von Willebrand factor

Overview
Namevon Willebrand factor
Smed IDSMED30009111
Length (bp)5530
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of von Willebrand factor (SMED30009111) t-SNE clustered cells

Violin plots show distribution of expression levels for von Willebrand factor (SMED30009111) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of von Willebrand factor (SMED30009111) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for von Willebrand factor (SMED30009111) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30009111

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 30

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parapharyngeal regionSMED30009111h1SMcG0017756 SmedASXL_001338SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
parapharyngeal regionSMED30009111h1SMcG0017757 SmedASXL_001338SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
parapharyngeal regionSMED30009111h1SMcG0017755 SmedASXL_001338SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
Smed sexual biotypeSMED30009111h1SMcG0017752 Contig16935uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30009111h1SMcG0017752 Contig16935newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30009111h1SMcG0017757 Contig16935uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30009111h1SMcG0017757 Contig16935newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30009111h1SMcG0017755 Contig16935uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30009111h1SMcG0017755 Contig16935newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30009111h1SMcG0017756 Contig16935uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30009111h1SMcG0017756 Contig16935newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30009111h1SMcG0017754 Contig16935uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30009111h1SMcG0017754 Contig16935newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
parapharyngeal regionSMED30009111h1SMcG0017755 dd_Smed_v6_17988_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
parapharyngeal regionSMED30009111h1SMcG0017756 dd_Smed_v6_17988_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
parapharyngeal regionSMED30009111h1SMcG0017757 dd_Smed_v6_17988_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30009111h1SMcG0017757 OX_Smed_1.0.11885ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
head regionSMED30009111h1SMcG0017755 OX_Smed_1.0.11885ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
head regionSMED30009111h1SMcG0017756 OX_Smed_1.0.11885ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
head regionSMED30009111h1SMcG0017757 OX_Smed_1.0.12256ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
reproductive organSMED30009111h1SMcG0017752 Contig16935uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30009111h1SMcG0017752 Contig16935newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30009111h1SMcG0017757 Contig16935uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30009111h1SMcG0017757 Contig16935newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30009111h1SMcG0017755 Contig16935uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30009111h1SMcG0017755 Contig16935newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30009111h1SMcG0017756 Contig16935uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30009111h1SMcG0017756 Contig16935newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30009111h1SMcG0017754 Contig16935uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30009111h1SMcG0017754 Contig16935newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of von Willebrand factor vs. Ensembl Human
Match: VWF (von Willebrand factor [Source:HGNC Symbol;Acc:HGNC:12726])

HSP 1 Score: 499.59 bits (1285), Expect = 3.751e-144
Identity = 353/1264 (27.93%), Postives = 557/1264 (44.07%), Query Frame = 2
Query:  443 STYYECSVIYGHHIKTFDGNVFSYPLRGGYTLFMDCLGAAPLFYVYFNASYDCFDQKTQNDCSISMKITVGTQTIILFPKNEFALVKNNKTKIPFNSEGIIVSSVGSFIKIKG-IDDLEILFDRDRNIYVYAPVTAEKKICGLCGYFNGIMSDDYRDFNQVIQKNVKTFVNSWIDRDPSDLNVYREREQYPCNALKLKNNDQYQKALTLCQDMVKNNLGRTCQSEVKIDKYLDMCQDEICECLQTQPENSTIENCYSTFCKIEEQYSYACTLKGIAVDWRSATTICKQPQCFNGQEFSECGSNCGKNCGQLGMELECESQCLPGCYCPRNRYWDGTMCVPQEKCPCVRDNGESTYQQGYRLKLNCETCICGMHGKWQCIENEECEGRCFISGDPHYITFDRRHFFFDGHCEYTAVMTTSDNVLLSNSTIAPLSITIQNTNCQDNSETGCPRTIGVIIGEDEDQVAINLLSSSEIKVNFVKISLPYQHTGNTKVLIDQVSTDILRLKSETGVEILWNGGSRIEIKLSKKYREKVTGMCGNFNGNEMDDSMTFKGVDEKDIDKFVLSWKTNPTCESDRGIVEYKGACALSRSYSDYANKVCHKLYESEEFKKCHSAANADKFFDQCTHDVCTCGMKRNGALDHCECEAFSSYARQCALENINLSWRTNELCPKKCPNENMKYNQCGSRCTSTCRLLQ--ESKCKEECIEGCFCPEGETFDEAAKECVKISDCKCEFHGRFYLPYEIRQDRCNNCTCTNGNWICTSNDCEG---------------------------KEFCPKSMAWFDCGICQKTCTNLDLVCPKGQCQLPGCFCPENTVLHNGECIKPFECPCYMNNKMYSENDTIVRGPANCQNPCICKDGKWVCEQNKQCSGICKTWGETHYESFDGKYFEFQGSCSYVISEDFCGNKLGTFKLISENIACGXXXXXCTKSIKFIYLNRVFQFVRGSNPIVSRNTNYPPGGPTAFYWTSDVDTHFILFTMEGIQVKWDKAMSLEIMIPEKYQNKVCGLCGNFDLRIDNDMRARSGEIEKDIVNFADSWKVHSSCPVPQKPPF-----MCSKRPDREPWAKAKCEILKSDSFKKCHDVVNVEHYYKRCVADACECDRGDDCVCFCTAVEQYVARCNEYEIGLKWRTNENCPHTCTGKRVWKNC------GNICPDSCIDIGKNVTDNTGCKKVCIEGC--FCPDG--LHWQNNECVERKACECVDPITNLKYNTGDKVI------RECEECNC 4081
            S+   CS+     + TFDG+++S+    GY  ++   G     +              QN   +S+ + +G    I    N      + +  +P+ S+G+ + +   + K+ G         D   N  V        K CGLCG FN    DD+      +  +   F NSW     S    + ER   P ++  + + +  +     CQ +   ++   C   V  + ++ +C+  +CEC                 C    +Y+  C  +G+ +   +  + C  P C  G E+ +C S C + C  L +   C+ +C+ GC CP  +  D  +CV   +CPCV       Y  G  L  +C TCIC  + +W C  NEEC G C ++G  H+ +FD R+F F G C+Y       D+           SI I+   C D+ +  C R++ V +    + + + L   + + ++   + LP        + I    T  +RL     +++ W+G  R+ +KLS  Y  K  G+CGN+NGN+ DD +T  G+ E  ++ F  +WK +  C+  +   ++   CAL+   + ++ + C  L  S  F+ CH A +   +   C +DVC+C   R      C C A +SYA  CA   + ++WR    C   CP   + Y QCG+ C  TCR L   + +C E C+EGCFCP G   DE   +CV  + C C + G  + P +I  D    C C +G   CT +   G                           K  CP      +   C KTC N DL C    C + GC CP   V H   C+    CPC+   K Y+  +T+  G     N C+C+D KW C  +  C   C T G  HY +FDG  + F G C YV+ +D+CG+  GTF+++  N  C   S  C K +  +      +   G       N   P    T F    +   + IL   + + V WD+ +S+ +++ + YQ KVCGLCGNFD   +ND+ + + ++E+D V+F +SWKV S C   +K P       C     ++    + C IL SD F+ C+ +V+ E Y   C+ D C C+   DC CFC  +  Y   C ++   + WRT   CP +C  + + +N        N C  +C  +     +   C   C+EGC   CP G  L      CV+ + C   + +   ++ +G KV         C+ C+C
Sbjct:   30 SSTARCSLFGSDFVNTFDGSMYSF---AGYCSYLLAGGCQKRSFSIIG--------DFQNGKRVSLSVYLGEFFDIHLFVNGTVTQGDQRVSMPYASKGLYLETEAGYYKLSGEAYGFVARIDGSGNFQVLLSDRYFNKTCGLCGNFNIFAEDDFMTQEGTLTSDPYDFANSWAL---SSGEQWCERASPPSSSCNISSGEMQKGLWEQCQLLKSTSVFARCHPLVDPEPFVALCEKTLCEC----------AGGLECACPALLEYARTCAQEGMVLYGWTDHSACS-PVCPAGMEYRQCVSPCARTCQSLHINEMCQERCVDGCSCPEGQLLDEGLCVESTECPCVHSG--KRYPPGTSLSRDCNTCIC-RNSQWIC-SNEECPGECLVTGQSHFKSFDNRYFTFSGICQYLLARDCQDHSF---------SIVIETVQCADDRDAVCTRSVTVRLPGLHNSL-VKLKHGAGVAMDGQDVQLPLL---KGDLRIQHTVTASVRLSYGEDLQMDWDGRGRLLVKLSPVYAGKTCGLCGNYNGNQGDDFLTPSGLAEPRVEDFGNAWKLHGDCQDLQK--QHSDPCALNPRMTRFSEEACAVL-TSPTFEACHRAVSPLPYLRNCRYDVCSCSDGRE-----CLCGALASYAAACAGRGVRVAWREPGRCELNCPKGQV-YLQCGTPCNLTCRSLSYPDEECNEACLEGCFCPPGLYMDERG-DCVPKAQCPCYYDGEIFQPEDIFSDHHTMCYCEDGFMHCTMSGVPGSLLPDAVLSSPLSHRSKRSLSCRPPMVKLVCPADNLRAEGLECTKTCQNYDLECMSMGC-VSGCLCPPGMVRHENRCVALERCPCFHQGKEYAPGETVKIG----CNTCVCQDRKWNC-TDHVCDATCSTIGMAHYLTFDGLKYLFPGECQYVLVQDYCGSNPGTFRILVGNKGCSHPSVKCKKRVTILVEGGEIELFDGE-----VNVKRPMKDETHFE-VVESGRYIILLLGKALSVVWDRHLSISVVLKQTYQEKVCGLCGNFDGIQNNDLTSSNLQVEEDPVDFGNSWKVSSQCADTRKVPLDSSPATCHNNIMKQTMVDSSCRILTSDVFQDCNKLVDPEPYLDVCIYDTCSCESIGDCACFCDTIAAYAHVCAQHGKVVTWRTATLCPQSCEERNLRENGYECEWRYNSCAPAC-QVTCQHPEPLACPVQCVEGCHAHCPPGKILDELLQTCVDPEDCPVCE-VAGRRFASGKKVTLNPSDPEHCQICHC 1227          

HSP 2 Score: 130.568 bits (327), Expect = 2.314e-29
Identity = 97/386 (25.13%), Postives = 171/386 (44.30%), Query Frame = 2
Query: 2984 ICKDGKWVCEQNKQCSGICKTWGETHYESFDGKYFEFQGSCSYVISEDFCGNKLGTFKLISENIACGXXXXXCTKSIKF-IYLNRVFQ---FVRGSNPIVSRNTNYPPGGPTAFYWTSDVDTHFILFTMEGIQVKWDKAMSLEIMIPEKYQNKVCGLCGNFDLRIDNDMRARSGEIEKDIVNFADSWKVHSS---CPVPQKPPFMC---SKRPDREPWAKAKCEILKSDS-FKKCHDVVNVEHYYKRCVADACECDRGDDCVCFCTAVEQYVARCNEYEIGL-KWRTNENCPHTCTGKRVWKNCGNICPDSCIDIGKNVTDNTGCKKVCIEGCFCPDGLHWQNNECVERKACECVDPITNLKYNTGDKVIRECEECNCYEGAFRCT 4105
            +C +G     + +  +  C  +G     +FDG  + F G CSY+++    G +  +F +I +            K +   +YL   F    FV G+     +  + P       Y  ++   + +     G   + D + + ++++ ++Y NK CGLCGNF++  ++D   + G +  D  +FA+SW + S    C     P   C   S    +  W +  C++LKS S F +CH +V+ E +   C    CEC  G +C C   A+ +Y   C +  + L  W  +  C   C     ++ C + C  +C    +++  N  C++ C++GC CP+G       CVE   C CV   +  +Y  G  + R+C  C C    + C+
Sbjct:   21 LCAEGT----RGRSSTARCSLFGSDFVNTFDGSMYSFAGYCSYLLAG---GCQKRSFSIIGD--------FQNGKRVSLSVYLGEFFDIHLFVNGTVTQGDQRVSMPYAS-KGLYLETEAGYYKLSGEAYGFVARIDGSGNFQVLLSDRYFNKTCGLCGNFNIFAEDDFMTQEGTLTSDPYDFANSWALSSGEQWCERASPPSSSCNISSGEMQKGLWEQ--CQLLKSTSVFARCHPLVDPEPFVALCEKTLCECAGGLECAC--PALLEYARTCAQEGMVLYGWTDHSACSPVCPAGMEYRQCVSPCARTC----QSLHINEMCQERCVDGCSCPEGQLLDEGLCVESTECPCVH--SGKRYPPGTSLSRDCNTCICRNSQWICS 380          

HSP 3 Score: 101.679 bits (252), Expect = 1.520e-20
Identity = 118/461 (25.60%), Postives = 178/461 (38.61%), Query Frame = 2
Query: 1601 CFISGDPHYITFDRRHFFFDGHCEYTAVMTTSDNVLLSNSTIAPLSITIQNTNCQDNSETGCPRTIGVIIGEDEDQVAINLLSSSEIKVNFVKISLPYQHTGNTKVLIDQVSTDILRLKSETGVEILWNGGSRIEIKLSKK-YREKVTGMCGNFNGNEMDDSMTFKGVDEKDIDKFVLSWKTNPTCESDRGIVEYKGACALSRSYSDYANKVCHKLYESEEFKKCHSAANADKFFDQCTHDVCTCGMKRNGALDHCE--CEAFSSYARQCALENINLSWRTNELCPKKCPNENMKYNQCGSRCTSTCRLLQESKCKEECIEGCFCPEGETF-------DEAAKECVKISDCKCEFHGRFYLPYEIRQDRCNNCTCTNGNWI-CTSNDCEGKEFCPKSMAWFDCGICQ--KTCTNLDLVCPKGQC----------QLPGCFCPENTVLHN-GECIKPFECPC 2911
            C  S   H +TFD ++F   G C Y         VL  N     L + + N  C   +  GC ++I V        +++ L S  E+ VN   +S+PY   GN +V +       +R      +       +  +++LS K +  K  G+CG  + N  +D M   G    D    V  W      ++ + I+E +  C +  S        C  L     F +CH       F+  C  D C           H E  CE  +SYA  C    + + WRT + C   CP  ++ YN C   C   C     S C +   EGCFCP  +         +EA  +C+     + +F   +   ++     C  CTC +G  + CT+        CP + A   CG+C+  +   N D  CP+ +C           +P C       L N GEC   F C C
Sbjct: 1950 CTGSSTRHIVTFDGQNFKLTGSCSY---------VLFQNKE-QDLEVILHNGACSPGARQGCMKSIEV----KHSALSVELHSDMEVTVNGRLVSVPYV-GGNMEVNVYGAIMHEVRFNHLGHIFTFTPQNNEFQLQLSPKTFASKTYGLCGICDENGANDFMLRDGTVTTDWKTLVQEWTVQRPGQTCQPILEEQ--CLVPDSSH------CQVLL-LPLFAECHKVLAPATFYAICQQDSC-----------HQEQVCEVIASYAHLCRTNGVCVDWRTPDFCAMSCP-PSLVYNHCEHGCPRHCD-GNVSSCGDHPSEGCFCPPDKVMLEGSCVPEEACTQCIGEDGVQHQFLEAWVPDHQ----PCQICTCLSGRKVNCTTQP------CPTAKAP-TCGLCEVARLRQNADQCCPEYECVCDPVSCDLPPVPHCERGLQPTLTNPGECRPNFTCAC 2362          

HSP 4 Score: 90.8929 bits (224), Expect = 2.446e-17
Identity = 92/371 (24.80%), Postives = 141/371 (38.01%), Query Frame = 2
Query: 3026 CSGICKTWGETHYESFDGKYFEFQGSCSYVISEDFCGNKLGTFKLISENIACGXXXXX-CTKSIKFIYLNRVFQF-------VRG---SNPIVSRNTNYPPGGPTAFYWTSDVDTHFILFTMEGIQVKWDKAMSLEIMIPEKYQNKVCGLCGNFDLRIDNDMRARSGEIEKDIVNFADSWKVHSSCPVPQKPPFMCSKRPDREPWA--KAKCEILKSDSFKKCHDVVNVEHYYKRCVADACECDRGDDCVCFCTAVEQYVARCNEYEIGLKWRTNENCPHTCTGKRVWKNCGNICPDSCIDIGKNVTDNTGCKKVCIEGCFCPDGLHWQNNECVERKAC-ECV--DPITNLKYNTGDKVIRECEECNCYEG 4090
            C  +C      H  +FDG+ F+  GSCSYV+ +    NK    ++I  N AC   +   C KSI+  +     +        V G   S P V  N      G        +   H   FT +  + +         + P+ + +K  GLCG  D    ND   R G +  D       W V       Q+P   C    + +      + C++L    F +CH V+    +Y  C  D+C  ++       C  +  Y   C    + + WRT + C  +C    V+ +C + CP  C     NV+    C     EGCFCP         CV  +AC +C+  D + +          + C+ C C  G
Sbjct: 1946 CPCVCTGSSTRHIVTFDGQNFKLTGSCSYVLFQ----NKEQDLEVILHNGACSPGARQGCMKSIEVKHSALSVELHSDMEVTVNGRLVSVPYVGGNMEVNVYGAIMHEVRFNHLGHIFTFTPQNNEFQLQ-------LSPKTFASKTYGLCGICDENGANDFMLRDGTVTTDWKTLVQEWTV-------QRPGQTCQPILEEQCLVPDSSHCQVLLLPLFAECHKVLAPATFYAICQQDSCHQEQ------VCEVIASYAHLCRTNGVCVDWRTPDFCAMSCPPSLVYNHCEHGCPRHC---DGNVSS---CGDHPSEGCFCPPDKVMLEGSCVPEEACTQCIGEDGVQHQFLEAWVPDHQPCQICTCLSG 2286          

HSP 5 Score: 56.225 bits (134), Expect = 8.054e-7
Identity = 73/351 (20.80%), Postives = 126/351 (35.90%), Query Frame = 2
Query:  476 HHIKTFDGNVFSYPLRGGYTLFMDCLGAAPLFYVYFNASYDCFDQKTQNDCSISMKITVGTQTIILFPKNEFALVKNNKTKIPFNSEGIIVSSVGSFIKIKGIDDLEILFDRDRNIYVY-----------APVTAEKKICGLCGYFNGIMSDDYRDFNQVIQKNVKTFVNSWIDRDPSDLNVYREREQYPCNALKLKNNDQYQKALTLCQDMVKNNLGRTCQSEVKIDKYLDMCQDEICECLQTQPENSTIENCYSTFCKIEEQYSYACTLKGIAVDWRSATTICKQPQCFNGQEFSECGSNCGKNCGQLGMELECESQCLPGCYCPRNRYWDGTMCVPQEKCP-CVRDNG 1492
             HI TFDG  F       Y LF +      L  +  N +        +  C  S+++     ++ L    E   V      +P+    + V+  G+ +        E+ F+   +I+ +           +P T   K  GLCG  +   ++D+   +  +  + KT V  W  + P         EQ       L  +  + + L L        L   C   +    +  +CQ + C   Q               C++   Y++ C   G+ VDWR+    C    C     ++ C   C ++C   G    C      GC+CP ++      CVP+E C  C+ ++G
Sbjct: 1956 RHIVTFDGQNFKLTGSCSYVLFQN--KEQDLEVILHNGA---CSPGARQGCMKSIEVKHSALSVELHSDMEVT-VNGRLVSVPYVGGNMEVNVYGAIMH-------EVRFNHLGHIFTFTPQNNEFQLQLSPKTFASKTYGLCGICDENGANDFMLRDGTVTTDWKTLVQEWTVQRPGQTCQPILEEQC------LVPDSSHCQVLLL-------PLFAECHKVLAPATFYAICQQDSCHQEQV--------------CEVIASYAHLCRTNGVCVDWRTP-DFCAM-SCPPSLVYNHCEHGCPRHCD--GNVSSCGDHPSEGCFCPPDKVMLEGSCVPEEACTQCIGEDG 2262          
BLAST of von Willebrand factor vs. Ensembl Human
Match: MUC5AC (mucin 5AC, oligomeric mucus/gel-forming [Source:HGNC Symbol;Acc:HGNC:7515])

HSP 1 Score: 490.73 bits (1262), Expect = 5.554e-141
Identity = 367/1280 (28.67%), Postives = 565/1280 (44.14%), Query Frame = 2
Query:  416 VTRVNNTMYSTYYECSVIYGHHIKTFDGNVFSYPLRGGYTLFMDCLGAAPLFYVYFNASYDCFDQKTQNDCSISM-KITVGTQTIILFPKNEFALVKNNKTKIPFNSEGIIVSSVGSFIKIKGIDDLEILFDRDRNIYVYAPVTAEKKICGLCGYFNGIMSDDYRDFNQVIQKNVKT----FVNSWIDRDPSDLNVYREREQYPCNALKLKNNDQYQKALTLCQDMVKNNLGRTCQSEVKIDKYLDMCQDEICECLQTQPENSTIENCYSTFCKIEEQYSYACT-LKGIAVDWRSATTICKQPQCFNGQEFSECGSNCGKNCGQLGMELECESQCLPGCYCPRNRYWDG---TMCVPQEKCPCVRDNGESTYQQGYRLKLNCETCICGMHGKWQCIENEECEGRCFISGDPHYITFDRRHFFFDGHCEYTAVMTTSDNVLLSNSTIAPLSITIQNTNCQDNSETGCPRTIGVIIGEDEDQVAINLLSSSEIKVNFVKISLPYQHTGNTKVLIDQVSTDILRLKSETGVEILWNGGSRIEI--KLSKKYREKVTGMCGNFNGNEMDDSMTFKGVDEKDIDKFVLSWKTNPTCESDRGIVEYKGACALSRSYSDYANKVCHKLYESE-EFKKCHSAANADKFFDQCTHDVCTCGMKRNGALDHCECEAFSSYARQCALENINLSWRTNELCPKK---CPNENMKYNQCGSRCTSTCRLLQESKCKEEC----IEGCFCPEGETFDEAAKECVKISDCKCEFHGRFYLPYEIRQDRCNNCTCTNGNWICTSNDCEGKEFCPKSMAWFDC---------GICQKTCTNLDLVCPKGQCQLPGCFCPENTVLHN-GECIKPFECPCYMNNKMYSENDTIVRGPANCQNPCICKDGKWVCEQNKQCSGICKTWGETHYESFDGKYFEFQGSCSYVISEDFCGNKLGT---FKLISENIACGXXXXXCTKSIKFIYLNRVFQFVRGSNPIVSRNTNYPPGGPTAFYWTSDVDTHFILFTMEGIQVKWDKAMSLEIMIPEKYQNKVCGLCGNFDLRIDNDMRARSGEIEKDIVNFADSWKVHSSCPVPQKPPFMCSKRPDREPWAKAKCEILKSDSFKKCHDVVNVEHYYKRCVADACECDRGDDCVCFCTAVEQYVARCNEYEIGLKWRTNENCPHTC-----TGKRVW--KNCGNICPDSCIDI-GKNVTDNTGCKKVCIEGCF--CPDG---LHWQNNECVERKACECVDP---ITNLKYNTGDKVI--RECEECNCYEGAFRCT 4105
            V R +N  ++    CS     H KTFDG+VF +P    Y +F +  GAA   Y  FN       +++Q   + ++ ++ +    +++       LV  +   +PF+  G+++    S+ K++    L ++++ D ++ +        K CGLCG FNG+        ++++  N K     F N     DP+D           C     +          +C++++   L   C + V +  YL+ C+ ++C C     E++ + +C    C    +YS  CT   G+  DWR     C Q +C N  ++ EC S C   C        CE  C+ GC+CP     D    T CVP  KC CV +   + Y  G     +C  C C   G+W C E   C G C + G  H+ TFD + +   G C Y         VL      +  ++  +   C       C ++  V +  D  Q  + + +S E+ +N +   LP        V I + ST  +  ++  G+++       +++  +L+ K R +  G+CGNFN  + DD  T  GV E     F  ++KT   C + R    ++  C+LS     YA   C +L +++  F +CH+A     ++  C  D C C    +     C C A SSY   CA + + L    + +C K    CP ++M Y+   S C  TCR L E           ++GC CP+G   D+  K CV+ S+C C   G      E   D    CTCT+G   C          C   M +FDC           CQK+C  LD+ C   QC +PGC CP+  V    G CI   +CPC  N   Y    TI  G   C N C C    W C  +  C   C  +G+ HY +FDG+ + F G C Y + ++ CG K  T   F++++EN+ CG++ ++C+K+IK        +   G   ++  + +         Y    +  + ++ T  G+ + WDK  S+ I +  +++ +VCGLCGNFD    ND   RS  +  D++ F +SWK+  SCP    P   C+  P R+ WA+ +C IL   +F  CH  V    YY+ CV DAC CD G DC CFCTAV  Y   C+E  + + WRT   CP  C      G+  W  + CG  C  +C +  G  + D  G     +EGC+  CP           +CV       + P   +    Y  G  V   + C+ C C E    CT
Sbjct:   68 VVRASNPAHNGRV-CSTWGSFHYKTFDGDVFRFPGLCNY-VFSEHCGAA---YEDFNIQL----RRSQESAAPTLSRVLMKVDGVVIQLTKGSVLVNGHPVLLPFSQSGVLIQQSSSYTKVEARLGLVLMWNHDDSLLLELDTKYANKTCGLCGDFNGMPV-----VSELLSHNTKLTPMEFGNLQKMDDPTDQ----------CQDPVPEPPRNCSTGFGICEELLHGQLFSGCVALVDVGSYLEACRQDLCFC-----EDTDLLSC---VCHTLAEYSRQCTHAGGLPQDWR-GPDFCPQ-KCPNNMQYHECRSPCADTCSNQEHSRACEDHCVAGCFCPEGTVLDDIGQTGCVPVSKCACVYNG--AAYAPGATYSTDCTNCTCS-GGRWSCQE-VPCPGTCSVLGGAHFSTFDGKQYTVHGDCSY---------VLTKPCDSSAFTVLAELRRCGLTDSETCLKS--VTLSLDGAQTVVVIKASGEVFLNQIYTQLPIS---AANVTIFRPSTFFIIAQTSLGLQLNLQLVPTMQLFMQLAPKLRGQTCGLCGNFNSIQADDFRTLSGVVEATAAAFFNTFKTQAACPNIRN--SFEDPCSLSVENEKYAQHWCSQLTDADGPFGRCHAAVKPGTYYSNCMFDTCNCERSED-----CLCAALSSYVHACAAKGVQLGGWRDGVCTKPMTTCP-KSMTYHYHVSTCQPTCRSLSEGDITCSVGFIPVDGCICPKGTFLDDTGK-CVQASNCPCYHRGSMIPNGESVHDSGAICTCTHGKLSCIGGQAPAP-VCAAPMVFFDCRNATPGDTGAGCQKSCHTLDMTCYSPQC-VPGCVCPDGLVADGEGGCITAEDCPCVHNEASYRAGQTIRVG---C-NTCTCDSRMWRCTDDP-CLATCAVYGDGHYLTFDGQSYSFNGDCEYTLVQNHCGGKDSTQDSFRVVTENVPCGTTGTTCSKAIKIFLGGFELKLSHGKVEVIGTDESQ-----EVPYTIRQMGIYLVVDTDIGLVLLWDKKTSIFINLSPEFKGRVCGLCGNFDDIAVNDFATRSRSVVGDVLEFGNSWKLSPSCPDALAPKDPCTANPFRKSWAQKQCSILHGPTFAACHAHVEPARYYEACVNDACACDSGGDCECFCTAVAAYAQACHEVGLCVSWRTPSICPLFCDYYNPEGQCEWHYQPCGVPCLRTCRNPRGDCLRDVRG-----LEGCYPKCPPEAPIFDEDKMQCVATCPTPPLPPRCHVHGKSYRPGAVVPSDKNCQSCLCTERGVECT 1269          

HSP 2 Score: 106.686 bits (265), Expect = 4.097e-22
Identity = 101/413 (24.46%), Postives = 153/413 (37.05%), Query Frame = 2
Query: 3008 CEQNKQCSGICKTWGETHYESFDGKYFEFQGSCSYVISEDFCGNKLGTFKLISENIACGXX-XXXCTKSIKFIYLNRVFQFVRG------SNPIVSRNTNYPPGGPTAFYWTSDVDTHFILFTME-GIQVKWDKAMSLEIMIP-EKYQNKVCGLCGNFDLRIDNDMRARSGEIEKDIVNFADSWKVH---------------------------------SSCPVPQKPPFMCSKRPDREPWAKAKCEILKSDSFKKCHDVVNVEHYYKRCVADACECDRGDDCVCFCTAVEQYVARCNEYEIGLKWR--TNENCPHTCTGKRVWKNCGNICPDSCIDIGKNVTDNTGCKKVCIEGCFCPDGLHWQNNE---CVERKACECVDPITNLKYNTGDKVIRECEECNCYEGAFRCT 4105
            C  + QC  +C  WG+ HY +FDG Y+ F  +C+YV+ +       G F+++ +N  CG+    SC +SI   Y        R       +N I+  N    PG        S +         E G+QV +   +   + +P  K+ N   G CG       ++ R   G +       +  W V                                  S+   P  PP  C   P         C+++ S  F+ CH V+    +Y+ CV D C      D    C+++E Y A C  ++I + WR  T   CP TC   +V++ CG   P  C                  EGCFCP+G+   +     CV      C+ P        G  V  +C+EC C    +  T
Sbjct: 4911 CCHHYQCQCVCSGWGDPHYITFDGTYYTFLDNCTYVLVQQIV-PVYGHFRVLVDNYFCGAEDGLSCPRSIILEYHQDRVVLTRKPVHGVMTNEIIFNNKVVSPGFRKNGIVVSRIGVKMYATIPELGVQVMFS-GLIFSVEVPFSKFANNTEGQCGTCTNDRKDECRTPRGTVVASCSEMSGLWNVSIPDQPACHRPHPTPTTVGPTTVGSTTVGPTTVGSTTVGPTTPPAPCLPSP--------ICQLILSKVFEPCHTVIPPLLFYEGCVFDRCHMT---DLDVVCSSLELYAALCASHDICIDWRGRTGHMCPFTCPADKVYQPCGPSNPSYCYGNDSASLGALPEAGPITEGCFCPEGMTLFSTSAQVCVPTGCPRCLGP-HGEPVKVGHTVGMDCQECTCEAATWTLT 5309          

HSP 3 Score: 91.2781 bits (225), Expect = 2.275e-17
Identity = 103/425 (24.24%), Postives = 166/425 (39.06%), Query Frame = 2
Query: 1571 CIENEECEGRCFISGDPHYITFDRRHFFFDGHCEYTAVMTTSDNVLLSNSTIAPL----SITIQNTNCQDNSETGCPRTIGVIIGEDEDQV-----AINLLSSSEIKVNFVKISLPYQHTGNTKVLIDQVSTDILRLKSETGVEILWNGGS-RIEIKLSKKYREKVTGMCGNFNGNEMDDSMTFKGVDEKDIDKFVLSWKTN----PTCESDRGIVEYK---------------GACALSRSYSD---YANKVCHKLYESEEFKKCHSAANADKFFDQCTHDVCTCGMKRNGALDHCECEAFSSYARQCALENINLSWR--TNELCPKKCPNENMKYNQCGSRCTSTC-----RLLQESKCKEECIEGCFCPEGET-FDEAAKECVKISDCKC-EFHGR-FYLPYEIRQDRCNNCTCTNGNWICT 2719
            C  + +C+  C   GDPHYITFD  ++ F  +C Y  V             I P+     + + N  C       CPR+I  I+   +D+V      ++ + ++EI  N   +S  ++  G   +++ ++   +     E GV+++++G    +E+  SK +     G CG    +  D+  T +G       +    W  +    P C                         G+  +  +        + +C +L  S+ F+ CH+      F++ C  D C         LD   C +   YA  CA  +I + WR  T  +CP  CP + + Y  CG    S C       L          EGCFCPEG T F  +A+ CV     +C   HG    + + +  D C  CTC    W  T
Sbjct: 4911 CCHHYQCQCVCSGWGDPHYITFDGTYYTFLDNCTYVLVQQ-----------IVPVYGHFRVLVDNYFCGAEDGLSCPRSI--ILEYHQDRVVLTRKPVHGVMTNEIIFNNKVVSPGFRKNG---IVVSRIGVKMYATIPELGVQVMFSGLIFSVEVPFSK-FANNTEGQCGTCTNDRKDECRTPRGTVVASCSEMSGLWNVSIPDQPACHRPHPTPTTVGPTTVGSTTVGPTTVGSTTVGPTTPPAPCLPSPIC-QLILSKVFEPCHTVIPPLLFYEGCVFDRC-----HMTDLD-VVCSSLELYAALCASHDICIDWRGRTGHMCPFTCPADKV-YQPCGPSNPSYCYGNDSASLGALPEAGPITEGCFCPEGMTLFSTSAQVCVPTGCPRCLGPHGEPVKVGHTVGMD-CQECTCEAATWTLT 5309          

HSP 4 Score: 76.6406 bits (187), Expect = 6.490e-13
Identity = 98/423 (23.17%), Postives = 171/423 (40.43%), Query Frame = 2
Query:  458 CSVIYGHHIKTFDGNVFSYPLRGGYTLFMDCLGAAPLFYVYFNASYDCFDQKTQN--------DCSISMKITVGTQTIILFPKNEFALVKNNKTKIPFNSEGIIVSSVGSFIKIKGIDDLEILFDRDRNIYVYAPVTAEKKICGLCGYFNGIMSDDYRDFNQVIQKNVKTFVNSWIDRDPSDLNVYREREQYPCNALKLKNNDQYQKALTLCQ-DMVKNNLGRTCQSEVKIDKYLDMCQDEICECLQTQPENSTIENCYSTFCKIEEQYSYACTLKGIAVDWRSATTICK------QPQCFNGQEFSECGSNCGKNCGQLGMELECESQCLPGCY--CPRNRYW---DGTMCV---PQEKCPCVRDNGESTYQQGYRLKL--NCETCICGMHGKWQCIENEEC----EGRCFISGDPHYITFD 1639
            C+V    H  TFDG  +S+     YTL  +  G         +++ D F   T+N         CS ++KI +G   + L       +  +   ++P+      +  +G ++ +     L +L+D+  +I++      + ++CGLCG F+ I  +D+   ++ +  +V  F NSW    PS  +    ++  PC A      + ++K+    Q  ++       C + V+  +Y + C ++ C C        +  +C   FC     Y+ AC   G+ V WR+ + IC        P+      +  CG  C + C     +   + + L GCY  CP        D   CV   P    P        +Y+ G  +    NC++C+C   G     + E C     G+ F  GD  Y T D
Sbjct:  903 CAVYGDGHYLTFDGQSYSFNGDCEYTLVQNHCGGK-------DSTQDSFRVVTENVPCGTTGTTCSKAIKIFLGGFELKLSHGKVEVIGTDESQEVPYT-----IRQMGIYLVVDTDIGLVLLWDKKTSIFINLSPEFKGRVCGLCGNFDDIAVNDFATRSRSVVGDVLEFGNSW-KLSPSCPDALAPKD--PCTA------NPFRKSWAQKQCSILHGPTFAACHAHVEPARYYEACVNDACAC-------DSGGDC-ECFCTAVAAYAQACHEVGLCVSWRTPS-ICPLFCDYYNPEGQCEWHYQPCGVPCLRTCRNPRGDCLRDVRGLEGCYPKCPPEAPIFDEDKMQCVATCPTPPLPPRCHVHGKSYRPGAVVPSDKNCQSCLCTERGVECTYKAEACVCTYNGQRFHPGDVIYHTTD 1295          
BLAST of von Willebrand factor vs. Ensembl Human
Match: MUC5AC (mucin 5AC, oligomeric mucus/gel-forming [Source:HGNC Symbol;Acc:HGNC:7515])

HSP 1 Score: 490.73 bits (1262), Expect = 5.554e-141
Identity = 367/1280 (28.67%), Postives = 565/1280 (44.14%), Query Frame = 2
Query:  416 VTRVNNTMYSTYYECSVIYGHHIKTFDGNVFSYPLRGGYTLFMDCLGAAPLFYVYFNASYDCFDQKTQNDCSISM-KITVGTQTIILFPKNEFALVKNNKTKIPFNSEGIIVSSVGSFIKIKGIDDLEILFDRDRNIYVYAPVTAEKKICGLCGYFNGIMSDDYRDFNQVIQKNVKT----FVNSWIDRDPSDLNVYREREQYPCNALKLKNNDQYQKALTLCQDMVKNNLGRTCQSEVKIDKYLDMCQDEICECLQTQPENSTIENCYSTFCKIEEQYSYACT-LKGIAVDWRSATTICKQPQCFNGQEFSECGSNCGKNCGQLGMELECESQCLPGCYCPRNRYWDG---TMCVPQEKCPCVRDNGESTYQQGYRLKLNCETCICGMHGKWQCIENEECEGRCFISGDPHYITFDRRHFFFDGHCEYTAVMTTSDNVLLSNSTIAPLSITIQNTNCQDNSETGCPRTIGVIIGEDEDQVAINLLSSSEIKVNFVKISLPYQHTGNTKVLIDQVSTDILRLKSETGVEILWNGGSRIEI--KLSKKYREKVTGMCGNFNGNEMDDSMTFKGVDEKDIDKFVLSWKTNPTCESDRGIVEYKGACALSRSYSDYANKVCHKLYESE-EFKKCHSAANADKFFDQCTHDVCTCGMKRNGALDHCECEAFSSYARQCALENINLSWRTNELCPKK---CPNENMKYNQCGSRCTSTCRLLQESKCKEEC----IEGCFCPEGETFDEAAKECVKISDCKCEFHGRFYLPYEIRQDRCNNCTCTNGNWICTSNDCEGKEFCPKSMAWFDC---------GICQKTCTNLDLVCPKGQCQLPGCFCPENTVLHN-GECIKPFECPCYMNNKMYSENDTIVRGPANCQNPCICKDGKWVCEQNKQCSGICKTWGETHYESFDGKYFEFQGSCSYVISEDFCGNKLGT---FKLISENIACGXXXXXCTKSIKFIYLNRVFQFVRGSNPIVSRNTNYPPGGPTAFYWTSDVDTHFILFTMEGIQVKWDKAMSLEIMIPEKYQNKVCGLCGNFDLRIDNDMRARSGEIEKDIVNFADSWKVHSSCPVPQKPPFMCSKRPDREPWAKAKCEILKSDSFKKCHDVVNVEHYYKRCVADACECDRGDDCVCFCTAVEQYVARCNEYEIGLKWRTNENCPHTC-----TGKRVW--KNCGNICPDSCIDI-GKNVTDNTGCKKVCIEGCF--CPDG---LHWQNNECVERKACECVDP---ITNLKYNTGDKVI--RECEECNCYEGAFRCT 4105
            V R +N  ++    CS     H KTFDG+VF +P    Y +F +  GAA   Y  FN       +++Q   + ++ ++ +    +++       LV  +   +PF+  G+++    S+ K++    L ++++ D ++ +        K CGLCG FNG+        ++++  N K     F N     DP+D           C     +          +C++++   L   C + V +  YL+ C+ ++C C     E++ + +C    C    +YS  CT   G+  DWR     C Q +C N  ++ EC S C   C        CE  C+ GC+CP     D    T CVP  KC CV +   + Y  G     +C  C C   G+W C E   C G C + G  H+ TFD + +   G C Y         VL      +  ++  +   C       C ++  V +  D  Q  + + +S E+ +N +   LP        V I + ST  +  ++  G+++       +++  +L+ K R +  G+CGNFN  + DD  T  GV E     F  ++KT   C + R    ++  C+LS     YA   C +L +++  F +CH+A     ++  C  D C C    +     C C A SSY   CA + + L    + +C K    CP ++M Y+   S C  TCR L E           ++GC CP+G   D+  K CV+ S+C C   G      E   D    CTCT+G   C          C   M +FDC           CQK+C  LD+ C   QC +PGC CP+  V    G CI   +CPC  N   Y    TI  G   C N C C    W C  +  C   C  +G+ HY +FDG+ + F G C Y + ++ CG K  T   F++++EN+ CG++ ++C+K+IK        +   G   ++  + +         Y    +  + ++ T  G+ + WDK  S+ I +  +++ +VCGLCGNFD    ND   RS  +  D++ F +SWK+  SCP    P   C+  P R+ WA+ +C IL   +F  CH  V    YY+ CV DAC CD G DC CFCTAV  Y   C+E  + + WRT   CP  C      G+  W  + CG  C  +C +  G  + D  G     +EGC+  CP           +CV       + P   +    Y  G  V   + C+ C C E    CT
Sbjct:   68 VVRASNPAHNGRV-CSTWGSFHYKTFDGDVFRFPGLCNY-VFSEHCGAA---YEDFNIQL----RRSQESAAPTLSRVLMKVDGVVIQLTKGSVLVNGHPVLLPFSQSGVLIQQSSSYTKVEARLGLVLMWNHDDSLLLELDTKYANKTCGLCGDFNGMPV-----VSELLSHNTKLTPMEFGNLQKMDDPTDQ----------CQDPVPEPPRNCSTGFGICEELLHGQLFSGCVALVDVGSYLEACRQDLCFC-----EDTDLLSC---VCHTLAEYSRQCTHAGGLPQDWR-GPDFCPQ-KCPNNMQYHECRSPCADTCSNQEHSRACEDHCVAGCFCPEGTVLDDIGQTGCVPVSKCACVYNG--AAYAPGATYSTDCTNCTCS-GGRWSCQE-VPCPGTCSVLGGAHFSTFDGKQYTVHGDCSY---------VLTKPCDSSAFTVLAELRRCGLTDSETCLKS--VTLSLDGAQTVVVIKASGEVFLNQIYTQLPIS---AANVTIFRPSTFFIIAQTSLGLQLNLQLVPTMQLFMQLAPKLRGQTCGLCGNFNSIQADDFRTLSGVVEATAAAFFNTFKTQAACPNIRN--SFEDPCSLSVENEKYAQHWCSQLTDADGPFGRCHAAVKPGTYYSNCMFDTCNCERSED-----CLCAALSSYVHACAAKGVQLGGWRDGVCTKPMTTCP-KSMTYHYHVSTCQPTCRSLSEGDITCSVGFIPVDGCICPKGTFLDDTGK-CVQASNCPCYHRGSMIPNGESVHDSGAICTCTHGKLSCIGGQAPAP-VCAAPMVFFDCRNATPGDTGAGCQKSCHTLDMTCYSPQC-VPGCVCPDGLVADGEGGCITAEDCPCVHNEASYRAGQTIRVG---C-NTCTCDSRMWRCTDDP-CLATCAVYGDGHYLTFDGQSYSFNGDCEYTLVQNHCGGKDSTQDSFRVVTENVPCGTTGTTCSKAIKIFLGGFELKLSHGKVEVIGTDESQ-----EVPYTIRQMGIYLVVDTDIGLVLLWDKKTSIFINLSPEFKGRVCGLCGNFDDIAVNDFATRSRSVVGDVLEFGNSWKLSPSCPDALAPKDPCTANPFRKSWAQKQCSILHGPTFAACHAHVEPARYYEACVNDACACDSGGDCECFCTAVAAYAQACHEVGLCVSWRTPSICPLFCDYYNPEGQCEWHYQPCGVPCLRTCRNPRGDCLRDVRG-----LEGCYPKCPPEAPIFDEDKMQCVATCPTPPLPPRCHVHGKSYRPGAVVPSDKNCQSCLCTERGVECT 1269          

