCQCLVELDNSISAHV---SLLHLNGQDLFNDCCRLKIEFSKNTDSLQIQRQNDKCRDYTVSPL-QEDEQFSLHFLDWQAKSVSTVPPQQYPSLSTVPLLQTQVQKPLYSDFLPNNLFYTVMPNVFKSTFQPSPVAIPESLLISDCAINPLYQEPIVKPPSSANAIDSSIILVSNLNYEKVNTDSIFTLFGVYGDVSKVCISPPSVGAALVYMQTNSQAETACRHLNLVPLFGKIISTYLLPGEIVAQSIFNTELNSDIEV-KHFTNTPLHRFKKPNSKNHFNIYPPSSVLHLSNIPLSFKEEDLLTLFHDNGFQCSSLRIFQKDKKMALAKMTSLEDAISALISLHNWKLTDSSHLRVSFSKALI 2373
            PS+V+H+R +     E+++  L +PFGK+ +++  K  NQA +E+     A  M +YYT   P    + + +QYS H     +LK  N+ +  V + + ++     ++D+ ++      +  + +R   +I   K Y     + L V           +F  N   +     +  ++ H+   + + L+GQ+++N CC L+IEFSK T SL ++  NDK RD+T   L   D Q +L      A           P + + P        P         L    MP          P+ IP S +    AI+ +        P++ +    S++LVSNLN + ++  S+F LFGVYGDV +V I       ALV M   +QA+ A  HLN   L G++I   +   + V       E   D  + K F+ +PLHRFKKP SKN  NI+PPS+ LHLSNIP S  ++ L  LF   G+   + + FQKD+KMAL ++ S+E+AI ALI LHN  L ++ HLRVSFSK+ I
Sbjct:   22 PSRVVHVRKVPIEVSEAEVISLGIPFGKVTNLLMLKAKNQAFIEMASEEAAITMVNYYTTATPHVRNQPVYIQYSNH----RELKTDNLPNQGVRSPSTLSV--LPVLDQCAAFFYRQAASPKYIRTCGIIVTHKYYKCCSFLYLYVG----------LFGSNYITKTNNSNNKFMAVHLLRLTPITLDGQNIYNACCTLRIEFSKLT-SLNVKYNNDKSRDFTRLDLPSGDGQPTLDPGMTAAFGA--------PGIISSPYAGAAGFAPAVGFPQAAGLSMQAMPGAL------GPLTIPPSAVAGRMAIHGM-------APTALH----SVLLVSNLNPDSISPHSLFILFGVYGDVHRVKILFNKKENALVQMADATQAQLAMSHLNGQRLHGRVIRVTISKHQTVQ---LPREGQEDQGLTKDFSGSPLHRFKKPGSKNFQNIFPPSATLHLSNIPPSIADDMLKDLFSSAGYTVKAFKFFQKDRKMALIQLGSVEEAIQALIDLHNHDLGENHHLRVSFSKSTI 506          
BLAST of Polypyrimidine tract-binding protein 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006507.1 (pep scaffold:Pmarinus_7.0:GL480554:3468:10153:1 gene:ENSPMAG00000005883.1 transcript:ENSPMAT00000006507.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 134.42 bits (337), Expect = 1.961e-35
Identity = 88/263 (33.46%), Postives = 144/263 (54.75%), Query Frame = 1
Query:  763 VDSNESKKSKLEPSTNTEPSKVLHIRNIASRAQESDLSLLAVPFGKIRSMVYAKKTNQALLELEKASEATRMFDYYTRYPPCFNGREMIVQYSKHVSLELKLKNSNIDASVDAANKMNEKHRSIVDEWSSENKSDRR------ILRVVIENLKNYNINHLVILKVFQRFGKVLRIIIFTKNMQCQCLVELDNSISAHVSLLHLNGQDLFNDCCRLKIEFSKNTDSLQIQRQNDKCRDYTVSPLQEDE-QFSLHFLDWQAKSVS 1530
             + +ESKK K + S++  PSKVLHIR +   A E+++  LA+PFG++ +++  K  +QA LE+     A     +Y+  PP    + + VQYS + S  LK  NS   A+   A +  +   +++    S+++          IL +++ENL  Y I   V+  VF ++G VL+IIIF KN Q Q L++  ++ +AH +   L+GQ+++N CC L++ FS+ T+ L ++  N+K RD T   L   E Q     +  Q K  S
Sbjct:    8 AEGSESKKFKGD-SSDELPSKVLHIRKLPENATEAEVVTLALPFGRVTNILMLKGKSQAFLEMASEEAAVAAVTFYSTDPPVLRNQPVYVQYSTYKS--LKTDNSAYQAARSHARREQKAQAAMMVANGSDSEETNSAAPQSPILHIIVENLL-YPITLEVLHHVFSKYGTVLKIIIFNKNSQYQALMQFADASNAHQAKTMLDGQNIYNGCCTLRVGFSRLTN-LNVKYNNEKSRDLTRPDLPAGEGQGPFPLMRAQGKETS 265          
BLAST of Polypyrimidine tract-binding protein 1 vs. Ensembl Sea Lamprey
Match: HNRNPLL (heterogeneous nuclear ribonucleoprotein L like [Source:HGNC Symbol;Acc:HGNC:25127])

HSP 1 Score: 119.398 bits (298), Expect = 7.916e-29
Identity = 119/481 (24.74%), Postives = 195/481 (40.54%), Query Frame = 1
Query:  817 PSKVLHIRNIASRAQESDLSLLAVPFGKIRSMVYAKKTNQALLELEKASEATRMFDYYTRYPPCFNGREMIVQYSKHVSLELKLKNSNIDASVDAANKMNEKHRSIVDEWSSENKSDRRILRVVIENLKNYNINHLVILKVFQRFGKVLRIIIFTKNMQCQCLVELDNSISAHVSLLHLNGQDLFNDCCRLKIEFSKNTD--SLQIQRQNDKCRDYT-----VSPLQEDEQFSL-----HFLDWQAKSVSTVPPQQYPSLSTVPLLQTQVQKPLYSDFLPNNLFYTVMPNVFKSTFQPSPVAIPESLLISDCAINPLYQEPIVKPPSSANAIDSSIILVSNLNYEKVNTDSIFTLFGVYGDVSKVCISPPSVGAALVYMQTNSQAETACRHLNLVPLFGKIISTYLLP-GEIVAQSIFNTELNSDIEVKHFTNTPLHRFKKPNSKNHFNIYPPSSVLHLSNIPLSFKEEDLLTLFHDNGFQ 2220
            PS V+HIR +AS A ES +      FG +R +V      QAL+E E+  +A          P    G+     +S                    + +++ K  +  D+ +  N     IL + + N   Y I   VI  +   +G V RI+IF KN   Q L   D+  SA  +   LNG D+++ CC LKIE++K      L + R + +  DYT     V   Q+ +Q +L       +        T  PQ Y                 ++++   + F    P         +P++ P +     CA       P   P     +  + +++V N+N   +N   +F L  +YG+V K+       G  ++ M   +  + A  +LN   LFG+ +S  +    EIVA   F  E  SD   + F  +  +RF      +   I PPS++LH  + P  F E+  + +  + G +
Sbjct:   10 PSPVVHIRGLASSADESQVMEALQEFGTVRHVVMMPHRRQALVEFERLEDARACVAGTAGDPVYVGGQPAYCNFS-------------------TSQRISRKGGTPADDVARTN----HILLLTVNNAL-YPITTEVIHTICSPYGVVQRIVIFKKN-GVQALRTFDSIPSAQQAKSSLNGADIYSGCCTLKIEYAKERKPARLNVYRNDSETWDYTLEGPCVPNGQQKKQPALLGDHPSTMRGYGNQQGTYCPQNYS----------------FNNYTSGSPFGNARPT--------TPMSGPGT-----CA-------PHNNPCPMGGSAANRVMMVYNMNPSVMNCSRLFNLVCLYGNVEKIKFLKSKPGVGMIQMADAASVDRAVANLNTAQLFGQKLSLSVSKQQEIVAGQAFELEDGSD-SFRDFVGSRHNRFSTHEQASKNRILPPSAILHFYSAPPEFSEQAFIQICEETGVK 428          
BLAST of Polypyrimidine tract-binding protein 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008413.1 (pep scaffold:Pmarinus_7.0:GL478562:177533:180128:-1 gene:ENSPMAG00000007617.1 transcript:ENSPMAT00000008413.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 108.612 bits (270), Expect = 9.147e-28
Identity = 65/145 (44.83%), Postives = 85/145 (58.62%), Query Frame = 1
Query: 1951 HLNLVPLFGKIISTYLLPGEIVAQSIFNT----ELNSDIEVKHFTNTPLHRFKKPNSKNHFNIYPPSSVLHLSNIPLSFKEEDLLTLFHDNGFQCSSLRIFQKDKKMALAKMTSLEDAISALISLHNWKLTDSSHLRVSFSKALI 2373
            HLN   ++GK I         V  S + T       SD     F+++PLHRF++  +KN  +I+PPS  LHLSNIP S  E+DL TLF  NG    +L+ F  D KMAL +M SLE+AI  L  LHN +L  +  LRVSFSK++I
Sbjct:   24 HLNGQRMYGKPIR--------VTSSRYQTVQLPRDGSDSLTCDFSDSPLHRFRRMGAKNFHHIFPPSVTLHLSNIPSSVLEDDLKTLFESNGCVVKALKFFATDHKMALVQMESLEEAIQTLAELHNHELEKNRLLRVSFSKSVI 160          
BLAST of Polypyrimidine tract-binding protein 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006509.1 (pep scaffold:Pmarinus_7.0:GL480554:3489:6552:1 gene:ENSPMAG00000005883.1 transcript:ENSPMAT00000006509.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 100.908 bits (250), Expect = 2.051e-24
Identity = 66/197 (33.50%), Postives = 108/197 (54.82%), Query Frame = 1
Query:  763 VDSNESKKSKLEPSTNTEPSKVLHIRNIASRAQESDLSLLAVPFGKIRSMVYAKKTNQALLELEKASEATRMFDYYTRYPPCFNGREMIVQYSKHVSLELKLKNSNIDASVDAANKMNEKHRSIV------DEWSSENKSDRRILRVVIENLKNYNINHLVILKVFQRFGKVLRIIIFTKNMQCQCLVELDNSISAH 1335
             + +ESKK K + S++  PSKVLHIR +   A E+++  LA+PFG++ +++  K  +QA LE+     A     +Y+  PP    + + VQYS + S  LK  NS   A+   A +  +   +++       E ++       IL +++ENL  Y I   V+  VF ++G VL+IIIF KN Q Q L++  ++ +AH
Sbjct:    1 AEGSESKKFKGD-SSDELPSKVLHIRKLPENATEAEVVTLALPFGRVTNILMLKGKSQAFLEMASEEAAVAAVTFYSTDPPVLRNQPVYVQYSTYKS--LKTDNSAYQAARSHARREQKAQAAMMVANGSDSEETNSAAPQSPILHIIVENLL-YPITLEVLHHVFSKYGTVLKIIIFNKNSQYQALMQFADASNAH 193          
BLAST of Polypyrimidine tract-binding protein 1 vs. Ensembl Sea Lamprey
Match: HNRNPLL (heterogeneous nuclear ribonucleoprotein L like [Source:HGNC Symbol;Acc:HGNC:25127])

HSP 1 Score: 68.5514 bits (166), Expect = 3.108e-12
Identity = 61/223 (27.35%), Postives = 93/223 (41.70%), Query Frame = 1
Query:  817 PSKVLHIRNIASRAQESDLSLLAVPFGKIRSMVYAKKTNQALLELEKASEATRMFDYYTRYPPCFNGREMIVQYSKHVSLELKLKNSNIDASVDAANKMNEKHRSIVDEWSSENKSDRRILRVVIENLKNYNINHLVILKVFQRFGKVLRIIIFTKNMQCQCLVELDNSISAHVSLLHLNGQDLFNDCCRLKIEFSKNTDSLQIQRQNDKCRDYTVSPLQEDE 1485
            PS V+H+R ++  A ESDL      FG I  +V   K  QAL+E E    +    +Y +       G   +     + +     K S      D                   N++   IL   I N   Y I   V+  +    G V RI+IF KN   Q +   D+  SA  +   LNG D+++ CC LK+E++K T  L + + + +  DYT   L+  +
Sbjct:   47 PSAVVHVRGLSDAALESDLVEAVQHFGPISYVVMMPKKRQALVEFEDLESSRSCVNYSS------TGSIYVCGQPAYFNFSTSQKISRPGGPED-------------------NRNSNHILLFTILN-PIYPITTDVLYTICNPCGPVQRIVIFRKN-GLQAMATFDSVQSAQRAKSSLNGADIYSGCCTLKVEYAKPT-RLNVFKNDSETWDYTNPGLKAGQ 241          

HSP 2 Score: 62.3882 bits (150), Expect = 2.600e-10
Identity = 55/210 (26.19%), Postives = 96/210 (45.71%), Query Frame = 1
Query: 1786 IILVSNLNYEKVNTDSIFTLFGVYGDVSKVCISPPSVGAALVYMQTNSQAETACRHLNLVPLFGKIIS------TYLLPGEIVAQSIFNTEL-NSDIEVKHFTNTPLHRFKKPNSKNHFNIYPPSSVLHLSNIPLSFKEEDLLTLFHDNGF-QCSSLRIF--QKDKKM-ALAKMTSLEDAISALISLHNWKLTDSSH-----LRVSFSKA 2367
            +++V   + E++N D +F +  ++G+V KV       GAA+V M      + A  HLN+  +FGK I+        ++PG+         EL +     K FT +  +RF          I  P++VLH  N P+    E  + L  +    +  S + F  + DK M  L +  +  DA+ AL  +++  L +++      L++ FS A
Sbjct:  316 VLMVYGFDAERINCDRVFNILCLFGNVEKVKFLKSKPGAAMVEMGDPYAVDRAVSHLNMSQIFGKKINLCVSKQQSIVPGQAY-------ELPDGTNSYKDFTGSRNNRFANAEKAAKNRIQQPTTVLHFFNAPMDITAEIFMQLCDEMSIARPLSFKAFSGKSDKSMSGLMEWENKNDAMEALACINHHSLKNANGPYPYTLKLCFSTA 518          
BLAST of Polypyrimidine tract-binding protein 1 vs. Ensembl Nematostella
Match: EDO43995 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RXA3])

HSP 1 Score: 163.31 bits (412), Expect = 2.944e-43
Identity = 93/205 (45.37%), Postives = 126/205 (61.46%), Query Frame = 1
Query: 1774 IDSSIILVSNLNYEKVNTDSIFTLFGVYGDVSKVCISPPSVGAALVYMQTNSQAETACRHLNLVPLFGKII-------STYLLPGEIVAQSIFNTELNSDIEVKHFTNTPLHRFKKPNSKNHFNIYPPSSVLHLSNIPLSFKEEDLLTLFHDNGFQCSSLRIFQKDKKMALAKMTSLEDAISALISLHNWKLTDSSHLRVSFSKA 2367
            + S ++LVSNLN E ++ D++FTLFG YGDV +V I       ALV      QA+TA  HLN V +FGK +       ++  LP E       +T L  D     + N+PLHRFKKP SKN  NI+PPS  LHLSNIP S  EE+L ++F D G   +  R   KD+KMA   M + E+AI ALI +HN+K++++ HLRVSF+++
Sbjct:  275 MGSPLVLVSNLNEEMISCDALFTLFGCYGDVQRVKILFNKKDTALVQFANVHQAQTAIGHLNGVRVFGKEMKVTNSKHTSVSLPKEGE-----DTNLTKD-----YMNSPLHRFKKPGSKNFQNIFPPSRTLHLSNIPESVTEEELTSMFEDCG-DVADFRFLPKDRKMAHLSMATTEEAIDALIKMHNYKISETHHLRVSFARS 468          

HSP 2 Score: 144.436 bits (363), Expect = 9.281e-37
Identity = 79/232 (34.05%), Postives = 130/232 (56.03%), Query Frame = 1
Query:  820 SKVLHIRNIASRAQESDLSLLAVPFGKIRSMVYAKKTNQALLELEKASEATRMFDYYTRYPPCFNGREMIVQYSKHVSLEL----------KLKNSNIDASVDAANKMNEKHRSIVDEWSSENKSDRRILRVVIENLKNYNINHLVILKVFQRFGKVLRIIIFTKNMQCQCLVELDNSISAHVSLLHLNGQDLFNDCCRLKIEFSKNTDSLQIQRQNDKCRDYTVSPLQEDE 1485
            SKVLH+RN+A+ A ++++  L +P+G++ +++  K  NQA LE++    A  + + Y+  PP   GR++ +QYS H  L             L +S++ A + +          I  E  S N     ILR+++EN+  Y I   V+ ++F ++G VL+I+IFT+N Q Q LV+   S  A  +   L+GQ+++N CC L+I++SK   +L ++  NDK RDYT   L   E
Sbjct:    2 SKVLHLRNVAAEATDAEIIALGIPYGRVTNVLMLKGKNQAFLEMKTKENAMALMNSYSYIPPSIRGRQIYIQYSNHQELTTNESQHSPGVRGLSSSHLGAGIGSLT----SGLGIAGELPSVNGC---ILRIIVENML-YPITIEVLNQIFTKYGTVLKIVIFTRNNQFQALVQFSQSTEARAAKCSLDGQNIYNGCCTLRIDYSK-LKTLSVKYNNDKTRDYTRPDLPSGE 224          
BLAST of Polypyrimidine tract-binding protein 1 vs. Ensembl Nematostella
Match: EDO26232 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7TCJ0])

HSP 1 Score: 117.472 bits (293), Expect = 7.329e-31
Identity = 67/149 (44.97%), Postives = 91/149 (61.07%), Query Frame = 1
Query: 1942 ACRHLNLVPLFGKII-------STYLLPGEIVAQSIFNTELNSDIEVKHFTNTPLHRFKKPNSKNHFNIYPPSSVLHLSNIPLSFKEEDLLTLFHDNGFQCSSLRIFQKDKKMALAKMTSLEDAISALISLHNWKLTDSSHLRVSFSKA 2367
            A  HLN V +FGK +       ++  LP E       +T L  D     + N+PLHRFKKP SKN  NI+PPS  LHLSNIP S  EE+L ++F D G   +  R   KD+KMA   M + E+AI ALI +HN+K++++ HLRVSF+++
Sbjct:    1 AIGHLNGVRVFGKEMKVTNSKHTSVSLPKEGE-----DTNLTKD-----YMNSPLHRFKKPGSKNFQNIFPPSRTLHLSNIPESVTEEELTSMFEDCG-DVADFRFLPKDRKMAHLSMATTEEAIDALIKMHNYKISETHHLRVSFARS 138          
BLAST of Polypyrimidine tract-binding protein 1 vs. Ensembl Nematostella
Match: EDO35537 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLA1])

HSP 1 Score: 100.138 bits (248), Expect = 4.670e-24
Identity = 74/222 (33.33%), Postives = 106/222 (47.75%), Query Frame = 1
Query:  808 NTEPSKVLHIRNIASRAQESDLSLLAVPFGKIRSMVYAKKTNQALLELEKASEATRMFDYYTRYPPCFNGREMIVQYSKHVSLELK----LKNSNIDASVDAANKMNEKHRSIVDEWSSENKSDRRILRVVIENLKNYNINHLVILKVFQRFGKVLRIIIFTKNMQCQCLVELDNSISAHVSLLHLNGQDLFNDCCRLKIEFSKNTDSLQIQRQNDKCRDYT 1461
            NT PS+V+H R +A   +E+DL  +  PFG I  +    K  QAL+E E    A  +  Y    P    GR+M V YSK  S E+K    L   +  A  +A+N +                     L  +I  L  + IN  ++ K+    GKVLRI+IF KN           ++SA  +L  LNGQD++  CC LKI++SK    L + + +D+  DYT
Sbjct:    2 NTPPSRVIHCRAVADGCKETDLIQVLQPFGTITYVTLLPKIRQALVEFESLESAIAVVTYSQTSPLTVLGRQMFVNYSK--SQEIKRDKVLNGDSNGACAEASNIL---------------------LLTIINPL--HPINVKILHKICSPSGKVLRIVIFHKNGL--------QALSAERALAVLNGQDIYAGCCTLKIDYSKKAKKLNVFKNDDETWDYT 190          
BLAST of Polypyrimidine tract-binding protein 1 vs. Ensembl Nematostella
Match: EDO39119 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SAW4])