HSP 2 Score: 106.686 bits (265), Expect = 4.097e-22
Identity = 101/413 (24.46%), Postives = 153/413 (37.05%), Query Frame = 2
Query: 3008 CEQNKQCSGICKTWGETHYESFDGKYFEFQGSCSYVISEDFCGNKLGTFKLISENIACGXX-XXXCTKSIKFIYLNRVFQFVRG------SNPIVSRNTNYPPGGPTAFYWTSDVDTHFILFTME-GIQVKWDKAMSLEIMIP-EKYQNKVCGLCGNFDLRIDNDMRARSGEIEKDIVNFADSWKVH---------------------------------SSCPVPQKPPFMCSKRPDREPWAKAKCEILKSDSFKKCHDVVNVEHYYKRCVADACECDRGDDCVCFCTAVEQYVARCNEYEIGLKWR--TNENCPHTCTGKRVWKNCGNICPDSCIDIGKNVTDNTGCKKVCIEGCFCPDGLHWQNNE---CVERKACECVDPITNLKYNTGDKVIRECEECNCYEGAFRCT 4105
            C  + QC  +C  WG+ HY +FDG Y+ F  +C+YV+ +       G F+++ +N  CG+    SC +SI   Y        R       +N I+  N    PG        S +         E G+QV +   +   + +P  K+ N   G CG       ++ R   G +       +  W V                                  S+   P  PP  C   P         C+++ S  F+ CH V+    +Y+ CV D C      D    C+++E Y A C  ++I + WR  T   CP TC   +V++ CG   P  C                  EGCFCP+G+   +     CV      C+ P        G  V  +C+EC C    +  T
Sbjct: 4911 CCHHYQCQCVCSGWGDPHYITFDGTYYTFLDNCTYVLVQQIV-PVYGHFRVLVDNYFCGAEDGLSCPRSIILEYHQDRVVLTRKPVHGVMTNEIIFNNKVVSPGFRKNGIVVSRIGVKMYATIPELGVQVMFS-GLIFSVEVPFSKFANNTEGQCGTCTNDRKDECRTPRGTVVASCSEMSGLWNVSIPDQPACHRPHPTPTTVGPTTVGSTTVGPTTVGSTTVGPTTPPAPCLPSP--------ICQLILSKVFEPCHTVIPPLLFYEGCVFDRCHMT---DLDVVCSSLELYAALCASHDICIDWRGRTGHMCPFTCPADKVYQPCGPSNPSYCYGNDSASLGALPEAGPITEGCFCPEGMTLFSTSAQVCVPTGCPRCLGP-HGEPVKVGHTVGMDCQECTCEAATWTLT 5309          

HSP 3 Score: 91.2781 bits (225), Expect = 2.275e-17
Identity = 103/425 (24.24%), Postives = 166/425 (39.06%), Query Frame = 2
Query: 1571 CIENEECEGRCFISGDPHYITFDRRHFFFDGHCEYTAVMTTSDNVLLSNSTIAPL----SITIQNTNCQDNSETGCPRTIGVIIGEDEDQV-----AINLLSSSEIKVNFVKISLPYQHTGNTKVLIDQVSTDILRLKSETGVEILWNGGS-RIEIKLSKKYREKVTGMCGNFNGNEMDDSMTFKGVDEKDIDKFVLSWKTN----PTCESDRGIVEYK---------------GACALSRSYSD---YANKVCHKLYESEEFKKCHSAANADKFFDQCTHDVCTCGMKRNGALDHCECEAFSSYARQCALENINLSWR--TNELCPKKCPNENMKYNQCGSRCTSTC-----RLLQESKCKEECIEGCFCPEGET-FDEAAKECVKISDCKC-EFHGR-FYLPYEIRQDRCNNCTCTNGNWICT 2719
            C  + +C+  C   GDPHYITFD  ++ F  +C Y  V             I P+     + + N  C       CPR+I  I+   +D+V      ++ + ++EI  N   +S  ++  G   +++ ++   +     E GV+++++G    +E+  SK +     G CG    +  D+  T +G       +    W  +    P C                         G+  +  +        + +C +L  S+ F+ CH+      F++ C  D C         LD   C +   YA  CA  +I + WR  T  +CP  CP + + Y  CG    S C       L          EGCFCPEG T F  +A+ CV     +C   HG    + + +  D C  CTC    W  T
Sbjct: 4911 CCHHYQCQCVCSGWGDPHYITFDGTYYTFLDNCTYVLVQQ-----------IVPVYGHFRVLVDNYFCGAEDGLSCPRSI--ILEYHQDRVVLTRKPVHGVMTNEIIFNNKVVSPGFRKNG---IVVSRIGVKMYATIPELGVQVMFSGLIFSVEVPFSK-FANNTEGQCGTCTNDRKDECRTPRGTVVASCSEMSGLWNVSIPDQPACHRPHPTPTTVGPTTVGSTTVGPTTVGSTTVGPTTPPAPCLPSPIC-QLILSKVFEPCHTVIPPLLFYEGCVFDRC-----HMTDLD-VVCSSLELYAALCASHDICIDWRGRTGHMCPFTCPADKV-YQPCGPSNPSYCYGNDSASLGALPEAGPITEGCFCPEGMTLFSTSAQVCVPTGCPRCLGPHGEPVKVGHTVGMD-CQECTCEAATWTLT 5309          

HSP 4 Score: 76.6406 bits (187), Expect = 6.490e-13
Identity = 98/423 (23.17%), Postives = 171/423 (40.43%), Query Frame = 2
Query:  458 CSVIYGHHIKTFDGNVFSYPLRGGYTLFMDCLGAAPLFYVYFNASYDCFDQKTQN--------DCSISMKITVGTQTIILFPKNEFALVKNNKTKIPFNSEGIIVSSVGSFIKIKGIDDLEILFDRDRNIYVYAPVTAEKKICGLCGYFNGIMSDDYRDFNQVIQKNVKTFVNSWIDRDPSDLNVYREREQYPCNALKLKNNDQYQKALTLCQ-DMVKNNLGRTCQSEVKIDKYLDMCQDEICECLQTQPENSTIENCYSTFCKIEEQYSYACTLKGIAVDWRSATTICK------QPQCFNGQEFSECGSNCGKNCGQLGMELECESQCLPGCY--CPRNRYW---DGTMCV---PQEKCPCVRDNGESTYQQGYRLKL--NCETCICGMHGKWQCIENEEC----EGRCFISGDPHYITFD 1639
            C+V    H  TFDG  +S+     YTL  +  G         +++ D F   T+N         CS ++KI +G   + L       +  +   ++P+      +  +G ++ +     L +L+D+  +I++      + ++CGLCG F+ I  +D+   ++ +  +V  F NSW    PS  +    ++  PC A      + ++K+    Q  ++       C + V+  +Y + C ++ C C        +  +C   FC     Y+ AC   G+ V WR+ + IC        P+      +  CG  C + C     +   + + L GCY  CP        D   CV   P    P        +Y+ G  +    NC++C+C   G     + E C     G+ F  GD  Y T D
Sbjct:  903 CAVYGDGHYLTFDGQSYSFNGDCEYTLVQNHCGGK-------DSTQDSFRVVTENVPCGTTGTTCSKAIKIFLGGFELKLSHGKVEVIGTDESQEVPYT-----IRQMGIYLVVDTDIGLVLLWDKKTSIFINLSPEFKGRVCGLCGNFDDIAVNDFATRSRSVVGDVLEFGNSW-KLSPSCPDALAPKD--PCTA------NPFRKSWAQKQCSILHGPTFAACHAHVEPARYYEACVNDACAC-------DSGGDC-ECFCTAVAAYAQACHEVGLCVSWRTPS-ICPLFCDYYNPEGQCEWHYQPCGVPCLRTCRNPRGDCLRDVRGLEGCYPKCPPEAPIFDEDKMQCVATCPTPPLPPRCHVHGKSYRPGAVVPSDKNCQSCLCTERGVECTYKAEACVCTYNGQRFHPGDVIYHTTD 1295          
BLAST of von Willebrand factor vs. Ensembl Human
Match: MUC5B (mucin 5B, oligomeric mucus/gel-forming [Source:HGNC Symbol;Acc:HGNC:7516])

HSP 1 Score: 473.781 bits (1218), Expect = 1.838e-135
Identity = 353/1252 (28.19%), Postives = 544/1252 (43.45%), Query Frame = 2
Query:  458 CSVIYGHHIKTFDGNVFSYPLRGGYTLFMDCLGAAPLFYVYFNASYDCFDQKTQNDCSISMKITVGTQTIILFPKNEFALVKNNKTKIPFNSEGIIVSSVGSFIKIKGIDDLEILFDRDRNIYVYAPVTAEKKICGLCGYFNGIMSDDYRDFNQVIQKNVKTFVNSWIDRDPSDLNVYREREQYPCNALKLKNNDQYQKALTLCQDMVKNNLGRTCQSEVKIDKYLDMCQDEICECLQTQPENSTIENCYSTFCKIEEQYSYACTLKGIAVDWRSATTICKQPQCFNGQEFSECGSNCGKNCGQLGMELECESQCLPGCYCPRNRYWDG---TMCVPQEKCPCVRDNGESTYQQGYRLKLNCETCICGMHGKWQCIENEECEGRCFISGDPHYITFDRRHFFFDGHCEYTAVMTTSDNVLLSNSTIAPLSITIQNTNCQDNSETGCPRTIGVIIGEDEDQVAINLLSSSEIKVNFVKISLPYQHTGNTKVLIDQVSTDILRLKSETGVEILWNGGSRIEIKLSKKYREKVTGMCGNFNGNEMDDSMTFKGVDEKDIDKFVLSWKTNPTCESDRGIVEYKGACALSRSYSDYANKVCHKLYE-SEEFKKCHSAANADKFFDQCTHDVCTCGMKRNGALDHCECEAFSSYARQCALENINLSWRTNELCPK---KCPNENMKYNQCGSRCTSTCRLLQESKCKEEC----IEGCFCPEGETFDEAAKECVKISDCKCEFHGRFYLPYEIRQDRCNNCTCTNGNWICTSNDCEGKEFCPKSMAWFDC---------GICQKTCTNLDLVCPKGQCQLPGCFCPENTVLH-NGECIKPFECPCYMNNKMYSENDTIVRGPANCQNPCICKDGKWVCEQNKQCSGICKTWGETHYESFDGKYFEFQGSCSYVISEDFCGNKL--GTFKLISENIACGXXXXXCTKSIKFIYLNRVFQFVRGSNPIVSRNTNYPPGGPTAFYWTSDVDTHFILFTMEGIQVKWDKAMSLEIMIPEKYQNKVCGLCGNFDLRIDNDMRARSGEIEKDIVNFADSWKVHSSCPVPQKPPFMCSKRPDREPWAKAKCEILKSDSFKKCHDVVNVEHYYKRCVADACECDRGDDCVCFCTAVEQYVARCNEYEIGLKWRTNENCPHTCT-----GKRVW--KNCGNICPDSCIDIGKNVTDNTGCKKVCIEGCF--CPDGLHWQNNE---CVERKACECVDPITNLKYNTGDKV--IRECEECNCYEGAFRC 4102
            CS     H KTFDG+VF +P    Y     C  A    Y  FN       +       +  ++ +  Q ++L   N   L+   + ++P++  G++V   G +IK+     L  L++ + +  +        + CGLCG FNG+ +     FN+    N +     + +    D    +  +  P  A    + +       +C   +       C + V    YL  C  ++C C  T P         +TF +   Q ++A    G   +WR    +C +    N Q   ECGS C   C        CE  C+ GC+CP     D    + C+P  +CPC   +G  TY  G      C +C C   G WQC ++  C G C + G  H  T+D + +   G C Y      +D+     + +    +T  N NC             V +  D    AI + +   + +N +   LP     N  +        +++      + +      ++ ++L   ++ ++ G+CGNFN N+ DD     GV E     F  +WK    C + R    ++  C+LS    +YA   C +L + +  F +CHS  N   F   C  D C C    +     C C A SSY   CA + + LS   + +C K    CP ++ +Y      C  TCR L E+          ++GC CP G TF   A  CV   +C C  HG    P E+  D    C+CT G   C     +    C   M + DC           C ++C  LD+ C    C + GC CP   V   +G CI   +CPC  N   Y   +TI     +C N C C++ +W C  ++ C G C  +G+ H+ +FDG  + F+GSC Y++++D+CG+    GTF++++ENI CG++ ++C+K+IK    +       G+   V+R    P G P        +   F++    G+ V WD+  S+ I + + Y+ +VCGLCGNFD    ND   RS  +  D + F +SWK+  SCP    P   C+  P R+ WA+ +C IL   +F  C   V+   YY+ CV DAC CD G DC CFCTAV  Y   C++  + + WRT + CP  C      G   W  + CG  C  +C    +N + +       +EGC+  CP    + N +   CV +  C C D   N  Y+ G +V     C+ CNC     +C
Sbjct:   77 CSTWGDFHYKTFDGDVFRFPGLCNYVFSEHCRAA----YEDFNVQ---LRRGLVGSRPVVTRVVIKAQGLVLEASNGSVLINGQREELPYSRTGLLVEQSGDYIKVSIRLVLTFLWNGEDSALLELDPKYANQTCGLCGDFNGLPA-----FNEFYAHNARLTPLQFGNLQKLDGPTEQCPDPLPLPAGNCTDEE------GICHRTLLGPAFAECHALVDSTAYLAACAQDLCRC-PTCP--------CATFVEYSRQCAHA---GGQPRNWR-CPELCPRTCPLNMQH-QECGSPCTDTCSNPQRAQLCEDHCVDGCFCPPGTVLDDITHSGCLPLGQCPCT--HGGRTYSPGTSFNTTCSSCTCS-GGLWQC-QDLPCPGTCSVQGGAHISTYDEKLYDLHGDCSYVLSKKCADSSFTVLAELRKCGLT-DNENCLK----------AVTLSLDGGDTAIRVQADGGVFLNSIYTQLPLS-AANITLFTPSSFFIVVQTGLGLQLLVQLVPLMQVFVRLDPAHQGQMCGLCGNFNQNQADDFTALSGVVEATGAAFANTWKAQAACANARN--SFEDPCSLSVENENYARHWCSRLTDPNSAFSRCHSIINPKPFHSNCMFDTCNCERSED-----CLCAALSSYVHACAAKGVQLSDWRDGVCTKYMQNCP-KSQRYAYVVDACQPTCRGLSEADVTCSVSFVPVDGCTCPAG-TFLNDAGACVPAQECPCYAHGTVLAPGEVVHDEGAVCSCTGGKLSCLGASLQKSTGCAAPMVYLDCSNSSAGTPGAECLRSCHTLDVGCFSTHC-VSGCVCPPGLVSDGSGGCIAEEDCPCVHNEATYKPGETI---RVDC-NTCTCRNRRWEC-SHRLCLGTCVAYGDGHFITFDGDRYSFEGSCEYILAQDYCGDNTTHGTFRIVTENIPCGTTGTTCSKAIKLFVESYELILQEGTFKAVARG---PGGDPPYKIRYMGI---FLVIETHGMAVSWDRKTSVFIRLHQDYKGRVCGLCGNFDDNAINDFATRSRSVVGDALEFGNSWKLSPSCPDALAPKDPCTANPFRKSWAQKQCSILHGPTFAACRSQVDSTKYYEACVNDACACDSGGDCECFCTAVAAYAQACHDAGLCVSWRTPDTCPLFCDFYNPHGGCEWHYQPCGAPCLKTC----RNPSGHCLVDLPGLEGCYPKCPPSQPFFNEDQMKCVAQ--CGCYDKDGNY-YDVGARVPTAENCQSCNCTPSGIQC 1252          

HSP 2 Score: 91.6633 bits (226), Expect = 1.656e-17
Identity = 98/398 (24.62%), Postives = 162/398 (40.70%), Query Frame = 2
Query: 2978 PCICKDGKWVCEQNKQCSGICKTWGETHYESFDGKYFEFQGSCSYVISEDFCGNKLGTFKLISENIACGXXXXX----CTKSIKFIYLNR----VFQFVRGSNP--IVSRNTNYPPGGPTAFYWTSDVDTHFILFTME--GIQVKWDKAMSLEIMIPEKYQNKVCGLCGNFDLRIDNDMRARSGEIEKDIVNFADSWKVHSS----CPVPQ-KPPFMCSKRPDREPWAKAK------CEILKSDSFKKCHDVVNVEHYYKRCVADACECDRGDDCVCFCTAVEQYVARCNEYEIGLKWR--TNENCPHTCTGKRVWKNCGNICPDSCIDIGKNVTDNTGCKKVCIEGCFCP-DGLHWQNNECVERKACECVDPITNLKYNTGDKVIRECEECNCYEGA 4093
            P    D    C+ + +C  IC  WG +HY +FDG  + F+G+C+YV+  +    + G   L  +N  C +S+++    C +++   Y +         V G     I+        G        S + T  +   +   G+ V ++  +    +    + N   G CG       +D   R G       + A +W V  S    C  P   PP      P               C+++ S  F +CH++V    ++  C++D C   RG   V  C ++E Y   C    +   WR  T   C  TC   +V+K CG I P +C     N  + +   +   EGCFCP D + +  +  +  +AC CV P    K+  G++ +  C+ C C EG+
Sbjct: 5055 PIKVSDPSQPCDFHYECECICSMWGGSHYSTFDGTSYTFRGNCTYVLMREIHA-RFGNLSLYLDNHYCTASATAAAARCPRALSIHYKSMDIVLTVTMVHGKEEGLILFDQIPVSSGFSKNGVLVSVLGTTTMRVDIPALGVSVTFNGQVFQARLPYSLFHNNTEGQCGTCTNNQRDDCLQRDGTTAASCKDMAKTWLVPDSRKDGCWAPTGTPPTASPAAPVSSTPTPTPCPPQPLCDLMLSQVFAECHNLVPPGPFFNACISDHC---RGRLEVP-CQSLEAYAELCRARGVCSDWRGATGGLCDLTCPPTKVYKPCGPIQPATC-----NSRNQSPQLEGMAEGCFCPEDQILFNAHMGICVQACPCVGPDGFPKF-PGERWVSNCQSCVCDEGS 5441          

HSP 3 Score: 86.2705 bits (212), Expect = 7.180e-16
Identity = 126/548 (22.99%), Postives = 190/548 (34.67%), Query Frame = 2
Query: 1571 CIENEECEGRCFISGDPHYITFDRRHFFFDGHCEYTAVMTTSDNVLLSNSTIAPLSITIQNTNCQDNSETG---CPRTIGVIIGEDEDQVAINLLSSSE---IKVNFVKISLPYQHTGNTKVLIDQVSTDILRLK-SETGVEILWNGG---SRIEIKLSKKYREKVTGMCGNFNGNEMDDSMTFKGVDEKDIDKFVLSW----KTNPTCESDRGIVEYKGACALSRSYSDYANKVCHKLYE---SEEFKKCHSAANADKFFDQCTHDVCTCGMKRNGALDHCECEAFSSYARQCALENINLSWR--TNELCPKKCPNENMKYNQCGSRCTSTCRLLQESKCKEECIEGCFCPEGET-FDEAAKECVKISDCKCEFHGRFYLPYEIRQDRCNNCTCTNGNWI--CTSNDCEGK---------------------EFCPKSMAWFDCGICQKTCTNLDLVCPKGQ----CQLPGCFCPE----------NTVLHNGECIKPFECPCYMNNKMYSE-NDTIVRGPANCQNPCICKDGKWVCEQNKQCSGIC 3040
            C  + ECE  C + G  HY TFD   + F G+C Y  +          ++    LS+ + N  C  ++      CPR + +     +  + + ++   E   I  + + +S  +   G   VL+  + T  +R+     GV + +NG    +R+   L   +     G CG    N+ DD +   G           +W         C +  G        A   S           L +   S+ F +CH+      FF+ C  D C       G L+   C++  +YA  C    +   WR  T  LC   CP   + Y  CG    +TC    +S   E   EGCFCPE +  F+     CV+   C     G    P E     C +C C  G+    C    C+ +                       CP+++    C     TC     VCP GQ     Q  G  CP           N   +      P   PC+M   +  +  D  V+   +  N   C  G        QC G C
Sbjct: 5065 CDFHYECECICSMWGGSHYSTFDGTSYTFRGNCTYVLMREI-------HARFGNLSLYLDNHYCTASATAAAARCPRALSIHYKSMDIVLTVTMVHGKEEGLILFDQIPVSSGFSKNG---VLVSVLGTTTMRVDIPALGVSVTFNGQVFQARLPYSL---FHNNTEGQCGTCTNNQRDDCLQRDGTTAASCKDMAKTWLVPDSRKDGCWAPTGTPPTASPAAPVSSTPTPTPCPPQPLCDLMLSQVFAECHNLVPPGPFFNACISDHC------RGRLE-VPCQSLEAYAELCRARGVCSDWRGATGGLCDLTCPPTKV-YKPCGPIQPATCNSRNQSPQLEGMAEGCFCPEDQILFNAHMGICVQACPCVGP-DGFPKFPGERWVSNCQSCVCDEGSVSVQCKPLPCDAQGQPPPCNRPGFVTVTRPRAENPCCPETV----CVCNTTTCPQSLPVCPPGQESICTQEEGDCCPTFRCRPQLCSYNGTFYGVGATFPGALPCHMCTCLSGDTQDPTVQCQEDACNNTTCPQGFEYKRVAGQCCGEC 5586          
BLAST of von Willebrand factor vs. Ensembl Human
Match: MUC2 (mucin 2, oligomeric mucus/gel-forming [Source:HGNC Symbol;Acc:HGNC:7512])

HSP 1 Score: 454.521 bits (1168), Expect = 4.033e-131
Identity = 366/1253 (29.21%), Postives = 564/1253 (45.01%), Query Frame = 2
Query:  458 CSVIYGHHIKTFDGNVFSYPLRGGYTLFMDCLGAAPLFYVYFNASYDCFDQKTQNDCSISMKITVGTQTIILFPKNEFALVKNNKTKIPFNSEGIIVSSVGSFIKIKGIDDLEILFDRDRNIYVYAPVTAEKKICGLCGYFNGIMSDDYRDF-NQVIQKNVKTFVNSWIDRDPSDLNVYREREQYPCNALKLKNNDQYQKALTLCQDMVKNNLGRTCQSEVKIDKYLDMCQDEICECLQTQPENSTIENCYSTFCKIEEQYSYACTLKGIAVDWRSATTICKQPQCFNGQEFSECGSNCGKNCGQLGMELECESQCLPGCYCPRNRYWDG---TMCVPQEKCPCVRDNGESTYQQGYRLKLNCETCICGMHGKWQCIENEECEGRCFISGDPHYITFDRRHFFFDGHCEYTAVMTTSDNVLLSNSTIAPLSITIQNTNCQDNSETGCPRTIGVIIGEDEDQVAINLLSSSEIKVNFVKISLPYQHTGNTKVLIDQVSTDILRLKSETGVEILWNGGSRIEIKLSKKYREKVTGMCGNFNGNEMDDSMTFKGVDEKDIDKFVLSWKTNPTCESDRGIVEYKGACALSRSYSDYANKVCHKLYESE-EFKKCHSAANADKFFDQCTHDVCTCGMKRNGALDHCECEAFSSYARQCALENINL-SWRTNELCPK---KCPNENM-KYNQCGSRCTSTCRLLQE--SKCKE--ECIEGCFCPEGETFDEAAKECVKISDCKCEFHGRFYLPYEIRQDRCNNCTCTNGNWICTSNDCEGKEFCPKSMAWFDCGICQKTCTNLDLVCPKG-QCQ-----------LPGCFCPENTVLHN-GECIKPFECPCYMNNKMYSENDTIVRGPANCQNPCICKDGKWVCEQNKQCSGICKTWGETHYESFDGKYFEFQGSCSYVISEDFCG--NKLGTFKLISENIACGXXXXXCTKSIKFIYLNRVFQFVRGSNPIVSRNTNYPPGGPTAFYWTSDVDTHFILFTMEGIQVKWDKAMSLEIMIPEKYQNKVCGLCGNFDLRIDNDMRARSGEIEKDIVNFADSWKVHSSCPVPQKPPFMCSKRPDREPWAKAKCEILKSDSFKKCHDVVNVEHYYKRCVADACECDRGDDCVCFCTAVEQYVARCNEYEIGLKWRTNENC---------PHTCTGKRVWKNCGNICPDSCIDIGKNVTDNTGCKKVCIEGCF--CP-DGLHWQNN--ECVERKACECVDPITNLKYNTGDKVIRE--CEECNC 4081
            CS     H KTFDG+VF +P    Y    DC G+   F V+         Q        S+ +T+   TI L      A++       P  S G+++    ++ K+     L ++++R+  + +          CGLCG +NG+ S  Y +F +  +  +   F N      P  +    E E  P +  + +           C+ ++       CQ  V ++ YL  CQ + C C    P   T     ST  +   Q S+A    G   +WR+AT +C +  C     + E GS C   C  L +   CE   + GC+CP    +D    + CVP  +C C R +G   Y  G  +  +CE C+C   G+W C ++  C G C + G  H  TFD + + F G C Y       ++       +AP   T + T         C +T  V++  D+ +  +   S   + +N ++++LP+  T +  V        ++ +     +++      ++ + L +  + +V G+CGNFNG E DD  T  G+ E     F  +WK   +C      ++    C+L+   ++YA   C  L ++E  F +CHSA +  +++ +C +D C C    +     C C A SSYAR C  + + L  WR   +C K    CPN  +  YN   + C  TCR L E  S C E    ++GC CP+    DE  + CV ++ C C   G +    ++   +   C C +G   C      G+  C       DC       T L    P+   CQ           + GC CP+  +    G C+   ECPC  NN +YS    I     +C N C CK G+WVC Q   C G C  +G  HY +FDGKY++F G CSYV  +D+CG  + LG+F +I+EN+ CG++  +C+K+IK I++ R    +   + +V +       G    Y T +V  + ++ +  GI V WDK  ++ I +   Y+  VCGLCGNFD R +ND   R   +    ++F +SWK   +CP     P  CS  P R  WA+ +C ILKS  F  CH  V+ + +Y+ CV D+C CD G DC CFC+AV  Y   C +    + WRT + C         PH C     ++ CGN   ++C  I   +  N       +EGC+  CP D   ++ +  +CV    C C   + +  Y  G  V  E  C+ C C
Sbjct:   37 CSTWGNFHYKTFDGDVFRFPGLCDYNFASDCRGSYKEFAVHLKRGPG---QAEAPAGVESILLTIKDDTIYL--TRHLAVLNGAVVSTPHYSPGLLIEKSDAYTKVYSRAGLTLMWNREDALMLELDTKFRNHTCGLCGDYNGLQS--YSEFLSDGVLFSPLEFGNMQKINQPDVVCEDPEEEVAPASCSEHRAE---------CERLLTAEAFADCQDLVPLEPYLRACQQDRCRC----PGGDTC--VCSTVAEFSRQCSHA---GGRPGNWRTAT-LCPK-TCPGNLVYLESGSPCMDTCSHLEVSSLCEEHRMDGCFCPEGTVYDDIGDSGCVPVSQCHC-RLHGH-LYTPGQEITNDCEQCVCNA-GRWVC-KDLPCPGTCALEGGSHITTFDGKTYTFHGDCYYVLAKGDHNDSYALLGELAPCGSTDKQT---------CLKT--VVLLADKKKNVVVFKSDGSVLLNELQVNLPHV-TASFSVFRPSSYHIMVSMAIGVRLQVQLAPVMQLFVTLDQASQGQVQGLCGNFNGLEGDDFKTASGLVEATGAGFANTWKAQSSCHDKLDWLD--DPCSLNIESANYAEHWCSLLKKTETPFGRCHSAVDPAEYYKRCKYDTCNCQNNED-----CLCAALSSYARACTAKGVMLWGWR-EHVCNKDVGSCPNSQVFLYNL--TTCQQTCRSLSEADSHCLEGFAPVDGCGCPDHTFLDEKGR-CVPLAKCSCYHRGLYLEAGDVVVRQEERCVCRDGRLHCRQIRLIGQS-CTAPKIHMDC----SNLTALATSKPRALSCQTLAAGYYHTECVSGCVCPDGLMDDGRGGCVVEKECPCVHNNDLYSSGAKI---KVDC-NTCTCKRGRWVCTQ-AVCHGTCSIYGSGHYITFDGKYYDFDGHCSYVAVQDYCGQNSSLGSFSIITENVPCGTTGVTCSKAIK-IFMGRTELKLEDKHRVVIQRDE----GHHVAYTTREVGQYLVVESSTGIIVIWDKRTTVFIKLAPSYKGTVCGLCGNFDHRSNNDFTTRDHMVVSSELDFGNSWKEAPTCPDVSTNPEPCSLNPHRRSWAEKQCSILKSSVFSICHSKVDPKPFYEACVHDSCSCDTGGDCECFCSAVASYAQECTKEGACVFWRTPDLCPIFCDYYNPPHECEWH--YEPCGNRSFETCRTI-NGIHSNISVSY--LEGCYPRCPKDRPIYEEDLKKCVTADKCGCY--VEDTHYPPGASVPTEETCKSCVC 1213          

HSP 2 Score: 172.17 bits (435), Expect = 4.130e-42
Identity = 144/509 (28.29%), Postives = 235/509 (46.17%), Query Frame = 2
Query: 2675 RCNNCTCTNGNWICTSNDCEGKEFCPKSMAWFDCGI-CQKTCTNLDLVCPKGQCQLPGCFCPENTV---LHNGECIKPFECPCYMNNKMYSENDTIVRGPANCQNPCICKDGKWVCEQNKQCSGICKTWGETHYESFDGKYFEFQGSCSYVISEDFCGNKLGTFKLISENIACGXX-XXXCTKSIKFIYLNRVFQFVRGSNPIVSRN---TNYPPGGPTAFYWTSDVDTHFILFTME---GIQVKWDKAMSLEIMIPEKYQNKVCGLCGNFDLRIDNDMRARSGEIEKDIVNFADSWKVHSSCPVPQKPPFM---CSKRPDREPWAKAKCEILKSDS--FKKCHDVVNVEHYYKRCVADACECDRGDDCVCFCTAVEQYVARCNEYEIGL-KWRTNENCPHTCTGKRVWKNCGNICPDSCIDIGKNVTDNTGCKKVC------------IEGCFCPDGLHW-QNNECVERKACECVDPITNLKYNTGDKVIRECEECNCYEGAFRCTKL 4111
            +C++     GNW  T+  C   + CP ++ + + G  C  TC++L++     + ++ GCFCPE TV   + +  C+   +C C ++  +Y+    I     +C+  C+C  G+WVC ++  C G C   G +H  +FDGK + F G C YV+++   G+   ++ L+ E   CGS+   +C K++  +   +    V  S+  V  N    N P    TA +      ++ I+ +M     +QV+    M L + + +  Q +V GLCGNF+    +D +  SG +E     FA++WK  SSC    K  ++   CS   +   +A+  C +LK     F +CH  V+   YYKRC  D C C   +DC+C   A+  Y   C    + L  WR      H C      K+ G+ CP+S + +    T    C+ +             ++GC CPD     +   CV    C C      L    GD V+R+ E C C +G   C ++
Sbjct:  274 QCSHAGGRPGNWR-TATLC--PKTCPGNLVYLESGSPCMDTCSHLEVSSLCEEHRMDGCFCPEGTVYDDIGDSGCVPVSQCHCRLHGHLYTPGQEITN---DCEQ-CVCNAGRWVC-KDLPCPGTCALEGGSHITTFDGKTYTFHGDCYYVLAK---GDHNDSYALLGELAPCGSTDKQTCLKTVVLLADKKKNVVVFKSDGSVLLNELQVNLP--HVTASFSVFRPSSYHIMVSMAIGVRLQVQLAPVMQLFVTLDQASQGQVQGLCGNFNGLEGDDFKTASGLVEATGAGFANTWKAQSSCH--DKLDWLDDPCSLNIESANYAEHWCSLLKKTETPFGRCHSAVDPAEYYKRCKYDTCNCQNNEDCLC--AALSSYARACTAKGVMLWGWRE-----HVCN-----KDVGS-CPNSQVFLYNLTTCQQTCRSLSEADSHCLEGFAPVDGCGCPDHTFLDEKGRCVPLAKCSCYH--RGLYLEAGDVVVRQEERCVCRDGRLHCRQI 752          

HSP 3 Score: 138.272 bits (347), Expect = 9.219e-32
Identity = 102/384 (26.56%), Postives = 180/384 (46.88%), Query Frame = 2
Query: 3035 ICKTWGETHYESFDGKYFEFQGSCSYVISEDFCGNKLGTFKLISENIACGXXXXXCTKSIK---------FIYLNRVFQFVRGSNPIVSRNTNYPPGGPTAFYWTSDVDTHFILFTMEGIQVKWDKAMSLEIMIPEKYQNKVCGLCGNFDLRIDNDMRARSGEIEKDI----VNFADSWKVHSSCPVPQKP-----PFMCSKRPDREPWAKAKCE-ILKSDSFKKCHDVVNVEHYYKRCVADACECDRGDDCVCFCTAVEQYVARCNEYEIGLK---WRTNENCPHTCTGKRVWKNCGNICPDSCIDIGKNVTDNTGCKKVCIEGCFCPDGLHWQ---NNECVERKACECVDPITNLKYNTGDKVIRECEECNCYEGAFRCTKL 4111
            +C TWG  HY++FDG  F F G C Y    +F  +  G++K  + ++  G   +     ++          IYL R    + G+   V    +Y PG           D +  +++  G+ + W++  +L + +  K++N  CGLCG++     N +++ S  +   +    + F +  K++    V + P     P  CS+        +A+CE +L +++F  C D+V +E Y + C  D C C  GD CV  C+ V ++  +C+    G +   WRT   CP TC G  V+   G+ C D+C     ++  ++ C++  ++GCFCP+G  +    ++ CV    C C   +    Y  G ++  +CE+C C  G + C  L
Sbjct:   36 VCSTWGNFHYKTFDGDVFRFPGLCDY----NFASDCRGSYKEFAVHLKRGPGQAEAPAGVESILLTIKDDTIYLTRHLAVLNGA---VVSTPHYSPG-----LLIEKSDAYTKVYSRAGLTLMWNREDALMLELDTKFRNHTCGLCGDY-----NGLQSYSEFLSDGVLFSPLEFGNMQKINQPDVVCEDPEEEVAPASCSEH-------RAECERLLTAEAFADCQDLVPLEPYLRACQQDRCRCPGGDTCV--CSTVAEFSRQCS--HAGGRPGNWRTATLCPKTCPGNLVYLESGSPCMDTC----SHLEVSSLCEEHRMDGCFCPEGTVYDDIGDSGCVPVSQCHCR--LHGHLYTPGQEITNDCEQCVCNAGRWVCKDL 385          
BLAST of von Willebrand factor vs. Ensembl Celegans
Match: T01D3.6 (pep chromosome:WBcel235:V:13716824:13720402:1 gene:WBGene00011330.1 transcript:T01D3.6b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:T01D3.6)

HSP 1 Score: 78.5666 bits (192), Expect = 4.291e-14
Identity = 87/378 (23.02%), Postives = 156/378 (41.27%), Query Frame = 2
Query: 1607 ISGDPHYITFDRRHFFFDGHCEYTAVM--TTSDNVLLSNSTIAPLSITIQNTNCQDNSETGCPRTIGVIIGEDEDQVAINLLSSSEIK-VNFVKISLP-YQHTGNTKVLIDQVSTDILRLKSETGVEILWNGGSRIEIKLS--KKYREKVT--GMCGNFNGNEMDDS-------MTFKGVDEKDIDKFVLSWKTNPTCESDRGIVEYKGA--CALSRSYSD-------YANKVCHKLYESE----EFKKCHSAAN--ADKFFDQCTHDVCTCGMKRNGALDHCECEAFSSYARQCALE----NINLSWRTNELCPKKCPNENMKYNQCGSRCTSTCRLLQESKCKEECIEGCFCPEGETFDE---AAKECVKISDCKC 2629
            +SGDPHY+T+D   F + G C Y      TT     L  S  A   +  +  +    SE          +  D   + I++   S+   VN V++  P Y    NT  +  + S     ++++ GV + +   + + +++    ++    T  G+ GN +G ++DD        +  K   + + +      KT  T  +D+ ++   G   C   ++  +        A++ C+ + ++E     F  C    N   + F+  C +D+C     RN A    +C  F+ + + C L      +N +WR    CP  CP  N   + C S C STC       C + C++GC C  G   D     + +C+++  C C
Sbjct:  190 MSGDPHYVTYDGLRFDYQGTCPYVFSQPCTTLPAPYLWYSVRAKNELPGKGYHISQVSE----------VEVDLHNLTIHVDGRSKTALVNGVQVLTPWYFPNKNTWTVRVRFSGSTFTIENDQGVVVTFTTYNSLCVQVPDIPEFNGATTLCGLAGNIDGKKLDDVVNKNGSVLAIKSSRQPENNNHADFMKTEDTWITDKFLILRPGQENCINGQTLDNNTNCDVATASQTCYPIQQAEMGLGTFGACQGLGNDTLEDFYYNCIYDIC-----RNPAF---KCTEFTYFLQYCQLALPQVAMNQNWRAQINCPLACP-LNAHPSTCTSSCPSTCAEPFPEYCDQGCVDGCECDPGYVIDNTVTGSIKCIRLDQCGC 548          

HSP 2 Score: 62.003 bits (149), Expect = 4.138e-9
Identity = 91/414 (21.98%), Postives = 149/414 (35.99%), Query Frame = 2
Query: 2963 ANCQNPCICKDGKWVCEQNKQCSGICKTW---GETHYESFDGKYFEFQGSCSYVISED--FCGNKLGTFKLISENIACGXXXXXCTKSIKFIYLNRVFQFVRGSNPIVSRN---TNYPPGGPTAFYWTSDVDTHFILFTME---GIQVKWDKAMSLEIMIPEKYQ----NKVCGLCGNFDLRIDNDMRARSGEI-------------EKDIVNFADSWKVHSSCPV-PQKPPFMCSKRPDRE-----PWAKAKCEILKS-----DSFKKCHDVVN--VEHYYKRCVADACECDRGDDCVCFCTAVEQYVARCNEYEIGLKWRTNENCPHTCTGKRVWKNCGNICPDSCIDIGKNVTDNTGCKKVCIEGCFCPDGLHWQNN-----ECVERKACECVDPITNLKYNTGDKVIREC 4066
            AN Q  CICK G       + C    +     G+ HY ++DG  F++QG+C YV S+           + + ++N   G        S   + L+ +   V G +     N      P   P    WT  V      FT+E   G+ V +    SL + +P+  +      +CGL GN D +  +D+  ++G +               D +   D+W       + P +   +  +  D         A   C  ++       +F  C  + N  +E +Y  C+ D C  +    C  F   ++       +  +   WR   NCP  C        C + CP +C +          C + C++GC C  G    N      +C+    C CVD   N        V + C
Sbjct:  160 ANHQLNCICKPGYTARRNGRDCDMKVQQACMSGDPHYVTYDGLRFDYQGTCPYVFSQPCTTLPAPYLWYSVRAKNELPGKGYHISQVSEVEVDLHNLTIHVDGRSKTALVNGVQVLTPWYFPNKNTWTVRVRFSGSTFTIENDQGVVVTFTTYNSLCVQVPDIPEFNGATTLCGLAGNIDGKKLDDVVNKNGSVLAIKSSRQPENNNHADFMKTEDTWITDKFLILRPGQENCINGQTLDNNTNCDVATASQTCYPIQQAEMGLGTFGACQGLGNDTLEDFYYNCIYDICR-NPAFKCTEFTYFLQYCQLALPQVAMNQNWRAQINCPLACPLNAHPSTCTSSCPSTCAEPFPEY-----CDQGCVDGCECDPGYVIDNTVTGSIKCIRLDQCGCVDSDGNAHRPGKPWVTQNC 567          
BLAST of von Willebrand factor vs. Ensembl Celegans
Match: T01D3.6 (pep chromosome:WBcel235:V:13716849:13720402:1 gene:WBGene00011330.1 transcript:T01D3.6a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:T01D3.6)

HSP 1 Score: 78.1814 bits (191), Expect = 5.481e-14
Identity = 89/390 (22.82%), Postives = 159/390 (40.77%), Query Frame = 2
Query: 1607 ISGDPHYITFDRRHFFFDGHCEYTAVM--TTSDNVLLSNSTIAPLSITIQNTNCQDNSETGCPRTIGVIIGEDEDQVAINLLSSSEIK-VNFVKISLP-YQHTGNTKVLIDQVSTDILRLKSETGVEILWNGGSRIEIKLS--KKYREKVT--GMCGNFNGNEMDDS-------MTFKGVDEKDIDKFVLSWKTNPTCESDRGIVEYKG-------------------ACALSRSYSDYA--NKVCHKLYESE----EFKKCHSAAN--ADKFFDQCTHDVCTCGMKRNGALDHCECEAFSSYARQCALE----NINLSWRTNELCPKKCPNENMKYNQCGSRCTSTCRLLQESKCKEECIEGCFCPEGETFDEAAK---ECVKISDCKC 2629
            +SGDPHY+T+D   F + G C Y      TT     L  S  A   +  +  +    SE          +  D   + I++   S+   VN V++  P Y    NT  +  + S     ++++ GV + +   + + +++    ++    T  G+ GN +G ++DD        +  K   + + +      KT  T  +D+ ++   G                   + +L++S +D A  ++ C+ + ++E     F  C    N   + F+  C +D+C     RN A    +C  F+ + + C L      +N +WR    CP  CP  N   + C S C STC       C + C++GC C  G   D       +C+++  C C
Sbjct:  190 MSGDPHYVTYDGLRFDYQGTCPYVFSQPCTTLPAPYLWYSVRAKNELPGKGYHISQVSE----------VEVDLHNLTIHVDGRSKTALVNGVQVLTPWYFPNKNTWTVRVRFSGSTFTIENDQGVVVTFTTYNSLCVQVPDIPEFNGATTLCGLAGNIDGKKLDDVVNKNGSVLAIKSSRQPENNNHADFMKTEDTWITDKFLILRPGQENCINGQTLDNNTNCVSTSISLAQSCADVATASQTCYPIQQAEMGLGTFGACQGLGNDTLEDFYYNCIYDIC-----RNPAF---KCTEFTYFLQYCQLALPQVAMNQNWRAQINCPLACP-LNAHPSTCTSSCPSTCAEPFPEYCDQGCVDGCECDPGYVIDNTVTGSIKCIRLDQCGC 560          

HSP 2 Score: 61.2326 bits (147), Expect = 6.681e-9
Identity = 89/412 (21.60%), Postives = 147/412 (35.68%), Query Frame = 2
Query: 2963 ANCQNPCICKDGKWVCEQNKQCSGICKTW---GETHYESFDGKYFEFQGSCSYVISED--FCGNKLGTFKLISENIACGXXXXXCTKSIKFIYLNRVFQFVRGSNPIVSRN---TNYPPGGPTAFYWTSDVDTHFILFTME---GIQVKWDKAMSLEIMIPEKYQ----NKVCGLCGNFDLRIDNDMRARSGEI-------------EKDIVNFADSWK--------------------------VHSSCPVPQKPPFMCSKRPDREPWAKAKCEILKSDSFKKCHDVVN--VEHYYKRCVADACECDRGDDCVCFCTAVEQYVARCNEYEIGLKWRTNENCPHTCTGKRVWKNCGNICPDSCIDIGKNVTDNTGCKKVCIEGCFCPDGLHWQNN-----ECVERKACECVD 4015
            AN Q  CICK G       + C    +     G+ HY ++DG  F++QG+C YV S+           + + ++N   G        S   + L+ +   V G +     N      P   P    WT  V      FT+E   G+ V +    SL + +P+  +      +CGL GN D +  +D+  ++G +               D +   D+W                           V +S  + Q    + +      P  +A+   +   +F  C  + N  +E +Y  C+ D C  +    C  F   ++       +  +   WR   NCP  C        C + CP +C +          C + C++GC C  G    N      +C+    C CVD
Sbjct:  160 ANHQLNCICKPGYTARRNGRDCDMKVQQACMSGDPHYVTYDGLRFDYQGTCPYVFSQPCTTLPAPYLWYSVRAKNELPGKGYHISQVSEVEVDLHNLTIHVDGRSKTALVNGVQVLTPWYFPNKNTWTVRVRFSGSTFTIENDQGVVVTFTTYNSLCVQVPDIPEFNGATTLCGLAGNIDGKKLDDVVNKNGSVLAIKSSRQPENNNHADFMKTEDTWITDKFLILRPGQENCINGQTLDNNTNCVSTSISLAQSCADVATASQTCYPIQQAE---MGLGTFGACQGLGNDTLEDFYYNCIYDICR-NPAFKCTEFTYFLQYCQLALPQVAMNQNWRAQINCPLACPLNAHPSTCTSSCPSTCAEPFPEY-----CDQGCVDGCECDPGYVIDNTVTGSIKCIRLDQCGCVD 562          
BLAST of von Willebrand factor vs. Ensembl Celegans
Match: apx-1 (Anterior pharynx in excess protein 1 [Source:UniProtKB/Swiss-Prot;Acc:P41990])

HSP 1 Score: 68.1662 bits (165), Expect = 4.046e-11
Identity = 28/49 (57.14%), Postives = 34/49 (69.39%), Query Frame = 2
Query:  239 CSLGWQGNRCSDPICVGGCSNGGKCVAPNQCLCLDNYSGPNCNTLLIKS 385
            CS GW G  CS+PIC GGCSN G+CVAPNQC C D ++G  C   L ++
Sbjct:  163 CSAGWSGEDCSNPICAGGCSNRGRCVAPNQCSCADGFNGTRCEQCLPRA 211          
BLAST of von Willebrand factor vs. Ensembl Celegans
Match: ten-1 (Teneurin-1 [Source:UniProtKB/Swiss-Prot;Acc:G5EGQ6])

HSP 1 Score: 64.3142 bits (155), Expect = 9.759e-10
Identity = 25/55 (45.45%), Postives = 32/55 (58.18%), Query Frame = 2
Query:  203 CVNGVC-KDGRCSCSLGWQGNRCSDPICVGGCSNGGKCVAPNQCLCLDNYSGPNC 364
            CVNG C  DG C C  GW+G+ C+D  C  GC + GKC +   C C   ++G NC
Sbjct:  740 CVNGDCLDDGSCQCWKGWRGSNCTDKKCAIGCEDRGKCASDGSCKCSSGWNGENC 794          
BLAST of von Willebrand factor vs. Ensembl Celegans
Match: ten-1 (Teneurin-1 [Source:UniProtKB/Swiss-Prot;Acc:G5EGQ6])

HSP 1 Score: 64.3142 bits (155), Expect = 9.786e-10
Identity = 25/55 (45.45%), Postives = 32/55 (58.18%), Query Frame = 2
Query:  203 CVNGVC-KDGRCSCSLGWQGNRCSDPICVGGCSNGGKCVAPNQCLCLDNYSGPNC 364
            CVNG C  DG C C  GW+G+ C+D  C  GC + GKC +   C C   ++G NC
Sbjct:  814 CVNGDCLDDGSCQCWKGWRGSNCTDKKCAIGCEDRGKCASDGSCKCSSGWNGENC 868          
BLAST of von Willebrand factor vs. Ensembl Fly
Match: Hml (gene:FBgn0029167 transcript:FBtr0333020)

HSP 1 Score: 454.907 bits (1169), Expect = 8.255e-130
Identity = 358/1265 (28.30%), Postives = 561/1265 (44.35%), Query Frame = 2
Query:  458 CSVIYGHHIKTFDGNVFSYPLRGGYTLFMDCLGAAPLFYVYFNASYDCFDQKTQNDCSISMKITVGTQTIILFPKNEFALVKNN----KTKIPFNSEGIIVSSVGSFIKIKGIDDLEILFDRDRNIYVYAPVTAEK--KICGLCGYFNGIMSDDYRDFNQVIQKNVKTFVNSWIDRDPSDL-----NVYREREQYPCNALKLKNNDQYQKALTLCQDMVKNNLGRTCQSEVKIDKYLDMCQDEICECLQTQPENSTIENCYSTFCKIEEQYSYACTLKGIAVD--WRSATTICKQPQCFNGQEFSECGSNCGKNCGQLGMELECESQCLPGCYCPRNRYWDGTMCVPQEKCPCVRDNGESTYQQGYRLKLNCETCICGMHGKWQCIENEECEGRCFISGDPHYITFDRRHFFFDGHCEYTAVMTTSDNVLLSNSTIAPLSITIQNTNCQDNSETGCPRTIGV-IIGEDEDQVAINLLSSSEIKVNFVKISLPYQHTGNTKVLIDQVSTDILRLKSETGVEILWNGGSRIEIKLSKKYREKVTGMCGNFNGNEMDDSMTFKGVDEKDIDKFVLSWKTNPTCESDRGIVEYKGACALSRSYSDYANKVCHKLYESEEFKKCHSAANADKFFDQCTHDVCTCGMKRNGALDHCECEAFSSYARQCALENINLSWRTN-ELCPKKCPNENMKYNQCGSRCTSTCR-LLQESKCKEECIEGCFCPEGETFDEAAKECVKISDCKCEFHGRFYLP--YEIR--QDRCNNCTCTNGNWICTSNDCEGKEFCPKS---------MAWFDCGICQ----KTCTNLDLVCPKGQCQLPGCFCPENTVLHNGE--CIKPFECPCYMNNKMYSENDTIVRGPANCQNPCICKDGKWVCEQNKQCSGICKTWGETHYESFDGKYFEFQGSCSYVISEDFCGNKLGTFKLISENIACGXXXXXCTKSIKFIYLNRVFQ-FVRGSNPIVSRNTNYPP----------GGPTAFYWTSDVDTHFILFTMEGIQVKWDKAMSLEIMIPEKYQNKVCGLCGNFDLRIDNDMRARSGEIEKDIVNFADSWKVHSSCPVPQKPPFMCSKRPDREPWAKAKCEILKSDSFKKCHDVVNVEHYYKRCVADACECDRGDDCVCFCTAVEQYVARCNEYEIGLKWRTNENCPHTCTGK-RVWKNCGNICPDSCID--IGKNVTDNTGCKKVCIEGCF---CPDGLHWQNN---ECVERKACECVDPITNLK-YNTGDKVIRE-CEECNC 4081
            C+   G ++KTFDG VF  PL   +TL  D +         F+         +   C+ ++KI    Q+++   +N    ++      K  +P    G+ V  V   ++I  ++ + +  D D   YV      +   K+ GLCG  +G  + D           VK F ++W   D S+L     +   E     C   KL      QKA+++C+ ++ N     C      D  +  C  + C C       +  E+  S  C      +  C  KGI ++  WR+   IC    C  G+ +  CG N    C         +  C  GC+CP         C+ +E CPC     E  ++    +K NC TC C  +G+W+C E++ C  RC   GDPHY TFD + + F G C Y  + T + +V   N  +A      ++ N     +  C + + +  I  D     I L       VN   I+   +  G  +VLI + S+  L ++   G+ + W+G SR+ I      R +  G+CG FN N  DD +T +G  E  ++ F   W+T  TC+      +    C L+      A K C  + + + F+ CH     ++F++ C +D C C       +  C C   S+Y  +C  + +   WR + + C  KCP   + +++CG  C  +C  L  +  CK EC+EGC CP GE  +E   ECV    C C F G  + P   E+R  +   + CTCT+G W C   +   K+  P S           + +   C     KTC N+D         LPGC C E  V       C+ P  C C+   K Y + + I     +C N C C+ G W C +N  C   C  WG++H+ +FDG  F+FQG+C YV+++    N  G F +  +N+ CG+   +C+KS++        +  +  ++   S + N  P           G  AF+         +      +QVKWD+   + + +  +++ KV GLCGN++    +DM+  S  +E   + F  +WK+   C  P  P   C K P+RE WA+ KC  LKSD FK+CH  V +E ++KRC+ D C CD+G DC C CTAV  Y   C +  I ++WR+   CP  C      +K C   C     D  + + + +    ++ C+EGC    C DG  + N+   +CV +  C+ V  + + K +  GD    + C  C C
Sbjct:  484 CTTWGGINMKTFDGLVFKAPLSCSHTLITDKVSGT------FDIILKACPYGSGYGCAHTLKIL--WQSVLYTFENLNGTMQLTTPIKKLPMPVQVMGMKVMPVAQHVQID-LESVGLKLDWDHRQYVSVQAGPQMWGKVGGLCGTLDGDPNTDLTSRTGKKLATVKAFADAWRVEDRSELCQVENSAEMEFGMDSCEQSKL------QKAVSVCERLLANEKLGDCIKPFNYDALIRTCMADYCNC-------ANREHPESCNCDAIAMLAKECAFKGIKLEHGWRN-LEICPI-SCGFGRVYQACGPNVEPTCDSDLALPASKGACNEGCFCPEGTVQYKEACITRELCPCSLRGKE--FKPESTVKKNCNTCTC-KNGQWRCTEDK-CGARCGAVGDPHYQTFDGKRYDFMGKCSYHLLKTQNTSVEAEN--VACSGAVSESMNFAAPDDPSCTKAVTIRFILRDGTPSVIKLDQGLTTIVNDKPIAKLPKMLGLGEVLIRRASSTFLTVEFADGIRVWWDGVSRVYIDAPPSLRGQTQGLCGTFNSNTQDDFLTPEGDVETAVEPFADKWRTKDTCQFKAETHQGPHPCTLNPEKKAQAEKFCDWILQ-DIFQDCHFLVEPEQFYEDCLYDTCAC----KDEMSKCFCPILSAYGTECMRQGVKTGWRMSVKECAVKCPLGQV-FDECGDGCALSCDDLPSKGSCKRECVEGCRCPHGEYVNEDG-ECVPKKMCHCNFDGMSFRPGYKEVRPGEKFLDLCTCTDGVWDCQDAEPGDKDKYPPSSELRSKCAKQPYAEFTKCAPKEPKTCKNMDKYVADSSDCLPGCVCMEGYVYDTSRLACVLPANCSCHHAGKSYDDGEKIKE---DC-NLCECRAGNWKCSKNG-CESTCSVWGDSHFTTFDGHDFDFQGACDYVLAKGVFDNGDG-FSITIQNVLCGTMGVTCSKSLEIALTGHAEESLLLSADSAYSTDPNKTPIKKLRDSVNSKGHNAFHIYKAGVFVVVEVIPLKLQVKWDEGTRVYVKLGNEWRQKVSGLCGNYNGNSLDDMQTPSMGLETSPMLFGHAWKLQPHCSAPVAPIDACKKHPERETWAQLKCGALKSDLFKECHAEVPLERFWKRCIFDTCACDQGGDCECLCTAVAAYADACAQKGINIRWRSQHFCPMQCDPHCSDYKACTPACAVETCDNFLDQGIAERMCNRENCLEGCHIKPCEDGFIYLNDTYRDCVPKAECKPVCMVRDGKTFYEGDITFTDSCATCRC 1705          

HSP 2 Score: 168.703 bits (426), Expect = 3.343e-41
Identity = 141/491 (28.72%), Postives = 220/491 (44.81%), Query Frame = 2
Query: 1325 EFSECGSNCGKNCGQLGMELECESQCLPGCYCPRNRYWDGT--MCVPQEKCPCVRDNGESTYQQGYRLKLNCETCICGMHGKWQCIENEECEGRCFISGDPHYITFDRRHFFFDGHCEYTAVMTTSDNVLLSNSTIAPLSITIQNTNCQDNSETGCPRTIGV-IIGEDEDQVAINL---LSSSEIKVNFVKISLPYQHTGNTKVLIDQVSTDILRLKSETGVEILWNGGSRIEIKLSKKYREKVTGMCGNFNGNEMDDSMTFKGVDEKDIDKFVLSWKTNPTCESDRGIVEYKGACALSRSYSDYANKVCHKLYESEEFKKCHSAANADKFFDQCTHDVCTCGMKRNGALDHCECEAFSSYARQCALENINLSWRTNELCPKKCPNENMKYNQCGSRCT-STC-----RLLQESKC-KEECIEGCF---CPEGETF-DEAAKECVKISDCKCEFHGR----FYLPYEIRQDRCNNCTCTNGNWICTSNDCE 2734
            EF++C     K C  +   +   S CLPGC C     +D +   CV    C C   +   +Y  G ++K +C  C C   G W+C +N  CE  C + GD H+ TFD   F F G C+Y       DN           SITIQN  C     T C +++ + + G  E+ + ++     S+   K    K+       G+    I +    ++       +++ W+ G+R+ +KL  ++R+KV+G+CGN+NGN +DD  T     E     F  +WK  P C +    ++   AC        +A   C  L +S+ FK+CH+    ++F+ +C  D C C     G    C C A ++YA  CA + IN+ WR+   CP +C      Y  C   C   TC     + + E  C +E C+EGC    C +G  + ++  ++CV  ++CK     R    FY       D C  C C+    IC+   C+
Sbjct: 1247 EFTKCAPKEPKTCKNMDKYVADSSDCLPGCVCMEGYVYDTSRLACVLPANCSC--HHAGKSYDDGEKIKEDCNLCEC-RAGNWKCSKNG-CESTCSVWGDSHFTTFDGHDFDFQGACDYVLAKGVFDNG-------DGFSITIQNVLCGTMGVT-CSKSLEIALTGHAEESLLLSADSAYSTDPNKTPIKKLRDSVNSKGHNAFHIYKAGVFVVVEVIPLKLQVKWDEGTRVYVKLGNEWRQKVSGLCGNYNGNSLDDMQTPSMGLETSPMLFGHAWKLQPHCSAPVAPID---ACKKHPERETWAQLKCGAL-KSDLFKECHAEVPLERFWKRCIFDTCACD---QGGDCECLCTAVAAYADACAQKGINIRWRSQHFCPMQCDPHCSDYKACTPACAVETCDNFLDQGIAERMCNRENCLEGCHIKPCEDGFIYLNDTYRDCVPKAECKPVCMVRDGKTFYEGDITFTDSCATCRCSKRKEICSGVKCD 1718          

HSP 3 Score: 146.362 bits (368), Expect = 1.850e-34
Identity = 207/852 (24.30%), Postives = 323/852 (37.91%), Query Frame = 2
Query:  467 IYGHHIKTFDGNVFSYPLRGGYTLFMDCLGAAPLFYVYFNASYDCFDQKTQNDCS--ISMKITVGTQTIILFPK-----NEFALVKNNKTKIPFNSEGIIVSSVG-SFIKIKGIDDLEILFDRDRNIYVYAPVTAEKKICGLCGYFNGIMSDDYRDFNQVIQKNVKTFVNSWID-RDPSDLNVYREREQYPCNALKLKNNDQYQKALTLCQDMVKNNLGRTCQSEVKIDKYLD-MCQDEICECLQTQPENSTIENCYSTFCKIEEQYSYACTLKGIAVD---WRSATTI---CKQP----QCFNGQEFSECGSNCGKNCGQLGMELECESQCLPGCYCPRNRYWDGTMCVPQEKCPCVRDNGESTYQQGYRLKLNCETCICGMHGKWQCIENEECEGRCFISGDPHYITFDRRHFFFDGHCEYTAVMTTSDNVLLSNSTIAPLSITIQNTNCQDNSET----------GCPRTIGVIIGEDEDQVAINLLSSSEIKV---NFVKISLPYQHTGNTKVLIDQVSTDILRLKSETGVEILWNGGSRIEIKL---SKKYREKVTGMCGNFNGNEMDDSMTFKGVDEKDIDKFVLSWKTNPTCESDRGIVEYKGACALSRSY---SDYANKVCHKLYESEEFKKCHSAANADKFFDQCTHDVCTCGMKRNGALDHCECEAFSSYARQCALENINLSWRTNELCPKKCPNENMKYNQCG-SRCTSTCRLLQE--------------SKCKEECI-----EGCFCPEGETFDEAAKECV-KISDCKCEFHGRFYLPYE-IRQDRCNNCTC-TNGNWICTSNDCEGKE-FCPKSMAWFDCGICQKTCTNLDLVCPKGQC 2833
            I G    TFDG VF Y     + L  D   ++    V+   S      +T+  C   I+++ T     +IL P      N +          P      +VS  G + + +       +  D    + V       + + GLCGY+NG   DD R  +  I  N + F +SW D R P D           C  LK     Q  KAL LC  +      R C   V   ++L+  C +  C C+     N     C    C I E +   C      V    WR+       C  P     C+  +    C +  G +C  L         C PGCYCP      G  CVP  +C                     + C+C   G  +                  Y+T+DR+ F F+G+C Y          LLS   + P   T Q     D+ +            C +++ ++ G+    V         ++V    F    +PY+ +  +  L   V  +++    E+ VE+  +    I   L   S KY  K+ G+CG+ NGN  +D        +  +D  + SW+ +   E   G+VE   +  + + +          C + Y +E F KC  A +   +   C  D+C  G  + G      C A ++YA++C    I  +WR  +LCP +CP+ +M Y  CG ++   T + L E               K  E C+     EGCFCP G+  D    +CV +I+  KC+     +LP E  ++D+C  C C + G   C    C+ +E  C +       G   +T  ++D  CP+ +C
Sbjct: 2704 ISGKSFTTFDGTVFKYG-PCSHILARDIHSSSWSISVHQQCS-----DETRKVCHKVITIQDTEAGNELILLPHLKLKFNGYEFTVQQLINSPICKASFVVSQPGKTLLAVSTKYGFWVQLDDIGIVKVGISSKFIRTVDGLCGYYNGNQKDDKRSPDGQIIPNTEKFGDSWYDKRIPKDQ----------CGDLKCPREMQ-AKALQLCNIIHHPTFAR-CHKAVNYKQFLNNYCLEAACNCMMAN--NGDPAACK---CNILESFVKKCLSVNPLVQLTTWRAVAQCEINCPSPLVHTDCYKRRCEPSCDNVHGDDCPVL------PDACFPGCYCPEGTVRKGPNCVPISEC---------------------KDCVCNSLGASK------------------YMTYDRKSFSFNGNCTY----------LLSRDVVLPGVHTFQVYVSMDDCKKLGQPTPVEGGSCAKSLHILNGDHVIHVQRVPQKPKSLQVLVDGFEVKKIPYKDSWIS--LRQVVGKELVLSLPESHVELTASFEDLI-FSLGVPSIKYGSKMEGLCGDCNGNAGNDLQPNPAKKKAGVD-VIQSWQAD---EPKLGLVEECLSEDVPKEHCIPLPPEKDPCLQFYNAELFGKCPLAVDPIAYVSACQQDICKPGNTQQGV-----CVALAAYAKECNQHGICTNWRRPQLCPYECPS-DMVYEPCGCAKNCDTIKALSEFDAVSLKNEAVVHTVKTDEMCLSSERFEGCFCPPGKVMD--GGQCVPEIACTKCD--DGLHLPDEKWKKDKCTECQCDSKGKTTCVEKKCQVEENICAE-------GYRPETIVSVDECCPRYRC 3453          

HSP 4 Score: 118.627 bits (296), Expect = 5.055e-26
Identity = 100/373 (26.81%), Postives = 160/373 (42.90%), Query Frame = 2
Query: 3032 GICKTWGETHYESFDGKYFEFQGSCSYVISEDFCGNKLGTFKLISENIACGXXXXXCTKSIKFIYLNRVFQF--VRGSNPIVSRNTNYPPGGPTAFYWTSDVDTHF-ILFTMEGIQVKWDKAMSLEIMIPEKYQNKVCGLCGNFDLRIDNDMRARSGEIEKDIVNFADSWKVHSS---CPVPQKPPF---MCSKRPDREPWAKAKCE-ILKSDSFKKCHDVVNVEHYYKRCVADACEC-DRGDDCVCFCTAVEQYVARCNEYEIGLK--WRTNENCPHTCTGKRVWKNCG-NICPDSCIDIGKNVTDNTGCKKVCIEGCFCPDGLHWQNNECVERKACECVDPITNLKYNTGDKVIRECEECNCYEGAFRCTK 4108
             +C TWG  + ++FDG  F+   SCS+ +  D      GTF +I +    G S   C  ++K ++ + ++ F  + G+  + +     P            V  H  I     G+++ WD    + +    +   KV GLCG  D   + D+ +R+G+    +  FAD+W+V      C V         M S    +   A + CE +L ++    C    N +   + C+AD C C +R     C C A+      C    I L+  WR  E CP +C   RV++ CG N+ P    D+    +     K  C EGCFCP+G       C+ R+ C C   +   ++     V + C  C C  G +RCT+
Sbjct:  482 ALCTTWGGINMKTFDGLVFKAPLSCSHTLITDKVS---GTFDIILKACPYG-SGYGCAHTLKILWQSVLYTFENLNGTMQLTTPIKKLPMPVQVMGMKVMPVAQHVQIDLESVGLKLDWDHRQYVSVQAGPQMWGKVGGLCGTLDGDPNTDLTSRTGKKLATVKAFADAWRVEDRSELCQVENSAEMEFGMDSCEQSKLQKAVSVCERLLANEKLGDCIKPFNYDALIRTCMADYCNCANREHPESCNCDAIAMLAKECAFKGIKLEHGWRNLEICPISCGFGRVYQACGPNVEPTCDSDLALPAS-----KGACNEGCFCPEGTVQYKEACITRELCPCS--LRGKEFKPESTVKKNCNTCTCKNGQWRCTE 843          

HSP 5 Score: 100.523 bits (249), Expect = 1.699e-20
Identity = 91/386 (23.58%), Postives = 161/386 (41.71%), Query Frame = 2
Query: 1508 QGYRLKLNCETCICGMHGKWQCIENEECEGRCFISGDPHYITFDRRHFFFDGHCEYTAVMTTSDNVLLSNSTIAPLSITIQNTNCQDNSETGCPRTIGVIIGEDEDQVAINLLSSSEIKVNFVKISLPYQHTGNTKV-----LIDQVSTDILRLKSETGVEILWNGGSRIEIKLSKKYREKVTGMCGNFNGNEMDDSMTFKGVDEKDIDKFVLSWKTNPTCESDRGIVEYK-GACALSRSYSDYANKVCHKLYESEEFKKCHSAANADKFFDQ-CTHDVCTCGMKRNGALDHCECEAFSSYARQCALEN--INL-SWRTNELCPKKCPNENMKYNQCGSRCTSTCRLLQESKC---KEECIEGCFCPEGETFDEAAKECVKISDCK 2626
            + Y ++L+      G   ++ C+     +  C ISG   + TFD   F + G C +         +L  +   +  SI++    C D +   C + I +     + +    L+    +K+ F       Q   N+ +     ++ Q    +L + ++ G  +  +    +++ +S K+   V G+CG +NGN+ DD  +  G    + +KF  SW        D+ I + + G     R     A ++C+ ++    F +CH A N  +F +  C    C C M  NG    C+C    S+ ++C   N  + L +WR    C   CP+  +  +    RC  +C  +    C    + C  GC+CPEG         CV IS+CK
Sbjct: 2671 EKYDVELDMSASKVGDCLRYSCVLRPNKDDVCEISGK-SFTTFDGTVFKY-GPCSH---------ILARDIHSSSWSISVHQ-QCSDETRKVCHKVITI----QDTEAGNELILLPHLKLKFNGYEFTVQQLINSPICKASFVVSQPGKTLLAVSTKYGFWVQLDDIGIVKVGISSKFIRTVDGLCGYYNGNQKDDKRSPDGQIIPNTEKFGDSW-------YDKRIPKDQCGDLKCPREMQAKALQLCNIIHHP-TFARCHKAVNYKQFLNNYCLEAACNCMMANNGDPAACKCNILESFVKKCLSVNPLVQLTTWRAVAQCEINCPSPLVHTDCYKRRCEPSCDNVHGDDCPVLPDACFPGCYCPEGTV--RKGPNCVPISECK 3030          

HSP 6 Score: 84.7297 bits (208), Expect = 1.033e-15
Identity = 115/493 (23.33%), Postives = 178/493 (36.11%), Query Frame = 2
Query: 2747 CPKSMAWFDC--GICQKTCTNL---DLVCPKGQCQLPGCFCPENTVLHNGECIKPFECPCYMNNKMYSENDTIVRGPANCQNPCICKDGKWVCEQNKQCSGICKTWGETHYESFDGKYFEFQGSCSYVISEDFCGNKLGTFKLISENIACGXXXX-------XCTKSIKFIYLNRVFQFVRGSNPIVSRNTNYPPGG------PTAFYWTS--DVDTHFILFTMEGIQVKWDKA---MSLEIMIPE-KYQNKVCGLCGNFDLRIDNDMRARSGEIEKDIVNFADSWKVHSS-------CPVPQKPPFMCSKRPDREPWAKAKCEILKSDSFKKCHDVVNVEHYYKRCVADACECDRGDDCVCFCTAVEQYVARCNEYEIGLKWRTNENCPHTCTGKRVWKNCGNICPDSCIDI------------GKNVTDNTGCKKVCI-----EGCFCPDGLHWQNNECVERKACECVDPITNLKYNTGDKVIRECEECNC 4081
            CP  +   DC    C+ +C N+   D       C  PGC+CPE TV     C+   EC                                      K C  +C + G + Y ++D K F F G+C+Y++S D     + TF++      C            SC KS+  +  + V    R   P   ++      G      P    W S   V    ++ ++    V+   +   +   + +P  KY +K+ GLCG+ +    ND++    + +K  V+   SW+           C     P   C   P   P      +   ++ F KC   V+   Y   C  D C+   G+     C A+  Y   CN++ I   WR  + CP+ C    V++ CG  C  +C  I             + V       ++C+     EGCFCP G      +CV   AC   D   +L      K   +C EC C
Sbjct: 2973 CPSPLVHTDCYKRRCEPSCDNVHGDDCPVLPDAC-FPGCYCPEGTVRKGPNCVPISEC--------------------------------------KDC--VCNSLGASKYMTYDRKSFSFNGNCTYLLSRDVVLPGVHTFQVYVSMDDCKKLGQPTPVEGGSCAKSLHILNGDHVIHVQR--VPQKPKSLQVLVDGFEVKKIPYKDSWISLRQVVGKELVLSLPESHVELTASFEDLIFSLGVPSIKYGSKMEGLCGDCNGNAGNDLQPNPAK-KKAGVDVIQSWQADEPKLGLVEECLSEDVPKEHCIPLP---PEKDPCLQFYNAELFGKCPLAVDPIAYVSACQQDICK--PGNTQQGVCVALAAYAKECNQHGICTNWRRPQLCPYECPSDMVYEPCG--CAKNCDTIKALSEFDAVSLKNEAVVHTVKTDEMCLSSERFEGCFCPPGKVMDGGQCVPEIACTKCDDGLHLPDEKWKK--DKCTECQC 3412          

HSP 7 Score: 83.5741 bits (205), Expect = 1.891e-15
Identity = 95/361 (26.32%), Postives = 148/361 (41.00%), Query Frame = 2
Query: 3035 ICKTWGETHYESFDGKYFEFQGSCSYVISEDFCGNKLGTFKLISENIACG-XXXXXCTKSI---------KFIYLNRVFQFVRGSNPIVSRNTNYPPGGPTAFYWTSDVDTHFILFTMEGIQVKWDKAMSLEIMIPEKYQNKVCGLCGNFDLRIDNDMRARSGEIEKDIVNFADSWKVHSSCPVPQKPPFMCSKRPDREPWAKA--KCEILKSDSFKKCHDVVNVEHYYKR-CVADACEC---DRGDDCVCFCTAVEQYVARC---NEYEIGLKWRTNENCPHTCTGKRVWKNC-GNICPDSCIDIGKNVTDNTGCKKVCIEGCFCPDGLHWQNNECVERKAC-ECV-DPITNLKYNTGDK 4051
            +C+  G++ + +FDG  F++ G CS++++ D   +       IS +  C   +   C K I         + I L  +     G    V +  N P     +F  +    T   + T  G  V+ D    +++ I  K+   V GLCG ++    +D R+  G+I  +   F DSW      P  Q     C     RE  AKA   C I+   +F +CH  VN + +    C+  AC C   + GD   C C  +E +V +C   N       WR    C   C    V  +C    C  SC ++  +  D       C  GC+CP+G   +   CV    C +CV + +   KY T D+
Sbjct: 2701 VCEISGKS-FTTFDGTVFKY-GPCSHILARDIHSSSWS----ISVHQQCSDETRKVCHKVITIQDTEAGNELILLPHLKLKFNGYEFTVQQLINSPICK-ASFVVSQPGKTLLAVSTKYGFWVQLDDIGIVKVGISSKFIRTVDGLCGYYNGNQKDDKRSPDGQIIPNTEKFGDSW-YDKRIPKDQCGDLKCP----REMQAKALQLCNIIHHPTFARCHKAVNYKQFLNNYCLEAACNCMMANNGDPAACKCNILESFVKKCLSVNPLVQLTTWRAVAQCEINCPSPLVHTDCYKRRCEPSCDNVHGD--DCPVLPDACFPGCYCPEGTVRKGPNCVPISECKDCVCNSLGASKYMTYDR 3047          
BLAST of von Willebrand factor vs. Ensembl Fly
Match: Hml (gene:FBgn0029167 transcript:FBtr0075753)

HSP 1 Score: 454.521 bits (1168), Expect = 1.032e-129
Identity = 358/1265 (28.30%), Postives = 561/1265 (44.35%), Query Frame = 2
Query:  458 CSVIYGHHIKTFDGNVFSYPLRGGYTLFMDCLGAAPLFYVYFNASYDCFDQKTQNDCSISMKITVGTQTIILFPKNEFALVKNN----KTKIPFNSEGIIVSSVGSFIKIKGIDDLEILFDRDRNIYVYAPVTAEK--KICGLCGYFNGIMSDDYRDFNQVIQKNVKTFVNSWIDRDPSDL-----NVYREREQYPCNALKLKNNDQYQKALTLCQDMVKNNLGRTCQSEVKIDKYLDMCQDEICECLQTQPENSTIENCYSTFCKIEEQYSYACTLKGIAVD--WRSATTICKQPQCFNGQEFSECGSNCGKNCGQLGMELECESQCLPGCYCPRNRYWDGTMCVPQEKCPCVRDNGESTYQQGYRLKLNCETCICGMHGKWQCIENEECEGRCFISGDPHYITFDRRHFFFDGHCEYTAVMTTSDNVLLSNSTIAPLSITIQNTNCQDNSETGCPRTIGV-IIGEDEDQVAINLLSSSEIKVNFVKISLPYQHTGNTKVLIDQVSTDILRLKSETGVEILWNGGSRIEIKLSKKYREKVTGMCGNFNGNEMDDSMTFKGVDEKDIDKFVLSWKTNPTCESDRGIVEYKGACALSRSYSDYANKVCHKLYESEEFKKCHSAANADKFFDQCTHDVCTCGMKRNGALDHCECEAFSSYARQCALENINLSWRTN-ELCPKKCPNENMKYNQCGSRCTSTCR-LLQESKCKEECIEGCFCPEGETFDEAAKECVKISDCKCEFHGRFYLP--YEIR--QDRCNNCTCTNGNWICTSNDCEGKEFCPKS---------MAWFDCGICQ----KTCTNLDLVCPKGQCQLPGCFCPENTVLHNGE--CIKPFECPCYMNNKMYSENDTIVRGPANCQNPCICKDGKWVCEQNKQCSGICKTWGETHYESFDGKYFEFQGSCSYVISEDFCGNKLGTFKLISENIACGXXXXXCTKSIKFIYLNRVFQ-FVRGSNPIVSRNTNYPP----------GGPTAFYWTSDVDTHFILFTMEGIQVKWDKAMSLEIMIPEKYQNKVCGLCGNFDLRIDNDMRARSGEIEKDIVNFADSWKVHSSCPVPQKPPFMCSKRPDREPWAKAKCEILKSDSFKKCHDVVNVEHYYKRCVADACECDRGDDCVCFCTAVEQYVARCNEYEIGLKWRTNENCPHTCTGK-RVWKNCGNICPDSCID--IGKNVTDNTGCKKVCIEGCF---CPDGLHWQNN---ECVERKACECVDPITNLK-YNTGDKVIRE-CEECNC 4081
            C+   G ++KTFDG VF  PL   +TL  D +         F+         +   C+ ++KI    Q+++   +N    ++      K  +P    G+ V  V   ++I  ++ + +  D D   YV      +   K+ GLCG  +G  + D           VK F ++W   D S+L     +   E     C   KL      QKA+++C+ ++ N     C      D  +  C  + C C       +  E+  S  C      +  C  KGI ++  WR+   IC    C  G+ +  CG N    C         +  C  GC+CP         C+ +E CPC     E  ++    +K NC TC C  +G+W+C E++ C  RC   GDPHY TFD + + F G C Y  + T + +V   N  +A      ++ N     +  C + + +  I  D     I L       VN   I+   +  G  +VLI + S+  L ++   G+ + W+G SR+ I      R +  G+CG FN N  DD +T +G  E  ++ F   W+T  TC+      +    C L+      A K C  + + + F+ CH     ++F++ C +D C C       +  C C   S+Y  +C  + +   WR + + C  KCP   + +++CG  C  +C  L  +  CK EC+EGC CP GE  +E   ECV    C C F G  + P   E+R  +   + CTCT+G W C   +   K+  P S           + +   C     KTC N+D         LPGC C E  V       C+ P  C C+   K Y + + I     +C N C C+ G W C +N  C   C  WG++H+ +FDG  F+FQG+C YV+++    N  G F +  +N+ CG+   +C+KS++        +  +  ++   S + N  P           G  AF+         +      +QVKWD+   + + +  +++ KV GLCGN++    +DM+  S  +E   + F  +WK+   C  P  P   C K P+RE WA+ KC  LKSD FK+CH  V +E ++KRC+ D C CD+G DC C CTAV  Y   C +  I ++WR+   CP  C      +K C   C     D  + + + +    ++ C+EGC    C DG  + N+   +CV +  C+ V  + + K +  GD    + C  C C
Sbjct:  485 CTTWGGINMKTFDGLVFKAPLSCSHTLITDKVSGT------FDIILKACPYGSGYGCAHTLKIL--WQSVLYTFENLNGTMQLTTPIKKLPMPVQVMGMKVMPVAQHVQID-LESVGLKLDWDHRQYVSVQAGPQMWGKVGGLCGTLDGDPNTDLTSRTGKKLATVKAFADAWRVEDRSELCQVENSAEMEFGMDSCEQSKL------QKAVSVCERLLANEKLGDCIKPFNYDALIRTCMADYCNC-------ANREHPESCNCDAIAMLAKECAFKGIKLEHGWRN-LEICPI-SCGFGRVYQACGPNVEPTCDSDLALPASKGACNEGCFCPEGTVQYKEACITRELCPCSLRGKE--FKPESTVKKNCNTCTC-KNGQWRCTEDK-CGARCGAVGDPHYQTFDGKRYDFMGKCSYHLLKTQNTSVEAEN--VACSGAVSESMNFAAPDDPSCTKAVTIRFILRDGTPSVIKLDQGLTTIVNDKPIAKLPKMLGLGEVLIRRASSTFLTVEFADGIRVWWDGVSRVYIDAPPSLRGQTQGLCGTFNSNTQDDFLTPEGDVETAVEPFADKWRTKDTCQFKAETHQGPHPCTLNPEKKAQAEKFCDWILQ-DIFQDCHFLVEPEQFYEDCLYDTCAC----KDEMSKCFCPILSAYGTECMRQGVKTGWRMSVKECAVKCPLGQV-FDECGDGCALSCDDLPSKGSCKRECVEGCRCPHGEYVNEDG-ECVPKKMCHCNFDGMSFRPGYKEVRPGEKFLDLCTCTDGVWDCQDAEPGDKDKYPPSSELRSKCAKQPYAEFTKCAPKEPKTCKNMDKYVADSSDCLPGCVCMEGYVYDTSRLACVLPANCSCHHAGKSYDDGEKIKE---DC-NLCECRAGNWKCSKNG-CESTCSVWGDSHFTTFDGHDFDFQGACDYVLAKGVFDNGDG-FSITIQNVLCGTMGVTCSKSLEIALTGHAEESLLLSADSAYSTDPNKTPIKKLRDSVNSKGHNAFHIYKAGVFVVVEVIPLKLQVKWDEGTRVYVKLGNEWRQKVSGLCGNYNGNSLDDMQTPSMGLETSPMLFGHAWKLQPHCSAPVAPIDACKKHPERETWAQLKCGALKSDLFKECHAEVPLERFWKRCIFDTCACDQGGDCECLCTAVAAYADACAQKGINIRWRSQHFCPMQCDPHCSDYKACTPACAVETCDNFLDQGIAERMCNRENCLEGCHIKPCEDGFIYLNDTYRDCVPKAECKPVCMVRDGKTFYEGDITFTDSCATCRC 1706          