HSP 1 Score: 68.5514 bits (166), Expect = 5.126e-12
Identity = 58/221 (26.24%), Postives = 96/221 (43.44%), Query Frame = 1
Query:  811 TEPSKVLHIRNIASRAQESDLSLLAVPFGKIRSMVYAKKTNQALLELEKASEATRMFDYYTRYPPC-FNGREMIVQYSKHVSLELKLKNSNIDASVDAANKMNEKHRSIVDEWSSENKSDRRILRVVIENLKNYNINHLVILKVFQRFGKVLRIIIFTKNMQCQCLVE---LDNSISAHVSLLHLNGQDLFNDCCRLKIEFSKNTDSLQIQRQNDKCRDYT 1461
             EPS+V+H+R +A  A+E DL      +G I  +    K  QAL+E E+ + A  + +      P    GR     YSK   +    +N ++                      SE + ++ +L  +I     Y +   ++  +F + G V RI+IF K+   Q +VE    D   +A  +   LNG D++  C  LKIE       L +++ + +  DYT
Sbjct:   44 AEPSRVVHVRGVADEAREQDLMQCLSQYGNISCITMMPKIRQALVEFEEIACANTLVNQTQMGNPVILCGRPAYANYSKSKQIS---RNVHV---------------------RSETQPNKILLITIIN--PQYVVTTDILHTIFSKQGMVQRIVIFRKS-GLQAMVEESRFDCVEAARHAKETLNGADIYTGCNTLKIESQGYAQQLNVRKNDSETYDYT 237          
BLAST of Polypyrimidine tract-binding protein 1 vs. Ensembl Nematostella
Match: EDO35536 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLA0])

HSP 1 Score: 51.9878 bits (123), Expect = 1.820e-7
Identity = 49/195 (25.13%), Postives = 84/195 (43.08%), Query Frame = 1
Query: 1786 IILVSNLNYEKVNTDSIFTLFGVYGDVSKVCISPPSVGAALVYMQTNSQAETACRHLNLVPLFGKIISTYLLPGEIVAQSIFNTEL-NSDIEVKHFTNTPLHRFKKPNS---KNHFNIYPPSSVLHLSNIPLSFKEEDLLTLFHDNG----FQCSSLRIFQKDKKMALAKMTSLEDAISALISLHNWKLTDSSHL 2346
            +++V  LN+EK+N + IF LF +YG+V KV       GA +V M     +E   R+L+   +F   I+        +A S   T L +S     +F +   +RFK  N     +     PP+ +LH  N P +   + L  +    G     + +            L +M  +  A+ ALI  +++ +    +L
Sbjct:    1 MLMVYGLNHEKMNCERIFNLFCLYGNVIKVKFLTNKPGACMVQMSDKIASEMIIRNLSGATIFDNKINIMFSKHPFIADSSVVTALPDSSPSAMNFADNRNNRFKYDNMPFLDSVVGYQPPTRMLHFFNAPPNCTVDQLRDVSTKAGALAPLKGTFFSKANTKSSAGLLEMPDIRSAMEALILTNHYTINPPGNL 195          
BLAST of Polypyrimidine tract-binding protein 1 vs. Ensembl Medaka
Match: ptbp1 (polypyrimidine tract binding protein 1 [Source:NCBI gene;Acc:101165926])

HSP 1 Score: 290.426 bits (742), Expect = 1.573e-87
Identity = 204/571 (35.73%), Postives = 301/571 (52.71%), Query Frame = 1
Query:  697 GVKRSIQNFNSNSLLGSSYSID-VDSNESKKSKLEPSTNTEPSKVLHIRNIASRAQESDLSLLAVPFGKIRSMVYAKKTNQALLELEKASEATRMFDYYTRYPPCFNGREMIVQYSKHVSLELKLKNS----NIDASVDAANKMNEKHR---SIVDEWSSENKSDRR--ILRVVIENLKNYNINHLVILKVFQRFGKVLRIIIFTKNMQCQCLVELDNSISAHVSLLHLNGQDLFNDCCRLKIEFSKNTDSLQIQRQNDKCRDYTVSPL-QEDEQFSLHFLDWQAKSVSTVPPQQYPSLSTVPLLQTQVQKPLYSDFLPNNLFYTVMPNVFKSTFQPSPVAIPESLLISDCAINPLYQEPIVKPPSSANAIDSSIILVSNLNYEKVNTDSIFTLFGVYGDVSKVCISPPSVGAALVYMQTNSQAETACRHLNLVPLFGKIISTYLLPGEIVAQSIFNTELNSDIEV-KHFTNTPLHRFKKPNSKNHFNIYPPSSVLHLSNIPLSFKEEDLLTLFHDNGFQCSSLRIFQKDKKMALAKMTSLEDAISALISLHNWKLTDSSHLRVSFSKALI 2373
            G KR      S+ +    Y ++  + N+SKK K +  +   PS+V+H+R + +   E+++  L +PFGK+ +++  K  NQA LE      A  M  YY+   P      + +QYS H   ELK  NS       A++ A N ++       +I  E +S   +  +  +LRV++ENL  Y +   V+ ++F +FG VL+II FTKN Q Q L++  ++++A  + L L+GQ+++N CC L+I FSK T SL ++  NDK RDYT   L   D Q SL   D QA + +   P     +S  P        P ++ F    L    +P+   S      + +  S + +  A     +  +    ++      +++LVSNLN E V    +F LFGVYGDV +V I       ALV M   +QA+ +  HLN   L G+ I   L     V       E + D  + K ++N+PLHRFKKP SKN+ NI+PPS+ LHLSNIP S  E+DL  LF   G    + + FQKD+KMAL +M S+E+AI  LI  HN  L ++ HLRVSFSK+ I
Sbjct:   30 GTKRGSDELFSSCITNGPYIMNSANGNDSKKFKGDVRSPGVPSRVVHVRKLPNDINEAEVISLGLPFGKVTNLLMLKGKNQAFLEFGSEECAQTMVSYYSSVTPVIRNHPIYMQYSTHK--ELKTDNSPNQVRAQAALQAVNALHGSGMGSMAISAEAASMGGAASQSPVLRVIVENLF-YPVTLDVLHQIFSKFGTVLKIITFTKNNQFQALIQYADAMTAQHAKLSLDGQNIYNACCTLRISFSKLT-SLNVKYNNDKSRDYTRPDLPTADSQPSL---DHQAMAAAAFGPG---IISASPYGGAHAFPPTFT-FQQAGLSMQGIPSALAS------LGVGHSGMAAAAAAAAATRLGLSGLGATGG---HNVLLVSNLNPESVTPHCLFILFGVYGDVMRVKILFNKKENALVQMSDGTQAQLSMSHLNGQRLHGRAIRVTLSKHTTVQ---LPREGHEDQGLTKDYSNSPLHRFKKPGSKNYSNIFPPSATLHLSNIPPSVMEDDLRRLFASTGATVKAFKFFQKDRKMALIQMGSVEEAIECLIEFHNHDLGENHHLRVSFSKSTI 577          
BLAST of Polypyrimidine tract-binding protein 1 vs. Ensembl Medaka
Match: ptbp1 (polypyrimidine tract binding protein 1 [Source:NCBI gene;Acc:101165926])

HSP 1 Score: 288.115 bits (736), Expect = 3.002e-87
Identity = 199/548 (36.31%), Postives = 292/548 (53.28%), Query Frame = 1
Query:  763 VDSNESKKSKLEPSTNTEPSKVLHIRNIASRAQESDLSLLAVPFGKIRSMVYAKKTNQALLELEKASEATRMFDYYTRYPPCFNGREMIVQYSKHVSLELKLKNS----NIDASVDAANKMNEKHR---SIVDEWSSENKSDRR--ILRVVIENLKNYNINHLVILKVFQRFGKVLRIIIFTKNMQCQCLVELDNSISAHVSLLHLNGQDLFNDCCRLKIEFSKNTDSLQIQRQNDKCRDYTVSPL-QEDEQFSLHFLDWQAKSVSTVPPQQYPSLSTVPLLQTQVQKPLYSDFLPNNLFYTVMPNVFKSTFQPSPVAIPESLLISDCAINPLYQEPIVKPPSSANAIDSSIILVSNLNYEKVNTDSIFTLFGVYGDVSKVCISPPSVGAALVYMQTNSQAETACRHLNLVPLFGKIISTYLLPGEIVAQSIFNTELNSDIEV-KHFTNTPLHRFKKPNSKNHFNIYPPSSVLHLSNIPLSFKEEDLLTLFHDNGFQCSSLRIFQKDKKMALAKMTSLEDAISALISLHNWKLTDSSHLRVSFSKALI 2373
             + N+SKK K +  +   PS+V+H+R + +   E+++  L +PFGK+ +++  K  NQA LE      A  M  YY+   P      + +QYS H   ELK  NS       A++ A N ++       +I  E +S   +  +  +LRV++ENL  Y +   V+ ++F +FG VL+II FTKN Q Q L++  ++++A  + L L+GQ+++N CC L+I FSK T SL ++  NDK RDYT   L   D Q SL   D QA + +   P     +S  P        P ++ F    L    +P+   S      + +  S + +  A     +  +    ++      +++LVSNLN E V    +F LFGVYGDV +V I       ALV M   +QA+ +  HLN   L G+ I   L     V       E + D  + K ++N+PLHRFKKP SKN+ NI+PPS+ LHLSNIP S  E+DL  LF   G    + + FQKD+KMAL +M S+E+AI  LI  HN  L ++ HLRVSFSK+ I
Sbjct:    4 ANGNDSKKFKGDVRSPGVPSRVVHVRKLPNDINEAEVISLGLPFGKVTNLLMLKGKNQAFLEFGSEECAQTMVSYYSSVTPVIRNHPIYMQYSTHK--ELKTDNSPNQVRAQAALQAVNALHGSGMGSMAISAEAASMGGAASQSPVLRVIVENLF-YPVTLDVLHQIFSKFGTVLKIITFTKNNQFQALIQYADAMTAQHAKLSLDGQNIYNACCTLRISFSKLT-SLNVKYNNDKSRDYTRPDLPTADSQPSL---DHQAMAAAAFGPG---IISASPYGGAHAFPPTFT-FQQAGLSMQGIPSALAS------LGVGHSGMAAAAAAAAATRLGLSGLGATGG---HNVLLVSNLNPESVTPHCLFILFGVYGDVMRVKILFNKKENALVQMSDGTQAQLSMSHLNGQRLHGRAIRVTLSKHTTVQ---LPREGHEDQGLTKDYSNSPLHRFKKPGSKNYSNIFPPSATLHLSNIPPSVMEDDLRRLFASTGATVKAFKFFQKDRKMALIQMGSVEEAIECLIEFHNHDLGENHHLRVSFSKSTI 528          
BLAST of Polypyrimidine tract-binding protein 1 vs. Ensembl Medaka
Match: PTBP2 (polypyrimidine tract binding protein 2 [Source:NCBI gene;Acc:101156726])

HSP 1 Score: 285.419 bits (729), Expect = 2.111e-86
Identity = 193/570 (33.86%), Postives = 288/570 (50.53%), Query Frame = 1
Query:  697 GVKRSIQNF----NSNSLLGSSYSIDVDSNESKKSKLEPSTNTEPSKVLHIRNIASRAQESDLSLLAVPFGKIRSMVYAKKTNQALLELEKASEATRMFDYYTRYPPCFNGREMIVQYSKHVSLELKLKNSNIDASVDAANKMNEKHRSIVDEWSSENKSDRRILRVVIENLKNYNINHLVILKVFQRFGKVLRIIIFTKNMQCQCLVELDNSISAHVSLLHLNGQDLFNDCCRLKIEFSKNTDSLQIQRQNDKCRDYTVSPLQEDEQFSLHFLDWQAKSVSTVPPQQYPSLSTVPLLQTQVQKPLYSDFLPNNLFYTVMPNVFKSTFQPSPVAIPESLLISDCAINPLYQEPI-------VKPPSSANAIDSSIILVSNLNYEKVNTDSIFTLFGVYGDVSKVCISPPSVGAALVYMQTNSQAETACRHLNLVPLFGKIISTYLLPGEIVAQSIFNTELNSDIEVKHFTNTPLHRFKKPNSKNHFNIYPPSSVLHLSNIPLSFKEEDLLTLFHDNGFQCSSLRIFQKDKKMALAKMTSLEDAISALISLHNWKLTDSSHLRVSFSKALI 2373
            G+KR         NSNS L +        ++SKK ++E +    PS+V+HIR + + A ++++  L +PFGK+ +++  +  NQA LE+     A  M +YY   PP      + VQ+S H  L+    +    A + A + +      + D  ++ +     +LR++I+N+  Y +   V+ ++F +FG V++II FTKN Q Q L++  + + A  + L L+GQ+++N CC L+I+FSK  + L ++  NDK RDY+   L                          P+  + P L   V   L  D  P       +P                       A+NPL            V  P  A +    ++L SNLN E V   S+FTLFGVYGDV +V I      +AL+ M   SQA+ A  HLN   ++GKII   L   + VA  +    L+     K FTN+ LHRFKKP SKN  NI+PPS+ LHLSN+     EEDL  LF + G    + + FQ D+KMAL +M+++E+AI ALI LHN+ +  + HLRVSFSK+ I
Sbjct:   10 GMKRGSDELSMYNNSNSDLSTRSDGASTGSDSKKLRVEEAL---PSRVIHIRRLPTEAMDAEVIALGLPFGKVTNILTLRGKNQAFLEMGTEEAAITMVNYYNTVPPHVRNSPVYVQFSNHKELKTDAASQRTQAVLQAVSAVQPPGSEVQDVLAAASSP---VLRIIIDNMF-YPVTLDVLQQIFSKFGTVMKIITFTKNNQFQALLQYSDPVQAQHAKLALDGQNIYNSCCTLRIDFSKLVN-LNVKYNNDKSRDYSRPEL--------------------------PAGDSRPTLDPSVAAALSKDSTP---LLCKIPG----------------------ALNPLSAAAAAAAAAGRVALPGQAGS--GGVLLASNLNEEMVTPQSLFTLFGVYGDVQRVKILYNKKDSALIQMCDPSQAQLAMSHLNGQKMYGKIIRVTLSKHQSVA--LPRDGLDDQGLTKDFTNSSLHRFKKPGSKNFQNIFPPSATLHLSNVLQDVTEEDLRLLFSNTGGTVKAFKFFQ-DRKMALIQMSTVEEAIQALIDLHNYNMGANQHLRVSFSKSTI 515          
BLAST of Polypyrimidine tract-binding protein 1 vs. Ensembl Medaka
Match: ENSORLT00000042697.1 (polypyrimidine tract-binding protein 1 [Source:NCBI gene;Acc:101170752])

HSP 1 Score: 284.648 bits (727), Expect = 4.466e-86
Identity = 200/548 (36.50%), Postives = 286/548 (52.19%), Query Frame = 1
Query:  763 VDSNESKKSKLEPSTNTEPSKVLHIRNIASRAQESDLSLLAVPFGKIRSMVYAKKTNQALLELEKASEATRMFDYYTRYPPCFNGREMIVQYSKHVSLELKLKNS-NIDASVDAANKMNEKH---RSIVDEWSSENKSDRRILRVVIENLKNYNINHLVILKVFQRFGKVLRIIIFTKNMQCQCLVELDNSISAHVSLLHLNGQDLFNDCCRLKIEFSKNTDSLQIQRQNDKCRDYTVSPLQEDEQFSLHFLDWQAKSVSTVPPQQYPSLSTVPLLQTQVQKPLYSDFLPNNLFYTVMPNVFKSTFQPSPVAIPESLLISDCAINPLYQEPIVKPPSSAN----AIDS--SIILVSNLNYEKVNTDSIFTLFGVYGDVSKVCISPPSVGAALVYMQTNSQAETACRHLNLVPLFGKIISTYLLPGEIVAQSIFNTELNSDIEV-KHFTNTPLHRFKKPNSKNHFNIYPPSSVLHLSNIPLSFKEEDLLTLFHDNGFQCSSLRIFQKDKKMALAKMTSLEDAISALISLHNWKLTDSSHLRVSFSKALI 2373
             + N+SKK K +      PS+VLHIR +     E+++  L +PFG + +++  K  NQA LE+     A  M  YY+   P    + + VQ+S H   ELK  NS N + +  A   ++  H    ++V   SS       +LRVV+ENL  Y ++   + ++F +FG VLRII+FTKN Q Q L++     SA  + + L+GQ+++N CC L+I FSK T +L ++  NDK RD+T   L                          PS    P ++ Q     +   + +   YT   + F   F   PV+ P + L        L    +   P+ A     AI +  S++LVSNLN E+V    +F LFGVYGDV +V I       ALV M  ++QA+ A  HLN   L G+ +   L     V       E + D  + K ++++PLHRFKKP SKN+ NI+PPS+ LHLSNIP S  E+DL  LF  +G    + + FQKD KMAL +M S+E+AI  LI LHN  L ++ HLRVSFSK+ I
Sbjct:    5 ANGNDSKKFKGDLRGPNVPSRVLHIRKLPIDITETEVISLGLPFGDVTNLLMLKAKNQAFLEMNSEEAAQNMVGYYSTVMPIIRQQPVFVQFSNHK--ELKTDNSPNQERAQAALRALSSSHVDTAALVVAPSS-------VLRVVVENLL-YPVSLDALCQIFSKFGTVLRIIVFTKNNQFQALLQYAEGASAQAAKVSLDGQNIYNGCCTLRISFSKLT-TLNVKYNNDKSRDFTRPDL--------------------------PSGDGQPTMEHQAMATAFGPGIISASPYTGATHAFPPAFALQPVSSPYAGLTMSGLPGTLASLTL---PAGARLGFPAIPAGHSVVLVSNLNAERVTPHCLFILFGVYGDVMRVKILFNKKENALVQMSDSTQAQLAMSHLNGQRLHGRPLRITLSKHTSVQ---LPREGHEDQGLTKDYSSSPLHRFKKPGSKNYSNIFPPSATLHLSNIPPSVVEDDLKMLFSSSGAVVKAFKFFQKDHKMALIQMGSVEEAIECLIQLHNHDLGENHHLRVSFSKSSI 509          
BLAST of Polypyrimidine tract-binding protein 1 vs. Ensembl Medaka
Match: ENSORLT00000036879.1 (polypyrimidine tract-binding protein 1 [Source:NCBI gene;Acc:101170752])

HSP 1 Score: 284.263 bits (726), Expect = 2.338e-85
Identity = 200/548 (36.50%), Postives = 286/548 (52.19%), Query Frame = 1
Query:  763 VDSNESKKSKLEPSTNTEPSKVLHIRNIASRAQESDLSLLAVPFGKIRSMVYAKKTNQALLELEKASEATRMFDYYTRYPPCFNGREMIVQYSKHVSLELKLKNS-NIDASVDAANKMNEKH---RSIVDEWSSENKSDRRILRVVIENLKNYNINHLVILKVFQRFGKVLRIIIFTKNMQCQCLVELDNSISAHVSLLHLNGQDLFNDCCRLKIEFSKNTDSLQIQRQNDKCRDYTVSPLQEDEQFSLHFLDWQAKSVSTVPPQQYPSLSTVPLLQTQVQKPLYSDFLPNNLFYTVMPNVFKSTFQPSPVAIPESLLISDCAINPLYQEPIVKPPSSAN----AIDS--SIILVSNLNYEKVNTDSIFTLFGVYGDVSKVCISPPSVGAALVYMQTNSQAETACRHLNLVPLFGKIISTYLLPGEIVAQSIFNTELNSDIEV-KHFTNTPLHRFKKPNSKNHFNIYPPSSVLHLSNIPLSFKEEDLLTLFHDNGFQCSSLRIFQKDKKMALAKMTSLEDAISALISLHNWKLTDSSHLRVSFSKALI 2373
             + N+SKK K +      PS+VLHIR +     E+++  L +PFG + +++  K  NQA LE+     A  M  YY+   P    + + VQ+S H   ELK  NS N + +  A   ++  H    ++V   SS       +LRVV+ENL  Y ++   + ++F +FG VLRII+FTKN Q Q L++     SA  + + L+GQ+++N CC L+I FSK T +L ++  NDK RD+T   L                          PS    P ++ Q     +   + +   YT   + F   F   PV+ P + L        L    +   P+ A     AI +  S++LVSNLN E+V    +F LFGVYGDV +V I       ALV M  ++QA+ A  HLN   L G+ +   L     V       E + D  + K ++++PLHRFKKP SKN+ NI+PPS+ LHLSNIP S  E+DL  LF  +G    + + FQKD KMAL +M S+E+AI  LI LHN  L ++ HLRVSFSK+ I
Sbjct:   58 ANGNDSKKFKGDLRGPNVPSRVLHIRKLPIDITETEVISLGLPFGDVTNLLMLKAKNQAFLEMNSEEAAQNMVGYYSTVMPIIRQQPVFVQFSNHK--ELKTDNSPNQERAQAALRALSSSHVDTAALVVAPSS-------VLRVVVENLL-YPVSLDALCQIFSKFGTVLRIIVFTKNNQFQALLQYAEGASAQAAKVSLDGQNIYNGCCTLRISFSKLT-TLNVKYNNDKSRDFTRPDL--------------------------PSGDGQPTMEHQAMATAFGPGIISASPYTGATHAFPPAFALQPVSSPYAGLTMSGLPGTLASLTL---PAGARLGFPAIPAGHSVVLVSNLNAERVTPHCLFILFGVYGDVMRVKILFNKKENALVQMSDSTQAQLAMSHLNGQRLHGRPLRITLSKHTSVQ---LPREGHEDQGLTKDYSSSPLHRFKKPGSKNYSNIFPPSATLHLSNIPPSVVEDDLKMLFSSSGAVVKAFKFFQKDHKMALIQMGSVEEAIECLIQLHNHDLGENHHLRVSFSKSSI 562          
BLAST of Polypyrimidine tract-binding protein 1 vs. Planmine SMEST
Match: SMESG000033951.1 (SMESG000033951.1)