HSP 2 Score: 168.318 bits (425), Expect = 3.793e-41
Identity = 141/491 (28.72%), Postives = 220/491 (44.81%), Query Frame = 2
Query: 1325 EFSECGSNCGKNCGQLGMELECESQCLPGCYCPRNRYWDGT--MCVPQEKCPCVRDNGESTYQQGYRLKLNCETCICGMHGKWQCIENEECEGRCFISGDPHYITFDRRHFFFDGHCEYTAVMTTSDNVLLSNSTIAPLSITIQNTNCQDNSETGCPRTIGV-IIGEDEDQVAINL---LSSSEIKVNFVKISLPYQHTGNTKVLIDQVSTDILRLKSETGVEILWNGGSRIEIKLSKKYREKVTGMCGNFNGNEMDDSMTFKGVDEKDIDKFVLSWKTNPTCESDRGIVEYKGACALSRSYSDYANKVCHKLYESEEFKKCHSAANADKFFDQCTHDVCTCGMKRNGALDHCECEAFSSYARQCALENINLSWRTNELCPKKCPNENMKYNQCGSRCT-STC-----RLLQESKC-KEECIEGCF---CPEGETF-DEAAKECVKISDCKCEFHGR----FYLPYEIRQDRCNNCTCTNGNWICTSNDCE 2734
            EF++C     K C  +   +   S CLPGC C     +D +   CV    C C   +   +Y  G ++K +C  C C   G W+C +N  CE  C + GD H+ TFD   F F G C+Y       DN           SITIQN  C     T C +++ + + G  E+ + ++     S+   K    K+       G+    I +    ++       +++ W+ G+R+ +KL  ++R+KV+G+CGN+NGN +DD  T     E     F  +WK  P C +    ++   AC        +A   C  L +S+ FK+CH+    ++F+ +C  D C C     G    C C A ++YA  CA + IN+ WR+   CP +C      Y  C   C   TC     + + E  C +E C+EGC    C +G  + ++  ++CV  ++CK     R    FY       D C  C C+    IC+   C+
Sbjct: 1248 EFTKCAPKEPKTCKNMDKYVADSSDCLPGCVCMEGYVYDTSRLACVLPANCSC--HHAGKSYDDGEKIKEDCNLCEC-RAGNWKCSKNG-CESTCSVWGDSHFTTFDGHDFDFQGACDYVLAKGVFDNG-------DGFSITIQNVLCGTMGVT-CSKSLEIALTGHAEESLLLSADSAYSTDPNKTPIKKLRDSVNSKGHNAFHIYKAGVFVVVEVIPLKLQVKWDEGTRVYVKLGNEWRQKVSGLCGNYNGNSLDDMQTPSMGLETSPMLFGHAWKLQPHCSAPVAPID---ACKKHPERETWAQLKCGAL-KSDLFKECHAEVPLERFWKRCIFDTCACD---QGGDCECLCTAVAAYADACAQKGINIRWRSQHFCPMQCDPHCSDYKACTPACAVETCDNFLDQGIAERMCNRENCLEGCHIKPCEDGFIYLNDTYRDCVPKAECKPVCMVRDGKTFYEGDITFTDSCATCRCSKRKEICSGVKCD 1719          

HSP 3 Score: 146.362 bits (368), Expect = 2.029e-34
Identity = 207/852 (24.30%), Postives = 323/852 (37.91%), Query Frame = 2
Query:  467 IYGHHIKTFDGNVFSYPLRGGYTLFMDCLGAAPLFYVYFNASYDCFDQKTQNDCS--ISMKITVGTQTIILFPK-----NEFALVKNNKTKIPFNSEGIIVSSVG-SFIKIKGIDDLEILFDRDRNIYVYAPVTAEKKICGLCGYFNGIMSDDYRDFNQVIQKNVKTFVNSWID-RDPSDLNVYREREQYPCNALKLKNNDQYQKALTLCQDMVKNNLGRTCQSEVKIDKYLD-MCQDEICECLQTQPENSTIENCYSTFCKIEEQYSYACTLKGIAVD---WRSATTI---CKQP----QCFNGQEFSECGSNCGKNCGQLGMELECESQCLPGCYCPRNRYWDGTMCVPQEKCPCVRDNGESTYQQGYRLKLNCETCICGMHGKWQCIENEECEGRCFISGDPHYITFDRRHFFFDGHCEYTAVMTTSDNVLLSNSTIAPLSITIQNTNCQDNSET----------GCPRTIGVIIGEDEDQVAINLLSSSEIKV---NFVKISLPYQHTGNTKVLIDQVSTDILRLKSETGVEILWNGGSRIEIKL---SKKYREKVTGMCGNFNGNEMDDSMTFKGVDEKDIDKFVLSWKTNPTCESDRGIVEYKGACALSRSY---SDYANKVCHKLYESEEFKKCHSAANADKFFDQCTHDVCTCGMKRNGALDHCECEAFSSYARQCALENINLSWRTNELCPKKCPNENMKYNQCG-SRCTSTCRLLQE--------------SKCKEECI-----EGCFCPEGETFDEAAKECV-KISDCKCEFHGRFYLPYE-IRQDRCNNCTC-TNGNWICTSNDCEGKE-FCPKSMAWFDCGICQKTCTNLDLVCPKGQC 2833
            I G    TFDG VF Y     + L  D   ++    V+   S      +T+  C   I+++ T     +IL P      N +          P      +VS  G + + +       +  D    + V       + + GLCGY+NG   DD R  +  I  N + F +SW D R P D           C  LK     Q  KAL LC  +      R C   V   ++L+  C +  C C+     N     C    C I E +   C      V    WR+       C  P     C+  +    C +  G +C  L         C PGCYCP      G  CVP  +C                     + C+C   G  +                  Y+T+DR+ F F+G+C Y          LLS   + P   T Q     D+ +            C +++ ++ G+    V         ++V    F    +PY+ +  +  L   V  +++    E+ VE+  +    I   L   S KY  K+ G+CG+ NGN  +D        +  +D  + SW+ +   E   G+VE   +  + + +          C + Y +E F KC  A +   +   C  D+C  G  + G      C A ++YA++C    I  +WR  +LCP +CP+ +M Y  CG ++   T + L E               K  E C+     EGCFCP G+  D    +CV +I+  KC+     +LP E  ++D+C  C C + G   C    C+ +E  C +       G   +T  ++D  CP+ +C
Sbjct: 2705 ISGKSFTTFDGTVFKYG-PCSHILARDIHSSSWSISVHQQCS-----DETRKVCHKVITIQDTEAGNELILLPHLKLKFNGYEFTVQQLINSPICKASFVVSQPGKTLLAVSTKYGFWVQLDDIGIVKVGISSKFIRTVDGLCGYYNGNQKDDKRSPDGQIIPNTEKFGDSWYDKRIPKDQ----------CGDLKCPREMQ-AKALQLCNIIHHPTFAR-CHKAVNYKQFLNNYCLEAACNCMMAN--NGDPAACK---CNILESFVKKCLSVNPLVQLTTWRAVAQCEINCPSPLVHTDCYKRRCEPSCDNVHGDDCPVL------PDACFPGCYCPEGTVRKGPNCVPISEC---------------------KDCVCNSLGASK------------------YMTYDRKSFSFNGNCTY----------LLSRDVVLPGVHTFQVYVSMDDCKKLGQPTPVEGGSCAKSLHILNGDHVIHVQRVPQKPKSLQVLVDGFEVKKIPYKDSWIS--LRQVVGKELVLSLPESHVELTASFEDLI-FSLGVPSIKYGSKMEGLCGDCNGNAGNDLQPNPAKKKAGVD-VIQSWQAD---EPKLGLVEECLSEDVPKEHCIPLPPEKDPCLQFYNAELFGKCPLAVDPIAYVSACQQDICKPGNTQQGV-----CVALAAYAKECNQHGICTNWRRPQLCPYECPS-DMVYEPCGCAKNCDTIKALSEFDAVSLKNEAVVHTVKTDEMCLSSERFEGCFCPPGKVMD--GGQCVPEIACTKCD--DGLHLPDEKWKKDKCTECQCDSKGKTTCVEKKCQVEENICAE-------GYRPETIVSVDECCPRYRC 3454          

HSP 4 Score: 118.627 bits (296), Expect = 5.184e-26
Identity = 100/373 (26.81%), Postives = 160/373 (42.90%), Query Frame = 2
Query: 3032 GICKTWGETHYESFDGKYFEFQGSCSYVISEDFCGNKLGTFKLISENIACGXXXXXCTKSIKFIYLNRVFQF--VRGSNPIVSRNTNYPPGGPTAFYWTSDVDTHF-ILFTMEGIQVKWDKAMSLEIMIPEKYQNKVCGLCGNFDLRIDNDMRARSGEIEKDIVNFADSWKVHSS---CPVPQKPPF---MCSKRPDREPWAKAKCE-ILKSDSFKKCHDVVNVEHYYKRCVADACEC-DRGDDCVCFCTAVEQYVARCNEYEIGLK--WRTNENCPHTCTGKRVWKNCG-NICPDSCIDIGKNVTDNTGCKKVCIEGCFCPDGLHWQNNECVERKACECVDPITNLKYNTGDKVIRECEECNCYEGAFRCTK 4108
             +C TWG  + ++FDG  F+   SCS+ +  D      GTF +I +    G S   C  ++K ++ + ++ F  + G+  + +     P            V  H  I     G+++ WD    + +    +   KV GLCG  D   + D+ +R+G+    +  FAD+W+V      C V         M S    +   A + CE +L ++    C    N +   + C+AD C C +R     C C A+      C    I L+  WR  E CP +C   RV++ CG N+ P    D+    +     K  C EGCFCP+G       C+ R+ C C   +   ++     V + C  C C  G +RCT+
Sbjct:  483 ALCTTWGGINMKTFDGLVFKAPLSCSHTLITDKVS---GTFDIILKACPYG-SGYGCAHTLKILWQSVLYTFENLNGTMQLTTPIKKLPMPVQVMGMKVMPVAQHVQIDLESVGLKLDWDHRQYVSVQAGPQMWGKVGGLCGTLDGDPNTDLTSRTGKKLATVKAFADAWRVEDRSELCQVENSAEMEFGMDSCEQSKLQKAVSVCERLLANEKLGDCIKPFNYDALIRTCMADYCNCANREHPESCNCDAIAMLAKECAFKGIKLEHGWRNLEICPISCGFGRVYQACGPNVEPTCDSDLALPAS-----KGACNEGCFCPEGTVQYKEACITRELCPCS--LRGKEFKPESTVKKNCNTCTCKNGQWRCTE 844          

HSP 5 Score: 100.138 bits (248), Expect = 1.895e-20
Identity = 91/386 (23.58%), Postives = 161/386 (41.71%), Query Frame = 2
Query: 1508 QGYRLKLNCETCICGMHGKWQCIENEECEGRCFISGDPHYITFDRRHFFFDGHCEYTAVMTTSDNVLLSNSTIAPLSITIQNTNCQDNSETGCPRTIGVIIGEDEDQVAINLLSSSEIKVNFVKISLPYQHTGNTKV-----LIDQVSTDILRLKSETGVEILWNGGSRIEIKLSKKYREKVTGMCGNFNGNEMDDSMTFKGVDEKDIDKFVLSWKTNPTCESDRGIVEYK-GACALSRSYSDYANKVCHKLYESEEFKKCHSAANADKFFDQ-CTHDVCTCGMKRNGALDHCECEAFSSYARQCALEN--INL-SWRTNELCPKKCPNENMKYNQCGSRCTSTCRLLQESKC---KEECIEGCFCPEGETFDEAAKECVKISDCK 2626
            + Y ++L+      G   ++ C+     +  C ISG   + TFD   F + G C +         +L  +   +  SI++    C D +   C + I +     + +    L+    +K+ F       Q   N+ +     ++ Q    +L + ++ G  +  +    +++ +S K+   V G+CG +NGN+ DD  +  G    + +KF  SW        D+ I + + G     R     A ++C+ ++    F +CH A N  +F +  C    C C M  NG    C+C    S+ ++C   N  + L +WR    C   CP+  +  +    RC  +C  +    C    + C  GC+CPEG         CV IS+CK
Sbjct: 2672 EKYDVELDMSASKVGDCLRYSCVLRPNKDDVCEISGK-SFTTFDGTVFKY-GPCSH---------ILARDIHSSSWSISVHQ-QCSDETRKVCHKVITI----QDTEAGNELILLPHLKLKFNGYEFTVQQLINSPICKASFVVSQPGKTLLAVSTKYGFWVQLDDIGIVKVGISSKFIRTVDGLCGYYNGNQKDDKRSPDGQIIPNTEKFGDSW-------YDKRIPKDQCGDLKCPREMQAKALQLCNIIHHP-TFARCHKAVNYKQFLNNYCLEAACNCMMANNGDPAACKCNILESFVKKCLSVNPLVQLTTWRAVAQCEINCPSPLVHTDCYKRRCEPSCDNVHGDDCPVLPDACFPGCYCPEGTV--RKGPNCVPISECK 3031          

HSP 6 Score: 84.3445 bits (207), Expect = 1.077e-15
Identity = 115/493 (23.33%), Postives = 178/493 (36.11%), Query Frame = 2
Query: 2747 CPKSMAWFDC--GICQKTCTNL---DLVCPKGQCQLPGCFCPENTVLHNGECIKPFECPCYMNNKMYSENDTIVRGPANCQNPCICKDGKWVCEQNKQCSGICKTWGETHYESFDGKYFEFQGSCSYVISEDFCGNKLGTFKLISENIACGXXXX-------XCTKSIKFIYLNRVFQFVRGSNPIVSRNTNYPPGG------PTAFYWTS--DVDTHFILFTMEGIQVKWDKA---MSLEIMIPE-KYQNKVCGLCGNFDLRIDNDMRARSGEIEKDIVNFADSWKVHSS-------CPVPQKPPFMCSKRPDREPWAKAKCEILKSDSFKKCHDVVNVEHYYKRCVADACECDRGDDCVCFCTAVEQYVARCNEYEIGLKWRTNENCPHTCTGKRVWKNCGNICPDSCIDI------------GKNVTDNTGCKKVCI-----EGCFCPDGLHWQNNECVERKACECVDPITNLKYNTGDKVIRECEECNC 4081
            CP  +   DC    C+ +C N+   D       C  PGC+CPE TV     C+   EC                                      K C  +C + G + Y ++D K F F G+C+Y++S D     + TF++      C            SC KS+  +  + V    R   P   ++      G      P    W S   V    ++ ++    V+   +   +   + +P  KY +K+ GLCG+ +    ND++    + +K  V+   SW+           C     P   C   P   P      +   ++ F KC   V+   Y   C  D C+   G+     C A+  Y   CN++ I   WR  + CP+ C    V++ CG  C  +C  I             + V       ++C+     EGCFCP G      +CV   AC   D   +L      K   +C EC C
Sbjct: 2974 CPSPLVHTDCYKRRCEPSCDNVHGDDCPVLPDAC-FPGCYCPEGTVRKGPNCVPISEC--------------------------------------KDC--VCNSLGASKYMTYDRKSFSFNGNCTYLLSRDVVLPGVHTFQVYVSMDDCKKLGQPTPVEGGSCAKSLHILNGDHVIHVQR--VPQKPKSLQVLVDGFEVKKIPYKDSWISLRQVVGKELVLSLPESHVELTASFEDLIFSLGVPSIKYGSKMEGLCGDCNGNAGNDLQPNPAK-KKAGVDVIQSWQADEPKLGLVEECLSEDVPKEHCIPLP---PEKDPCLQFYNAELFGKCPLAVDPIAYVSACQQDICK--PGNTQQGVCVALAAYAKECNQHGICTNWRRPQLCPYECPSDMVYEPCG--CAKNCDTIKALSEFDAVSLKNEAVVHTVKTDEMCLSSERFEGCFCPPGKVMDGGQCVPEIACTKCDDGLHLPDEKWKK--DKCTECQC 3413          

HSP 7 Score: 83.5741 bits (205), Expect = 1.907e-15
Identity = 95/361 (26.32%), Postives = 148/361 (41.00%), Query Frame = 2
Query: 3035 ICKTWGETHYESFDGKYFEFQGSCSYVISEDFCGNKLGTFKLISENIACG-XXXXXCTKSI---------KFIYLNRVFQFVRGSNPIVSRNTNYPPGGPTAFYWTSDVDTHFILFTMEGIQVKWDKAMSLEIMIPEKYQNKVCGLCGNFDLRIDNDMRARSGEIEKDIVNFADSWKVHSSCPVPQKPPFMCSKRPDREPWAKA--KCEILKSDSFKKCHDVVNVEHYYKR-CVADACEC---DRGDDCVCFCTAVEQYVARC---NEYEIGLKWRTNENCPHTCTGKRVWKNC-GNICPDSCIDIGKNVTDNTGCKKVCIEGCFCPDGLHWQNNECVERKAC-ECV-DPITNLKYNTGDK 4051
            +C+  G++ + +FDG  F++ G CS++++ D   +       IS +  C   +   C K I         + I L  +     G    V +  N P     +F  +    T   + T  G  V+ D    +++ I  K+   V GLCG ++    +D R+  G+I  +   F DSW      P  Q     C     RE  AKA   C I+   +F +CH  VN + +    C+  AC C   + GD   C C  +E +V +C   N       WR    C   C    V  +C    C  SC ++  +  D       C  GC+CP+G   +   CV    C +CV + +   KY T D+
Sbjct: 2702 VCEISGKS-FTTFDGTVFKY-GPCSHILARDIHSSSWS----ISVHQQCSDETRKVCHKVITIQDTEAGNELILLPHLKLKFNGYEFTVQQLINSPICK-ASFVVSQPGKTLLAVSTKYGFWVQLDDIGIVKVGISSKFIRTVDGLCGYYNGNQKDDKRSPDGQIIPNTEKFGDSW-YDKRIPKDQCGDLKCP----REMQAKALQLCNIIHHPTFARCHKAVNYKQFLNNYCLEAACNCMMANNGDPAACKCNILESFVKKCLSVNPLVQLTTWRAVAQCEINCPSPLVHTDCYKRRCEPSCDNVHGD--DCPVLPDACFPGCYCPEGTVRKGPNCVPISECKDCVCNSLGASKYMTYDR 3048          
BLAST of von Willebrand factor vs. Ensembl Fly
Match: cv-2 (gene:FBgn0000395 transcript:FBtr0071610)

HSP 1 Score: 127.487 bits (319), Expect = 2.967e-29
Identity = 109/421 (25.89%), Postives = 172/421 (40.86%), Query Frame = 2
Query: 2624 KCEFHGRFYL-PYEIRQDRCNNCTCTNGNWICTSNDCEGKEFCPKSMAWFDCGICQKTCTNLDLVCPKGQCQLPGCFCPENTVLHNGECIK-----------PFECPCYMNNKMYSENDTIVRGPANCQNPCICKDGKWVCEQNKQCSGICKTWGETHYESFDGKYFEFQGSCSYVISEDFCGNKLGTFKLISENIACGXXXXXCTKSIKFIYLN-RVFQFVRGSNPIVSRNTNYP----PGGPTAFYWTSDVDTHFILFTMEGIQVKWDKAMSLEIMIPEKYQNKVCGLCGNFDLRIDNDMRARSGEIEKD--IVNFADSWKVHSSCPVPQKPPFMCSKRPDREPWAKAKCEILKSDS-FKKCHDVVNVEHYYKRCVADACECDRGDDCVCFCTAVEQYVARCNEYEIGLK-WRTNENCP 3823
            KC F+   Y    +   DRC NCTC NG  +C    C   E  P+      C      C    +   + +C L G     N     G C                CP          N+ + + P  C            C++  + +G C  +G+ H+ +FDGK+F FQGSC Y+++ D  G    TF +   N   G+  +S  K++     N +V    R    +       P     GG              +L +  G+ ++W+ A  L++ +P K++ ++CGLCGNF+    +D+  + G    D  + +FA+SWKV       +K  F+ +     +  +   C  L   + F +C++ +N E+Y   C  D CEC  GD   C C +   Y   C    + L  WR+  NCP
Sbjct:  255 KCLFNKSVYPEKTQFMPDRCTNCTCLNGTSVCQRPTCPILECAPEFQEPDGC------CPRCAVAEVRSECSLDGIVYQNNETWDMGPCRSCRCNGGTIRCAQMRCPAVK----CRANEELKQPPGEC------------CQRCVETAGTCTVFGDPHFRTFDGKFFSFQGSCKYLLASDCMGK---TFHIRLTNEGRGTRRASWAKTVTLSLRNLKVNLGQRMRVKVNGTRVTLPYFVVAGGQNVTIERLANGGAVMLRSEMGLTLEWNGAGFLQVSVPAKFKKRLCGLCGNFNGSSRDDLTGKDGRSHGDDEVWHFANSWKVGGPKSCSRKREFLAATPTCDKRKSNFYCHPLSVPALFGECNERLNPENYKAACRMDVCECPSGD---CHCDSFAAYAHECRRLGVQLPDWRSATNCP 647          

HSP 2 Score: 124.02 bits (310), Expect = 3.705e-28
Identity = 109/413 (26.39%), Postives = 171/413 (41.40%), Query Frame = 2
Query: 1280 SATTICKQPQCFN---GQEFSECGSNCGKNCGQLGMELECESQCLPGCYCPRNRYWD-----------GTMCVPQEKCPCV--RDNGESTYQQGYRLKLNCETCICGMHGKWQCIENEECEGRCFISGDPHYITFDRRHFFFDGHCEYTAVMTTSDNVLLSNSTIAPLSITIQNTNCQDNSETGCPRTIGVIIGEDEDQVAINLLSSSEIKVNFVKISLPY-QHTGNTKVLIDQVSTD-ILRLKSETGVEILWNGGSRIEIKLSKKYREKVTGMCGNFNGNEMDDSMTFKGVDEKD--IDKFVLSWKTN--PTCESDRGIVEYKGACALSRSYSDYANKVCHKLYESEEFKKCHSAANADKFFDQCTHDVCTCGMKRNGALDHCECEAFSSYARQCALENINLS-WRTNELCP 2449
            + T++C++P C       EF E    C   C    +  EC    L G     N  WD           GT+   Q +CP V  R N E     G      C+ C+             E  G C + GDPH+ TFD + F F G C+Y         +L S+       I + N   +        +T+ + +      + +NL     +KVN  +++LPY    G   V I++++    + L+SE G+ + WNG   +++ +  K+++++ G+CGNFNG+  DD     G    D  +  F  SWK     +C   R  +     C   +S     N  CH L     F +C+   N + +   C  DVC C          C C++F++YA +C    + L  WR+   CP
Sbjct:  281 NGTSVCQRPTCPILECAPEFQE-PDGCCPRCAVAEVRSECS---LDGIVYQNNETWDMGPCRSCRCNGGTIRCAQMRCPAVKCRANEELKQPPGE----CCQRCV-------------ETAGTCTVFGDPHFRTFDGKFFSFQGSCKY---------LLASDCMGKTFHIRLTNEG-RGTRRASWAKTVTLSL----RNLKVNLGQRMRVKVNGTRVTLPYFVVAGGQNVTIERLANGGAVMLRSEMGLTLEWNGAGFLQVSVPAKFKKRLCGLCGNFNGSSRDDLTGKDGRSHGDDEVWHFANSWKVGGPKSCSRKREFLAATPTCDKRKS-----NFYCHPLSVPALFGECNERLNPENYKAACRMDVCEC------PSGDCHCDSFAAYAHECRRLGVQLPDWRSATNCP 647          

HSP 3 Score: 72.0182 bits (175), Expect = 4.944e-12
Identity = 65/291 (22.34%), Postives = 113/291 (38.83%), Query Frame = 2
Query:  446 TYYECSVIYGHHIKTFDGNVFSYPLRGGYTLFMDCLGAAPLFYVYFNASYDCFDQKTQNDCSISMKITVGTQTI-ILFPKNEFALVKNNKTKIPF----NSEGIIVSSV--GSFIKIKGIDDLEILFDRDRNIYVYAPVTAEKKICGLCGYFNGIMSDDY--RDFNQVIQKNVKTFVNSWIDRDPSDLNVYREREQYPCNALKLKNNDQYQKALTLCQDMVKNNLGRTCQSEVKIDKYLDMCQDEICECLQTQPENSTIENCYSTFCKIEEQYSYACTLKGIAV-DWRSAT 1288
            T   C+V    H +TFDG  FS+     Y L  DC+G    F++         + +     S +  +T+  + + +   +     V   +  +P+      + + +  +  G  + ++    L + ++    + V  P   +K++CGLCG FNG   DD   +D        V  F NSW    P   +  RE        L        +K+   C  +    L   C   +  + Y   C+ ++CEC           +C+   C     Y++ C   G+ + DWRSAT
Sbjct:  379 TAGTCTVFGDPHFRTFDGKFFSFQGSCKYLLASDCMGKT--FHIRLTN-----EGRGTRRASWAKTVTLSLRNLKVNLGQRMRVKVNGTRVTLPYFVVAGGQNVTIERLANGGAVMLRSEMGLTLEWNGAGFLQVSVPAKFKKRLCGLCGNFNGSSRDDLTGKDGRSHGDDEVWHFANSWKVGGPKSCSRKRE-------FLAATPTCDKRKSNFYCHPLSVPALFGECNERLNPENYKAACRMDVCECPSG--------DCH---CDSFAAYAHECRRLGVQLPDWRSAT 644          
BLAST of von Willebrand factor vs. Ensembl Fly
Match: Ten-a (gene:FBgn0267001 transcript:FBtr0300201)

HSP 1 Score: 64.6994 bits (156), Expect = 1.107e-9
Identity = 34/109 (31.19%), Postives = 55/109 (50.46%), Query Frame = 2
Query:  191 CSPDCV-NGVCKDGRCSCSLGWQGNRCSDPICVGGCSNGGKCVAPN---QCLCLDNYSGPNCNTLLIKSSQSDVSNYG-AVTRVNNTMYSTYYECSVIYGHHIKTFDGN 502
            C   C  +G CK+G C CS GW G  C+ P C  GCS  G+C   N   +C C++ ++G +C+  L  + + ++ N G  +T  +++   ++  CS     HI     N
Sbjct:  655 CDSRCSEHGQCKNGTCVCSQGWNGRHCTLPGCENGCSRHGQCTLENGEYRCDCIEGWAGRDCSIALELNCKDNIDNDGDGMTDCSDSECCSHPACS----EHIMCLSSN 759          

HSP 2 Score: 60.077 bits (144), Expect = 2.458e-8
Identity = 33/96 (34.38%), Postives = 45/96 (46.88%), Query Frame = 2
Query:  191 CSPDC-VNGVCKDGRCSCSLGWQGNRCSDPICVGGCSNGGKCVAPNQCLCLDNYSGPNCNTLLIKSSQSDVSNYGAVTRVNNTMYSTYYECSVIYG 475
            CS DC  NGVC+ G+C C+ GW GN C    C   CS  G+C     C+C   ++G +C    +   ++  S +G  T  N       Y C  I G
Sbjct:  624 CSLDCGRNGVCESGKCRCNSGWTGNLCDQLPCDSRCSEHGQC-KNGTCVCSQGWNGRHCT---LPGCENGCSRHGQCTLENGE-----YRCDCIEG 710          
BLAST of von Willebrand factor vs. Ensembl Fly
Match: Ten-a (gene:FBgn0267001 transcript:FBtr0308221)

HSP 1 Score: 64.6994 bits (156), Expect = 1.120e-9
Identity = 34/109 (31.19%), Postives = 55/109 (50.46%), Query Frame = 2
Query:  191 CSPDCV-NGVCKDGRCSCSLGWQGNRCSDPICVGGCSNGGKCVAPN---QCLCLDNYSGPNCNTLLIKSSQSDVSNYG-AVTRVNNTMYSTYYECSVIYGHHIKTFDGN 502
            C   C  +G CK+G C CS GW G  C+ P C  GCS  G+C   N   +C C++ ++G +C+  L  + + ++ N G  +T  +++   ++  CS     HI     N
Sbjct:  757 CDSRCSEHGQCKNGTCVCSQGWNGRHCTLPGCENGCSRHGQCTLENGEYRCDCIEGWAGRDCSIALELNCKDNIDNDGDGMTDCSDSECCSHPACS----EHIMCLSSN 861          

HSP 2 Score: 60.077 bits (144), Expect = 2.508e-8
Identity = 33/96 (34.38%), Postives = 45/96 (46.88%), Query Frame = 2
Query:  191 CSPDC-VNGVCKDGRCSCSLGWQGNRCSDPICVGGCSNGGKCVAPNQCLCLDNYSGPNCNTLLIKSSQSDVSNYGAVTRVNNTMYSTYYECSVIYG 475
            CS DC  NGVC+ G+C C+ GW GN C    C   CS  G+C     C+C   ++G +C    +   ++  S +G  T  N       Y C  I G
Sbjct:  726 CSLDCGRNGVCESGKCRCNSGWTGNLCDQLPCDSRCSEHGQC-KNGTCVCSQGWNGRHCT---LPGCENGCSRHGQCTLENGE-----YRCDCIEG 812          
BLAST of von Willebrand factor vs. Ensembl Zebrafish
Match: vwf (von Willebrand factor [Source:ZFIN;Acc:ZDB-GENE-070103-1])

HSP 1 Score: 529.25 bits (1362), Expect = 5.020e-154
Identity = 361/1269 (28.45%), Postives = 572/1269 (45.07%), Query Frame = 2
Query:  455 ECSVIYGHHIKTFDGNVFSYPLRGGYTLFMDCLGAAPLFYVYFNASYDCFDQKTQNDCSISMKITVGTQTIILFPKNEFALVKNNKTKIPFNSEGIIVSSVGSFIKIKGID-DLEILFDRDRNIYVYAPVTAEKKICGLCGYFNGIMSDDYRDFNQVIQKNVKTFVNSWIDRDPSDLNVYREREQYPCNALKLKNNDQYQKALTLCQDMVKNNLGRTCQSEVKIDKYLDMCQDEICECLQTQPENSTIENCYSTFCKIEEQYSYACTLKGIAV-DWRSATTICKQPQCFNGQEFSECGSNCGKNCGQLGMELECESQCLPGCYCPRNRYWDGTMCVPQEKCPCVRDNGESTYQQGYRLKLNCETCICGMHGKWQCIENEECEGRCFISGDPHYITFDRRHFFFDGHCEYTAVMTTSDNVLLSNSTIAPLSITIQNTNCQDNSETGCPRTIGVIIGEDEDQVAINLLSSSEIKVNFVKISLPYQHTGNTKVLIDQVSTDILRLKSETGVEILWNGGSRIEIKLSKKYREKVTGMCGNFNGNEMDDSMTFKGVDEKDIDKFVLSWKTNPTCESDRGIVEYKGACALSRSYSDYANKVCHKLYESEEFKKCHSAANADKFFDQCTHDVCTCGMKRNGALDHCECEAFSSYARQCALENINLSWRTNELCPKKCPNENMKYNQCGSRCTSTCRLLQ--ESKCKEECIEGCFCPEGETFDEAAKECVKISDCKCEFHGRFYLPYEIRQDRCNNCTCTNGNWICTSNDCEGKEF------------------CPKSMAWFDC------GI-CQKTCTNLDLVCPKGQCQLPGCFCPENTVLHNGECIKPFECPCYMNNKMYSENDTIVRGPANCQNPCICKDGKWVCEQNKQCSGICKTWGETHYESFDGKYFEFQGSCSYVISEDFCGNKLGTFKLISENIACGXXXXXCTKSIKFIYLNRVFQF----VRGSNPIVSRNTNYPPGGPTAFYWTSDVDTHFILFTMEGIQVKWDKAMSLEIMIPEKYQNKVCGLCGNFDLRIDNDMRARSGEIEKDIVNFADSWKVHSSCPVPQKPPFMCSKRPDREPWAKAKCEILKSDSFKKCHDVVNVEHYYKRCVADACECDRGDDCVCFCTAVEQYVARCNEYEIGLKWRTNENCPHTC------TGKRV-WK--NCGNICPDSCIDIGKNVTDNTGCKKVCIEGC--FCPDG--LHWQNNECVERKACE-CVDPITNLKYNTGDKVI------RECEECNCYEGAFRC 4102
             CS+    HI TFDG ++ +P    Y L  DC   +      F+   D    K +      + + +G    +    +        +  +P+ S  +       ++++   +    I  D   NI +        + CGLCG +N +  D+Y      +  +   F NSW  +   +           CN+      DQ    ++ C+ M  + L   C   V    ++ +C+ ++C C       S  + C    C+   +YS AC  +GI + +W + +     P+C  G E+S+C   C  +C  + ++  C+ +C+ GC CP  +  DG  CV   +C C   +    Y     +  +C TC+C  HG W+C  NE C G C ++G  HY TFD + F F G C Y         +L  +      S  I+   C D+ +  C R+I +   +  +Q  ++L     + V+ + +  P     N  + I       +RL+    + + W+G  R+ ++L   Y  ++ G+CGN+NGN+ DD +T  G+ E  ++ F  SWK N  C+  +  ++    C+L+     +A + C  L  S +F+ CH   N + +   C +DVC C   +      C C+A SSYA  CA   + ++WR++  C   CP+  + Y  CGS C  TCR L   ++ C   C EGCFCP G  F   A ECV    C C  +G  + P ++  D  + C C +G+  CTSN+  G                     CP  +  F+C      GI C KTC NL+L C    C + GC CP  TV +  +CI   +CPCY N++ Y    +I     +C N C+C+  +W C + + C G+C+  G+THY SFDG  F F G C YV+++D+C    GTF+++ EN ACG +   C+KSI  +Y+  +       VR   P++                      ++I+   + I + WD    + + I  +Y+ KVCGLCGNFD   +ND+ + S ++E D  +F +SWKV  SC         CS    +    +  C +L S  F+ C+ VV+ E Y+  C  D C C    DC CFC  +  Y   C +  + + WR+N+ CP +C      +G +  W+   C + CP +C        +   C   C+EGC   CP G  L     +CVE   C+ CV      + + G + I      R C+ C+C      C
Sbjct:   28 RCSLFSRQHIHTFDGVIYEFPGDCSYMLAGDCRQRS------FSILGDFSHGKRKG-----VTVFLGEMFELHLSVDGTLSQGAERLPLPYASSSVFAGYELGYVRLWSEEFGFSIRIDPLHNIQLTLEKRHSNQTCGLCGNYNYLAEDEYSAQEGFLTDDPYDFANSWAMKGADEPCKRVLPPSQSCNSTGESTKDQ----MSACESMRSSVLFMHCAHLVDPAAFVSVCESDVCHC-------SAGKEC---VCQAMLEYSRACASRGITLSNWHTQSQC--SPKCPVGMEYSDCTPTCSTSCQNVNIQEVCKEECVDGCICPAGKVLDGDRCVDVSQCSCT--HAGRRYPPASYISQDCNTCVC-RHGSWECT-NEGCPGECLVTGQSHYKTFDNKFFTFSGICHY---------LLAKDCQSNSFSAVIETAQCADDQDAICTRSITLRFKDLANQT-VHLKHGGVVSVDGMDVQTPLI---NGPLRIQNTVLSSVRLRYGHDLHLDWDGRGRVLLRLKPAYAGQMCGLCGNYNGNQGDDFLTVGGLVETRVEAFGNSWKMNADCDDVQ--MQNSDPCSLNPKRVRFAEEACAVLL-SMKFEPCHYMVNPEPYVKNCRYDVCACADGQE-----CLCDAVSSYAVACAARGVLVNWRSHGYCELTCPDAQV-YEMCGSVCNQTCRSLSLPDTGCDGVCEEGCFCPRG-LFLSDAGECVPPQHCSCHHNGEIFEPNDMIGDHHSICVCESGSMHCTSNEATGSTLSDLFFDEQSPSRGRRSLSCPPPLQRFECESARDAGIECAKTCQNLELDCVSLGC-VSGCMCPPGTVRYRKDCIPQEQCPCYHNSRPYESGQSIT---VDC-NTCVCEQRQWKCSE-RVCDGVCRAIGDTHYISFDGLKFSFPGPCQYVLAQDYCNGLDGTFRVLVENSACGIAGYRCSKSITVLYMGGLIVMEHGEVRMKRPVLKETE----------VEIVRSGLYYIVLLGKHISITWDTGTRISLQISGQYRGKVCGLCGNFDGSQNNDLLSSSNQMEVDAADFGNSWKVRPSCADAVSVVSQCSTDLVKLVTVEQSCRVLTSAIFRDCNSVVDPEPYWDICTQDTCSCPSVGDCACFCNTIAAYAHECAQKGLPVNWRSNDLCPLSCEDLNKESGVQCEWRYNTCASACPSTC-----QHPEPLSCPISCVEGCHAVCPPGHLLDEVLRKCVEPSQCQVCVH--DGQRVSHGKQFILNHEDPRLCQICHCESNTLTC 1219          

HSP 2 Score: 141.354 bits (355), Expect = 7.107e-33
Identity = 107/388 (27.58%), Postives = 158/388 (40.72%), Query Frame = 2
Query: 1586 ECEGRCFISGDPHYITFDRRHFFFDGHCEYTAVMTTSDNVLLSNSTIAPLSITIQNTNCQDNSETGCPRTIGVIIGEDEDQVAINLLSSSEIKVNFVKISLPYQHTGNTKVLIDQVSTDILRLKSET-GVEILWNGGSRIEIKLSKKYREKVTGMCGNFNGNEMDDSMTFKGVDEKDIDKFVLSWKTNPTCESDRGIVEYKGACALSRSYSDYANKVCHKLYESEEFKKCHSAANADKFFDQCTHDVCTCGMKRNGALDHCECEAFSSYARQCALENINLS-WRTNELCPKKCPNENMKYNQCGSRCTSTCRLLQ-ESKCKEECIEGCFCPEGETFDEAAKECVKISDCKCEFHGRFYLPYEIRQDRCNNCTCTNGNWICTSNDCEGK 2740
            E   RC +    H  TFD   + F G C Y   M   D    S S +   S              G  + + V +GE      ++L     +     ++ LPY  +     +        +RL SE  G  I  +    I++ L K++  +  G+CGN+N    D+    +G    D   F  SW      E  + ++    +C  +   +      C  +  S  F  C    +   F   C  DVC C   +      C C+A   Y+R CA   I LS W T   C  KCP   M+Y+ C   C+++C+ +  +  CKEEC++GC CP G+  D     CV +S C C   GR Y P       CN C C +G+W CT+  C G+
Sbjct:   24 EGSARCSLFSRQHIHTFDGVIYEFPGDCSY---MLAGDCRQRSFSILGDFS-------------HGKRKGVTVFLGE---MFELHLSVDGTLSQGAERLPLPYASSS----VFAGYELGYVRLWSEEFGFSIRIDPLHNIQLTLEKRHSNQTCGLCGNYNYLAEDEYSAQEGFLTDDPYDFANSWAMKGADEPCKRVLPPSQSCNSTGESTKDQMSACESMRSSVLFMHCAHLVDPAAFVSVCESDVCHCSAGKE-----CVCQAMLEYSRACASRGITLSNWHTQSQCSPKCP-VGMEYSDCTPTCSTSCQNVNIQEVCKEECVDGCICPAGKVLD--GDRCVDVSQCSCTHAGRRYPPASYISQDCNTCVCRHGSWECTNEGCPGE 380          