HSP 1 Score: 1283.09 bits (3319), Expect = 0.000e+0
Identity = 642/642 (100.00%), Postives = 642/642 (100.00%), Query Frame = 1
Query:  448 MTFPQFDPRFXXXXXXXXXXXXXXXXGSFTDPVHCGVLNSLANNQQAMLDAQSLMVFPYFLNFPCNMPYTNPHFISNGQNTISGVKRSIQNFNSNSLLGSSYSIDVDSNESKKSKLEPSTNTEPSKVLHIRNIASRAQESDLSLLAVPFGKIRSMVYAKKTNQALLELEKASEATRMFDYYTRYPPCFNGREMIVQYSKHVSLELKLKNSNIDASVDAANKMNEKHRSIVDEWSSENKSDRRILRVVIENLKNYNINHLVILKVFQRFGKVLRIIIFTKNMQCQCLVELDNSISAHVSLLHLNGQDLFNDCCRLKIEFSKNTDSLQIQRQNDKCRDYTVSPLQEDEQFSLHFLDWQAKSVSTVPPQQYPSLSTVPLLQTQVQKPLYSDFLPNNLFYTVMPNVFKSTFQPSPVAIPESLLISDCAINPLYQEPIVKPPSSANAIDSSIILVSNLNYEKVNTDSIFTLFGVYGDVSKVCISPPSVGAALVYMQTNSQAETACRHLNLVPLFGKIISTYLLPGEIVAQSIFNTELNSDIEVKHFTNTPLHRFKKPNSKNHFNIYPPSSVLHLSNIPLSFKEEDLLTLFHDNGFQCSSLRIFQKDKKMALAKMTSLEDAISALISLHNWKLTDSSHLRVSFSKALI 2373
            MTFPQFDPRFSDISSLISLVSSASVDGSFTDPVHCGVLNSLANNQQAMLDAQSLMVFPYFLNFPCNMPYTNPHFISNGQNTISGVKRSIQNFNSNSLLGSSYSIDVDSNESKKSKLEPSTNTEPSKVLHIRNIASRAQESDLSLLAVPFGKIRSMVYAKKTNQALLELEKASEATRMFDYYTRYPPCFNGREMIVQYSKHVSLELKLKNSNIDASVDAANKMNEKHRSIVDEWSSENKSDRRILRVVIENLKNYNINHLVILKVFQRFGKVLRIIIFTKNMQCQCLVELDNSISAHVSLLHLNGQDLFNDCCRLKIEFSKNTDSLQIQRQNDKCRDYTVSPLQEDEQFSLHFLDWQAKSVSTVPPQQYPSLSTVPLLQTQVQKPLYSDFLPNNLFYTVMPNVFKSTFQPSPVAIPESLLISDCAINPLYQEPIVKPPSSANAIDSSIILVSNLNYEKVNTDSIFTLFGVYGDVSKVCISPPSVGAALVYMQTNSQAETACRHLNLVPLFGKIISTYLLPGEIVAQSIFNTELNSDIEVKHFTNTPLHRFKKPNSKNHFNIYPPSSVLHLSNIPLSFKEEDLLTLFHDNGFQCSSLRIFQKDKKMALAKMTSLEDAISALISLHNWKLTDSSHLRVSFSKALI
Sbjct:    1 MTFPQFDPRFSDISSLISLVSSASVDGSFTDPVHCGVLNSLANNQQAMLDAQSLMVFPYFLNFPCNMPYTNPHFISNGQNTISGVKRSIQNFNSNSLLGSSYSIDVDSNESKKSKLEPSTNTEPSKVLHIRNIASRAQESDLSLLAVPFGKIRSMVYAKKTNQALLELEKASEATRMFDYYTRYPPCFNGREMIVQYSKHVSLELKLKNSNIDASVDAANKMNEKHRSIVDEWSSENKSDRRILRVVIENLKNYNINHLVILKVFQRFGKVLRIIIFTKNMQCQCLVELDNSISAHVSLLHLNGQDLFNDCCRLKIEFSKNTDSLQIQRQNDKCRDYTVSPLQEDEQFSLHFLDWQAKSVSTVPPQQYPSLSTVPLLQTQVQKPLYSDFLPNNLFYTVMPNVFKSTFQPSPVAIPESLLISDCAINPLYQEPIVKPPSSANAIDSSIILVSNLNYEKVNTDSIFTLFGVYGDVSKVCISPPSVGAALVYMQTNSQAETACRHLNLVPLFGKIISTYLLPGEIVAQSIFNTELNSDIEVKHFTNTPLHRFKKPNSKNHFNIYPPSSVLHLSNIPLSFKEEDLLTLFHDNGFQCSSLRIFQKDKKMALAKMTSLEDAISALISLHNWKLTDSSHLRVSFSKALI 642          
BLAST of Polypyrimidine tract-binding protein 1 vs. Planmine SMEST
Match: SMESG000033951.1 (SMESG000033951.1)

HSP 1 Score: 1273.84 bits (3295), Expect = 0.000e+0
Identity = 640/642 (99.69%), Postives = 640/642 (99.69%), Query Frame = 1
Query:  448 MTFPQFDPRFXXXXXXXXXXXXXXXXGSFTDPVHCGVLNSLANNQQAMLDAQSLMVFPYFLNFPCNMPYTNPHFISNGQNTISGVKRSIQNFNSNSLLGSSYSIDVDSNESKKSKLEPSTNTEPSKVLHIRNIASRAQESDLSLLAVPFGKIRSMVYAKKTNQALLELEKASEATRMFDYYTRYPPCFNGREMIVQYSKHVSLELKLKNSNIDASVDAANKMNEKHRSIVDEWSSENKSDRRILRVVIENLKNYNINHLVILKVFQRFGKVLRIIIFTKNMQCQCLVELDNSISAHVSLLHLNGQDLFNDCCRLKIEFSKNTDSLQIQRQNDKCRDYTVSPLQEDEQFSLHFLDWQAKSVSTVPPQQYPSLSTVPLLQTQVQKPLYSDFLPNNLFYTVMPNVFKSTFQPSPVAIPESLLISDCAINPLYQEPIVKPPSSANAIDSSIILVSNLNYEKVNTDSIFTLFGVYGDVSKVCISPPSVGAALVYMQTNSQAETACRHLNLVPLFGKIISTYLLPGEIVAQSIFNTELNSDIEVKHFTNTPLHRFKKPNSKNHFNIYPPSSVLHLSNIPLSFKEEDLLTLFHDNGFQCSSLRIFQKDKKMALAKMTSLEDAISALISLHNWKLTDSSHLRVSFSKALI 2373
            MTFPQFDPRFSDISSLISLVSSASVDGSFTDPVHCGVLNSLANNQQAMLDAQSLMVFPYFLNFPCNMPYTNPHFISNGQNTISG  RSIQNFNSNSLLGSSYSIDVDSNESKKSKLEPSTNTEPSKVLHIRNIASRAQESDLSLLAVPFGKIRSMVYAKKTNQALLELEKASEATRMFDYYTRYPPCFNGREMIVQYSKHVSLELKLKNSNIDASVDAANKMNEKHRSIVDEWSSENKSDRRILRVVIENLKNYNINHLVILKVFQRFGKVLRIIIFTKNMQCQCLVELDNSISAHVSLLHLNGQDLFNDCCRLKIEFSKNTDSLQIQRQNDKCRDYTVSPLQEDEQFSLHFLDWQAKSVSTVPPQQYPSLSTVPLLQTQVQKPLYSDFLPNNLFYTVMPNVFKSTFQPSPVAIPESLLISDCAINPLYQEPIVKPPSSANAIDSSIILVSNLNYEKVNTDSIFTLFGVYGDVSKVCISPPSVGAALVYMQTNSQAETACRHLNLVPLFGKIISTYLLPGEIVAQSIFNTELNSDIEVKHFTNTPLHRFKKPNSKNHFNIYPPSSVLHLSNIPLSFKEEDLLTLFHDNGFQCSSLRIFQKDKKMALAKMTSLEDAISALISLHNWKLTDSSHLRVSFSKALI
Sbjct:    1 MTFPQFDPRFSDISSLISLVSSASVDGSFTDPVHCGVLNSLANNQQAMLDAQSLMVFPYFLNFPCNMPYTNPHFISNGQNTISG--RSIQNFNSNSLLGSSYSIDVDSNESKKSKLEPSTNTEPSKVLHIRNIASRAQESDLSLLAVPFGKIRSMVYAKKTNQALLELEKASEATRMFDYYTRYPPCFNGREMIVQYSKHVSLELKLKNSNIDASVDAANKMNEKHRSIVDEWSSENKSDRRILRVVIENLKNYNINHLVILKVFQRFGKVLRIIIFTKNMQCQCLVELDNSISAHVSLLHLNGQDLFNDCCRLKIEFSKNTDSLQIQRQNDKCRDYTVSPLQEDEQFSLHFLDWQAKSVSTVPPQQYPSLSTVPLLQTQVQKPLYSDFLPNNLFYTVMPNVFKSTFQPSPVAIPESLLISDCAINPLYQEPIVKPPSSANAIDSSIILVSNLNYEKVNTDSIFTLFGVYGDVSKVCISPPSVGAALVYMQTNSQAETACRHLNLVPLFGKIISTYLLPGEIVAQSIFNTELNSDIEVKHFTNTPLHRFKKPNSKNHFNIYPPSSVLHLSNIPLSFKEEDLLTLFHDNGFQCSSLRIFQKDKKMALAKMTSLEDAISALISLHNWKLTDSSHLRVSFSKALI 640          
BLAST of Polypyrimidine tract-binding protein 1 vs. Planmine SMEST
Match: SMESG000018057.1 (SMESG000018057.1)