HSP 3 Score: 128.642 bits (322), Expect = 6.420e-29
Identity = 95/384 (24.74%), Postives = 168/384 (43.75%), Query Frame = 2
Query: 3029 SGICKTWGETHYESFDGKYFEFQGSCSYVISEDFCGNKLGTFKLISENIACGXXXXXCTKSIKFIYLNRVFQFVRGSNPIVSRNTNYPPGGPTAFYWTSDVDTHFILFTME--GIQVKWDKAMSLEIMIPEKYQNKVCGLCGNFDLRIDNDMRARSGEIEKDIVNFADSWKVHSS---CPVPQKPPFMCSKRPDREPWAKAKCEILKSDS-FKKCHDVVNVEHYYKRCVADACECDRGDDCVCFCTAVEQYVARCNEYEIGLK-WRTNENCPHTCTGKRVWKNCGNICPDSCIDIGKNVTDNTGCKKVCIEGCFCPDGLHWQNNECVERKACECVDPITNLKYNTGDKVIRECEECNCYEGAFRCT-KLFSKECLHTSRPEIST 4156
            S  C  +   H  +FDG  +EF G CSY+++ D C  +  +F ++      G  S    K +  ++L  +F+     +  +S+     P    +    +  +  ++    E  G  ++ D   ++++ + +++ N+ CGLCGN++   +++  A+ G +  D  +FA+SW +  +   C     P   C+   +      + CE ++S   F  C  +V+   +   C +D C C  G +CV  C A+ +Y   C    I L  W T   C   C     + +C   C  SC    +NV     CK+ C++GC CP G     + CV+   C C       +Y     + ++C  C C  G++ CT +    ECL T +    T
Sbjct:   26 SARCSLFSRQHIHTFDGVIYEFPGDCSYMLAGD-CRQR--SFSIL------GDFSHGKRKGVT-VFLGEMFELHLSVDGTLSQGAERLPLPYASSSVFAGYELGYVRLWSEEFGFSIRIDPLHNIQLTLEKRHSNQTCGLCGNYNYLAEDEYSAQEGFLTDDPYDFANSWAMKGADEPCKRVLPPSQSCNSTGESTKDQMSACESMRSSVLFMHCAHLVDPAAFVSVCESDVCHCSAGKECV--CQAMLEYSRACASRGITLSNWHTQSQCSPKCPVGMEYSDCTPTCSTSC----QNVNIQEVCKEECVDGCICPAGKVLDGDRCVDVSQCSCTH--AGRRYPPASYISQDCNTCVCRHGSWECTNEGCPGECLVTGQSHYKT 391          

HSP 4 Score: 112.849 bits (281), Expect = 3.326e-24
Identity = 116/470 (24.68%), Postives = 191/470 (40.64%), Query Frame = 2
Query:  191 CSPDCVNG-VCKDGRCSCSLGWQGNRCSDPICVGGCSNGGKCVAPNQCLCLDNYSGPNCNTLLIKSSQSDVSNYGAVTRVNNTMYSTYYECSVIYGHHIKTFDGNVFSYPLRGGYTLFMDCLGAAPLFYVYFNASYDCFDQKTQNDCSISMKITVGTQTIILFPKNEFALVKNNKTKIPF-NSEGIIVSSVGSFIKIKGIDDLEILFD-RDRNIYVYAPVTAEKKICGLCGYFNGIMSDDYRDFNQVIQKNVKTFVNSWIDRDPSDLNVYREREQYPCNALKLKNNDQYQKALTLCQDMVKNNLGRTCQSEVKIDKYLDMCQDEICECLQTQPENSTIENCYSTFCKIEEQYSYACTLKGIAVDWRSATTICKQPQCFNGQEFSECGSNCGKNCGQLGM-ELECESQCLPGCYCPRNRYW-DGTMCVPQEKCPCVRDNGESTYQQGYRLKLNCETCICGMHGKWQCIENE 1585
            C  +CV+G +C  G+        G+RC D +    C++ G+   P       +Y   +CNT + +    + +N G              EC V    H KTFD   F++     Y L  DC   +  F      +    DQ      SI+++        +         V     + P  N    I ++V S ++++   DL + +D R R +    P  A  ++CGLCG +NG   DD+     +++  V+ F NSW  +  +D +  + +   PC+     N  + + A   C  ++       C   V  + Y+  C+ ++C C   Q             C     Y+ AC  +G+ V+WRS      +  C + Q +  CGS C + C  L + +  C+  C  GC+CPR  +  D   CVP + C C   NGE  ++    +  +   C+C   G   C  NE
Sbjct:  314 CKEECVDGCICPAGKV-----LDGDRCVD-VSQCSCTHAGRRYPPA------SYISQDCNTCVCRHGSWECTNEGCPG-----------ECLVTGQSHYKTFDNKFFTFSGICHYLLAKDCQSNS--FSAVIETAQCADDQDAICTRSITLRFKDLANQTVHLKHGGVVSVDGMDVQTPLINGPLRIQNTVLSSVRLRYGHDLHLDWDGRGRVLLRLKPAYA-GQMCGLCGNYNGNQGDDFLTVGGLVETRVEAFGNSW--KMNADCDDVQMQNSDPCSL----NPKRVRFAEEACAVLLSMKF-EPCHYMVNPEPYVKNCRYDVCACADGQ----------ECLCDAVSSYAVACAARGVLVNWRSHGYC--ELTCPDAQVYEMCGSVCNQTCRSLSLPDTGCDGVCEEGCFCPRGLFLSDAGECVPPQHCSC-HHNGE-IFEPNDMIGDHHSICVC-ESGSMHCTSNE 735          

HSP 5 Score: 77.0258 bits (188), Expect = 2.864e-13
Identity = 83/380 (21.84%), Postives = 148/380 (38.95%), Query Frame = 2
Query: 2966 NCQN--PCICKDGKWVCEQNKQCSGI------CKTWGETHYESFDGKYFEFQGSCSYVISEDFCGNKLGTFKLISENIAC-GXXXXXCTKSIKF------IYLNRVFQFVRG----SNPIVSRNTNYPPGGPTAFYWTSDVDTHFILFTMEGIQVKWDKAMSLEIMIPEKYQNKVCGLCGNFDLRIDNDMRARSGEIEKDIVNFADSWKVHSSCPVPQKPPFMCSKRPDREPWAKAKCEILKSDSFKKCHDVVNVEHYYKRCVADACECDRGDDCVCFCTAVEQYVARCNEYEIGLKWRTNENCPHTCTGKRVWKNCGNICPDSCID--------IGKNVTDNTG--CKKVCIEGCFCPDGLHWQNNECVERKAC-ECVD 4015
            NC+   P +CK+       N  C         C     +H  SF G   + + +CSY++       + G  +L+    AC  S +  C KS++       + L    +   G    + P  +        G       S+     + FT    +   +  +++        +    GLCG+      + +    G +  D   +  +W + S C V  +   +C    ++       C++L S+ F  CH +V V+ Y + C + AC+ +        C  V  Y   C +  + + WRT+  CP +C+    +  C + C + C          +G  +    G  C     EGCFCP+G     ++CV+R+AC +CV+
Sbjct: 1919 NCEKMEPPVCKNNLPALRYNHHCGCTWTCPCSCMGSSTSHVVSFSGAALKVKSACSYLLL------RSGGAELVLHTTACQSSPNQICMKSLELREGGTSVVLQDDMKVTVGGVLTAVPFRTERVTVTQIGSILHQLRSEQHGFTLTFTPHSNEFMLNMDIAM--------KPNTTGLCGSCS-DDQSGLLLSDGSVTTDPDVYLQAWALGSEC-VQHQEIQLCPAGLEK------ACDVLSSEVFSHCHALVPVQDYIQICRSVACQPNA------LCDLVTAYSTVCRQQGVCVDWRTSSLCPMSCSDSMEYAACRSGCLEQCGQSQFTPGDMMGDGLLKANGSVCLNTPTEGCFCPEGSVLMEDKCVDREACSQCVE 2270          

HSP 6 Score: 72.7886 bits (177), Expect = 4.666e-12
Identity = 106/475 (22.32%), Postives = 177/475 (37.26%), Query Frame = 2
Query: 1589 CEGRCFISGDPHYITFDRRHFFFDGHCEYTAVMTTSDNVLLSNSTIAPLSITIQNTNCQDNSETGCPRTIGVIIGEDEDQVAINLLSSSEIKVNFVKISLPYQHTGNTKVLIDQVSTDILRLKSET-GVEILWNGGS-RIEIKLSKKYREKVTGMCGNFNGNEMDDSMTFKGVDEKDIDKFVLSWKTNPTCESDRGIVEYKGACALSRSYSDYANKVCHKLYESEEFKKCHSAANADKFFDQCTHDVCTCGMKRNGALDHCECEAFSSYARQCALENINLSWRTNELCPKKCPNENMKYNQCGSRCTSTCRLLQ---------------ESKCKEECIEGCFCPEGETFDEAAKECVKISDC-KCEFHG----RFYLPYEIRQDRCNNCTCTNGNWI-CTSNDCEGKEFCPKSMAWFDCGICQKTCTNL-DLVCPKGQC---------QLPGCFCPENTVLHN-GECIKPFECPC 2911
            C   C  S   H ++F          C Y          LL  S  A L   +  T CQ +    C +++ +     E   ++ L    ++ V  V  ++P++     +V + Q+ + + +L+SE  G  + +   S    + +    +   TG+CG+ + ++    +   G    D D ++ +W     C   + I                  K C  L  SE F  CH+      +   C    C     +  AL    C+  ++Y+  C  + + + WRT+ LCP  C +++M+Y  C S C   C   Q                S C     EGCFCPEG    E   +CV    C +C  H     +F   +    + C  C C +   I CT+  C   +         +CG C+     +    CP+ +C           P C    + VL N G+C+  ++C C
Sbjct: 1947 CPCSCMGSSTSHVVSFSGAALKVKSACSY----------LLLRSGGAEL--VLHTTACQSSPNQICMKSLEL----REGGTSVVLQDDMKVTVGGVLTAVPFR---TERVTVTQIGSILHQLRSEQHGFTLTFTPHSNEFMLNMDIAMKPNTTGLCGSCS-DDQSGLLLSDGSVTTDPDVYLQAWALGSECVQHQEIQLCPAG----------LEKACDVL-SSEVFSHCHALVPVQDYIQICRSVAC-----QPNAL----CDLVTAYSTVCRQQGVCVDWRTSSLCPMSC-SDSMEYAACRSGCLEQCGQSQFTPGDMMGDGLLKANGSVCLNTPTEGCFCPEGSVLME--DKCVDREACSQCVEHSGKTHQFMESWNPEDNPCVLCVCLDQQRINCTALPCTNAKA-------PECGQCEVLQEKMGSKCCPQYECVCDINCKRPDPPHCDHGLSVVLTNPGDCLPVYQCVC 2371          

HSP 7 Score: 58.151 bits (139), Expect = 1.358e-7
Identity = 81/377 (21.49%), Postives = 144/377 (38.20%), Query Frame = 2
Query:  479 HIKTFDGNVFSYPLRGGYTLFMDCLGAAPLFYVYFNASYDCFDQKTQNDCSISMKITVGTQTIILFPKNEFALVKNNKTKIPFNSEGIIVSSVGSFIKIKGIDD--LEILFDRDRNIYVY-APVTAEKKICGLCGYFNGIMSDDYRDFNQVIQKNVKTFVNSWIDRDPSDLNVYREREQYPCNALKLKNNDQYQKALTLCQDMVKNNLGRTCQSEVKIDKYLDMCQDEICECLQTQPENSTIENCYSTFCKIEEQYSYACTLKGIAVDWRSATTICKQPQCFNGQEFSECGSNCGKNCGQL----------GMELECESQCL----PGCYCPRNRYWDGTMCVPQEKCP-CVRDNGES-TYQQGYRLKLN-CETCIC 1549
            H+ +F G          Y L     G A L  ++  A     +Q     C  S+++  G  +++L    +   V    T +PF +E + V+ +GS +     +     + F    N ++    +  +    GLCG      SDD                +  +  DP   +VY +        ++ +        L    D++ + +   C + V +  Y+ +C+   C     QP         +  C +   YS  C  +G+ VDWR+ +++C    C +  E++ C S C + CGQ           G+     S CL     GC+CP         CV +E C  CV  +G++  + + +  + N C  C+C
Sbjct: 1958 HVVSFSGAALKVKSACSYLLLRS--GGAELV-LHTTACQSSPNQI----CMKSLELREGGTSVVLQDDMKVT-VGGVLTAVPFRTERVTVTQIGSILHQLRSEQHGFTLTFTPHSNEFMLNMDIAMKPNTTGLCGS----CSDDQSGL---------LLSDGSVTTDP---DVYLQAWALGSECVQHQEIQLCPAGLEKACDVLSSEVFSHCHALVPVQDYIQICRSVAC-----QP---------NALCDLVTAYSTVCRQQGVCVDWRT-SSLCPM-SCSDSMEYAACRSGCLEQCGQSQFTPGDMMGDGLLKANGSVCLNTPTEGCFCPEGSVLMEDKCVDREACSQCVEHSGKTHQFMESWNPEDNPCVLCVC 2294          
BLAST of von Willebrand factor vs. Ensembl Zebrafish
Match: vwf (von Willebrand factor [Source:ZFIN;Acc:ZDB-GENE-070103-1])

HSP 1 Score: 522.702 bits (1345), Expect = 1.848e-153
Identity = 360/1273 (28.28%), Postives = 570/1273 (44.78%), Query Frame = 2
Query:  455 ECSVIYGHHIKTFDGNVFSYPLRGGYTLFMDCLGAAPLFYVYFNASYDCFDQKTQNDCSISMKITVGTQTIILFPKNEFALVKNNKTKIPFNSEGIIVSSVGSFIKIKGID-DLEILFDRDRNIYVYAPVTAEKKICGLCGYFNGIMSDDYRDFNQVIQKNVKTFVNSWIDRDPSDLNVYREREQYPCNALKLK----NNDQYQKALTLCQDMVKNNLGRTCQSEVKIDKYLDMCQDEICECLQTQPENSTIENCYSTFCKIEEQYSYACTLKGIAV-DWRSATTICKQPQCFNGQEFSECGSNCGKNCGQLGMELECESQCLPGCYCPRNRYWDGTMCVPQEKCPCVRDNGESTYQQGYRLKLNCETCICGMHGKWQCIENEECEGRCFISGDPHYITFDRRHFFFDGHCEYTAVMTTSDNVLLSNSTIAPLSITIQNTNCQDNSETGCPRTIGVIIGEDEDQVAINLLSSSEIKVNFVKISLPYQHTGNTKVLIDQVSTDILRLKSETGVEILWNGGSRIEIKLSKKYREKVTGMCGNFNGNEMDDSMTFKGVDEKDIDKFVLSWKTNPTCESDRGIVEYKGACALSRSYSDYANKVCHKLYESEEFKKCHSAANADKFFDQCTHDVCTCGMKRNGALDHCECEAFSSYARQCALENINLSWRTNELCPKKCPNENMKYNQCGSRCTSTCRLLQ--ESKCKEECIEGCFCPEGETFDEAAKECVKISDCKCEFHGRFYLPYEIRQDRCNNCTCTNGNWICTSNDCEGKEF------------------CPKSMAWFDC------GI-CQKTCTNLDLVCPKGQCQLPGCFCPENTVLHNGECIKPFECPCYMNNKMYSENDTIVRGPANCQNPCICKDGKWVCEQNKQCSGICKTWGETHYESFDGKYFEFQGSCSYVISEDFCGNKLGTFKLISENIACGXXXXXCTKSIKFIYLNRVFQF----VRGSNPIVSRNTNYPPGGPTAFYWTSDVDTHFILFTMEGIQVKWDKAMSLEIMIPEKYQNKVCGLCGNFDLRIDNDMRARSGEIEKDIVNFADSWKVHSSCPVPQKPPFMCSKRPDREPWAKAKCEILKSDSFKKCHDVVNVEHYYKRCVADACECDRGDDCVCFCTAVEQYVARCNEYEIGLKWRTNENCPHTC------TGKR-VWK--NCGNICPDSCIDIGKNVTDNTGCKKVCIEGC--FCPDG--LHWQNNECVERKACE-CVDPITNLKYNTGDKVI------RECEECNCYEGAFRC 4102
             CS+    HI TFDG ++ +P    Y L  DC   +      F+   D    K +      + + +G    +    +        +  +P+ S  +       ++++   +    I  D   NI +        + CGLCG +N +  D+Y      +  +   F NSW  +   +          PC  +       N+      ++ C+ M  + L   C   V    ++ +C+ ++C C       S  + C    C+   +YS AC  +GI + +W + +     P+C  G E+S+C   C  +C  + ++  C+ +C+ GC CP  +  DG  CV   +C C   +    Y     +  +C TC+C  HG W+C  NE C G C ++G  HY TFD + F F G C Y        N           S  I+   C D+ +  C R+I +   +  +Q  ++L     + V+ + +  P     N  + I       +RL+    + + W+G  R+ ++L   Y  ++ G+CGN+NGN+ DD +T  G+ E  ++ F  SWK N  C+  +  ++    C+L+     +A + C  L  S +F+ CH   N + +   C +DVC C   +      C C+A SSYA  CA   + ++WR++  C   CP+  + Y  CGS C  TCR L   ++ C   C EGCFCP G  F   A ECV    C C  +G  + P ++  D  + C C +G+  CTSN+  G                     CP  +  F+C      GI C KTC NL+L C    C + GC CP  TV +  +CI   +CPCY N++ Y    +I     +C N C+C+  +W C + + C G+C+  G+THY SFDG  F F G C YV+++D+C    GTF+++ EN ACG +   C+KSI  +Y+  +       VR   P++                      ++I+   + I + WD    + + I  +Y+ KVCGLCGNFD   +ND+ + S ++E D  +F +SWKV  SC         CS    +    +  C +L S  F+ C+ VV+ E Y+  C  D C C    DC CFC  +  Y   C +  + + WR+N+ CP +C      +G +  W+   C + CP +C        +   C   C+EGC   CP G  L     +CVE   C+ CV      + + G + I      R C+ C+C      C
Sbjct:   16 RCSLFSRQHIHTFDGVIYEFPGDCSYMLAGDCRQRS------FSILGDFSHGKRKG-----VTVFLGEMFELHLSVDGTLSQGAERLPLPYASSSVFAGYELGYVRLWSEEFGFSIRIDPLHNIQLTLEKRHSNQTCGLCGNYNYLAEDEYSAQEGFLTDDPYDFANSWAMKGADE----------PCKRVLPPSQSCNSTGESTKMSACESMRSSVLFMHCAHLVDPAAFVSVCESDVCHC-------SAGKEC---VCQAMLEYSRACASRGITLSNWHTQSQC--SPKCPVGMEYSDCTPTCSTSCQNVNIQEVCKEECVDGCICPAGKVLDGDRCVDVSQCSCT--HAGRRYPPASYISQDCNTCVC-RHGSWECT-NEGCPGECLVTGQSHYKTFDNKFFTFSGICHYLLAKDCQSN---------SFSAVIETAQCADDQDAICTRSITLRFKDLANQT-VHLKHGGVVSVDGMDVQTPLI---NGPLRIQNTVLSSVRLRYGHDLHLDWDGRGRVLLRLKPAYAGQMCGLCGNYNGNQGDDFLTVGGLVETRVEAFGNSWKMNADCDDVQ--MQNSDPCSLNPKRVRFAEEACAVLL-SMKFEPCHYMVNPEPYVKNCRYDVCACADGQE-----CLCDAVSSYAVACAARGVLVNWRSHGYCELTCPDAQV-YEMCGSVCNQTCRSLSLPDTGCDGVCEEGCFCPRG-LFLSDAGECVPPQHCSCHHNGEIFEPNDMIGDHHSICVCESGSMHCTSNEATGSTLSDLFFDEQSPSRGRRSLSCPPPLQRFECESARDAGIECAKTCQNLELDCVSLGC-VSGCMCPPGTVRYRKDCIPQEQCPCYHNSRPYESGQSIT---VDC-NTCVCEQRQWKCSE-RVCDGVCRAIGDTHYISFDGLKFSFPGPCQYVLAQDYCNGLDGTFRVLVENSACGIAGYRCSKSITVLYMGGLIVMEHGEVRMKRPVLKETE----------VEIVRSGLYYIVLLGKHISITWDTGTRISLQISGQYRGKVCGLCGNFDGSQNNDLLSSSNQMEVDAADFGNSWKVRPSCADAVSVVSQCSTDLVKLVTVEQSCRVLTSAIFRDCNSVVDPEPYWDICTQDTCSCPSVGDCACFCNTIAAYAHECAQKGLPVNWRSNDLCPLSCEDLNKESGVQCEWRYNTCASACPSTC-----QHPEPLSCPISCVEGCHAVCPPGHLLDEVLRKCVEPSQCQVCVH--DGQRVSHGKQFILNHEDPRLCQICHCESNTLTC 1205          

HSP 2 Score: 137.887 bits (346), Expect = 8.524e-32
Identity = 107/388 (27.58%), Postives = 159/388 (40.98%), Query Frame = 2
Query: 1586 ECEGRCFISGDPHYITFDRRHFFFDGHCEYTAVMTTSDNVLLSNSTIAPLSITIQNTNCQDNSETGCPRTIGVIIGEDEDQVAINLLSSSEIKVNFVKISLPYQHTGNTKVLIDQVSTDILRLKSET-GVEILWNGGSRIEIKLSKKYREKVTGMCGNFNGNEMDDSMTFKGVDEKDIDKFVLSWKTNPTCESDRGIVEYKGACALSRSYSDYANKVCHKLYESEEFKKCHSAANADKFFDQCTHDVCTCGMKRNGALDHCECEAFSSYARQCALENINLS-WRTNELCPKKCPNENMKYNQCGSRCTSTCRLLQ-ESKCKEECIEGCFCPEGETFDEAAKECVKISDCKCEFHGRFYLPYEIRQDRCNNCTCTNGNWICTSNDCEGK 2740
            E   RC +    H  TFD   + F G C Y   M   D    S S +   S              G  + + V +GE      ++L     +     ++ LPY  +     +        +RL SE  G  I  +    I++ L K++  +  G+CGN+N    D+    +G    D   F  SW      E  + ++    +C  +   +  +   C  +  S  F  C    +   F   C  DVC C   +      C C+A   Y+R CA   I LS W T   C  KCP   M+Y+ C   C+++C+ +  +  CKEEC++GC CP G+  D     CV +S C C   GR Y P       CN C C +G+W CT+  C G+
Sbjct:   12 EGSARCSLFSRQHIHTFDGVIYEFPGDCSY---MLAGDCRQRSFSILGDFS-------------HGKRKGVTVFLGE---MFELHLSVDGTLSQGAERLPLPYASSS----VFAGYELGYVRLWSEEFGFSIRIDPLHNIQLTLEKRHSNQTCGLCGNYNYLAEDEYSAQEGFLTDDPYDFANSWAMKGADEPCKRVLPPSQSCNSTGESTKMS--ACESMRSSVLFMHCAHLVDPAAFVSVCESDVCHCSAGKE-----CVCQAMLEYSRACASRGITLSNWHTQSQCSPKCP-VGMEYSDCTPTCSTSCQNVNIQEVCKEECVDGCICPAGKVLD--GDRCVDVSQCSCTHAGRRYPPASYISQDCNTCVCRHGSWECTNEGCPGE 366          

HSP 3 Score: 125.946 bits (315), Expect = 3.220e-28
Identity = 96/382 (25.13%), Postives = 167/382 (43.72%), Query Frame = 2
Query: 3029 SGICKTWGETHYESFDGKYFEFQGSCSYVISEDFCGNKLGTFKLISENIACGXXXXXCTKSIKFIYLNRVFQFVRGSNPIVSRNTNYPPGGPTAFYWTSDVDTHFILFTME--GIQVKWDKAMSLEIMIPEKYQNKVCGLCGNFDLRIDNDMRARSGEIEKDIVNFADSWKVHSSC-PVPQKPPFMCSKRPDREPWAKAKCEILKSDS-FKKCHDVVNVEHYYKRCVADACECDRGDDCVCFCTAVEQYVARCNEYEIGLK-WRTNENCPHTCTGKRVWKNCGNICPDSCIDIGKNVTDNTGCKKVCIEGCFCPDGLHWQNNECVERKACECVDPITNLKYNTGDKVIRECEECNCYEGAFRCTKLF-SKECLHTSRPEIST 4156
            S  C  +   H  +FDG  +EF G CSY+++ D C  +  +F ++      G  S    K +  ++L  +F+     +  +S+     P    +    +  +  ++    E  G  ++ D   ++++ + +++ N+ CGLCGN++   +++  A+ G +  D  +FA+SW +  +  P  +  P   S     E    + CE ++S   F  C  +V+   +   C +D C C  G +CV  C A+ +Y   C    I L  W T   C   C     + +C   C  SC    +NV     CK+ C++GC CP G     + CV+   C C       +Y     + ++C  C C  G++ CT      ECL T +    T
Sbjct:   14 SARCSLFSRQHIHTFDGVIYEFPGDCSYMLAGD-CRQR--SFSIL------GDFSHGKRKGVT-VFLGEMFELHLSVDGTLSQGAERLPLPYASSSVFAGYELGYVRLWSEEFGFSIRIDPLHNIQLTLEKRHSNQTCGLCGNYNYLAEDEYSAQEGFLTDDPYDFANSWAMKGADEPCKRVLPPSQSCNSTGESTKMSACESMRSSVLFMHCAHLVDPAAFVSVCESDVCHCSAGKECV--CQAMLEYSRACASRGITLSNWHTQSQCSPKCPVGMEYSDCTPTCSTSC----QNVNIQEVCKEECVDGCICPAGKVLDGDRCVDVSQCSCTH--AGRRYPPASYISQDCNTCVCRHGSWECTNEGCPGECLVTGQSHYKT 377          

HSP 4 Score: 110.153 bits (274), Expect = 1.988e-23
Identity = 116/470 (24.68%), Postives = 191/470 (40.64%), Query Frame = 2
Query:  191 CSPDCVNG-VCKDGRCSCSLGWQGNRCSDPICVGGCSNGGKCVAPNQCLCLDNYSGPNCNTLLIKSSQSDVSNYGAVTRVNNTMYSTYYECSVIYGHHIKTFDGNVFSYPLRGGYTLFMDCLGAAPLFYVYFNASYDCFDQKTQNDCSISMKITVGTQTIILFPKNEFALVKNNKTKIPF-NSEGIIVSSVGSFIKIKGIDDLEILFD-RDRNIYVYAPVTAEKKICGLCGYFNGIMSDDYRDFNQVIQKNVKTFVNSWIDRDPSDLNVYREREQYPCNALKLKNNDQYQKALTLCQDMVKNNLGRTCQSEVKIDKYLDMCQDEICECLQTQPENSTIENCYSTFCKIEEQYSYACTLKGIAVDWRSATTICKQPQCFNGQEFSECGSNCGKNCGQLGM-ELECESQCLPGCYCPRNRYW-DGTMCVPQEKCPCVRDNGESTYQQGYRLKLNCETCICGMHGKWQCIENE 1585
            C  +CV+G +C  G+        G+RC D +    C++ G+   P       +Y   +CNT + +    + +N G              EC V    H KTFD   F++     Y L  DC   +  F      +    DQ      SI+++        +         V     + P  N    I ++V S ++++   DL + +D R R +    P  A  ++CGLCG +NG   DD+     +++  V+ F NSW  +  +D +  + +   PC+     N  + + A   C  ++       C   V  + Y+  C+ ++C C   Q             C     Y+ AC  +G+ V+WRS      +  C + Q +  CGS C + C  L + +  C+  C  GC+CPR  +  D   CVP + C C   NGE  ++    +  +   C+C   G   C  NE
Sbjct:  300 CKEECVDGCICPAGKV-----LDGDRCVD-VSQCSCTHAGRRYPPA------SYISQDCNTCVCRHGSWECTNEGCPG-----------ECLVTGQSHYKTFDNKFFTFSGICHYLLAKDCQSNS--FSAVIETAQCADDQDAICTRSITLRFKDLANQTVHLKHGGVVSVDGMDVQTPLINGPLRIQNTVLSSVRLRYGHDLHLDWDGRGRVLLRLKPAYA-GQMCGLCGNYNGNQGDDFLTVGGLVETRVEAFGNSW--KMNADCDDVQMQNSDPCSL----NPKRVRFAEEACAVLLSMKF-EPCHYMVNPEPYVKNCRYDVCACADGQ----------ECLCDAVSSYAVACAARGVLVNWRSHGYC--ELTCPDAQVYEMCGSVCNQTCRSLSLPDTGCDGVCEEGCFCPRGLFLSDAGECVPPQHCSC-HHNGE-IFEPNDMIGDHHSICVC-ESGSMHCTSNE 721          
BLAST of von Willebrand factor vs. Ensembl Zebrafish
Match: scospondin (subcommissural organ spondin [Source:ZFIN;Acc:ZDB-GENE-051114-1])

HSP 1 Score: 501.901 bits (1291), Expect = 6.860e-145
Identity = 357/1263 (28.27%), Postives = 558/1263 (44.18%), Query Frame = 2
Query:  368 TLLIKSSQSDVSNYGAVTRVNNTMYSTYYECSVIYGHHIKTFDGNVFSYPLRGGYTLFMDCLGAAPLFYVYFNASYDCFDQKTQNDCSISMKITVGTQTIILFPKNEFALVKNNKTKIPFNSEGIIVSSVGSFIKIKGIDDLEILFDRDRNIYVYAPVTAEKKICGLCGYFNGIMSDDYRDFNQVIQKNVKTFVNSWIDRDPSDLNVYREREQYPCNALKLKNNDQYQKALTLCQDMVKNNLGRTCQSEVKIDKYLDMCQDEICECLQTQPENSTIENCYSTFCKIEEQYSYACTLKGIAVDWRSATTICKQPQCFNGQEFSECGSNCGKNCG--QLGMELECESQCLPGCYCPRNRYWDGTMCVPQEKCPCVRDNGESTYQQGYRLKLNCETCICGMHGKWQCIENEECEGRCFISGDPHYITFDRRHFFFD-GHCEYTAVMTTSDNVLLSNSTIAPLSITIQNTNCQDNSETGCPRTIGVIIGEDEDQVAINLLSSSEIKVNFVKISLPYQHTGNTKVLIDQVSTDILRLKSETGVEILWN-GGSRIEIKLSKKYREKVTGMCGNFNGNEMDDSMTFKGVDEKDIDKFVLSWKTNPTCESDRGIVEYKGACALSRSYSDYANKVCHKLYESEEFKKCHSAANADKFFDQCTHDVCTCGMKRNGALDHCECEAFSSYARQCALENINLSWRTNELCPKKCPNENMKYNQCGSRCTSTCRLLQES-KCKEE-----CIEGCFCPEGETFDEAAKECVKISDCKCEFHGRFYLPYEIRQDRCNNCTCTNGNWICTSNDCEGKEFCPKSMAWFDCGICQKTCTNLDLVCPKGQCQLP--GCFCPENTVLHNGECIKPFECPCYMNNKMYSENDTIVRGPANCQNPCICKDGKWVCEQNKQCSGICKTWGETHYESFDGKYFEFQGSCSYVISEDFCGNKLGTFKLISENIACGXXXXXCTKSIKFIYLNRVFQFVRGSNPIVSRNTNYPPGGPTAFYWTSDVDTHFILF----TMEGIQVKWDKAMSLEIMIPEKYQNKVCGLCGNFDLRIDNDMRARSGEIEKDIVNFADSWKVHSSCP--VPQKPPFMCSKRPDREPWAKAKCEILKSDSFKKCHDVVNVEHYYKRCVADACECDRGDDCVCFCTAVEQYVARCNEYEIGLKWRTNENCPHTCTGKRVWKNCGNICPDSCIDIGKNVTDNTGCKKVCIEGCFCPDGLHWQNNECVERKACECVDPITNLKYNTGDKVIRECEECNCYEGAFRC 4102
            TLL     S V   G +  V +   S+   C    G H +TFD   F +     Y L     G    + VY +   +     T   C   +++ +G   + +   N            P    G+ V  +G F+ ++    + + FD +  IY+           GLCG +N    DD+      + +   +F NSW  +D     V  +  +   ++  L N+   ++       ++K      C  +V    Y+D C    C  L+ +  ++ +       C     Y   C  + I + WR     C    C  GQ FS+C S+C   C   +     +C  +C+ GC CP+  Y     CV ++ CPC       +Y  G  ++  C TC+C   G+W+C   E+CE +C + G  H  TFD++ +      C +TAV    D  L         SI I    C    E GC R + +          + +  +  + VN  +  LP   TG+  +L+ + S+ +L +++  G +++W+  G  + I L   +  KV G+CG  + ++ DD  T +G  E     F   +    +C +   +      C         A +VC  ++ S  F+ CH   + + F   C  +VC+CG + +     C C   ++YA  CA E   LSWR +  CP +C    + Y +CG  C ++C  L +   C+ +     C+ GC CP+G   D A  +CV +  C C+     +       + CN C C  G W CT   C     CP S+  F    C +TC++ +   P   C  P  GC CPE TVL   +C+KP ECPC+ N ++Y  NDTI +   +C N C+C++ +W C Q   CSG C   G+ HY +FDG+++ F G C YV+ ++      G F + +EN+ CGS+  +CTKS+     N     +RG    V+     P   P ++  +  +     LF    +  G+ + WD  M + + +      +V GLCGNFD   +ND   R G +E     F +SWK+  SCP    Q     C   P R  WAK KC ++  + F  CH  V  + YY  CV DAC CD G DC C CTAV  Y   CN   + ++WR+ E CP  C    V++ CG  C  +C     +++D+      C+EGCFCP G  + ++ C+    C C        +  G  V + C+ C+C  G ++C
Sbjct:  170 TLLPDVGSSPVVRGGLLRGVRDPQASS--TCMSWSGTHFRTFDRKHFHFQGSCTYLLASSTDGT---WAVYISTVCE-----TSGRCRKDLRMMLGLGLVSIHKDNMTVNGLAVPQGEPLFQNGVSVHWLGDFVFVESGLGVRLKFDMENTIYLTVTAEHLTNTRGLCGVYNNNPDDDFTTSTGSVSQYAASFGNSWRVQDQQQSQVCSDAAELG-HSCDLSNDVSLRRDAESACHLLKETPFSHCHHQVDPGPYIDTCLYLFCS-LEVKDRDTAV-------CDTLASYVRECAQQHIIISWRR-RGFCGTRVCPRGQVFSDCVSSCPATCASPRPPAAGQCRDECVGGCECPQGVYLHAGQCVRRDDCPCFHR--RHSYSAGQTIRQRCNTCVC-RAGQWEC-STEKCEAQCSVLGAMHITTFDQKRYGLQTADCRFTAVEDFVDKKL---------SIIIGAGPCA-GGEAGCLREMSITA----LHTTLTVTDAGSVLVNGHRNPLPVV-TGD--LLVRRASSSVLLIQA-FGAQLMWHLDGPLLFITLQPGFAHKVRGLCGTLSWSQHDDFTTPEGDVENSAASFAAKFIVG-SCPAPSAMT--SDPCGTLTQRRQLAERVCSVIH-SNVFQACHDVVDREPFMRLCVSEVCSCGPQAS-----CHCSVLTAYATHCAQEGALLSWRNHTFCPVQCSGGQV-YQECGRLCGTSCADLWDGWSCEPDEGSRVCVSGCQCPDGLAQD-AQGQCVPVHMCPCKSGDTLHPAGSSINNNCNTCVCARGVWNCTDLSCPELNQCPGSLI-FSPRSCLRTCSSPNS--PLDACTEPIHGCICPEGTVLLGDQCVKPDECPCHHNGRLYFTNDTISK---DC-NTCVCREQRWHCGQ-ALCSGTCVATGDPHYITFDGRHYSFLGDCEYVLVQE----SSGLFSVSAENVPCGSTGVTCTKSVTLTIGNTAIHLLRGKAVTVN---GIPVTLPKSYSGSGLILERVGLFVSLSSRLGVTLLWDGGMRVYVRLMPHLHGRVGGLCGNFDGDAENDFTTRQGIMESTPELFGNSWKISPSCPDVADQDLRDPCFINPHRVTWAKKKCAVINQEIFSSCHSEVPYQQYYDWCVFDACGCDSGGDCECLCTAVAAYAEECNRRGVYVRWRSQELCPLQCENGLVYEACGAACSPACPST-PSLSDSLCSALSCVEGCFCPQGTVYHDDACISPSQCPCE--WDGSVFPAGAMVTQHCQNCSCSAGLWQC 1361          

HSP 2 Score: 52.373 bits (124), Expect = 8.314e-6
Identity = 36/108 (33.33%), Postives = 49/108 (45.37%), Query Frame = 2
Query: 2489 GSRCTSTC-RLLQESKCKEECIEGCFCPEGETFDEAAKECVKISDCKCEFHGRFYLPYE-IRQDRCNNCTCTNGNWICTSNDCEGKEFCPKSMAWFD---CGICQKTC 2797
            G  C   C   + + +C  EC +GC+C  G  F    K CV +  C C   G   +P + + +D CNNCTC NG   C      G+E CP    W +      C +TC
Sbjct: 2706 GGACPRVCLDAMADVQCASECYDGCYCSPG--FYLFNKSCVHLQFCPCVHQGALLMPGDSVPRDSCNNCTCVNGEMQC------GEEPCPVHCGWSEWTSWSACSRTC 2805          
BLAST of von Willebrand factor vs. Ensembl Zebrafish
Match: CABZ01080550.1 (pep chromosome:GRCz11:25:8269956:8292650:1 gene:ENSDARG00000100621.2 transcript:ENSDART00000166938.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CABZ01080550.1)