HSP 1 Score: 364.77 bits (935), Expect = 3.173e-116
Identity = 208/540 (38.52%), Postives = 313/540 (57.96%), Query Frame = 1
Query:  772 NESKKSKLEPSTNTEPSKVLHIRNIASRAQESDLSLLAVPFGKIRSMVYAKKTNQALLELEKASEATRMFDYYTRYPPCFNGREMIVQYSKHVSLELKLKNSNIDASVDAANKMNEKHRSIVDEWSSENKSDRRILRVVIENLKNYNINHLVILKVFQRFGKVLRIIIFTKNMQCQCLVELDNSISAHVSLLHLNGQDLFNDCCRLKIEFSKNTDSLQIQRQNDKCRDYTVSPLQEDE-------QFSL-HFLDWQAKSVSTVPPQQYPSLSTVPLLQTQVQKPLYSDFLPNNLFYTVMPNVFKSTFQPSPVAIPESLLISDCAINPLYQEPIVKPPSSANAIDSSIILVSNLNYEKVNTDSIFTLFGVYGDVSKVCISPPSVGAALVYMQTNSQAETACRHLNLVPLFGKIISTYLLPGEIVAQSIFNTELNSDIEVKHFTNTPLHRFKKPNSKNHFNIYPPSSVLHLSNIPLSFKEEDLLTLFHDNGFQCSSLRIFQKDKKMALAKMTSLEDAISALISLHNWKLTDSSHLRVSFSKA 2367
            N  KK K+E   + +PS+V+HIRN+     ++ +++LAVPFG I ++V+ +K NQAL+++ + +EA  M DY+ +Y P   G+ + +Q+SKH  L+L+  NSNID  V +AN   EK +  +  W++       ILR++I+N  N  INHLV  K+F RFG+++RI+ FTKN Q   LVE  +++S+HV+ L LNG +L  DC  ++I+FSKN   LQ+QRQ+DK RDY  SPL   E       Q+S   F   ++ S++    QQ+ S  T  L     Q  +  +  P             +               S+ + N ++       P+S     +S++LV+NLN EK N D++FTLFGVYGDV +V +       ALV    + QA TA R+L+   L+GK +  ++    ++   +   + N  +  K ++N+ LHRFKKPNSKN+ NI+PPS+V+HLSNIP +  E DL  +    G++    +    DKKMAL ++ S+EDAI  LI  HN KL++ +HLR+SFSKA
Sbjct:   11 NSHKKVKMEQGIDEKPSRVIHIRNVPQEVDDTSVAMLAVPFGYIDNIVFVRKNNQALIQMRELNEAIEMADYFNQYVPLMYGKHLFIQFSKHQQLDLRNNNSNIDKLVQSAN---EKRKHYLINWANNTGGASEILRILIDNAPNLIINHLVFYKIFSRFGQIIRIVSFTKNNQHHGLVEFASTLSSHVAQLQLNGANLLGDCGTMRIDFSKNPGPLQVQRQSDKVRDYMESPLNRTELQELEGPQYSFPLFAVGRSMSMARGNDQQFMSNITAQLSAMASQTGV--ELTPAAAMAAASLMAACNQMNHRTADQSNWGFGSNQSQNAMFN------PNSGIENGNSVVLVTNLNAEKSNPDALFTLFGVYGDVMRVKVMFNKKNTALVQFANHQQAMTAIRNLDACFLWGKQMHLHVSKTNVIQLPM--EDANHGL-TKDYSNSTLHRFKKPNSKNYQNIFPPSAVVHLSNIPPTTSEGDLSDMIRIAGYEVKKFKFLPNDKKMALLELNSVEDAIHVLIEFHNRKLSEKNHLRISFSKA 536          
BLAST of Polypyrimidine tract-binding protein 1 vs. Planmine SMEST
Match: SMESG000018057.1 (SMESG000018057.1)

HSP 1 Score: 362.459 bits (929), Expect = 4.563e-115
Identity = 207/541 (38.26%), Postives = 313/541 (57.86%), Query Frame = 1
Query:  772 NESKKSKLEPSTNTEPSKVLHIRNIASRAQESDLSLLAVPFGKIRSMVYAKKTNQALLELEKASEATRMFDYYTRYPPCFNGREMIVQYSKHVSLELKLKNSNIDASVDAANKMNEKHRSIVDEWSSENKSDRRILRVVIENLKNYNINHLVILKVFQRFGKVLRIIIFTKNMQCQCLVELDNSISAHVSLLHLNGQDLFNDCCRLKIEFSKNTDSLQIQRQNDKCRDYTVSPLQEDE-------QFSL-HFLDWQAKSVSTVPPQQYPSLSTVPLL-QTQVQKPLYSDFLPNNLFYTVMPNVFKSTFQPSPVAIPESLLISDCAINPLYQEPIVKPPSSANAIDSSIILVSNLNYEKVNTDSIFTLFGVYGDVSKVCISPPSVGAALVYMQTNSQAETACRHLNLVPLFGKIISTYLLPGEIVAQSIFNTELNSDIEVKHFTNTPLHRFKKPNSKNHFNIYPPSSVLHLSNIPLSFKEEDLLTLFHDNGFQCSSLRIFQKDKKMALAKMTSLEDAISALISLHNWKLTDSSHLRVSFSKA 2367
            N  KK K+E   + +PS+V+HIRN+     ++ +++LAVPFG I ++V+ +K NQAL+++ + +EA  M DY+ +Y P   G+ + +Q+SKH  L+L+  NSNID  V +AN   EK +  +  W++       ILR++I+N  N  INHLV  K+F RFG+++RI+ FTKN Q   LVE  +++S+HV+ L LNG +L  DC  ++I+FSKN   LQ+QRQ+DK RDY  SPL   E       Q+S   F   ++ S++    QQ+ +     +  QT V      +  P             +               S+ + N ++       P+S     +S++LV+NLN EK N D++FTLFGVYGDV +V +       ALV    + QA TA R+L+   L+GK +  ++    ++   +   + N  +  K ++N+ LHRFKKPNSKN+ NI+PPS+V+HLSNIP +  E DL  +    G++    +    DKKMAL ++ S+EDAI  LI  HN KL++ +HLR+SFSKA
Sbjct:   32 NSHKKVKMEQGIDEKPSRVIHIRNVPQEVDDTSVAMLAVPFGYIDNIVFVRKNNQALIQMRELNEAIEMADYFNQYVPLMYGKHLFIQFSKHQQLDLRNNNSNIDKLVQSAN---EKRKHYLINWANNTGGASEILRILIDNAPNLIINHLVFYKIFSRFGQIIRIVSFTKNNQHHGLVEFASTLSSHVAQLQLNGANLLGDCGTMRIDFSKNPGPLQVQRQSDKVRDYMESPLNRTELQELEGPQYSFPLFAVGRSMSMARGNDQQFMTAQLSAMASQTGV------ELTPAAAMAAASLMAACNQMNHRTADQSNWGFGSNQSQNAMFN------PNSGIENGNSVVLVTNLNAEKSNPDALFTLFGVYGDVMRVKVMFNKKNTALVQFANHQQAMTAIRNLDACFLWGKQMHLHVSKTNVIQLPM--EDANHGL-TKDYSNSTLHRFKKPNSKNYQNIFPPSAVVHLSNIPPTTSEGDLSDMIRIAGYEVKKFKFLPNDKKMALLELNSVEDAIHVLIEFHNRKLSEKNHLRISFSKA 554          
BLAST of Polypyrimidine tract-binding protein 1 vs. Planmine SMEST
Match: SMESG000018057.1 (SMESG000018057.1)