HSP 1 Score: 456.062 bits (1172), Expect = 2.517e-133
Identity = 339/1191 (28.46%), Postives = 529/1191 (44.42%), Query Frame = 2
Query:  458 CSVIYGHHIKTFDGNVFSYPLRGGYTLFMDCLGAAPLFYVYFNASYDCFDQKTQNDCSISMKITVGTQTIILFPKNEFALVKNNKTKIPFNSEGIIVSSVGSFIKIKGIDDLEILFDRDRNIYVYAPVTAEKKICGLCGYFNGIMSDDYRDFNQVIQKNVKTFVNSW--IDRDPSDLNVYREREQYPCNALKLKNNDQYQKALTLCQDMVKNNLGRTCQSEVKIDKYLDMCQDEICECLQTQPENSTIENCYSTFCKIEEQYSYACTLKGIAVDWRSATTICKQPQCFNGQEFSECGSNCGKNCGQLGMELECESQCLPGCYCPRNRYWDG---TMCVPQEKCPCVRDNGESTYQQGYRLKLNCETCICGMHGKWQCIENEECEGRCFISGDPHYITFDRRHFFFDGHCEYTAVMTTSDNVLLSNSTIAPLSITIQNTNCQDNSETGCPRTIGVIIGEDEDQVAINLLSSSEIKVNFVKISLPYQHTGNTKVLIDQVSTDILRLKSETGVEILWNGGSRIEIKLSKKYREKVTGMCGNFNGNEMDDSMTFKGVDEKDIDKFVLSWKTNPTCESDRGIVEYKGACALSRSYSDYANKVCHKLYESEE-FKKCHSAANADKFFDQCTHDVCTCGMKRNGALDHCECEAFSSYARQCALENINLSWRTNELCPK---KCPNE---NMKYNQCGSRCTSTCRLLQESKCKEECIEGCFCPEGETFDEAAKECVKISDCKCEFHGRFYLPYEIRQDRCNNCTCTNGNWICTSNDCEGKEFCPKSMAWFDCGI---------CQKTCTNLDLVCPKGQCQLPGCFCPENTVLHN-GECIKPFECPCYMNNKMYSENDTIVRGPANCQNPCICKDGKWVCEQNKQCSGICKTWGETHYESFDGKYFEFQGSCSYVISEDFCGNKLGTFKLISENIACGXXXXXCTKSIKFIYLNRVFQFVRGSNPIVSRNTNYPPGGPTAFYWTSDVDTHFILFTMEGIQVKWDKAMSLEIMIPEKYQNKVCGLCGNFDLRIDNDMRARSGEIEKDIVNFADSWKVHSSCPVPQKPPFMCSKRPDREPWAKAKCEILKSDSFKKCHDVVNVEHYYKRCVADACECDRGDDCVCFCTAVEQYVARCNEYEIGLKWRTNENCPHTCTGKRVWKNCGNICPDSCIDIGKNVTDNTGCKKVCIEGCFCPDGL 3964
            CS+    H KTFDG+V+ +P    Y L  DC      F +Y   +      K         ++++    I +        V   K  +P +  GI+V     + ++     + +++++D  + V        + CGLCG FNGI       +N+ IQ         +  + R P   N   + E    N  +    DQ +K    C D++++    +C   +  + Y+  C +++C     QPE+       +T  +   Q S+A    G    WR+A   C   QC      SE GS C   C        CE   + GC+CP    +D    T C+P EKC C  D     Y  G  L+ + E C C   G W C+      G C +    H+ TFD + F F G C Y       ++  +    I P         C  +    C ++I V++ +++ +  + + +   ++ N  ++SLPY  T +  V        IL+      V++      ++ I + + ++ K  G+CGNFN    DD  T +GV E     F  +WK    C  DR        C+ S     +A   C K+ + E  F +CH+  N D ++ +C +  CTC    +     C C  FSSYAR CA + + L      +C K    CP     + +   C   C S     Q        ++GC CP+G   DE    CV +  C C  +G+   P +    R  +C C NG + C S   +    CP    +F+C           C KTC++ ++ C    CQ  GC CP   +    G C++P+ CPC  + + Y+    IV+   +C    IC+ G W+C Q K+C GIC  +G  HY++FD + F F+G CSY+ +++ CGNK G F +++EN+ CG++ ++C+K++  +          G+       T     GP   Y   +V  + ++    G+ V WD+  ++ I++  ++ + VCGLCGNF+    +D   +      +I+ F DSWKV S+CP  Q     CS+ P+RE WAK +C I+K  +FK CH  V+   YY+ CV D+C CD G DC CFCTAV  Y   CNE  + + WRT E CP  C              D   + G+     + C   C + C  PDG+
Sbjct:    4 CSMWGNFHFKTFDGDVYQFPGMCEYNLVSDCQSLIRQFSIYVKRTERSTGPKIS-------RVSITINDIAIELTENQVNVNEAKVTLPVHVSGILVEENTIYTRLYSKMGITVMWNKDDAVMVELDSKYSNRTCGLCGDFNGIPV-----YNEFIQSGRTVGYTEFGNMHRVP---NPTHQCEDPFENVDEQNVVDQCEKYRADCADLLEDEKWSSCSWVLDPEAYIKACTNDLC---NRQPEDEDTTALCATLTEYSRQCSHA---GGNPPAWRTAK-FCNV-QCPYNMVHSESGSPCMDTCSHKDTNALCEEHNIDGCFCPPGTVFDDISDTGCIPAEKCQCKHDR---VYSSGEVLRKSEEECYC-QEGSWVCMSIPG-PGLCAVEEGSHFTTFDGKEFTFHGDCNYLLSKDCEESKFIILGQIVP---------CFTHETDTCLKSI-VVLFDNDKKNPLFIKADGTVQHN-AEVSLPYM-TADFTVFRPSSFHIILQTVFGLQVQVQLVPLMQVYITVDQSFQGKTCGLCGNFNKVLADDLKTPQGVVEGTAVSFANAWKAQSNC-PDRS-ERMDDPCSYSSDSEHFAEHWCSKMKDKESLFAQCHATVNPDSYYKRCKYSSCTCEKSED-----CLCTVFSSYARACAAKGVILEGWREVVCDKYIKDCPASQSYSYELQSCQRTCVSLASERQSCNVDFVPVDGCACPDGLYQDEN-NLCVPMEKCPCYHNGQKIHPGKSLTIRDEHCVCMNGKFHCRSWKTQILG-CPSPKVFFNCSTAGPEEYGLECAKTCSHQEVDCFSLDCQ-SGCQCPFGLLDDGRGHCVQPYNCPCKHDGQYYAPGSVIVK---DCNKCSICRWGNWLCSQ-KKCPGICTIYGSGHYKTFDQQRFGFRGDCSYIAAQNKCGNKTGNFHVVTENMPCGTTGTTCSKAVGILLGRTWLLLSDGTVTATDVGT-----GPNIKYNERNVGMYLVIDAAIGLTVLWDRKTTVRIILQPQHMDDVCGLCGNFNGNGKDDFTTQGNLPTTNIMEFVDSWKVLSTCPDAQPDFDPCSQTPNRETWAKIQCSIIKEVTFKDCHSKVDPNPYYENCVKDSCSCDTGGDCECFCTAVAAYAQACNEAGVCVVWRTPEICPVYC--------------DYYNEPGECTWHYSPCHTPCYKTCLNPDGI 1121          

HSP 2 Score: 171.785 bits (434), Expect = 2.620e-42
Identity = 137/488 (28.07%), Postives = 231/488 (47.34%), Query Frame = 2
Query: 2747 CPKSMAWFDCG-ICQKTCTNLDLVCPKGQCQLPGCFCPENTV---LHNGECIKPFECPCYMNNKMYSENDTIVRGPANCQNPCICKDGKWVCEQNKQCSGICKTWGETHYESFDGKYFEFQGSCSYVISEDFCGNKLGTFKLISENIAC-GXXXXXCTKSIKFIYLN--RVFQFVRGSNPIVSRNTNYPPGGPTAFYWTSDVDTHFILFTMEGIQVKWD--KAMSLEIMIPEKYQNKVCGLCGNFDLRIDNDMRARSGEIEKDIVNFADSWKVHSSCP-VPQKPPFMCSKRPDREPWAKAKCEILKSDS--FKKCHDVVNVEHYYKRCVADACECDRGDDCVCFCTAVEQYVARCNEYEIGLK-WRTN------ENCPHTCTGKRVWKNCGNICPDSCIDIGKNVTDNTGCKKVCIEGCFCPDGLHW-QNNECVERKACECVDPITNLKYNTGDKVIRECEECNCYEGAFRCTKLFSKECLHTSRPEI 4150
            CP +M   + G  C  TC++ D      +  + GCFCP  TV   + +  CI   +C C  ++++YS  + + +     +  C C++G WVC  +    G+C     +H+ +FDGK F F G C+Y++S+D   +K   F ++ + + C    + +C KSI  ++ N  +   F++    +        P     F        H IL T+ G+QV+      M + I + + +Q K CGLCGNF+  + +D++   G +E   V+FA++WK  S+CP   ++    CS   D E +A+  C  +K     F +CH  VN + YYKRC   +C C++ +DC+C  T    Y   C    + L+ WR        ++CP + +     ++C      +C+ +      +     V ++GC CPDGL+  +NN CV  + C C       K + G  +    E C C  G F C + +  + L    P++
Sbjct:  267 CPYNMVHSESGSPCMDTCSHKDTNALCEEHNIDGCFCPPGTVFDDISDTGCIPAEKCQC-KHDRVYSSGEVLRKS----EEECYCQEGSWVC-MSIPGPGLCAVEEGSHFTTFDGKEFTFHGDCNYLLSKDCEESK---FIILGQIVPCFTHETDTCLKSIVVLFDNDKKNPLFIKADGTVQHNAEVSLPYMTADFTVFRPSSFHIILQTVFGLQVQVQLVPLMQVYITVDQSFQGKTCGLCGNFNKVLADDLKTPQGVVEGTAVSFANAWKAQSNCPDRSERMDDPCSYSSDSEHFAEHWCSKMKDKESLFAQCHATVNPDSYYKRCKYSSCTCEKSEDCLC--TVFSSYARACAAKGVILEGWREVVCDKYIKDCPASQSYSYELQSCQR----TCVSLASE-RQSCNVDFVPVDGCACPDGLYQDENNLCVPMEKCPCYH--NGQKIHPGKSLTIRDEHCVCMNGKFHC-RSWKTQILGCPSPKV 735          

HSP 3 Score: 95.1301 bits (235), Expect = 7.331e-19
Identity = 97/384 (25.26%), Postives = 163/384 (42.45%), Query Frame = 2
Query: 3035 ICKTWGETHYESFDGKYFEFQGSCSYVISEDFCGNKLGTFKLISENI--ACGXXXXXCTKSIKFIYLN-----------RVFQFVRGSNPIVSRNTNYPPGGPTAFYWTSDVDTHFILFTMEGIQVKWDKAMSLEIMIPEKYQNKVCGLCGNFDLRIDNDMRARSGEIEKDIVNFADSWKVHSSCPVPQ---KPPFMCSKRP---DREPWAKAKC-EILKSDSFKKCHDVVNVEHYYKRCVADACECDRGD-DCVCFCTAVEQYVARCNEYEIGL-KWRTNENCPHTCTGKRVWKNCGNICPDSCIDIGKNVTDNTGCKKVCIEGCFCPDGLHW---QNNECVERKACECVDPITNLKYNTGDKVIRECEECNCYEGAFRCTKL 4111
            IC  WG  H+++FDG  ++F G C Y +  D C + +  F +  +    + G   S  + +I  I +            +V   V  S  +V  NT Y                   L++  GI V W+K  ++ + +  KY N+ CGLCG+F+     +   +SG      V + +   +H   P P    + PF         D+    +A C ++L+ + +  C  V++ E Y K C  D C     D D    C  + +Y  +C+        WRT + C   C    V    G+ C D+C     +   N  C++  I+GCFCP G  +    +  C+  + C+C     +  Y++G+ + +  EEC C EG++ C  +
Sbjct:    3 ICSMWGNFHFKTFDGDVYQFPGMCEYNLVSD-CQSLIRQFSIYVKRTERSTGPKISRVSITINDIAIELTENQVNVNEAKVTLPVHVSGILVEENTIYTR-----------------LYSKMGITVMWNKDDAVMVELDSKYSNRTCGLCGDFNGIPVYNEFIQSGRT----VGYTEFGNMHRV-PNPTHQCEDPFENVDEQNVVDQCEKYRADCADLLEDEKWSSCSWVLDPEAYIKACTNDLCNRQPEDEDTTALCATLTEYSRQCSHAGGNPPAWRTAKFCNVQCPYNMVHSESGSPCMDTC----SHKDTNALCEEHNIDGCFCPPGTVFDDISDTGCIPAEKCQCKH---DRVYSSGEVLRKSEEECYCQEGSWVCMSI 356          
BLAST of von Willebrand factor vs. Ensembl Zebrafish
Match: otog (otogelin [Source:ZFIN;Acc:ZDB-GENE-120228-1])

HSP 1 Score: 437.958 bits (1125), Expect = 2.203e-124
Identity = 334/1214 (27.51%), Postives = 536/1214 (44.15%), Query Frame = 2
Query:  281 CVGGCSNGGKCVAPNQCLC-LDNYSGPNCNTLLIKSSQSDVSNYGAVTRVNNTMYSTYYECSVIYGHHIKTFDGNVFSYPLRGGYTLFMDCLGAAPLFYVYFNASYDCFDQKTQNDCSISMKITVGTQTIILFPKNEFALV-KNNKTKIPFNSEGIIVSSVGSFIKIKGIDDLEILFD-RDRNIYVYAPVTAEKKICGLCGYFNGIMSDDYRDFNQVIQKNVKTFVNSWIDRDPSDLNVYREREQYPCNALKLKNNDQYQKALTLCQDMVKNNLGRTCQSEVKIDKYLDMCQDEICECLQTQPENSTIENCYSTFCKIEEQYSYACTLKGIAV-DWRSATTICKQPQCFNGQEFSECGSNCGKNCGQLGMELECESQCLPGCYCPRNRYWDGTMCVPQEKCPCVRDNGESTYQQGYRLKLNCETCICGMHGKWQCIENEECEGRCFISGDPHYITFDRRHFFFDGHCEYTAVMTTSDNVLLSNSTIAPLSITIQNTNCQDNSETGCPRTIGVIIGEDEDQVAINLLSSSEIKV-NFVKISLPYQHTGNTKVLIDQVSTDILRLKSETGVEILWNGGS-RIEIKLSKKYREKVTGMCGNFNGNEMDDSMTFKGVDEKDIDKFVLSWKTNPTCESDRGIVEYKGACALSRSYSDYANKVCHKLYESEEFKKCHSAANADKFFDQCTHDVCTCGMKRNGALDHCECEAFSSYARQCALENINLSWRTN-ELCPKKCPNENMKYNQCGSRCTSTCRLLQ-ESKCKEECIEGCFCPEGETFDEAAKECVKISDCKCEFHGRFYLPYEIRQDRCNNCTCTNGNWICTSNDCEGKEFCPKSMAWFDCG------------ICQKTCTN--LDLVCPKGQCQLPGCFCPENTVLHNGECIKPFECPCYMNNKMYSENDTIVRGPANCQNPCICKDGKWVCEQNKQCSGICKTWGETHYESFDGKYFEFQGSCSYVISEDFCGNKLGTFKLISENIACGXXXXXCTKSIKFIYLNRVFQFVRG----SNP--IVSRNTNYPPGGPTAFYWTSDVDTHFILFTMEGIQVKWDKAMSLEIMIPEKYQNKVCGLCGNFDLRIDNDMRARSGEIEKDIVNFADSWKVHS--SCPVPQKPPFMCSKRPDREPWAKAKCEILKSDSFKKCHDVVNVEHYYKRCVADACECDRGDDCVCFCTAVEQYVARCNEYEIGLKWRTNENCPHTC 3832
            C   C NGG+CV P+ C C L   +G  C T                  V N  +     C     ++ +TFDG  + +P +  YTL  DC   A    V+     D     +   C+ S+ + +  +  I      F++  K     +P +   + +  +  +I +       + +     ++Y+          CGLCG FN    DD +    V  +++  F NSW + +P           YP     L +     K   +C  +++    ++C   V    Y+  C +++C    + P  + +       C++  +Y+ AC      + DWR+   +C    C +   F EC + C  +C    M ++ + QCL GCYCP +  ++  +CV    CPC  ++    Y  G+ ++ +C  C C   G W C E+  C G C ++GD  + +FD R + F   C+Y         VL  +      ++TIQN  C  N +  C +++ +++ ED  +  I +  S E+ + +  +ISLPY    +    I ++S+  +++K   G+ + +N    R+ ++L +++R+   G+CG FNGN  DD +   G+ E     F  +W+ +  C   R  +     C   +  + YA + C  L + E F  CH   +   F  QC  DVC CG     AL  C C   + YAR C    + + +R++   C   CP+  M+Y  C S C   C  L     C +EC EGC CPEG  F+     CV  ++C C F G  Y P ++         C +G  +  ++  E    CP    + DCG             C++TC    L+L C   +  +PGC CP   + H  EC KP  CPC    K Y   D +    + C   C+C+ G + CE  + C  +C  +G+ HY +FDG  F++ G C   + +      L    + +EN+ C  S   C KS+  I + R F          NP  ++ R          A+ W +   T  +    E + V WD+  ++ I    ++Q ++ GLCGNFD +  N+MR            F +SW      + P  + P   C+  P REP+AK +C IL S+ F+ CH VV+V  +Y  C+ D C C+RG DC CFCT+V  Y  RC +  I + WR+   CP+ C
Sbjct:   91 CASPCLNGGRCVHPDSCNCTLYQAAGTRCQT------------------VPNLGFEREMTCRSWGQYNYETFDGLYYYFPGKCSYTLLRDCEDNA-RSSVHIQVHNDPECSSSPYSCTRSISLFLPWEGEIRL--QHFSVTFKGQSVLLPHHIHDVELERISDYIVVSQPHVFTLAWQGLTSSVYIKMSPEFVGHTCGLCGNFNADTQDDLKTSYGVFTQDLAMFGNSWAEEEPELARCTVVPSLYPSPCATL-DPHVLLKVEEVCSTLLREPF-QSCHEFVSPYSYMASCSNDLC---LSGPNGAVV-------CQVFTEYARACAHADHPLHDWRTHFPVCNV-DCPDELLFRECITCCPMHCKIEQMCIDSKLQCLDGCYCPDDLIFEDGVCVKASDCPC--EHHGMLYPSGHIIQEDCNNCTC-FGGIWNCTEHN-CPGECSVTGDMFFQSFDGRVYTFPATCQY---------VLAKSRNSGKFTVTIQNAPCGANLDGACIQSVNLVVNEDP-RTEITMSHSGEVFLASQFRISLPY---SDDMFQIQELSSMFVQVKLSQGLWLQYNWKEFRLYLQLEEQWRDNTLGLCGTFNGNIQDDFLAPSGMIESTPFLFGNAWRVSSAC-VPRPSLPQLDPCDTHQQAASYAVEKCDVLTQ-EVFSACHEYVSPVGFQLQCRADVCKCG-----AL--CLCSILAHYARTCRRHGVIIEFRSHLPECAVSCPS-TMEYGVCVSACQRRCLFLSLPQPCGDECEEGCVCPEGTYFNMHTHTCVPRNECPCSFLGADYSPGDVIITSSGVQICQDGKLVSQTSIIE--TLCPAGQFYEDCGNRVDGPSASKGLACEQTCETYLLNLTCSTHEPCVPGCVCPAGLLKHGDECFKPRACPCLWKGKEYYPGDKVS---SPCHQ-CVCQHGTFQCE-FRPCPSMCTAYGDRHYRTFDGFLFDYIGVCKVYLVKSSLDAML---TVTAENVDCFESGVICRKSLH-ISVGRSFIVFDDDTGRPNPSSVIDRQR--------AYIWQAGYYT-IVHLLGEDLTVLWDRKTTIHIQAGPRWQGRLTGLCGNFDQKTANEMRTPENIDSSTPQEFGNSWTAAECVNSPDIRHP---CNLNPLREPFAKRQCGILLSEVFQVCHPVVDVTWFYMNCLVDTCGCNRGGDCECFCTSVAAYAHRCCQKGIPIDWRSPSICPYDC 1220          

HSP 2 Score: 161.77 bits (408), Expect = 4.447e-39
Identity = 115/462 (24.89%), Postives = 212/462 (45.89%), Query Frame = 2
Query: 2747 CPKSMAWFDCGICQKTCTNLDLVCPKGQCQ-LPGCFCPENTVLHNGECIKPFECPCYMNNKMYSENDTIVRGPANCQNPCICKDGKWVCEQNKQCSGICKTWGETHYESFDGKYFEFQGSCSYVISEDFCGNKLGTFKLISENIACGXXXX-XCTKSIKFIY-LNRVFQFVRGSNPIVSRNTNYPPGGPTA--FYWTSDVDTHFILFTM-EGIQVKWD-KAMSLEIMIPEKYQNKVCGLCGNFDLRIDNDMRARSGEIEKDIVNFADSWKVHSSC-PVPQKPPF-MCSKRPDREPWAKAKCEILKSDSFKKCHDVVNVEHYYKRCVADACECDRGDDCVCFCTAVEQYVARCNEYEIGLKWRTN-ENCPHTCTGKRVWKNCGNICPDSCIDIGKNVTDNTGCKKVCIEGCFCPDGLHW--QNNECVERKACECVDPITNLKYNTGDKVIRECEECNCYEGAF 4096
            CP  + + +C  C      ++ +C   + Q L GC+CP++ +  +G C+K  +CPC  +  +Y     I     +C N C C  G W C ++  C G C   G+  ++SFDG+ + F  +C YV+++       G F +  +N  CG++   +C +S+  +   +   +     +  V   + +    P +   +   ++ + F+   + +G+ ++++ K   L + + E++++   GLCG F+  I +D  A SG IE     F ++W+V S+C P P  P    C        +A  KC++L  + F  CH+ V+   +  +C AD C+C      +C C+ +  Y   C  + + +++R++   C  +C     +  C + C   C+ +         C   C EGC CP+G ++    + CV R  C C        Y+ GD +I       C +G  
Sbjct:  404 CPDELLFRECITCCPMHCKIEQMCIDSKLQCLDGCYCPDDLIFEDGVCVKASDCPCEHHGMLYPSGHIIQE---DCNN-CTCFGGIWNCTEHN-CPGECSVTGDMFFQSFDGRVYTFPATCQYVLAK---SRNSGKFTVTIQNAPCGANLDGACIQSVNLVVNEDPRTEITMSHSGEVFLASQFRISLPYSDDMFQIQELSSMFVQVKLSQGLWLQYNWKEFRLYLQLEEQWRDNTLGLCGTFNGNIQDDFLAPSGMIESTPFLFGNAWRVSSACVPRPSLPQLDPCDTHQQAASYAVEKCDVLTQEVFSACHEYVSPVGFQLQCRADVCKCG----ALCLCSILAHYARTCRRHGVIIEFRSHLPECAVSCPSTMEYGVCVSACQRRCLFLSLP----QPCGDECEEGCVCPEGTYFNMHTHTCVPRNECPCS--FLGADYSPGDVIITSSGVQICQDGKL 847          

HSP 3 Score: 119.783 bits (299), Expect = 2.859e-26
Identity = 94/374 (25.13%), Postives = 160/374 (42.78%), Query Frame = 2
Query: 3038 CKTWGETHYESFDGKYFEFQGSCSYVISEDFCGNKLGTFKL-ISENIACGXXXXXCTKSIKF-------IYLNRVFQFVRGSNPIVSRNTNYPPGGPTAFYWTSDVDTHFILFTMEGIQVKWDKAMS-LEIMIPEKYQNKVCGLCGNFDLRIDNDMRARSGEIEKDIVNFADSW-----KVHSSCPVPQKPPFMCSKR-PDREPWAKAKCEILKSDSFKKCHDVVNVEHYYKRCVADACECDRGDDCVCFCTAVEQYVARCNEYEIGLK-WRTN-ENCPHTCTGKRVWKNCGNICPDSCIDIGKNVTDNTGCKKVCIEGCFCPDGLHWQNNECVERKACECVDPITNLKYNTGDKVIRECEECNCYEGAFRCTK 4108
            C++WG+ +YE+FDG Y+ F G CSY +  D   N   +  + +  +  C SS  SCT+SI         I L       +G + ++  + +              +  + ++       + W    S + I +  ++    CGLCGNF+    +D++   G   +D+  F +SW     ++     VP   P  C+   P      +  C  L  + F+ CH+ V+   Y   C  D C    G +    C    +Y   C   +  L  WRT+   C   C  + +++ C   CP  C  I +   D+   K  C++GC+CPD L +++  CV+   C C      + Y +G  +  +C  C C+ G + CT+
Sbjct:  133 CRSWGQYNYETFDGLYYYFPGKCSYTLLRDCEDNARSSVHIQVHNDPECSSSPYSCTRSISLFLPWEGEIRLQHFSVTFKGQSVLLPHHIHD--------VELERISDYIVVSQPHVFTLAWQGLTSSVYIKMSPEFVGHTCGLCGNFNADTQDDLKTSYGVFTQDLAMFGNSWAEEEPELARCTVVPSLYPSPCATLDPHVLLKVEEVCSTLLREPFQSCHEFVSPYSYMASCSNDLCL--SGPNGAVVCQVFTEYARACAHADHPLHDWRTHFPVCNVDCPDELLFRECITCCPMHC-KIEQMCIDS---KLQCLDGCYCPDDLIFEDGVCVKASDCPCEH--HGMLYPSGHIIQEDCNNCTCFGGIWNCTE 490          

HSP 4 Score: 72.7886 bits (177), Expect = 4.605e-12
Identity = 90/374 (24.06%), Postives = 142/374 (37.97%), Query Frame = 2
Query: 1568 QCIENEECEGRCFISGDPHYITFDRRHFFFDGHCEYTAVMTTSDNVLLSNSTIAPLSITIQNTNCQDNSETGCPRTI---GVIIGEDEDQVAINLL------SSSEIKVNFVKISLPYQHTGNTKVLIDQVSTDILRLKSETGVEILW---NGGSRIEIKLSKKYREKVTGMCGNFNGNEMDDSMTFKGV---DEKDIDKFVLSWKTNPTCESDRGIVEYKGACALSRSYSDYANKVCHKLYESEEFKKCHSAANADKFFDQCTHDVCTCGMKRNGALDHCECEAFSSYARQCALENINLSWRTNELCPKKCPNENMKYNQCGSRCTS-TCRLLQESKCKEECI---EGCFCPEGETFDEA-AKECVKISDCKC 2629
            +C    +C  RC +  D + ITFD +         Y           L N T+   SI +Q  +  D++       +    + I    ++V +N L      +S   K  F K       TGN           +  ++S  G++I W    G   IE+  S   R    G+CG+ +GN ++D     G    +++D   F+ SW+   T          +  C  S          C  +  +  F  CH+      F +    DV            +  C A ++YA  C   NI + WR+++ CP  CP  N++Y  C   CT+ +C   +     E+C    EGC CPEG       +  C+  S C C
Sbjct: 2298 KCCPRWDCPCRCSVFPDLNLITFDGKSVAIYKAALYVVTQ-------LPNETV---SILVQECSGPDDTLVWNFTNLCLAALNITHKSNEVLVNRLQRRLYVNSRYAKPRFKKYGFEILDTGN-----------MYLIRSPAGLKIQWFHTTGMMVIEMD-SYNNRLPTMGLCGSCDGNPLNDLTLSNGTVVPEQEDPAVFIDSWQIPNTTSYVSNSRRREVNCTTSDCSQ------CFNMLNNNTFTLCHAYVPPGVFCEMWVRDV---------EYVNNPCIALAAYAASCHKFNICMEWRSSDFCPFVCPG-NLRYQACLPACTAPSCPNQEFEFVPEQCTGLSEGCVCPEGTLLHRPYSALCIPPSKCAC 2633          

HSP 5 Score: 67.3958 bits (163), Expect = 2.253e-10
Identity = 58/245 (23.67%), Postives = 106/245 (43.27%), Query Frame = 2
Query: 3326 DVDTHFILFTMEGIQVKWDKAMSLEIMIPEKYQNKV--CGLCGNFDLRIDNDMRARSGEI---EKDIVNFADSWKVHSSCPVPQKPPFMCSKRPDREPWAKAKCE----ILKSDSFKKCHDVVNVEHYYKRCVADACECDRGDDCVCFCTAVEQYVARCNEYEIGLKWRTNENCPHTCTGKRVWKNCGNIC-PDSCIDIGKNVTDN--TGCKKVCIEGCFCPDG--LHWQNNE-CVERKACECVD 4015
            D    +++ +  G++++W     + ++  + Y N++   GLCG+ D    ND+   +G +   ++D   F DSW++      P    ++ + R        + C     +L +++F  CH  V    + +  V D    +        C A+  Y A C+++ I ++WR+++ CP  C G   ++ C   C   SC +          TG      EGC CP+G  LH   +  C+    C C D
Sbjct: 2407 DTGNMYLIRSPAGLKIQWFHTTGMMVIEMDSYNNRLPTMGLCGSCDGNPLNDLTLSNGTVVPEQEDPAVFIDSWQI------PNTTSYVSNSRRREVNCTTSDCSQCFNMLNNNTFTLCHAYVPPGVFCEMWVRDVEYVNNP------CIALAAYAASCHKFNICMEWRSSDFCPFVCPGNLRYQACLPACTAPSCPNQEFEFVPEQCTGLS----EGCVCPEGTLLHRPYSALCIPPSKCACTD 2635          
BLAST of von Willebrand factor vs. Ensembl Xenopus
Match: ndufs8 (NADH:ubiquinone oxidoreductase core subunit S8 [Source:Xenbase;Acc:XB-GENE-945877])

HSP 1 Score: 566.614 bits (1459), Expect = 1.328e-166
Identity = 385/1262 (30.51%), Postives = 595/1262 (47.15%), Query Frame = 2
Query:  440 YSTYYECSVIYGHHIKTFDGNVFSYPLRGGYTLFMDCLGAAPLFYVYFNASYDCFDQKTQNDCSISMKITVGTQTIILFPKNEFALVKNNKTKIPFNSEGIIVSSVGSFIKIKGIDD-LEILFDRDRNIYVYAPVTAEKKICGLCGYFNGIMSDDYRDFNQVIQKNVKTFVNSWIDRDPSDLNVYREREQYP-CNALKLKNNDQYQKALTLCQDMVKNNLGRTCQSEVKIDKYLDMCQDEICECLQTQPENSTIENCYSTFCKIEEQYSYACTLKGIAVDWRSATTICKQPQCFNGQEFSECGSNCGKNCGQLGMELECESQCLPGCYCPRNRYWDGTMCVPQEKCPCVRDNGESTYQQGYRLKLNCETCICGMHGKWQCIENEECEGRCFISGDPHYITFDRRHFFFDGHCEYTAVMTTSDNVLLSNSTIAPLSITIQNTNCQDNSETGCPRTIGVIIGEDEDQVAINLLSSSEIKVNFVKISLPYQHTGNTKVLIDQVSTDILRLKSETGVEILWNGGSRIEIKLSKKYREKVTGMCGNFNGNEMDDSMTFKGVDEKDIDKFVLSWKTNPTCESDRGIVEYKGACALSRSYSDYANKVCHKLYESEEFKKCHSAANADKFFDQCTHDVCTCGMKRNGALDHCECEAFSSYARQCALENINLSWRTNELCPKKCPNENMKYNQCGSRCTSTCRLLQ--ESKCKEECIEGCFCPEGETFDEAAKECVKISDCKCEFHGRFYLPYEIRQDRCNNCTCTNGNWICTSNDCEG------------KEFCPKSMAWFDCGICQKTCTNLDLVCPKGQCQLPGCFCPENTVLHNGECIKPFECPCYMNNKMYSENDTIVRGPANCQNPCICKDGKWVCEQNKQCSGICKTWGETHYESFDGKYFEFQGSCSYVISEDFCGNKLGTFKLISENIACGXXXXXCTKSIKFIYLNRVFQFVRGSNPIVSRNTNYPPGGPTAFYWTSDVDTHFILFTMEGIQVKWDKAMSLEIMIPEKYQNKVCGLCGNFDLRIDNDMRARSGEIEKDIVNFADSWKVHSSCP--VPQKPPFMCSKRPDREPWAKAKCEILKSDSFKKCHDVVNVEHYYKRCVADACECDRGDDCVCFCTAVEQYVARCNEYEIGLKWRTNENCPHTCTGKRV--------WK--NCGNICPDSCIDIGKNVTDNTGCKKVCIEGC--FCPDG--LHWQNNECVERKACECVDPITNLKYNT---GDKVI------RECEECNCYEGAFRC 4102
            +S    CS+   +HI+TFDG  + +     Y L  DC   +      F+   D  + K +     S+ + +G    I    +  A        +P+ S GI + S   + K+   +    +  D   N+ V  P     K CGLCG +N    DD+     ++ +N   F NSW           R R  YP  N   + +    +  +  CQ +  ++    C   V  D Y+ +C+D++CEC +         NC    C+   +Y+  C   G+        TICK P C  G E++EC S C K C  L +   C+ QC+ GC CP  +  DG  C+P  +C C+       Y  G  ++ +C +C C  +G W+C  NE+C G CF++G  H+ +FD +HF F G C+Y         +L +++  +  S+TI+   C D+ +  C R+  + +  D   + I L     + ++   I LP    G  ++    +S   +RL  +  +++ W+G  ++ IKLS  Y   ++G+CGN+NGN+ DD +T  G+ E  ++ F  SWK N  C     + +    C L+   + ++ +VC  L +S  F+ CH+  N   +   C +DVC+C    NG    C C A S+YA  C+ + I + WRT E CP +C +E   Y QCGS C  TCR L   +  C+E C+EGC+CP G   +E   ECV  SDC C + G  + P ++  +  + C C NG   C+++D               K  CP          C KTC N +L C    C + GC CP+  V H  +C+ P  CPC+   K Y+   ++     +C N C+C++ KW C +N  C   C   G +HY +FDG  ++F G C YV+++D+CG   GTF+++  N  CG S   CTK I  ++ N   +       I       P    T+F        +FIL     + V WDK M + + + E Y++KVCGLCGNFD   +ND+ + + +IE D VNF +SWKV+  C       P  +C     ++  A+  C IL  D F +C  VVN E Y++ C  D C C+   DC CFC ++  Y   C +  I + WR++  CP +C  K          W+  +C   CP +C        +   C   C+EGC  +CP G  L   +  C+E K C    P+  ++ +T   G K+I      + C+ C+C     +C
Sbjct:   24 WSVLARCSLFGENHIQTFDGTFYDFYGDCSYMLAGDCNKHS------FSLLADYRNGKKK-----SVSLYLGEYFDIHLFLDGTATQGEKHISMPYASNGIFLESEAGYYKLSSQEHGFMVKIDASGNVQVVLPSKHFNKTCGLCGNYNQFAEDDFMMQEGILTENSYDFANSWALHG----GARRCRRTYPPSNTCNISSETAEKDFMQRCQMLKTSSAFMQCHHLVDPDPYIAICEDDMCECAEEL-------NCP---CQTFLEYARTCAQHGVITSNWPTHTICK-PLCPFGMEYNECVSPCVKTCQSLNINEVCQEQCIDGCSCPDGKVLDGDRCIPVFECSCIHSGKR--YPPGSAIRRDCNSCTC-QNGAWEC-SNEDCPGECFVTGQSHFKSFDNKHFTFSGICQY---------LLATDAMDSTFSVTIETVQCADDIDAVCTRSASLRL-LDMHNITIKLKHGGGVSLDGQDILLPLVQ-GFLRIQTTVLSA--VRLTYKEDLQVDWDGHGKLLIKLSPIYSGLISGLCGNYNGNQGDDFLTPSGLIETSVEDFGNSWKLNGDCTD--LMKQDTDPCNLNPKRARFSEEVCFALMDSA-FQSCHNEVNPAPYLKNCRYDVCSCS---NGK--ECLCSALSTYAAACSRKGILIDWRTPEFCPIQC-SEGKIYQQCGSPCNQTCRSLSHPDVDCREFCMEGCYCPPGLYTNEDG-ECVPKSDCSCYYDGELFQPDDVFSNHYSMCYCENGLMHCSTSDVPSVKRSLDCRPPLNKIICPADNPKATGIECAKTCQNYELECVSHGC-ISGCTCPDGMVRHKSKCMFPQRCPCFHAGKEYAPGSSV---EIDC-NTCVCENRKWKCTENI-CDATCSAIGVSHYLTFDGFRYKFPGDCQYVLAQDYCGGVTGTFRILVGNEGCGFSGEKCTKRITILFRNGEIELTNEQIHI-----KKPLSDETSFDVLKS-GNYFILLLGNQMSVTWDKGMRVYVTLKETYRDKVCGLCGNFDGIENNDLISSNNQIEMDPVNFGNSWKVNPLCADFGAVSPLSLCKDNLMKQMAAENACNILMGDLFAECAKVVNPEPYWEICTYDTCTCESAGDCACFCDSLAAYAHVCAQRGINVHWRSSHLCPQSCEEKNQRDLDYVCEWRYNSCTTACPVTC-----QHPEPVNCPLKCVEGCQAYCPPGKILDEVSESCIEPKDC----PVCTIEGHTVPHGRKIILNHDDPQRCQLCHCEGKNLQC 1211          

HSP 2 Score: 199.134 bits (505), Expect = 2.987e-50
Identity = 148/490 (30.20%), Postives = 222/490 (45.31%), Query Frame = 2
Query: 1340 GSNCGKNCGQLGMELECESQ-CLPGCYCPRNRYWDGTMCVPQEKCPCVRDNGESTYQQGYRLKLNCETCICGMHGKWQCIENEECEGRCFISGDPHYITFDRRHFFFDGHCEYTAVMTTSDNVLLSNSTIAPLSITIQNTNCQDNSETGCPRTIGVIIGEDEDQVAINLLSSSEIKVNFVKISLPYQHTGNTKVLIDQVSTDILR------LKSETGVEILWNGGSRIEIKLSKKYREKVTGMCGNFNGNEMDDSMTFKGVDEKDIDKFVLSWKTNPTCESDRGIVEYKGACALSRSYSDYANKVCHKLYESEEFKKCHSAANADKFFDQCTHDVCTCGMKRNGALDHCECEAFSSYARQCALENINLSWRTNELCPKKCPNENMK---------YNQCGSRCTSTCRLLQESKCKEECIEGC--FCPEGETFDEAAKECVKISDCK-CEF------HGRFYLPYEIRQDRCNNCTCTNGNWICTSNDCE 2734
            G  C K C     ELEC S  C+ GC CP       + C+  ++CPC     E  Y  G  ++++C TC+C  + KW+C EN  C+  C   G  HY+TFD   + F G C+Y         V           I + N  C  + E  C + I ++    E +     L++ +I +               K L D+ S D+L+      L     + + W+ G R+ + L + YR+KV G+CGNF+G E +D ++     E D   F  SWK NP C +D G V     C  +      A   C+ L   + F +C    N + +++ CT+D CTC    + A   C C++ ++YA  CA   IN+ WR++ LCP+ C  +N +         YN C + C  TC+  +   C  +C+EGC  +CP G+  DE ++ C++  DC  C        HGR  +       RC  C C   N  C  N CE
Sbjct:  765 GIECAKTCQNY--ELECVSHGCISGCTCPDGMVRHKSKCMFPQRCPCFHAGKE--YAPGSSVEIDCNTCVCE-NRKWKCTENI-CDATCSAIGVSHYLTFDGFRYKFPGDCQYVLAQDYCGGV------TGTFRILVGNEGCGFSGEK-CTKRITILFRNGEIE-----LTNEQIHIK--------------KPLSDETSFDVLKSGNYFILLLGNQMSVTWDKGMRVYVTLKETYRDKVCGLCGNFDGIENNDLISSNNQIEMDPVNFGNSWKVNPLC-ADFGAVSPLSLCKDNLMKQMAAENACNILM-GDLFAECAKVVNPEPYWEICTYDTCTCESAGDCA---CFCDSLAAYAHVCAQRGINVHWRSSHLCPQSCEEKNQRDLDYVCEWRYNSCTTACPVTCQHPEPVNCPLKCVEGCQAYCPPGKILDEVSESCIEPKDCPVCTIEGHTVPHGRKIILNHDDPQRCQLCHCEGKNLQC--NACE 1215          

HSP 3 Score: 141.354 bits (355), Expect = 1.164e-32
Identity = 97/365 (26.58%), Postives = 174/365 (47.67%), Query Frame = 2
Query: 3038 CKTWGETHYESFDGKYFEFQGSCSYVISEDFCGNKLGTFKLISENIACGXXXXXCTKSIKFIYLNRVFQ---FVRGSNPIVSRNTNYPPGGPTAFYWTSDVDTHFILFTMEGIQVKWDKAMSLEIMIPEKYQNKVCGLCGNFDLRIDNDMRARSGEIEKDIVNFADSWKVHSS---CPVPQKPPFMCSKRPD-REPWAKAKCEILK-SDSFKKCHDVVNVEHYYKRCVADACECDRGDDCVCFCTAVEQYVARCNEYE-IGLKWRTNENCPHTCTGKRVWKNCGNICPDSCIDIGKNVTDNTGCKKVCIEGCFCPDGLHWQNNECVERKACECVDPITNLKYNTGDKVIRECEECNCYEGAFRCT 4105
            C  +GE H ++FDG +++F G CSY+++ D C     +F L+++         +  K    +YL   F    F+ G+     ++ + P       +  S+   + +     G  VK D + ++++++P K+ NK CGLCGN++   ++D   + G + ++  +FA+SW +H     C     P   C+   +  E     +C++LK S +F +CH +V+ + Y   C  D CEC   ++  C C    +Y   C ++  I   W T+  C   C     +  C + C  +C    +++  N  C++ CI+GC CPDG     + C+    C C+   +  +Y  G  + R+C  C C  GA+ C+
Sbjct:   30 CSLFGENHIQTFDGTFYDFYGDCSYMLAGD-CNKH--SFSLLAD-------YRNGKKKSVSLYLGEYFDIHLFLDGTATQGEKHISMPYAS-NGIFLESEAGYYKLSSQEHGFMVKIDASGNVQVVLPSKHFNKTCGLCGNYNQFAEDDFMMQEGILTENSYDFANSWALHGGARRCRRTYPPSNTCNISSETAEKDFMQRCQMLKTSSAFMQCHHLVDPDPYIAICEDDMCEC--AEELNCPCQTFLEYARTCAQHGVITSNWPTHTICKPLCPFGMEYNECVSPCVKTC----QSLNINEVCQEQCIDGCSCPDGKVLDGDRCIPVFECSCIH--SGKRYPPGSAIRRDCNSCTCQNGAWECS 375          

HSP 4 Score: 100.138 bits (248), Expect = 3.458e-20
Identity = 111/432 (25.69%), Postives = 172/432 (39.81%), Query Frame = 2
Query: 3026 CSGICKTWGETHYESFDGKYFEFQGSCSYVISEDFCGNKLGTFKLISENIACGXX-XXXCTKSIKFIYLNRVFQFVRGSNPIVSRNTNYPPGGPTA---FYWTSDVD-THFILFTMEGIQVKWDKAMSLEIMI--PEKYQNKVCGLCGNFDLRIDNDMRARSGEIEKDIVNFADSWKVHSSCPVPQKPPFMCSKRPDR---EPWAKAKCEILKSDSFKKCHDVVNVEHYYKRCVADACECDRGDDCVCFCTAVEQYVARCNEYEIGLKWRTNENCPHTCTGKRVWKNCGNICPDSCIDIGKNVTDNTGCKKVCIEGCFCPDGLHWQNNECVERKAC-ECVDPITNLKYNTGDKVIR-------ECEECNCYEG------AFRCTKLFSKECLHTSRPEISTKPPHCVNEYEFLCPNNFCARRCNGIIECRDG 4249
            C  +C      H  +FDG  F+  G+CSYV+  D    ++   K+I  N  C ++   +C KS++  +    +  +  SN  VS N +  P  P A   F  T   +  H +     G    +  A +  ++   P  +  +  GLCG  D    ND     G +  D   F   W V  S          C  +PD+   +P + ++C+I+ S +F+ CH +   + Y+  C   +C    G D    C  +  YV  C    + + WRT + CP  C    V+ +C   C   C   GK + + T C     EGCFCP+G    N +CV  K C +C D     +Y    +++         C  C C E       A  C  +    C     P +      C  +YE +C    C    N +  C +G
Sbjct: 1951 CPCMCMGSSTRHIVTFDGLDFKLMGACSYVLFHD----EVHDVKVILHNAECNTTNHQTCMKSVEVKH--NKYSILLSSNMQVSVNGDIVPL-PYANDNFEVTLYGEIVHEVKIPQLGFVFTFTPANNEFVLQLNPAAFSLRTSGLCGICDQNTVNDFTLSDGSVTTDSSKFIKEWTVVDSLG------RTCETKPDKACTQPIS-SECKIMLSKTFEACHTIFPPKPYFTVCEEASC---HGQD---ICEVIAAYVHVCRINGVCINWRTPDFCPMECPRLMVYHHCHMGCNKEC---GKTL-NGTLCSDSSTEGCFCPEGDVIVNGKCVNEKVCSQCTD-----RYGEEHQLLETWIPTNAPCSICMCLENRMINCTAMPCPTVKPLTCGPCEIPRLKKTSEQCCPDYECVCDLTTC--DVNPVPHCENG 2351          

HSP 5 Score: 92.8189 bits (229), Expect = 5.565e-18
Identity = 115/504 (22.82%), Postives = 194/504 (38.49%), Query Frame = 2
Query: 1523 KLNCETCICGM-HGKWQCIENEE-------CEGRCFISGDPHYITFDRRHFFFDGHCEYTAVMTTSDNVLLSNSTIAPLSITIQNTNCQDNSETGCPRTIGVIIGEDEDQVAINLLSSSEIKVNFVKISLPYQHTGNTKVLIDQVSTDILRLKSETGVEILWNGGSRIEIKLS-KKYREKVTGMCGNFNGNEMDDSMTFKGVDEKDIDKFVLSWKTNPTCESDRGIVEYKGACALSRSYSDYANKVCH-------KLYESEEFKKCHSAANADKFFDQCTHDVCTCGMKRNGALDHCE--CEAFSSYARQCALENINLSWRTNELCPKKCPNENMKYNQCGSRCTSTC-RLLQESKCKEECIEGCFCPEGETFDEAA----KECVKISDCKCEFHGRF--YLPYEIRQDRCNNCTCTNGNWI-CTSNDCEGKEFCPKSMAWFDCGIC---------QKTCTNLDLVCPKGQCQ---LPGCFCPENTVLHN-GECIKPFECPCYM 2917
            K+NCE     M H     ++ EE       C   C  S   H +TFD   F   G C Y          +L +  +  + + + N  C   +   C +++ V      ++ +I L S+ ++ VN   + LPY +      L  ++  ++ ++     V       +   ++L+   +  + +G+CG  + N ++D     G    D  KF+  W           +V+     +L R+     +K C        K+  S+ F+ CH+      +F  C    C           H +  CE  ++Y   C +  + ++WRT + CP +CP   M Y+ C   C   C + L  + C +   EGCFCPEG+          K C + +D   E H     ++P       C+ C C     I CT+  C        ++    CG C         ++ C + + VC    C    +P C      VL N G C   +EC C +
Sbjct: 1921 KVNCEKIPKPMCHNNLPAMKIEETCGCRWTCPCMCMGSSTRHIVTFDGLDFKLMGACSY----------VLFHDEVHDVKVILHNAECNTTNHQTCMKSVEV----KHNKYSILLSSNMQVSVNGDIVPLPYANDNFEVTLYGEIVHEV-KIPQLGFVFTFTPANNEFVLQLNPAAFSLRTSGLCGICDQNTVNDFTLSDGSVTTDSSKFIKEWT----------VVD-----SLGRTCETKPDKACTQPISSECKIMLSKTFEACHTIFPPKPYFTVCEEASC-----------HGQDICEVIAAYVHVCRINGVCINWRTPDFCPMECPRL-MVYHHCHMGCNKECGKTLNGTLCSDSSTEGCFCPEGDVIVNGKCVNEKVCSQCTDRYGEEHQLLETWIP---TNAPCSICMCLENRMINCTAMPC-------PTVKPLTCGPCEIPRLKKTSEQCCPDYECVCDLTTCDVNPVPHCENGLVPVLTNPGHCKPNYECACRI 2372          

HSP 6 Score: 56.225 bits (134), Expect = 8.026e-7
Identity = 67/335 (20.00%), Postives = 119/335 (35.52%), Query Frame = 2
Query:  479 HIKTFDGNVFSYPLRGGYTLFMDCLGAAPLFYVYFNASYDCFDQKTQNDCSISMKITVGTQTIILFPKNEFALVKNNKTKIPFNSEGIIVSSVGSFIKIKGIDDLEILFD----RDRNIYVYAPVTAEKKICGLCGYFNGIMSDDYRDFNQVIQKNVKTFVNSWIDRDPSDLNVYREREQYPCNALKLKNNDQYQKALTLCQDMVKNNLGRTCQSEVKIDKYLDMCQDEICECLQTQPENSTIENCYSTFCKIEEQYSYACTLKGIAVDWRSATTICKQPQCFNGQEFSECGSNCGKNCGQLGMELECESQCLPGCYCPRNRYWDGTMCVPQEKC 1471
            HI TFDG  F       Y LF D +    +  +  NA  +  + +T   C  S+++     +I+L   N    V  +   +P+ ++   V+  G  +    I  L  +F      +  +    P     +  GLCG  +    +D+   +  +  +   F+  W   D    ++ R  E  P  A         Q   + C+ M+       C +      Y  +C++  C                   C++   Y + C + G+ ++WR+    C   +C     +  C   C K CG+      C      GC+CP         CV ++ C
Sbjct: 1962 HIVTFDGLDFKLMGACSYVLFHDEVHDVKV--ILHNAECNTTNHQT---CMKSVEVKHNKYSILL-SSNMQVSVNGDIVPLPYANDNFEVTLYGEIVHEVKIPQLGFVFTFTPANNEFVLQLNPAAFSLRTSGLCGICDQNTVNDFTLSDGSVTTDSSKFIKEWTVVD----SLGRTCETKPDKACT-------QPISSECKIMLSKTF-EACHTIFPPKPYFTVCEEASCH--------------GQDICEVIAAYVHVCRINGVCINWRTP-DFCPM-ECPRLMVYHHCHMGCNKECGKTLNGTLCSDSSTEGCFCPEGDVIVNGKCVNEKVC 2262          
BLAST of von Willebrand factor vs. Ensembl Xenopus
Match: ndufs8 (NADH:ubiquinone oxidoreductase core subunit S8 [Source:Xenbase;Acc:XB-GENE-945877])

HSP 1 Score: 564.303 bits (1453), Expect = 7.695e-166
Identity = 388/1277 (30.38%), Postives = 599/1277 (46.91%), Query Frame = 2
Query:  440 YSTYYECSVIYGHHIKTFDGNVFSYPLRGGYTLFMDCLGAAPLFYVYFNASYDCFDQKTQNDCSISMKITVGTQTIILFPKNEFALVKNNKTKIPFNSEGIIVSSVGSFIKIKGIDD-LEILFDRDRNIYVYAPVTAEKKICGLCGYFNGIMSDDYRDFNQVIQKNVKTFVNSWIDRDPSDLNVYREREQYP-CNALKLKNNDQYQKALTLCQDMVKNNLGRTCQSEVKIDKYLDMCQDEICECLQTQPENSTIENCYSTFCKIEEQYSYACTLKGIAVDWRSATTICKQPQCFNGQEFSECGSNCGKNCGQLGMELECESQCLPGCYCPRNRYWDGTMCVPQEKCPCVRDNGESTYQQGYRLKLNCETCICGMHGKWQCIENEECEGRCFISGDPHYITFDRRHFFFDGHCEYTAVMTTSDNVLLSNSTIAPLSITIQNTNCQDNSETGCPRTIGVIIGEDEDQVAINLLSSSEIKVNFVKISLPYQHTGNTKVLIDQVSTDILRLKSETGVEILWNGGSRIEIKLSKKYREKVTGMCGNFNGNEMDDSMTFKGVDEKDIDKFVLSWKTNPTCESDRGIVEYKGACALSRSYSDYANKVCHKLYESEEFKKCHSAANADKFFDQCTHDVCTCGMKRNGALDHCECEAFSSYARQCALENINLSWRTNELCPKKCPNENMKYNQCGSRCTSTCRLLQ--ESKCKEECIEGCFCPEGETFDEAAKECVKISDCKCEFHGRFYLPYEIRQDRCNNCTCTNGNWICTSNDCEGKEFCPKSM---------AWFDC-----------------GI-CQKTCTNLDLVCPKGQCQLPGCFCPENTVLHNGECIKPFECPCYMNNKMYSENDTIVRGPANCQNPCICKDGKWVCEQNKQCSGICKTWGETHYESFDGKYFEFQGSCSYVISEDFCGNKLGTFKLISENIACGXXXXXCTKSIKFIYLNRVFQFVRGSNPIVSRNTNYPPGGPTAFYWTSDVDTHFILFTMEGIQVKWDKAMSLEIMIPEKYQNKVCGLCGNFDLRIDNDMRARSGEIEKDIVNFADSWKVHSSCP--VPQKPPFMCSKRPDREPWAKAKCEILKSDSFKKCHDVVNVEHYYKRCVADACECDRGDDCVCFCTAVEQYVARCNEYEIGLKWRTNENCPHTCTGKRV--------WK--NCGNICPDSCIDIGKNVTDNTGCKKVCIEGC--FCPDG--LHWQNNECVERKACECVDPITNLKYNT---GDKVI------RECEECNCYEGAFRC 4102
            +S    CS+   +HI+TFDG  + +     Y L  DC   +      F+   D  + K +     S+ + +G    I    +  A        +P+ S GI + S   + K+   +    +  D   N+ V  P     K CGLCG +N    DD+     ++ +N   F NSW           R R  YP  N   + +    +  +  CQ +  ++    C   V  D Y+ +C+D++CEC +         NC    C+   +Y+  C   G+        TICK P C  G E++EC S C K C  L +   C+ QC+ GC CP  +  DG  C+P  +C C+       Y  G  ++ +C +C C  +G W+C  NE+C G CF++G  H+ +FD +HF F G C+Y         +L +++  +  S+TI+   C D+ +  C R+  + +  D   + I L     + ++   I LP    G  ++    +S   +RL  +  +++ W+G  ++ IKLS  Y   ++G+CGN+NGN+ DD +T  G+ E  ++ F  SWK N  C     + +    C L+   + ++ +VC  L +S  F+ CH+  N   +   C +DVC+C    NG    C C A S+YA  C+ + I + WRT E CP +C +E   Y QCGS C  TCR L   +  C+E C+EGC+CP G   +E   ECV  SDC C + G  + P ++  +  + C C NG   C+++D     F P+S             DC                 GI C KTC N +L C    C + GC CP+  V H  +C+ P  CPC+   K Y+   ++     +C N C+C++ KW C +N  C   C   G +HY +FDG  ++F G C YV+++D+CG   GTF+++  N  CG S   CTK I  ++ N   +            TN  P      +       +FIL     + V WDK M + + + E Y++KVCGLCGNFD   +ND+ + + +IE D VNF +SWKV+  C       P  +C     ++  A+  C IL  D F +C  VVN E Y++ C  D C C+   DC CFC ++  Y   C +  I + WR++  CP +C  K          W+  +C   CP +C        +   C   C+EGC  +CP G  L   +  C+E K C    P+  ++ +T   G K+I      + C+ C+C     +C
Sbjct:   24 WSVLARCSLFGENHIQTFDGTFYDFYGDCSYMLAGDCNKHS------FSLLADYRNGKKK-----SVSLYLGEYFDIHLFLDGTATQGEKHISMPYASNGIFLESEAGYYKLSSQEHGFMVKIDASGNVQVVLPSKHFNKTCGLCGNYNQFAEDDFMMQEGILTENSYDFANSWALHG----GARRCRRTYPPSNTCNISSETAEKDFMQRCQMLKTSSAFMQCHHLVDPDPYIAICEDDMCECAEEL-------NCP---CQTFLEYARTCAQHGVITSNWPTHTICK-PLCPFGMEYNECVSPCVKTCQSLNINEVCQEQCIDGCSCPDGKVLDGDRCIPVFECSCIHSGKR--YPPGSAIRRDCNSCTC-QNGAWEC-SNEDCPGECFVTGQSHFKSFDNKHFTFSGICQY---------LLATDAMDSTFSVTIETVQCADDIDAVCTRSASLRL-LDMHNITIKLKHGGGVSLDGQDILLPLVQ-GFLRIQTTVLSA--VRLTYKEDLQVDWDGHGKLLIKLSPIYSGLISGLCGNYNGNQGDDFLTPSGLIETSVEDFGNSWKLNGDCTD--LMKQDTDPCNLNPKRARFSEEVCFALMDSA-FQSCHNEVNPAPYLKNCRYDVCSCS---NGK--ECLCSALSTYAAACSRKGILIDWRTPEFCPIQC-SEGKIYQQCGSPCNQTCRSLSHPDVDCREFCMEGCYCPPGLYTNEDG-ECVPKSDCSCYYDGELFQPDDVFSNHYSMCYCENGLMHCSTSDVPSGYF-PESFFNQPPARVKRSLDCRPPLNKIICPADNPKATGIECAKTCQNYELECVSHGC-ISGCTCPDGMVRHKSKCMFPQRCPCFHAGKEYAPGSSV---EIDC-NTCVCENRKWKCTENI-CDATCSAIGVSHYLTFDGFRYKFPGDCQYVLAQDYCGGVTGTFRILVGNEGCGFSGEKCTKRITILFRNGEIEL-----------TNEQPLSDETSFDVLKSGNYFILLLGNQMSVTWDKGMRVYVTLKETYRDKVCGLCGNFDGIENNDLISSNNQIEMDPVNFGNSWKVNPLCADFGAVSPLSLCKDNLMKQMAAENACNILMGDLFAECAKVVNPEPYWEICTYDTCTCESAGDCACFCDSLAAYAHVCAQRGINVHWRSSHLCPQSCEEKNQRDLDYVCEWRYNSCTTACPVTC-----QHPEPVNCPLKCVEGCQAYCPPGKILDEVSESCIEPKDC----PVCTIEGHTVPHGRKIILNHDDPQRCQLCHCEGKNLQC 1220          

HSP 2 Score: 197.208 bits (500), Expect = 1.105e-49
Identity = 148/490 (30.20%), Postives = 220/490 (44.90%), Query Frame = 2
Query: 1340 GSNCGKNCGQLGMELECESQ-CLPGCYCPRNRYWDGTMCVPQEKCPCVRDNGESTYQQGYRLKLNCETCICGMHGKWQCIENEECEGRCFISGDPHYITFDRRHFFFDGHCEYTAVMTTSDNVLLSNSTIAPLSITIQNTNCQDNSETGCPRTIGVIIGEDEDQVAINLLSSSEIKVNFVKISLPYQHTGNTKVLIDQVSTDILR------LKSETGVEILWNGGSRIEIKLSKKYREKVTGMCGNFNGNEMDDSMTFKGVDEKDIDKFVLSWKTNPTCESDRGIVEYKGACALSRSYSDYANKVCHKLYESEEFKKCHSAANADKFFDQCTHDVCTCGMKRNGALDHCECEAFSSYARQCALENINLSWRTNELCPKKCPNENMK---------YNQCGSRCTSTCRLLQESKCKEECIEGC--FCPEGETFDEAAKECVKISDCK-CEF------HGRFYLPYEIRQDRCNNCTCTNGNWICTSNDCE 2734
            G  C K C     ELEC S  C+ GC CP       + C+  ++CPC     E  Y  G  ++++C TC+C  + KW+C EN  C+  C   G  HY+TFD   + F G C+Y         V           I + N  C  + E  C + I +            L  + EI++             N + L D+ S D+L+      L     + + W+ G R+ + L + YR+KV G+CGNF+G E +D ++     E D   F  SWK NP C +D G V     C  +      A   C+ L   + F +C    N + +++ CT+D CTC    + A   C C++ ++YA  CA   IN+ WR++ LCP+ C  +N +         YN C + C  TC+  +   C  +C+EGC  +CP G+  DE ++ C++  DC  C        HGR  +       RC  C C   N  C  N CE
Sbjct:  779 GIECAKTCQNY--ELECVSHGCISGCTCPDGMVRHKSKCMFPQRCPCFHAGKE--YAPGSSVEIDCNTCVCE-NRKWKCTENI-CDATCSAIGVSHYLTFDGFRYKFPGDCQYVLAQDYCGGV------TGTFRILVGNEGCGFSGEK-CTKRITI------------LFRNGEIELT------------NEQPLSDETSFDVLKSGNYFILLLGNQMSVTWDKGMRVYVTLKETYRDKVCGLCGNFDGIENNDLISSNNQIEMDPVNFGNSWKVNPLC-ADFGAVSPLSLCKDNLMKQMAAENACNILM-GDLFAECAKVVNPEPYWEICTYDTCTCESAGDCA---CFCDSLAAYAHVCAQRGINVHWRSSHLCPQSCEEKNQRDLDYVCEWRYNSCTTACPVTCQHPEPVNCPLKCVEGCQAYCPPGKILDEVSESCIEPKDCPVCTIEGHTVPHGRKIILNHDDPQRCQLCHCEGKNLQC--NACE 1224          

HSP 3 Score: 141.354 bits (355), Expect = 1.168e-32
Identity = 97/365 (26.58%), Postives = 174/365 (47.67%), Query Frame = 2
Query: 3038 CKTWGETHYESFDGKYFEFQGSCSYVISEDFCGNKLGTFKLISENIACGXXXXXCTKSIKFIYLNRVFQ---FVRGSNPIVSRNTNYPPGGPTAFYWTSDVDTHFILFTMEGIQVKWDKAMSLEIMIPEKYQNKVCGLCGNFDLRIDNDMRARSGEIEKDIVNFADSWKVHSS---CPVPQKPPFMCSKRPD-REPWAKAKCEILK-SDSFKKCHDVVNVEHYYKRCVADACECDRGDDCVCFCTAVEQYVARCNEYE-IGLKWRTNENCPHTCTGKRVWKNCGNICPDSCIDIGKNVTDNTGCKKVCIEGCFCPDGLHWQNNECVERKACECVDPITNLKYNTGDKVIRECEECNCYEGAFRCT 4105
            C  +GE H ++FDG +++F G CSY+++ D C     +F L+++         +  K    +YL   F    F+ G+     ++ + P       +  S+   + +     G  VK D + ++++++P K+ NK CGLCGN++   ++D   + G + ++  +FA+SW +H     C     P   C+   +  E     +C++LK S +F +CH +V+ + Y   C  D CEC   ++  C C    +Y   C ++  I   W T+  C   C     +  C + C  +C    +++  N  C++ CI+GC CPDG     + C+    C C+   +  +Y  G  + R+C  C C  GA+ C+
Sbjct:   30 CSLFGENHIQTFDGTFYDFYGDCSYMLAGD-CNKH--SFSLLAD-------YRNGKKKSVSLYLGEYFDIHLFLDGTATQGEKHISMPYAS-NGIFLESEAGYYKLSSQEHGFMVKIDASGNVQVVLPSKHFNKTCGLCGNYNQFAEDDFMMQEGILTENSYDFANSWALHGGARRCRRTYPPSNTCNISSETAEKDFMQRCQMLKTSSAFMQCHHLVDPDPYIAICEDDMCEC--AEELNCPCQTFLEYARTCAQHGVITSNWPTHTICKPLCPFGMEYNECVSPCVKTC----QSLNINEVCQEQCIDGCSCPDGKVLDGDRCIPVFECSCIH--SGKRYPPGSAIRRDCNSCTCQNGAWECS 375          

HSP 4 Score: 100.138 bits (248), Expect = 3.977e-20
Identity = 111/432 (25.69%), Postives = 172/432 (39.81%), Query Frame = 2
Query: 3026 CSGICKTWGETHYESFDGKYFEFQGSCSYVISEDFCGNKLGTFKLISENIACGXX-XXXCTKSIKFIYLNRVFQFVRGSNPIVSRNTNYPPGGPTA---FYWTSDVD-THFILFTMEGIQVKWDKAMSLEIMI--PEKYQNKVCGLCGNFDLRIDNDMRARSGEIEKDIVNFADSWKVHSSCPVPQKPPFMCSKRPDR---EPWAKAKCEILKSDSFKKCHDVVNVEHYYKRCVADACECDRGDDCVCFCTAVEQYVARCNEYEIGLKWRTNENCPHTCTGKRVWKNCGNICPDSCIDIGKNVTDNTGCKKVCIEGCFCPDGLHWQNNECVERKAC-ECVDPITNLKYNTGDKVIR-------ECEECNCYEG------AFRCTKLFSKECLHTSRPEISTKPPHCVNEYEFLCPNNFCARRCNGIIECRDG 4249
            C  +C      H  +FDG  F+  G+CSYV+  D    ++   K+I  N  C ++   +C KS++  +    +  +  SN  VS N +  P  P A   F  T   +  H +     G    +  A +  ++   P  +  +  GLCG  D    ND     G +  D   F   W V  S          C  +PD+   +P + ++C+I+ S +F+ CH +   + Y+  C   +C    G D    C  +  YV  C    + + WRT + CP  C    V+ +C   C   C   GK + + T C     EGCFCP+G    N +CV  K C +C D     +Y    +++         C  C C E       A  C  +    C     P +      C  +YE +C    C    N +  C +G
Sbjct: 1921 CPCMCMGSSTRHIVTFDGLDFKLMGACSYVLFHD----EVHDVKVILHNAECNTTNHQTCMKSVEVKH--NKYSILLSSNMQVSVNGDIVPL-PYANDNFEVTLYGEIVHEVKIPQLGFVFTFTPANNEFVLQLNPAAFSLRTSGLCGICDQNTVNDFTLSDGSVTTDSSKFIKEWTVVDSLG------RTCETKPDKACTQPIS-SECKIMLSKTFEACHTIFPPKPYFTVCEEASC---HGQD---ICEVIAAYVHVCRINGVCINWRTPDFCPMECPRLMVYHHCHMGCNKEC---GKTL-NGTLCSDSSTEGCFCPEGDVIVNGKCVNEKVCSQCTD-----RYGEEHQLLETWIPTNAPCSICMCLENRMINCTAMPCPTVKPLTCGPCEIPRLKKTSEQCCPDYECVCDLTTC--DVNPVPHCENG 2321          

HSP 5 Score: 92.8189 bits (229), Expect = 5.320e-18
Identity = 115/504 (22.82%), Postives = 194/504 (38.49%), Query Frame = 2
Query: 1523 KLNCETCICGM-HGKWQCIENEE-------CEGRCFISGDPHYITFDRRHFFFDGHCEYTAVMTTSDNVLLSNSTIAPLSITIQNTNCQDNSETGCPRTIGVIIGEDEDQVAINLLSSSEIKVNFVKISLPYQHTGNTKVLIDQVSTDILRLKSETGVEILWNGGSRIEIKLS-KKYREKVTGMCGNFNGNEMDDSMTFKGVDEKDIDKFVLSWKTNPTCESDRGIVEYKGACALSRSYSDYANKVCH-------KLYESEEFKKCHSAANADKFFDQCTHDVCTCGMKRNGALDHCE--CEAFSSYARQCALENINLSWRTNELCPKKCPNENMKYNQCGSRCTSTC-RLLQESKCKEECIEGCFCPEGETFDEAA----KECVKISDCKCEFHGRF--YLPYEIRQDRCNNCTCTNGNWI-CTSNDCEGKEFCPKSMAWFDCGIC---------QKTCTNLDLVCPKGQCQ---LPGCFCPENTVLHN-GECIKPFECPCYM 2917
            K+NCE     M H     ++ EE       C   C  S   H +TFD   F   G C Y          +L +  +  + + + N  C   +   C +++ V      ++ +I L S+ ++ VN   + LPY +      L  ++  ++ ++     V       +   ++L+   +  + +G+CG  + N ++D     G    D  KF+  W           +V+     +L R+     +K C        K+  S+ F+ CH+      +F  C    C           H +  CE  ++Y   C +  + ++WRT + CP +CP   M Y+ C   C   C + L  + C +   EGCFCPEG+          K C + +D   E H     ++P       C+ C C     I CT+  C        ++    CG C         ++ C + + VC    C    +P C      VL N G C   +EC C +
Sbjct: 1891 KVNCEKIPKPMCHNNLPAMKIEETCGCRWTCPCMCMGSSTRHIVTFDGLDFKLMGACSY----------VLFHDEVHDVKVILHNAECNTTNHQTCMKSVEV----KHNKYSILLSSNMQVSVNGDIVPLPYANDNFEVTLYGEIVHEV-KIPQLGFVFTFTPANNEFVLQLNPAAFSLRTSGLCGICDQNTVNDFTLSDGSVTTDSSKFIKEWT----------VVD-----SLGRTCETKPDKACTQPISSECKIMLSKTFEACHTIFPPKPYFTVCEEASC-----------HGQDICEVIAAYVHVCRINGVCINWRTPDFCPMECPRL-MVYHHCHMGCNKECGKTLNGTLCSDSSTEGCFCPEGDVIVNGKCVNEKVCSQCTDRYGEEHQLLETWIP---TNAPCSICMCLENRMINCTAMPC-------PTVKPLTCGPCEIPRLKKTSEQCCPDYECVCDLTTCDVNPVPHCENGLVPVLTNPGHCKPNYECACRI 2342          

HSP 6 Score: 55.8398 bits (133), Expect = 8.644e-7
Identity = 67/335 (20.00%), Postives = 119/335 (35.52%), Query Frame = 2
Query:  479 HIKTFDGNVFSYPLRGGYTLFMDCLGAAPLFYVYFNASYDCFDQKTQNDCSISMKITVGTQTIILFPKNEFALVKNNKTKIPFNSEGIIVSSVGSFIKIKGIDDLEILFD----RDRNIYVYAPVTAEKKICGLCGYFNGIMSDDYRDFNQVIQKNVKTFVNSWIDRDPSDLNVYREREQYPCNALKLKNNDQYQKALTLCQDMVKNNLGRTCQSEVKIDKYLDMCQDEICECLQTQPENSTIENCYSTFCKIEEQYSYACTLKGIAVDWRSATTICKQPQCFNGQEFSECGSNCGKNCGQLGMELECESQCLPGCYCPRNRYWDGTMCVPQEKC 1471
            HI TFDG  F       Y LF D +    +  +  NA  +  + +T   C  S+++     +I+L   N    V  +   +P+ ++   V+  G  +    I  L  +F      +  +    P     +  GLCG  +    +D+   +  +  +   F+  W   D    ++ R  E  P  A         Q   + C+ M+       C +      Y  +C++  C                   C++   Y + C + G+ ++WR+    C   +C     +  C   C K CG+      C      GC+CP         CV ++ C
Sbjct: 1932 HIVTFDGLDFKLMGACSYVLFHDEVHDVKV--ILHNAECNTTNHQT---CMKSVEVKHNKYSILL-SSNMQVSVNGDIVPLPYANDNFEVTLYGEIVHEVKIPQLGFVFTFTPANNEFVLQLNPAAFSLRTSGLCGICDQNTVNDFTLSDGSVTTDSSKFIKEWTVVD----SLGRTCETKPDKACT-------QPISSECKIMLSKTF-EACHTIFPPKPYFTVCEEASCH--------------GQDICEVIAAYVHVCRINGVCINWRTP-DFCPM-ECPRLMVYHHCHMGCNKECGKTLNGTLCSDSSTEGCFCPEGDVIVNGKCVNEKVC 2232          
BLAST of von Willebrand factor vs. Ensembl Xenopus
Match: ndufs8 (NADH:ubiquinone oxidoreductase core subunit S8 [Source:Xenbase;Acc:XB-GENE-945877])

HSP 1 Score: 563.148 bits (1450), Expect = 1.830e-165
Identity = 390/1280 (30.47%), Postives = 601/1280 (46.95%), Query Frame = 2
Query:  440 YSTYYECSVIYGHHIKTFDGNVFSYPLRGGYTLFMDCLGAAPLFYVYFNASYDCFDQKTQNDCSISMKITVGTQTIILFPKNEFALVKNNKTKIPFNSEGIIVSSVGSFIKIKGIDD-LEILFDRDRNIYVYAPVTAEKKICGLCGYFNGIMSDDYRDFNQVIQKNVKTFVNSWIDRDPSDLNVYREREQYP-CNALKLKNNDQYQKALTLCQDMVKNNLGRTCQSEVKIDKYLDMCQDEICECLQTQPENSTIENCYSTFCKIEEQYSYACTLKGIAVDWRSATTICKQPQCFNGQEFSECGSNCGKNCGQLGMELECESQCLPGCYCPRNRYWDGTMCVPQEKCPCVRDNGESTYQQGYRLKLNCETCICGMHGKWQCIENEECEGRCFISGDPHYITFDRRHFFFDGHCEYTAVMTTSDNVLLSNSTIAPLSITIQNTNCQDNSETGCPRTIGVIIGEDEDQVAINLLSSSEIKVNFVKISLPYQHTGNTKVLIDQVSTDILRLKSETGVEILWNGGSRIEIKLSKKYREKVTGMCGNFNGNEMDDSMTFKGVDEKDIDKFVLSWKTNPTCESDRGIVEYKGACALSRSYSDYANKVCHKLYESEEFKKCHSAANADKFFDQCTHDVCTCGMKRNGALDHCECEAFSSYARQCALENINLSWRTNELCPKKCPNENMKYNQCGSRCTSTCRLLQ--ESKCKEECIEGCFCPEGETFDEAAKECVKISDCKCEFHGRFYLPYEIRQDRCNNCTCTNGNWICTSNDCEGKEFCPKSM---------AWFDC-----------------GI-CQKTCTNLDLVCPKGQCQLPGCFCPENTVLHNGECIKPFECPCYMNNKMYSENDTIVRGPANCQNPCICKDGKWVCEQNKQCSGICKTWGETHYESFDGKYFEFQGSCSYVISEDFCGNKLGTFKLISENIACGXXXXXCTKSIKFIYLNRVFQFVRGSNPIVSRNTNYPPGGPTAFYWTSDVDTHFILFTMEGIQVKWDKAMSLEIMIPEKYQNKVCGLCGNFDLRIDNDMRARSGEIEKDIVNFADSWKVHSSCPVPQK-----PPFMCSKRPDREPWAKAKCEILKSDSFKKCHDVVNVEHYYKRCVADACECDRGDDCVCFCTAVEQYVARCNEYEIGLKWRTNENCPHTCTGKRV--------WK--NCGNICPDSCIDIGKNVTDNTGCKKVCIEGC--FCPDG--LHWQNNECVERKACECVDPITNLKYNT---GDKVI------RECEECNCYEGAFRC 4102
            +S    CS+   +HI+TFDG  + +     Y L  DC   +      F+   D  + K +     S+ + +G    I    +  A        +P+ S GI + S   + K+   +    +  D   N+ V  P     K CGLCG +N    DD+     ++ +N   F NSW           R R  YP  N   + +    +  +  CQ +  ++    C   V  D Y+ +C+D++CEC +         NC    C+   +Y+  C   G+        TICK P C  G E++EC S C K C  L +   C+ QC+ GC CP  +  DG  C+P  +C C+       Y  G  ++ +C +C C  +G W+C  NE+C G CF++G  H+ +FD +HF F G C+Y         +L +++  +  S+TI+   C D+ +  C R+  + +  D   + I L     + ++   I LP    G  ++    +S   +RL  +  +++ W+G  ++ IKLS  Y   ++G+CGN+NGN+ DD +T  G+ E  ++ F  SWK N  C     + +    C L+   + ++ +VC  L +S  F+ CH+  N   +   C +DVC+C    NG    C C A S+YA  C+ + I + WRT E CP +C +E   Y QCGS C  TCR L   +  C+E C+EGC+CP G   +E   ECV  SDC C + G  + P ++  +  + C C NG   C+++D     F P+S             DC                 GI C KTC N +L C    C + GC CP+  V H  +C+ P  CPC+   K Y+   ++     +C N C+C++ KW C +N  C   C   G +HY +FDG  ++F G C YV+++D+CG   GTF+++  N  CG S   CTK I  ++ N   +       I       P    T+F        +FIL     + V WDK M + + + E Y++KVCGLCGNFD   +ND+ + + +IE D VNF +SWKV+  C    K     P  +C     ++  A+  C IL  D F +C  VVN E Y++ C  D C C+   DC CFC ++  Y   C +  I + WR++  CP +C  K          W+  +C   CP +C        +   C   C+EGC  +CP G  L   +  C+E K C    P+  ++ +T   G K+I      + C+ C+C     +C
Sbjct:   35 WSVLARCSLFGENHIQTFDGTFYDFYGDCSYMLAGDCNKHS------FSLLADYRNGKKK-----SVSLYLGEYFDIHLFLDGTATQGEKHISMPYASNGIFLESEAGYYKLSSQEHGFMVKIDASGNVQVVLPSKHFNKTCGLCGNYNQFAEDDFMMQEGILTENSYDFANSWALHG----GARRCRRTYPPSNTCNISSETAEKDFMQRCQMLKTSSAFMQCHHLVDPDPYIAICEDDMCECAEEL-------NCP---CQTFLEYARTCAQHGVITSNWPTHTICK-PLCPFGMEYNECVSPCVKTCQSLNINEVCQEQCIDGCSCPDGKVLDGDRCIPVFECSCIHSGKR--YPPGSAIRRDCNSCTC-QNGAWEC-SNEDCPGECFVTGQSHFKSFDNKHFTFSGICQY---------LLATDAMDSTFSVTIETVQCADDIDAVCTRSASLRL-LDMHNITIKLKHGGGVSLDGQDILLPLVQ-GFLRIQTTVLSA--VRLTYKEDLQVDWDGHGKLLIKLSPIYSGLISGLCGNYNGNQGDDFLTPSGLIETSVEDFGNSWKLNGDCTD--LMKQDTDPCNLNPKRARFSEEVCFALMDSA-FQSCHNEVNPAPYLKNCRYDVCSCS---NGK--ECLCSALSTYAAACSRKGILIDWRTPEFCPIQC-SEGKIYQQCGSPCNQTCRSLSHPDVDCREFCMEGCYCPPGLYTNEDG-ECVPKSDCSCYYDGELFQPDDVFSNHYSMCYCENGLMHCSTSDVPSGYF-PESFFNQPPARVKRSLDCRPPLNKIICPADNPKATGIECAKTCQNYELECVSHGC-ISGCTCPDGMVRHKSKCMFPQRCPCFHAGKEYAPGSSV---EIDC-NTCVCENRKWKCTENI-CDATCSAIGVSHYLTFDGFRYKFPGDCQYVLAQDYCGGVTGTFRILVGNEGCGFSGEKCTKRITILFRNGEIELTNEQIHI-----KKPLSDETSFDVLKS-GNYFILLLGNQMSVTWDKGMRVYVTLKETYRDKVCGLCGNFDGIENNDLISSNNQIEMDPVNFGNSWKVNPLCADAAKFGAVSPLSLCKDNLMKQMAAENACNILMGDLFAECAKVVNPEPYWEICTYDTCTCESAGDCACFCDSLAAYAHVCAQRGINVHWRSSHLCPQSCEEKNQRDLDYVCEWRYNSCTTACPVTC-----QHPEPVNCPLKCVEGCQAYCPPGKILDEVSESCIEPKDC----PVCTIEGHTVPHGRKIILNHDDPQRCQLCHCEGKNLQC 1239          

HSP 2 Score: 196.052 bits (497), Expect = 2.434e-49
Identity = 147/492 (29.88%), Postives = 221/492 (44.92%), Query Frame = 2
Query: 1340 GSNCGKNCGQLGMELECESQ-CLPGCYCPRNRYWDGTMCVPQEKCPCVRDNGESTYQQGYRLKLNCETCICGMHGKWQCIENEECEGRCFISGDPHYITFDRRHFFFDGHCEYTAVMTTSDNVLLSNSTIAPLSITIQNTNCQDNSETGCPRTIGVIIGEDEDQVAINLLSSSEIKVNFVKISLPYQHTGNTKVLIDQVSTDILR------LKSETGVEILWNGGSRIEIKLSKKYREKVTGMCGNFNGNEMDDSMTFKGVDEKDIDKFVLSWKTNPTCE--SDRGIVEYKGACALSRSYSDYANKVCHKLYESEEFKKCHSAANADKFFDQCTHDVCTCGMKRNGALDHCECEAFSSYARQCALENINLSWRTNELCPKKCPNENMK---------YNQCGSRCTSTCRLLQESKCKEECIEGC--FCPEGETFDEAAKECVKISDCK-CEF------HGRFYLPYEIRQDRCNNCTCTNGNWICTSNDCE 2734
            G  C K C     ELEC S  C+ GC CP       + C+  ++CPC     E  Y  G  ++++C TC+C  + KW+C EN  C+  C   G  HY+TFD   + F G C+Y         V           I + N  C  + E  C + I ++    E +     L++ +I +               K L D+ S D+L+      L     + + W+ G R+ + L + YR+KV G+CGNF+G E +D ++     E D   F  SWK NP C   +  G V     C  +      A   C+ L   + F +C    N + +++ CT+D CTC    + A   C C++ ++YA  CA   IN+ WR++ LCP+ C  +N +         YN C + C  TC+  +   C  +C+EGC  +CP G+  DE ++ C++  DC  C        HGR  +       RC  C C   N  C  N CE
Sbjct:  790 GIECAKTCQNY--ELECVSHGCISGCTCPDGMVRHKSKCMFPQRCPCFHAGKE--YAPGSSVEIDCNTCVCE-NRKWKCTENI-CDATCSAIGVSHYLTFDGFRYKFPGDCQYVLAQDYCGGV------TGTFRILVGNEGCGFSGEK-CTKRITILFRNGEIE-----LTNEQIHIK--------------KPLSDETSFDVLKSGNYFILLLGNQMSVTWDKGMRVYVTLKETYRDKVCGLCGNFDGIENNDLISSNNQIEMDPVNFGNSWKVNPLCADAAKFGAVSPLSLCKDNLMKQMAAENACNILM-GDLFAECAKVVNPEPYWEICTYDTCTCESAGDCA---CFCDSLAAYAHVCAQRGINVHWRSSHLCPQSCEEKNQRDLDYVCEWRYNSCTTACPVTCQHPEPVNCPLKCVEGCQAYCPPGKILDEVSESCIEPKDCPVCTIEGHTVPHGRKIILNHDDPQRCQLCHCEGKNLQC--NACE 1243          

HSP 3 Score: 140.969 bits (354), Expect = 1.285e-32
Identity = 97/365 (26.58%), Postives = 174/365 (47.67%), Query Frame = 2
Query: 3038 CKTWGETHYESFDGKYFEFQGSCSYVISEDFCGNKLGTFKLISENIACGXXXXXCTKSIKFIYLNRVFQ---FVRGSNPIVSRNTNYPPGGPTAFYWTSDVDTHFILFTMEGIQVKWDKAMSLEIMIPEKYQNKVCGLCGNFDLRIDNDMRARSGEIEKDIVNFADSWKVHSS---CPVPQKPPFMCSKRPD-REPWAKAKCEILK-SDSFKKCHDVVNVEHYYKRCVADACECDRGDDCVCFCTAVEQYVARCNEYE-IGLKWRTNENCPHTCTGKRVWKNCGNICPDSCIDIGKNVTDNTGCKKVCIEGCFCPDGLHWQNNECVERKACECVDPITNLKYNTGDKVIRECEECNCYEGAFRCT 4105
            C  +GE H ++FDG +++F G CSY+++ D C     +F L+++         +  K    +YL   F    F+ G+     ++ + P       +  S+   + +     G  VK D + ++++++P K+ NK CGLCGN++   ++D   + G + ++  +FA+SW +H     C     P   C+   +  E     +C++LK S +F +CH +V+ + Y   C  D CEC   ++  C C    +Y   C ++  I   W T+  C   C     +  C + C  +C    +++  N  C++ CI+GC CPDG     + C+    C C+   +  +Y  G  + R+C  C C  GA+ C+
Sbjct:   41 CSLFGENHIQTFDGTFYDFYGDCSYMLAGD-CNKH--SFSLLAD-------YRNGKKKSVSLYLGEYFDIHLFLDGTATQGEKHISMPYAS-NGIFLESEAGYYKLSSQEHGFMVKIDASGNVQVVLPSKHFNKTCGLCGNYNQFAEDDFMMQEGILTENSYDFANSWALHGGARRCRRTYPPSNTCNISSETAEKDFMQRCQMLKTSSAFMQCHHLVDPDPYIAICEDDMCEC--AEELNCPCQTFLEYARTCAQHGVITSNWPTHTICKPLCPFGMEYNECVSPCVKTC----QSLNINEVCQEQCIDGCSCPDGKVLDGDRCIPVFECSCIH--SGKRYPPGSAIRRDCNSCTCQNGAWECS 386          