HSP 1 Score: 362.073 bits (928), Expect = 6.605e-115
Identity = 207/541 (38.26%), Postives = 313/541 (57.86%), Query Frame = 1
Query:  772 NESKKSKLEPSTNTEPSKVLHIRNIASRAQESDLSLLAVPFGKIRSMVYAKKTNQALLELEKASEATRMFDYYTRYPPCFNGREMIVQYSKHVSLELKLKNSNIDASVDAANKMNEKHRSIVDEWSSENKSDRRILRVVIENLKNYNINHLVILKVFQRFGKVLRIIIFTKNMQCQCLVELDNSISAHVSLLHLNGQDLFNDCCRLKIEFSKNTDSLQIQRQNDKCRDYTVSPLQEDE-------QFSL-HFLDWQAKSVSTVPPQQYPSLSTVPLL-QTQVQKPLYSDFLPNNLFYTVMPNVFKSTFQPSPVAIPESLLISDCAINPLYQEPIVKPPSSANAIDSSIILVSNLNYEKVNTDSIFTLFGVYGDVSKVCISPPSVGAALVYMQTNSQAETACRHLNLVPLFGKIISTYLLPGEIVAQSIFNTELNSDIEVKHFTNTPLHRFKKPNSKNHFNIYPPSSVLHLSNIPLSFKEEDLLTLFHDNGFQCSSLRIFQKDKKMALAKMTSLEDAISALISLHNWKLTDSSHLRVSFSKA 2367
            N  KK K+E   + +PS+V+HIRN+     ++ +++LAVPFG I ++V+ +K NQAL+++ + +EA  M DY+ +Y P   G+ + +Q+SKH  L+L+  NSNID  V +AN   EK +  +  W++       ILR++I+N  N  INHLV  K+F RFG+++RI+ FTKN Q   LVE  +++S+HV+ L LNG +L  DC  ++I+FSKN   LQ+QRQ+DK RDY  SPL   E       Q+S   F   ++ S++    QQ+ +     +  QT V      +  P             +               S+ + N ++       P+S     +S++LV+NLN EK N D++FTLFGVYGDV +V +       ALV    + QA TA R+L+   L+GK +  ++    ++   +   + N  +  K ++N+ LHRFKKPNSKN+ NI+PPS+V+HLSNIP +  E DL  +    G++    +    DKKMAL ++ S+EDAI  LI  HN KL++ +HLR+SFSKA
Sbjct:   37 NSHKKVKMEQGIDEKPSRVIHIRNVPQEVDDTSVAMLAVPFGYIDNIVFVRKNNQALIQMRELNEAIEMADYFNQYVPLMYGKHLFIQFSKHQQLDLRNNNSNIDKLVQSAN---EKRKHYLINWANNTGGASEILRILIDNAPNLIINHLVFYKIFSRFGQIIRIVSFTKNNQHHGLVEFASTLSSHVAQLQLNGANLLGDCGTMRIDFSKNPGPLQVQRQSDKVRDYMESPLNRTELQELEGPQYSFPLFAVGRSMSMARGNDQQFMTAQLSAMASQTGV------ELTPAAAMAAASLMAACNQMNHRTADQSNWGFGSNQSQNAMFN------PNSGIENGNSVVLVTNLNAEKSNPDALFTLFGVYGDVMRVKVMFNKKNTALVQFANHQQAMTAIRNLDACFLWGKQMHLHVSKTNVIQLPM--EDANHGL-TKDYSNSTLHRFKKPNSKNYQNIFPPSAVVHLSNIPPTTSEGDLSDMIRIAGYEVKKFKFLPNDKKMALLELNSVEDAIHVLIEFHNRKLSEKNHLRISFSKA 559          
The following BLAST results are available for this feature:
BLAST of Polypyrimidine tract-binding protein 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PTBP22.837e-9736.03polypyrimidine tract binding protein 2 [Source:HGN... [more]
PTBP22.544e-9636.03polypyrimidine tract binding protein 2 [Source:HGN... [more]
PTBP23.025e-9536.03polypyrimidine tract binding protein 2 [Source:HGN... [more]
PTBP22.880e-9436.03polypyrimidine tract binding protein 2 [Source:HGN... [more]
PTBP36.302e-8634.49polypyrimidine tract binding protein 3 [Source:HGN... [more]
back to top
BLAST of Polypyrimidine tract-binding protein 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ptb-11.341e-4142.86PTB (HnRNP) homolog; Putative RNA-binding protein ... [more]
ptb-11.341e-4142.86PTB (HnRNP) homolog; Putative RNA-binding protein ... [more]
ptb-11.349e-4042.86PTB (HnRNP) homolog; Putative RNA-binding protein ... [more]
hrpl-12.598e-1823.06Heterogeneous nuclear RibonucleoProtein (HnRNP) L ... [more]
hrpl-15.494e-1821.69Heterogeneous nuclear RibonucleoProtein (HnRNP) L ... [more]
back to top
BLAST of Polypyrimidine tract-binding protein 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
heph3.647e-8432.68gene:FBgn0011224 transcript:FBtr0346192[more]
heph5.017e-8434.38gene:FBgn0011224 transcript:FBtr0112865[more]
heph9.881e-8434.38gene:FBgn0011224 transcript:FBtr0300268[more]
heph9.881e-8434.38gene:FBgn0011224 transcript:FBtr0300269[more]
heph9.881e-8434.38gene:FBgn0011224 transcript:FBtr0300267[more]
back to top
BLAST of Polypyrimidine tract-binding protein 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ptbp2b2.817e-9236.14polypyrimidine tract binding protein 2b [Source:ZF... [more]
ptbp34.173e-9135.38polypyrimidine tract binding protein 3 [Source:ZFI... [more]
ptbp34.173e-9135.38polypyrimidine tract binding protein 3 [Source:ZFI... [more]
ptbp31.807e-9035.40polypyrimidine tract binding protein 3 [Source:ZFI... [more]
ptbp1b3.577e-8935.78polypyrimidine tract binding protein 1b [Source:ZF... [more]
back to top
BLAST of Polypyrimidine tract-binding protein 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ptbp11.394e-8636.07polypyrimidine tract binding protein 1 [Source:NCB... [more]
taco11.737e-8636.26translational activator of mitochondrially encoded... [more]
taco11.919e-8636.13translational activator of mitochondrially encoded... [more]
taco12.938e-8636.26translational activator of mitochondrially encoded... [more]
taco14.702e-8636.50translational activator of mitochondrially encoded... [more]
back to top
BLAST of Polypyrimidine tract-binding protein 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ptbp21.859e-9736.03polypyrimidine tract binding protein 2 [Source:MGI... [more]
Ptbp22.772e-9536.03polypyrimidine tract binding protein 2 [Source:MGI... [more]
Ptbp32.265e-8534.60polypyrimidine tract binding protein 3 [Source:MGI... [more]
Ptbp32.406e-8534.76polypyrimidine tract binding protein 3 [Source:MGI... [more]
Ptbp36.139e-8535.04polypyrimidine tract binding protein 3 [Source:MGI... [more]
back to top
BLAST of Polypyrimidine tract-binding protein 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q66H20|PTBP2_RAT1.939e-9436.03Polypyrimidine tract-binding protein 2 OS=Rattus n... [more]
sp|Q91Z31|PTBP2_MOUSE1.939e-9436.03Polypyrimidine tract-binding protein 2 OS=Mus musc... [more]
sp|Q9UKA9|PTBP2_HUMAN1.383e-9336.03Polypyrimidine tract-binding protein 2 OS=Homo sap... [more]
sp|Q29099|PTBP1_PIG2.077e-8535.71Polypyrimidine tract-binding protein 1 OS=Sus scro... [more]
sp|O95758|PTBP3_HUMAN3.026e-8534.49Polypyrimidine tract-binding protein 3 OS=Homo sap... [more]
back to top
BLAST of Polypyrimidine tract-binding protein 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3Q0KMW91.650e-10937.24Polypyrimidine tract binding protein, putative OS=... [more]
A0A183QYD01.962e-10937.16Uncharacterized protein OS=Schistosoma rodhaini OX... [more]
A0A267FSF73.833e-10539.38Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267E2T62.682e-10339.01Uncharacterized protein OS=Macrostomum lignano OX=... [more]
G4LZU32.069e-10136.05Polypyrimidine tract binding protein, putative OS=... [more]
back to top
BLAST of Polypyrimidine tract-binding protein 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ptbp2b2.436e-9135.79polypyrimidine tract-binding protein 2-like [Sourc... [more]
ptbp1b2.440e-8936.95polypyrimidine tract binding protein 1 [Source:NCB... [more]
ptbp1b4.272e-8936.95polypyrimidine tract binding protein 1 [Source:NCB... [more]
ptbp1b4.398e-8836.16polypyrimidine tract binding protein 1 [Source:NCB... [more]
ptbp34.231e-6532.45polypyrimidine tract binding protein 3 [Source:ZFI... [more]
back to top
BLAST of Polypyrimidine tract-binding protein 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000006507.11.961e-3533.46pep scaffold:Pmarinus_7.0:GL480554:3468:10153:1 ge... [more]
HNRNPLL7.916e-2924.74heterogeneous nuclear ribonucleoprotein L like [So... [more]
ENSPMAT00000008413.19.147e-2844.83pep scaffold:Pmarinus_7.0:GL478562:177533:180128:-... [more]
ENSPMAT00000006509.12.051e-2433.50pep scaffold:Pmarinus_7.0:GL480554:3489:6552:1 gen... [more]
HNRNPLL3.108e-1227.35heterogeneous nuclear ribonucleoprotein L like [So... [more]
back to top
BLAST of Polypyrimidine tract-binding protein 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Polypyrimidine tract-binding protein 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO439952.944e-4345.37Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO262327.329e-3144.97Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO355374.670e-2433.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO391195.126e-1226.24Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO355361.820e-725.13Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Polypyrimidine tract-binding protein 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ptbp11.573e-8735.73polypyrimidine tract binding protein 1 [Source:NCB... [more]
ptbp13.002e-8736.31polypyrimidine tract binding protein 1 [Source:NCB... [more]
PTBP22.111e-8633.86polypyrimidine tract binding protein 2 [Source:NCB... [more]
ENSORLT00000042697.14.466e-8636.50polypyrimidine tract-binding protein 1 [Source:NCB... [more]
ENSORLT00000036879.12.338e-8536.50polypyrimidine tract-binding protein 1 [Source:NCB... [more]
back to top
BLAST of Polypyrimidine tract-binding protein 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000033951.10.000e+0100.00SMESG000033951.1[more]
SMESG000033951.10.000e+099.69SMESG000033951.1[more]
SMESG000018057.13.173e-11638.52SMESG000018057.1[more]
SMESG000018057.14.563e-11538.26SMESG000018057.1[more]
SMESG000018057.16.605e-11538.26SMESG000018057.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30009115 ID=SMED30009115|Name=Polypyrimidine tract-binding protein 1|organism=Schmidtea mediterranea sexual|type=transcript|length=2583bp
CTAGAAATAGTTAATATGAATCTGTCATATTCTATCAAATACAATTGAGT
GTCACTAAAACAATCGTATTATTTGTGCAAATAGTACTCAAATTGTATAA
TTTAAATTTGTAATGATCAGTACCTATTTGTTATGAGTATGTCAACTTAA
ACGTGTTCACATCGAAATATTTACTCAGAAAGATACAGTGGCTCTGCATA
TTTTCAACATTTTCTCATAACTATCAATCCACTAACAAAATTGACACATC
TGAGCATAAACCAATAAACCTCGCTCCAGTTATCATTGATTAACTATAAA
AGAAGCAATTTGACAGTTCTCTTTACAAACTCAGTTGTGAAAGTATTAAA
ATTATTTACTAAATTTATGATTGGCATATTTTTCTCTCACTGTTGATAGC
AGCCGTACAAATTTTATTGTGTATAACTTTTTTTTCATCAAAAAAGAATG
ACTTTTCCGCAATTTGATCCAAGATTTTCCGATATCTCGTCACTAATAAG
TCTTGTATCGAGCGCGTCTGTCGATGGATCATTTACTGATCCGGTTCATT
GTGGAGTTTTAAATTCTCTCGCAAATAATCAACAGGCTATGCTTGATGCT
CAATCTTTGATGGTTTTTCCATATTTTTTAAATTTTCCTTGTAACATGCC
GTATACAAATCCTCATTTCATTTCCAATGGACAAAACACAATAAGTGGAG
TAAAGAGATCCATTCAAAACTTTAATTCAAACTCTTTGTTAGGCTCAAGT
TACAGCATTGATGTTGATTCAAATGAATCAAAAAAGTCGAAATTGGAGCC
TAGCACCAATACTGAACCGTCGAAAGTGCTCCATATTAGAAATATAGCAT
CAAGAGCACAGGAATCCGATCTTAGTTTGCTGGCAGTGCCATTTGGGAAA
ATTAGATCTATGGTTTATGCCAAGAAAACAAACCAGGCCTTATTGGAATT
AGAAAAAGCTTCTGAAGCTACAAGGATGTTTGATTATTACACTCGTTATC
CCCCTTGTTTTAATGGGCGAGAAATGATTGTTCAGTATTCTAAACATGTA
AGCCTTGAATTAAAATTGAAAAACAGCAATATTGATGCGTCAGTTGATGC
TGCTAACAAAATGAATGAAAAACATAGGTCTATAGTTGATGAATGGAGCT
CTGAAAATAAATCTGATAGAAGAATATTAAGAGTTGTCATTGAAAACTTG
AAAAATTACAATATTAACCACTTGGTAATTTTAAAGGTGTTCCAACGTTT
TGGAAAGGTTTTACGAATCATTATTTTTACAAAAAATATGCAATGCCAAT
GTTTGGTGGAACTAGACAATTCAATATCAGCTCATGTTTCCCTTTTACAC
CTCAATGGCCAGGATCTATTCAACGATTGTTGTCGTTTAAAAATTGAATT
TTCGAAAAACACCGACTCTCTTCAAATACAAAGACAAAACGACAAATGCC
GAGATTATACCGTTTCTCCTCTTCAAGAAGACGAACAGTTTTCTCTTCAT
TTTCTTGATTGGCAAGCCAAATCCGTCTCAACAGTTCCTCCACAACAATA
TCCATCATTGTCAACTGTTCCTTTATTGCAAACTCAAGTTCAAAAGCCTC
TTTATAGTGACTTTTTACCTAATAATTTATTTTATACTGTCATGCCAAAT
GTTTTCAAATCGACTTTTCAACCTTCACCAGTTGCCATTCCAGAATCTTT
GCTCATCTCCGATTGTGCAATAAATCCTTTGTATCAGGAACCAATTGTGA
AACCTCCTTCATCTGCCAATGCTATAGATTCATCTATTATTTTAGTATCA
AATTTGAATTATGAAAAGGTCAACACGGATTCCATTTTCACTCTTTTTGG
AGTTTATGGTGACGTGTCTAAAGTTTGTATATCCCCGCCATCTGTTGGAG
CAGCATTAGTATATATGCAAACGAATAGTCAAGCAGAAACTGCTTGTCGC
CATCTTAACTTAGTGCCTCTTTTTGGAAAAATAATTTCAACATATCTACT
TCCTGGGGAAATAGTTGCACAATCTATTTTCAACACTGAACTCAACTCAG
ACATTGAGGTTAAACATTTTACAAATACTCCACTGCACCGATTCAAAAAA
CCCAATTCCAAAAATCATTTTAACATTTATCCCCCAAGTTCTGTTCTTCA
TTTGAGCAATATTCCATTGTCCTTTAAAGAAGAGGATTTATTGACGCTTT
TCCATGATAACGGATTTCAATGTTCGAGCCTTAGAATTTTTCAGAAAGAT
AAAAAGATGGCATTAGCAAAAATGACATCTTTAGAAGATGCTATTTCAGC
TTTAATTTCACTGCATAATTGGAAATTGACAGACAGCTCACATCTCCGCG
TTAGTTTCAGCAAGGCCTTGATTTAAAGAAGAAGATTGGCAGTCGATTTA
CTACATTTTTCCGGATCTTCCCACACTGAAAACAATTCATTTTTTACTAT
GATAATTTGGAGTAGTGAATTTTCAGTTATTAAAAATTAATTTATGAATT
ACAAATGAGATTCATTATAATGATAATTAAATTTAGTAAATATTTTTATG
TACATTTTTTGAAAAAATTATAGAAATTTCGGA
back to top

protein sequence of SMED30009115-orf-1

>SMED30009115-orf-1 ID=SMED30009115-orf-1|Name=SMED30009115-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=643bp
MTFPQFDPRFSDISSLISLVSSASVDGSFTDPVHCGVLNSLANNQQAMLD
AQSLMVFPYFLNFPCNMPYTNPHFISNGQNTISGVKRSIQNFNSNSLLGS
SYSIDVDSNESKKSKLEPSTNTEPSKVLHIRNIASRAQESDLSLLAVPFG
KIRSMVYAKKTNQALLELEKASEATRMFDYYTRYPPCFNGREMIVQYSKH
VSLELKLKNSNIDASVDAANKMNEKHRSIVDEWSSENKSDRRILRVVIEN
LKNYNINHLVILKVFQRFGKVLRIIIFTKNMQCQCLVELDNSISAHVSLL
HLNGQDLFNDCCRLKIEFSKNTDSLQIQRQNDKCRDYTVSPLQEDEQFSL
HFLDWQAKSVSTVPPQQYPSLSTVPLLQTQVQKPLYSDFLPNNLFYTVMP
NVFKSTFQPSPVAIPESLLISDCAINPLYQEPIVKPPSSANAIDSSIILV
SNLNYEKVNTDSIFTLFGVYGDVSKVCISPPSVGAALVYMQTNSQAETAC
RHLNLVPLFGKIISTYLLPGEIVAQSIFNTELNSDIEVKHFTNTPLHRFK
KPNSKNHFNIYPPSSVLHLSNIPLSFKEEDLLTLFHDNGFQCSSLRIFQK
DKKMALAKMTSLEDAISALISLHNWKLTDSSHLRVSFSKALI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000043dorsal ventral margin of the whole animal
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR006536HnRNP-L/PTB
IPR035979RBD_domain_sf
IPR000504RRM_dom
IPR012677Nucleotide-bd_a/b_plait_sf
Vocabulary: molecular function
TermDefinition
GO:0003676nucleic acid binding
GO:0000166nucleotide binding
GO:0000014single-stranded DNA endodeoxyribonuclease activity
GO:0001069regulatory region RNA binding
GO:0003697single-stranded DNA binding
GO:0003723RNA binding
GO:0003729mRNA binding
GO:0043565sequence-specific DNA binding
Vocabulary: biological process
TermDefinition
GO:0000381regulation of alternative mRNA splicing, via spliceosome
GO:0000956nuclear-transcribed mRNA catabolic process
GO:0003231cardiac ventricle development
GO:0006259DNA metabolic process
GO:0006397mRNA processing
GO:0008380RNA splicing
GO:0010976positive regulation of neuron projection development
GO:0032024positive regulation of insulin secretion
GO:0045727positive regulation of translation
GO:0048025negative regulation of mRNA splicing, via spliceosome
GO:0051148negative regulation of muscle cell differentiation
GO:00709353'-UTR-mediated mRNA stabilization
GO:1904411positive regulation of secretory granule organization
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005737cytoplasm
GO:0044306neuron projection terminus
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000504RNA recognition motif domainSMARTSM00360rrm1_1coord: 245..315
e-value: 8.7E-5
score: 31.9
coord: 447..516
e-value: 2.7E-4
score: 30.3
coord: 566..636
e-value: 0.014
score: 23.1
coord: 127..196
e-value: 0.023
score: 21.2
IPR000504RNA recognition motif domainPROSITEPS50102RRMcoord: 446..513
score: 9.576
IPR000504RNA recognition motif domainPROSITEPS50102RRMcoord: 565..640
score: 9.303
IPR000504RNA recognition motif domainPROSITEPS50102RRMcoord: 244..321
score: 9.252
IPR012677Nucleotide-binding alpha-beta plait domain superfamilyGENE3DG3DSA:3.30.70.330coord: 241..347
e-value: 9.3E-25
score: 88.7
IPR012677Nucleotide-binding alpha-beta plait domain superfamilyGENE3DG3DSA:3.30.70.330coord: 442..555
e-value: 1.5E-15
score: 59.2
IPR012677Nucleotide-binding alpha-beta plait domain superfamilyGENE3DG3DSA:3.30.70.330coord: 556..640
e-value: 2.9E-17
score: 64.4
IPR012677Nucleotide-binding alpha-beta plait domain superfamilyGENE3DG3DSA:3.30.70.330coord: 108..230
e-value: 1.5E-20
score: 75.3
IPR006536HnRNP-L/PTBTIGRFAMTIGR01649TIGR01649coord: 124..640
e-value: 9.3E-113
score: 375.7
NoneNo IPR availablePFAMPF13893RRM_5coord: 432..528
e-value: 1.6E-18
score: 66.5
coord: 246..331
e-value: 5.2E-7
score: 29.3
NoneNo IPR availablePANTHERPTHR15592MATRIN 3/NUCLEAR PROTEIN 220-RELATEDcoord: 109..640
NoneNo IPR availablePANTHERPTHR15592:SF27HEPHAESTUS, ISOFORM Ycoord: 109..640
NoneNo IPR availableCDDcd12425RRM4_PTBP1_likecoord: 566..640
e-value: 4.827E-28
score: 105.436
NoneNo IPR availableCDDcd12421RRM1_PTBP1_hnRNPL_likecoord: 127..200
e-value: 1.34359E-19
score: 81.0889
IPR035979RNA-binding domain superfamilySUPERFAMILYSSF54928RNA-binding domain, RBDcoord: 437..515
IPR035979RNA-binding domain superfamilySUPERFAMILYSSF54928RNA-binding domain, RBDcoord: 553..639
IPR035979RNA-binding domain superfamilySUPERFAMILYSSF54928RNA-binding domain, RBDcoord: 120..200
IPR035979RNA-binding domain superfamilySUPERFAMILYSSF54928RNA-binding domain, RBDcoord: 239..342