HSP 4 Score: 99.7525 bits (247), Expect = 4.444e-20
Identity = 111/432 (25.69%), Postives = 172/432 (39.81%), Query Frame = 2
Query: 3026 CSGICKTWGETHYESFDGKYFEFQGSCSYVISEDFCGNKLGTFKLISENIACGXX-XXXCTKSIKFIYLNRVFQFVRGSNPIVSRNTNYPPGGPTA---FYWTSDVD-THFILFTMEGIQVKWDKAMSLEIMI--PEKYQNKVCGLCGNFDLRIDNDMRARSGEIEKDIVNFADSWKVHSSCPVPQKPPFMCSKRPDR---EPWAKAKCEILKSDSFKKCHDVVNVEHYYKRCVADACECDRGDDCVCFCTAVEQYVARCNEYEIGLKWRTNENCPHTCTGKRVWKNCGNICPDSCIDIGKNVTDNTGCKKVCIEGCFCPDGLHWQNNECVERKAC-ECVDPITNLKYNTGDKVIR-------ECEECNCYEG------AFRCTKLFSKECLHTSRPEISTKPPHCVNEYEFLCPNNFCARRCNGIIECRDG 4249
            C  +C      H  +FDG  F+  G+CSYV+  D    ++   K+I  N  C ++   +C KS++  +    +  +  SN  VS N +  P  P A   F  T   +  H +     G    +  A +  ++   P  +  +  GLCG  D    ND     G +  D   F   W V  S          C  +PD+   +P + ++C+I+ S +F+ CH +   + Y+  C   +C    G D    C  +  YV  C    + + WRT + CP  C    V+ +C   C   C   GK + + T C     EGCFCP+G    N +CV  K C +C D     +Y    +++         C  C C E       A  C  +    C     P +      C  +YE +C    C    N +  C +G
Sbjct: 1944 CPCMCMGSSTRHIVTFDGLDFKLMGACSYVLFHD----EVHDVKVILHNAECNTTNHQTCMKSVEVKH--NKYSILLSSNMQVSVNGDIVPL-PYANDNFEVTLYGEIVHEVKIPQLGFVFTFTPANNEFVLQLNPAAFSLRTSGLCGICDQNTVNDFTLSDGSVTTDSSKFIKEWTVVDSLG------RTCETKPDKACTQPIS-SECKIMLSKTFEACHTIFPPKPYFTVCEEASC---HGQD---ICEVIAAYVHVCRINGVCINWRTPDFCPMECPRLMVYHHCHMGCNKEC---GKTL-NGTLCSDSSTEGCFCPEGDVIVNGKCVNEKVCSQCTD-----RYGEEHQLLETWIPTNAPCSICMCLENRMINCTAMPCPTVKPLTCGPCEIPRLKKTSEQCCPDYECVCDLTTC--DVNPVPHCENG 2344          

HSP 5 Score: 93.2041 bits (230), Expect = 5.152e-18
Identity = 115/504 (22.82%), Postives = 194/504 (38.49%), Query Frame = 2
Query: 1523 KLNCETCICGM-HGKWQCIENEE-------CEGRCFISGDPHYITFDRRHFFFDGHCEYTAVMTTSDNVLLSNSTIAPLSITIQNTNCQDNSETGCPRTIGVIIGEDEDQVAINLLSSSEIKVNFVKISLPYQHTGNTKVLIDQVSTDILRLKSETGVEILWNGGSRIEIKLS-KKYREKVTGMCGNFNGNEMDDSMTFKGVDEKDIDKFVLSWKTNPTCESDRGIVEYKGACALSRSYSDYANKVCH-------KLYESEEFKKCHSAANADKFFDQCTHDVCTCGMKRNGALDHCE--CEAFSSYARQCALENINLSWRTNELCPKKCPNENMKYNQCGSRCTSTC-RLLQESKCKEECIEGCFCPEGETFDEAA----KECVKISDCKCEFHGRF--YLPYEIRQDRCNNCTCTNGNWI-CTSNDCEGKEFCPKSMAWFDCGIC---------QKTCTNLDLVCPKGQCQ---LPGCFCPENTVLHN-GECIKPFECPCYM 2917
            K+NCE     M H     ++ EE       C   C  S   H +TFD   F   G C Y          +L +  +  + + + N  C   +   C +++ V      ++ +I L S+ ++ VN   + LPY +      L  ++  ++ ++     V       +   ++L+   +  + +G+CG  + N ++D     G    D  KF+  W           +V+     +L R+     +K C        K+  S+ F+ CH+      +F  C    C           H +  CE  ++Y   C +  + ++WRT + CP +CP   M Y+ C   C   C + L  + C +   EGCFCPEG+          K C + +D   E H     ++P       C+ C C     I CT+  C        ++    CG C         ++ C + + VC    C    +P C      VL N G C   +EC C +
Sbjct: 1914 KVNCEKIPKPMCHNNLPAMKIEETCGCRWTCPCMCMGSSTRHIVTFDGLDFKLMGACSY----------VLFHDEVHDVKVILHNAECNTTNHQTCMKSVEV----KHNKYSILLSSNMQVSVNGDIVPLPYANDNFEVTLYGEIVHEV-KIPQLGFVFTFTPANNEFVLQLNPAAFSLRTSGLCGICDQNTVNDFTLSDGSVTTDSSKFIKEWT----------VVD-----SLGRTCETKPDKACTQPISSECKIMLSKTFEACHTIFPPKPYFTVCEEASC-----------HGQDICEVIAAYVHVCRINGVCINWRTPDFCPMECPRL-MVYHHCHMGCNKECGKTLNGTLCSDSSTEGCFCPEGDVIVNGKCVNEKVCSQCTDRYGEEHQLLETWIP---TNAPCSICMCLENRMINCTAMPC-------PTVKPLTCGPCEIPRLKKTSEQCCPDYECVCDLTTCDVNPVPHCENGLVPVLTNPGHCKPNYECACRI 2365          

HSP 6 Score: 55.8398 bits (133), Expect = 9.489e-7
Identity = 67/335 (20.00%), Postives = 119/335 (35.52%), Query Frame = 2
Query:  479 HIKTFDGNVFSYPLRGGYTLFMDCLGAAPLFYVYFNASYDCFDQKTQNDCSISMKITVGTQTIILFPKNEFALVKNNKTKIPFNSEGIIVSSVGSFIKIKGIDDLEILFD----RDRNIYVYAPVTAEKKICGLCGYFNGIMSDDYRDFNQVIQKNVKTFVNSWIDRDPSDLNVYREREQYPCNALKLKNNDQYQKALTLCQDMVKNNLGRTCQSEVKIDKYLDMCQDEICECLQTQPENSTIENCYSTFCKIEEQYSYACTLKGIAVDWRSATTICKQPQCFNGQEFSECGSNCGKNCGQLGMELECESQCLPGCYCPRNRYWDGTMCVPQEKC 1471
            HI TFDG  F       Y LF D +    +  +  NA  +  + +T   C  S+++     +I+L   N    V  +   +P+ ++   V+  G  +    I  L  +F      +  +    P     +  GLCG  +    +D+   +  +  +   F+  W   D    ++ R  E  P  A         Q   + C+ M+       C +      Y  +C++  C                   C++   Y + C + G+ ++WR+    C   +C     +  C   C K CG+      C      GC+CP         CV ++ C
Sbjct: 1955 HIVTFDGLDFKLMGACSYVLFHDEVHDVKV--ILHNAECNTTNHQT---CMKSVEVKHNKYSILL-SSNMQVSVNGDIVPLPYANDNFEVTLYGEIVHEVKIPQLGFVFTFTPANNEFVLQLNPAAFSLRTSGLCGICDQNTVNDFTLSDGSVTTDSSKFIKEWTVVD----SLGRTCETKPDKACT-------QPISSECKIMLSKTF-EACHTIFPPKPYFTVCEEASCH--------------GQDICEVIAAYVHVCRINGVCINWRTP-DFCPM-ECPRLMVYHHCHMGCNKECGKTLNGTLCSDSSTEGCFCPEGDVIVNGKCVNEKVC 2255          
BLAST of von Willebrand factor vs. Ensembl Xenopus
Match: ndufs8 (NADH:ubiquinone oxidoreductase core subunit S8 [Source:Xenbase;Acc:XB-GENE-945877])

HSP 1 Score: 561.992 bits (1447), Expect = 3.925e-165
Identity = 389/1277 (30.46%), Postives = 600/1277 (46.99%), Query Frame = 2
Query:  440 YSTYYECSVIYGHHIKTFDGNVFSYPLRGGYTLFMDCLGAAPLFYVYFNASYDCFDQKTQNDCSISMKITVGTQTIILFPKNEFALVKNNKTKIPFNSEGIIVSSVGSFIKIKGIDD-LEILFDRDRNIYVYAPVTAEKKICGLCGYFNGIMSDDYRDFNQVIQKNVKTFVNSWIDRDPSDLNVYREREQYP-CNALKLKNNDQYQKALTLCQDMVKNNLGRTCQSEVKIDKYLDMCQDEICECLQTQPENSTIENCYSTFCKIEEQYSYACTLKGIAVDWRSATTICKQPQCFNGQEFSECGSNCGKNCGQLGMELECESQCLPGCYCPRNRYWDGTMCVPQEKCPCVRDNGESTYQQGYRLKLNCETCICGMHGKWQCIENEECEGRCFISGDPHYITFDRRHFFFDGHCEYTAVMTTSDNVLLSNSTIAPLSITIQNTNCQDNSETGCPRTIGVIIGEDEDQVAINLLSSSEIKVNFVKISLPYQHTGNTKVLIDQVSTDILRLKSETGVEILWNGGSRIEIKLSKKYREKVTGMCGNFNGNEMDDSMTFKGVDEKDIDKFVLSWKTNPTCESDRGIVEYKGACALSRSYSDYANKVCHKLYESEEFKKCHSAANADKFFDQCTHDVCTCGMKRNGALDHCECEAFSSYARQCALENINLSWRTNELCPKKCPNENMKYNQCGSRCTSTCRLLQ--ESKCKEECIEGCFCPEGETFDEAAKECVKISDCKCEFHGRFYLPYEIRQDRCNNCTCTNGNWICTSNDCEGKEFCPKSM---------AWFDC-----------------GI-CQKTCTNLDLVCPKGQCQLPGCFCPENTVLHNGECIKPFECPCYMNNKMYSENDTIVRGPANCQNPCICKDGKWVCEQNKQCSGICKTWGETHYESFDGKYFEFQGSCSYVISEDFCGNKLGTFKLISENIACGXXXXXCTKSIKFIYLNRVFQFVRGSNPIVSRNTNYPPGGPTAFYWTSDVDTHFILFTMEGIQVKWDKAMSLEIMIPEKYQNKVCGLCGNFDLRIDNDMRARSGEIEKDIVNFADSWKVHSSCP--VPQKPPFMCSKRPDREPWAKAKCEILKSDSFKKCHDVVNVEHYYKRCVADACECDRGDDCVCFCTAVEQYVARCNEYEIGLKWRTNENCPHTCTGKRV--------WK--NCGNICPDSCIDIGKNVTDNTGCKKVCIEGC--FCPDG--LHWQNNECVERKACECVDPITNLKYNT---GDKVI------RECEECNCYEGAFRC 4102
            +S    CS+   +HI+TFDG  + +     Y L  DC   +      F+   D  + K +     S+ + +G    I    +  A        +P+ S GI + S   + K+   +    +  D   N+ V  P     K CGLCG +N    DD+     ++ +N   F NSW           R R  YP  N   + +    +  +  CQ +  ++    C   V  D Y+ +C+D++CEC +         NC    C+   +Y+  C   G+        TICK P C  G E++EC S C K C  L +   C+ QC+ GC CP  +  DG  C+P  +C C+       Y  G  ++ +C +C C  +G W+C  NE+C G CF++G  H+ +FD +HF F G C+Y         +L +++  +  S+TI+   C D+ +  C R+  + +  D   + I L     + ++   I LP    G  ++    +S   +RL  +  +++ W+G  ++ IKLS  Y   ++G+CGN+NGN+ DD +T  G+ E  ++ F  SWK N  C     + +    C L+   + ++ +VC  L +S  F+ CH+  N   +   C +DVC+C    NG    C C A S+YA  C+ + I + WRT E CP +C +E   Y QCGS C  TCR L   +  C+E C+EGC+CP G   +E   ECV  SDC C + G  + P ++  +  + C C NG   C+++D     F P+S             DC                 GI C KTC N +L C    C + GC CP+  V H  +C+ P  CPC+   K Y+   ++     +C N C+C++ KW C +N  C   C   G +HY +FDG  ++F G C YV+++D+CG   GTF+++  N  CG S   CTK I  ++ N   +       I       P    T+F        +FIL     + V WDK M + + + E Y++KVCGLCGNFD   +ND+ + + +IE D VNF +SWKV+  C       P  +C     ++  A+  C IL  D F +C  VVN E Y++ C  D C C+   DC CFC ++  Y   C +  I + WR++  CP +C  K          W+  +C   CP +C        +   C   C+EGC  +CP G  L   +  C+E K C    P+  ++ +T   G K+I      + C+ C+C     +C
Sbjct:   24 WSVLARCSLFGENHIQTFDGTFYDFYGDCSYMLAGDCNKHS------FSLLADYRNGKKK-----SVSLYLGEYFDIHLFLDGTATQGEKHISMPYASNGIFLESEAGYYKLSSQEHGFMVKIDASGNVQVVLPSKHFNKTCGLCGNYNQFAEDDFMMQEGILTENSYDFANSWALHG----GARRCRRTYPPSNTCNISSETAEKDFMQRCQMLKTSSAFMQCHHLVDPDPYIAICEDDMCECAEEL-------NCP---CQTFLEYARTCAQHGVITSNWPTHTICK-PLCPFGMEYNECVSPCVKTCQSLNINEVCQEQCIDGCSCPDGKVLDGDRCIPVFECSCIHSGKR--YPPGSAIRRDCNSCTC-QNGAWEC-SNEDCPGECFVTGQSHFKSFDNKHFTFSGICQY---------LLATDAMDSTFSVTIETVQCADDIDAVCTRSASLRL-LDMHNITIKLKHGGGVSLDGQDILLPLVQ-GFLRIQTTVLSA--VRLTYKEDLQVDWDGHGKLLIKLSPIYSGLISGLCGNYNGNQGDDFLTPSGLIETSVEDFGNSWKLNGDCTD--LMKQDTDPCNLNPKRARFSEEVCFALMDSA-FQSCHNEVNPAPYLKNCRYDVCSCS---NGK--ECLCSALSTYAAACSRKGILIDWRTPEFCPIQC-SEGKIYQQCGSPCNQTCRSLSHPDVDCREFCMEGCYCPPGLYTNEDG-ECVPKSDCSCYYDGELFQPDDVFSNHYSMCYCENGLMHCSTSDVPSGYF-PESFFNQPPARVKRSLDCRPPLNKIICPADNPKATGIECAKTCQNYELECVSHGC-ISGCTCPDGMVRHKSKCMFPQRCPCFHAGKEYAPGSSV---EIDC-NTCVCENRKWKCTENI-CDATCSAIGVSHYLTFDGFRYKFPGDCQYVLAQDYCGGVTGTFRILVGNEGCGFSGEKCTKRITILFRNGEIELTNEQIHI-----KKPLSDETSFDVLKS-GNYFILLLGNQMSVTWDKGMRVYVTLKETYRDKVCGLCGNFDGIENNDLISSNNQIEMDPVNFGNSWKVNPLCADFGAVSPLSLCKDNLMKQMAAENACNILMGDLFAECAKVVNPEPYWEICTYDTCTCESAGDCACFCDSLAAYAHVCAQRGINVHWRSSHLCPQSCEEKNQRDLDYVCEWRYNSCTTACPVTC-----QHPEPVNCPLKCVEGCQAYCPPGKILDEVSESCIEPKDC----PVCTIEGHTVPHGRKIILNHDDPQRCQLCHCEGKNLQC 1225          

HSP 2 Score: 199.134 bits (505), Expect = 2.965e-50
Identity = 148/490 (30.20%), Postives = 222/490 (45.31%), Query Frame = 2
Query: 1340 GSNCGKNCGQLGMELECESQ-CLPGCYCPRNRYWDGTMCVPQEKCPCVRDNGESTYQQGYRLKLNCETCICGMHGKWQCIENEECEGRCFISGDPHYITFDRRHFFFDGHCEYTAVMTTSDNVLLSNSTIAPLSITIQNTNCQDNSETGCPRTIGVIIGEDEDQVAINLLSSSEIKVNFVKISLPYQHTGNTKVLIDQVSTDILR------LKSETGVEILWNGGSRIEIKLSKKYREKVTGMCGNFNGNEMDDSMTFKGVDEKDIDKFVLSWKTNPTCESDRGIVEYKGACALSRSYSDYANKVCHKLYESEEFKKCHSAANADKFFDQCTHDVCTCGMKRNGALDHCECEAFSSYARQCALENINLSWRTNELCPKKCPNENMK---------YNQCGSRCTSTCRLLQESKCKEECIEGC--FCPEGETFDEAAKECVKISDCK-CEF------HGRFYLPYEIRQDRCNNCTCTNGNWICTSNDCE 2734
            G  C K C     ELEC S  C+ GC CP       + C+  ++CPC     E  Y  G  ++++C TC+C  + KW+C EN  C+  C   G  HY+TFD   + F G C+Y         V           I + N  C  + E  C + I ++    E +     L++ +I +               K L D+ S D+L+      L     + + W+ G R+ + L + YR+KV G+CGNF+G E +D ++     E D   F  SWK NP C +D G V     C  +      A   C+ L   + F +C    N + +++ CT+D CTC    + A   C C++ ++YA  CA   IN+ WR++ LCP+ C  +N +         YN C + C  TC+  +   C  +C+EGC  +CP G+  DE ++ C++  DC  C        HGR  +       RC  C C   N  C  N CE
Sbjct:  779 GIECAKTCQNY--ELECVSHGCISGCTCPDGMVRHKSKCMFPQRCPCFHAGKE--YAPGSSVEIDCNTCVCE-NRKWKCTENI-CDATCSAIGVSHYLTFDGFRYKFPGDCQYVLAQDYCGGV------TGTFRILVGNEGCGFSGEK-CTKRITILFRNGEIE-----LTNEQIHIK--------------KPLSDETSFDVLKSGNYFILLLGNQMSVTWDKGMRVYVTLKETYRDKVCGLCGNFDGIENNDLISSNNQIEMDPVNFGNSWKVNPLC-ADFGAVSPLSLCKDNLMKQMAAENACNILM-GDLFAECAKVVNPEPYWEICTYDTCTCESAGDCA---CFCDSLAAYAHVCAQRGINVHWRSSHLCPQSCEEKNQRDLDYVCEWRYNSCTTACPVTCQHPEPVNCPLKCVEGCQAYCPPGKILDEVSESCIEPKDCPVCTIEGHTVPHGRKIILNHDDPQRCQLCHCEGKNLQC--NACE 1229          

HSP 3 Score: 140.969 bits (354), Expect = 1.315e-32
Identity = 98/365 (26.85%), Postives = 176/365 (48.22%), Query Frame = 2
Query: 3038 CKTWGETHYESFDGKYFEFQGSCSYVISEDFCGNKLGTFKLISENIACGXXXXXCTKSIKFIYLNRVFQ---FVRGSNPIVSRNTNYPPGGPTAFYWTSDVDTHFILFTMEGIQVKWDKAMSLEIMIPEKYQNKVCGLCGNFDLRIDNDMRARSGEIEKDIVNFADSWKVHSS---CPVPQKPPFMCSKRPD-REPWAKAKCEILK-SDSFKKCHDVVNVEHYYKRCVADACECDRGDDCVCFCTAVEQYVARCNEYE-IGLKWRTNENCPHTCTGKRVWKNCGNICPDSCIDIGKNVTDNTGCKKVCIEGCFCPDGLHWQNNECVERKACECVDPITNLKYNTGDKVIRECEECNCYEGAFRCT 4105
            C  +GE H ++FDG +++F G CSY+++ D C     +F L+++        +   KS+  +YL   F    F+ G+     ++ + P       +  S+   + +     G  VK D + ++++++P K+ NK CGLCGN++   ++D   + G + ++  +FA+SW +H     C     P   C+   +  E     +C++LK S +F +CH +V+ + Y   C  D CEC   ++  C C    +Y   C ++  I   W T+  C   C     +  C + C  +C    +++  N  C++ CI+GC CPDG     + C+    C C+   +  +Y  G  + R+C  C C  GA+ C+
Sbjct:   30 CSLFGENHIQTFDGTFYDFYGDCSYMLAGD-CNKH--SFSLLAD------YRNGKKKSVS-LYLGEYFDIHLFLDGTATQGEKHISMPYAS-NGIFLESEAGYYKLSSQEHGFMVKIDASGNVQVVLPSKHFNKTCGLCGNYNQFAEDDFMMQEGILTENSYDFANSWALHGGARRCRRTYPPSNTCNISSETAEKDFMQRCQMLKTSSAFMQCHHLVDPDPYIAICEDDMCEC--AEELNCPCQTFLEYARTCAQHGVITSNWPTHTICKPLCPFGMEYNECVSPCVKTC----QSLNINEVCQEQCIDGCSCPDGKVLDGDRCIPVFECSCIH--SGKRYPPGSAIRRDCNSCTCQNGAWECS 375          

HSP 4 Score: 99.7525 bits (247), Expect = 4.439e-20
Identity = 111/432 (25.69%), Postives = 172/432 (39.81%), Query Frame = 2
Query: 3026 CSGICKTWGETHYESFDGKYFEFQGSCSYVISEDFCGNKLGTFKLISENIACGXX-XXXCTKSIKFIYLNRVFQFVRGSNPIVSRNTNYPPGGPTA---FYWTSDVD-THFILFTMEGIQVKWDKAMSLEIMI--PEKYQNKVCGLCGNFDLRIDNDMRARSGEIEKDIVNFADSWKVHSSCPVPQKPPFMCSKRPDR---EPWAKAKCEILKSDSFKKCHDVVNVEHYYKRCVADACECDRGDDCVCFCTAVEQYVARCNEYEIGLKWRTNENCPHTCTGKRVWKNCGNICPDSCIDIGKNVTDNTGCKKVCIEGCFCPDGLHWQNNECVERKAC-ECVDPITNLKYNTGDKVIR-------ECEECNCYEG------AFRCTKLFSKECLHTSRPEISTKPPHCVNEYEFLCPNNFCARRCNGIIECRDG 4249
            C  +C      H  +FDG  F+  G+CSYV+  D    ++   K+I  N  C ++   +C KS++  +    +  +  SN  VS N +  P  P A   F  T   +  H +     G    +  A +  ++   P  +  +  GLCG  D    ND     G +  D   F   W V  S          C  +PD+   +P + ++C+I+ S +F+ CH +   + Y+  C   +C    G D    C  +  YV  C    + + WRT + CP  C    V+ +C   C   C   GK + + T C     EGCFCP+G    N +CV  K C +C D     +Y    +++         C  C C E       A  C  +    C     P +      C  +YE +C    C    N +  C +G
Sbjct: 1928 CPCMCMGSSTRHIVTFDGLDFKLMGACSYVLFHD----EVHDVKVILHNAECNTTNHQTCMKSVEVKH--NKYSILLSSNMQVSVNGDIVPL-PYANDNFEVTLYGEIVHEVKIPQLGFVFTFTPANNEFVLQLNPAAFSLRTSGLCGICDQNTVNDFTLSDGSVTTDSSKFIKEWTVVDSLG------RTCETKPDKACTQPIS-SECKIMLSKTFEACHTIFPPKPYFTVCEEASC---HGQD---ICEVIAAYVHVCRINGVCINWRTPDFCPMECPRLMVYHHCHMGCNKEC---GKTL-NGTLCSDSSTEGCFCPEGDVIVNGKCVNEKVCSQCTD-----RYGEEHQLLETWIPTNAPCSICMCLENRMINCTAMPCPTVKPLTCGPCEIPRLKKTSEQCCPDYECVCDLTTC--DVNPVPHCENG 2328          

HSP 5 Score: 92.8189 bits (229), Expect = 5.190e-18
Identity = 115/504 (22.82%), Postives = 194/504 (38.49%), Query Frame = 2
Query: 1523 KLNCETCICGM-HGKWQCIENEE-------CEGRCFISGDPHYITFDRRHFFFDGHCEYTAVMTTSDNVLLSNSTIAPLSITIQNTNCQDNSETGCPRTIGVIIGEDEDQVAINLLSSSEIKVNFVKISLPYQHTGNTKVLIDQVSTDILRLKSETGVEILWNGGSRIEIKLS-KKYREKVTGMCGNFNGNEMDDSMTFKGVDEKDIDKFVLSWKTNPTCESDRGIVEYKGACALSRSYSDYANKVCH-------KLYESEEFKKCHSAANADKFFDQCTHDVCTCGMKRNGALDHCE--CEAFSSYARQCALENINLSWRTNELCPKKCPNENMKYNQCGSRCTSTC-RLLQESKCKEECIEGCFCPEGETFDEAA----KECVKISDCKCEFHGRF--YLPYEIRQDRCNNCTCTNGNWI-CTSNDCEGKEFCPKSMAWFDCGIC---------QKTCTNLDLVCPKGQCQ---LPGCFCPENTVLHN-GECIKPFECPCYM 2917
            K+NCE     M H     ++ EE       C   C  S   H +TFD   F   G C Y          +L +  +  + + + N  C   +   C +++ V      ++ +I L S+ ++ VN   + LPY +      L  ++  ++ ++     V       +   ++L+   +  + +G+CG  + N ++D     G    D  KF+  W           +V+     +L R+     +K C        K+  S+ F+ CH+      +F  C    C           H +  CE  ++Y   C +  + ++WRT + CP +CP   M Y+ C   C   C + L  + C +   EGCFCPEG+          K C + +D   E H     ++P       C+ C C     I CT+  C        ++    CG C         ++ C + + VC    C    +P C      VL N G C   +EC C +
Sbjct: 1898 KVNCEKIPKPMCHNNLPAMKIEETCGCRWTCPCMCMGSSTRHIVTFDGLDFKLMGACSY----------VLFHDEVHDVKVILHNAECNTTNHQTCMKSVEV----KHNKYSILLSSNMQVSVNGDIVPLPYANDNFEVTLYGEIVHEV-KIPQLGFVFTFTPANNEFVLQLNPAAFSLRTSGLCGICDQNTVNDFTLSDGSVTTDSSKFIKEWT----------VVD-----SLGRTCETKPDKACTQPISSECKIMLSKTFEACHTIFPPKPYFTVCEEASC-----------HGQDICEVIAAYVHVCRINGVCINWRTPDFCPMECPRL-MVYHHCHMGCNKECGKTLNGTLCSDSSTEGCFCPEGDVIVNGKCVNEKVCSQCTDRYGEEHQLLETWIP---TNAPCSICMCLENRMINCTAMPC-------PTVKPLTCGPCEIPRLKKTSEQCCPDYECVCDLTTCDVNPVPHCENGLVPVLTNPGHCKPNYECACRI 2349          

HSP 6 Score: 55.8398 bits (133), Expect = 9.404e-7
Identity = 67/335 (20.00%), Postives = 119/335 (35.52%), Query Frame = 2
Query:  479 HIKTFDGNVFSYPLRGGYTLFMDCLGAAPLFYVYFNASYDCFDQKTQNDCSISMKITVGTQTIILFPKNEFALVKNNKTKIPFNSEGIIVSSVGSFIKIKGIDDLEILFD----RDRNIYVYAPVTAEKKICGLCGYFNGIMSDDYRDFNQVIQKNVKTFVNSWIDRDPSDLNVYREREQYPCNALKLKNNDQYQKALTLCQDMVKNNLGRTCQSEVKIDKYLDMCQDEICECLQTQPENSTIENCYSTFCKIEEQYSYACTLKGIAVDWRSATTICKQPQCFNGQEFSECGSNCGKNCGQLGMELECESQCLPGCYCPRNRYWDGTMCVPQEKC 1471
            HI TFDG  F       Y LF D +    +  +  NA  +  + +T   C  S+++     +I+L   N    V  +   +P+ ++   V+  G  +    I  L  +F      +  +    P     +  GLCG  +    +D+   +  +  +   F+  W   D    ++ R  E  P  A         Q   + C+ M+       C +      Y  +C++  C                   C++   Y + C + G+ ++WR+    C   +C     +  C   C K CG+      C      GC+CP         CV ++ C
Sbjct: 1939 HIVTFDGLDFKLMGACSYVLFHDEVHDVKV--ILHNAECNTTNHQT---CMKSVEVKHNKYSILL-SSNMQVSVNGDIVPLPYANDNFEVTLYGEIVHEVKIPQLGFVFTFTPANNEFVLQLNPAAFSLRTSGLCGICDQNTVNDFTLSDGSVTTDSSKFIKEWTVVD----SLGRTCETKPDKACT-------QPISSECKIMLSKTF-EACHTIFPPKPYFTVCEEASCH--------------GQDICEVIAAYVHVCRINGVCINWRTP-DFCPM-ECPRLMVYHHCHMGCNKECGKTLNGTLCSDSSTEGCFCPEGDVIVNGKCVNEKVC 2239          
BLAST of von Willebrand factor vs. Ensembl Xenopus
Match: ndufs8 (NADH:ubiquinone oxidoreductase core subunit S8 [Source:Xenbase;Acc:XB-GENE-945877])

HSP 1 Score: 558.14 bits (1437), Expect = 7.892e-164
Identity = 391/1281 (30.52%), Postives = 599/1281 (46.76%), Query Frame = 2
Query:  440 YSTYYECSVIYGHHIKTFDGNVFSYPLRGGYTLFMDCLGAAPLFYVYFNASYDCFDQKTQNDCSISMKITVGTQTIILFPKNEFALVKNNKTKIPFNSEGIIVSSVGSFIKIKGIDD-LEILFDRDRNIYVYAPVTAEKKICGLCGYFNGIMSDDYRDFNQVIQKNVKTFVNSWIDRDPSDLNVYREREQYP----CNALKLKNNDQYQKALTL-CQDMVKNNLGRTCQSEVKIDKYLDMCQDEICECLQTQPENSTIENCYSTFCKIEEQYSYACTLKGIAVDWRSATTICKQPQCFNGQEFSECGSNCGKNCGQLGMELECESQCLPGCYCPRNRYWDGTMCVPQEKCPCVRDNGESTYQQGYRLKLNCETCICGMHGKWQCIENEECEGRCFISGDPHYITFDRRHFFFDGHCEYTAVMTTSDNVLLSNSTIAPLSITIQNTNCQDNSETGCPRTIGVIIGEDEDQVAINLLSSSEIKVNFVKISLPYQHTGNTKVLIDQVSTDILRLKSETGVEILWNGGSRIEIKLSKKYREKVTGMCGNFNGNEMDDSMTFKGVDEKDIDKFVLSWKTNPTCESDRGIVEYKGACALSRSYSDYANKVCHKLYESEEFKKCHSAANADKFFDQCTHDVCTCGMKRNGALDHCECEAFSSYARQCALENINLSWRTNELCPKKCPNENMKYNQCGSRCTSTCRLLQ--ESKCKEECIEGCFCPEGETFDEAAKECVKISDCKCEFHGRFYLPYEIRQDRCNNCTCTNGNWICTSNDCEGKEFCPKSM---------AWFDC-----------------GI-CQKTCTNLDLVCPKGQCQLPGCFCPENTVLHNGECIKPFECPCYMNNKMYSENDTIVRGPANCQNPCICKDGKWVCEQNKQCSGICKTWGETHYESFDGKYFEFQGSCSYVISEDFCGNKLGTFKLISENIACGXXXXXCTKSIKFIYLNRVFQFVRGSNPIVSRNTNYPPGGPTAFYWTSDVDTHFILFTMEGIQVKWDKAMSLEIMIPEKYQNKVCGLCGNFDLRIDNDMRARSGEIEKDIVNFADSWKVHSSCP--VPQKPPFMCSKRPDREPWAKAKCEILKSDSFKKCHDVVNVEHYYKRCVADACECDRGDDCVCFCTAVEQYVARCNEYEIGLKWRTNENCPHTCTGKRV--------WK--NCGNICPDSCIDIGKNVTDNTGCKKVCIEGC--FCPDG--LHWQNNECVERKACECVDPITNLKYNT---GDKVI------RECEECNCYEGAFRC 4102
            +S    CS+   +HI+TFDG  + +     Y L  DC   +      F+   D  + K +     S+ + +G    I    +  A        +P+ S GI + S   + K+   +    +  D   N+ V  P     K CGLCG +N    DD+     ++ +N   F NSW           R R  YP    CN         Y     + CQ +  ++    C   V  D Y+ +C+D++CEC +         NC    C+   +Y+  C   G+        TICK P C  G E++EC S C K C  L +   C+ QC+ GC CP  +  DG  C+P  +C C+       Y  G  ++ +C +C C  +G W+C  NE+C G CF++G  H+ +FD +HF F G C+Y         +L +++  +  S+TI+   C D+ +  C R+  + +  D   + I L     + ++   I LP    G  ++    +S   +RL  +  +++ W+G  ++ IKLS  Y   ++G+CGN+NGN+ DD +T  G+ E  ++ F  SWK N  C     + +    C L+   + ++ +VC  L +S  F+ CH+  N   +   C +DVC+C    NG    C C A S+YA  C+ + I + WRT E CP +C +E   Y QCGS C  TCR L   +  C+E C+EGC+CP G   +E   ECV  SDC C + G  + P ++  +  + C C NG   C+++D     F P+S             DC                 GI C KTC N +L C    C + GC CP+  V H  +C+ P  CPC+   K Y+   ++     +C N C+C++ KW C +N  C   C   G +HY +FDG  ++F G C YV+++D+CG   GTF+++  N  CG S   CTK I  ++ N   +       I       P    T+F        +FIL     + V WDK M + + + E Y++KVCGLCGNFD   +ND+ + + +IE D VNF +SWKV+  C       P  +C     ++  A+  C IL  D F +C  VVN E Y++ C  D C C+   DC CFC ++  Y   C +  I + WR++  CP +C  K          W+  +C   CP +C        +   C   C+EGC  +CP G  L   +  C+E K C    P+  ++ +T   G K+I      + C+ C+C     +C
Sbjct:   18 WSVLARCSLFGENHIQTFDGTFYDFYGDCSYMLAGDCNKHS------FSLLADYRNGKKK-----SVSLYLGEYFDIHLFLDGTATQGEKHISMPYASNGIFLESEAGYYKLSSQEHGFMVKIDASGNVQVVLPSKHFNKTCGLCGNYNQFAEDDFMMQEGILTENSYDFANSWALHG----GARRCRRTYPPSNTCNISSETAEKVYVGLWKVECQMLKTSSAFMQCHHLVDPDPYIAICEDDMCECAEEL-------NCP---CQTFLEYARTCAQHGVITSNWPTHTICK-PLCPFGMEYNECVSPCVKTCQSLNINEVCQEQCIDGCSCPDGKVLDGDRCIPVFECSCIHSGKR--YPPGSAIRRDCNSCTC-QNGAWEC-SNEDCPGECFVTGQSHFKSFDNKHFTFSGICQY---------LLATDAMDSTFSVTIETVQCADDIDAVCTRSASLRL-LDMHNITIKLKHGGGVSLDGQDILLPLVQ-GFLRIQTTVLSA--VRLTYKEDLQVDWDGHGKLLIKLSPIYSGLISGLCGNYNGNQGDDFLTPSGLIETSVEDFGNSWKLNGDCTD--LMKQDTDPCNLNPKRARFSEEVCFALMDSA-FQSCHNEVNPAPYLKNCRYDVCSCS---NGK--ECLCSALSTYAAACSRKGILIDWRTPEFCPIQC-SEGKIYQQCGSPCNQTCRSLSHPDVDCREFCMEGCYCPPGLYTNEDG-ECVPKSDCSCYYDGELFQPDDVFSNHYSMCYCENGLMHCSTSDVPSGYF-PESFFNQPPARVKRSLDCRPPLNKIICPADNPKATGIECAKTCQNYELECVSHGC-ISGCTCPDGMVRHKSKCMFPQRCPCFHAGKEYAPGSSV---EIDC-NTCVCENRKWKCTENI-CDATCSAIGVSHYLTFDGFRYKFPGDCQYVLAQDYCGGVTGTFRILVGNEGCGFSGEKCTKRITILFRNGEIELTNEQIHI-----KKPLSDETSFDVLKS-GNYFILLLGNQMSVTWDKGMRVYVTLKETYRDKVCGLCGNFDGIENNDLISSNNQIEMDPVNFGNSWKVNPLCADFGAVSPLSLCKDNLMKQMAAENACNILMGDLFAECAKVVNPEPYWEICTYDTCTCESAGDCACFCDSLAAYAHVCAQRGINVHWRSSHLCPQSCEEKNQRDLDYVCEWRYNSCTTACPVTC-----QHPEPVNCPLKCVEGCQAYCPPGKILDEVSESCIEPKDC----PVCTIEGHTVPHGRKIILNHDDPQRCQLCHCEGKNLQC 1223          

HSP 2 Score: 199.134 bits (505), Expect = 2.989e-50
Identity = 148/490 (30.20%), Postives = 222/490 (45.31%), Query Frame = 2
Query: 1340 GSNCGKNCGQLGMELECESQ-CLPGCYCPRNRYWDGTMCVPQEKCPCVRDNGESTYQQGYRLKLNCETCICGMHGKWQCIENEECEGRCFISGDPHYITFDRRHFFFDGHCEYTAVMTTSDNVLLSNSTIAPLSITIQNTNCQDNSETGCPRTIGVIIGEDEDQVAINLLSSSEIKVNFVKISLPYQHTGNTKVLIDQVSTDILR------LKSETGVEILWNGGSRIEIKLSKKYREKVTGMCGNFNGNEMDDSMTFKGVDEKDIDKFVLSWKTNPTCESDRGIVEYKGACALSRSYSDYANKVCHKLYESEEFKKCHSAANADKFFDQCTHDVCTCGMKRNGALDHCECEAFSSYARQCALENINLSWRTNELCPKKCPNENMK---------YNQCGSRCTSTCRLLQESKCKEECIEGC--FCPEGETFDEAAKECVKISDCK-CEF------HGRFYLPYEIRQDRCNNCTCTNGNWICTSNDCE 2734
            G  C K C     ELEC S  C+ GC CP       + C+  ++CPC     E  Y  G  ++++C TC+C  + KW+C EN  C+  C   G  HY+TFD   + F G C+Y         V           I + N  C  + E  C + I ++    E +     L++ +I +               K L D+ S D+L+      L     + + W+ G R+ + L + YR+KV G+CGNF+G E +D ++     E D   F  SWK NP C +D G V     C  +      A   C+ L   + F +C    N + +++ CT+D CTC    + A   C C++ ++YA  CA   IN+ WR++ LCP+ C  +N +         YN C + C  TC+  +   C  +C+EGC  +CP G+  DE ++ C++  DC  C        HGR  +       RC  C C   N  C  N CE
Sbjct:  777 GIECAKTCQNY--ELECVSHGCISGCTCPDGMVRHKSKCMFPQRCPCFHAGKE--YAPGSSVEIDCNTCVCE-NRKWKCTENI-CDATCSAIGVSHYLTFDGFRYKFPGDCQYVLAQDYCGGV------TGTFRILVGNEGCGFSGEK-CTKRITILFRNGEIE-----LTNEQIHIK--------------KPLSDETSFDVLKSGNYFILLLGNQMSVTWDKGMRVYVTLKETYRDKVCGLCGNFDGIENNDLISSNNQIEMDPVNFGNSWKVNPLC-ADFGAVSPLSLCKDNLMKQMAAENACNILM-GDLFAECAKVVNPEPYWEICTYDTCTCESAGDCA---CFCDSLAAYAHVCAQRGINVHWRSSHLCPQSCEEKNQRDLDYVCEWRYNSCTTACPVTCQHPEPVNCPLKCVEGCQAYCPPGKILDEVSESCIEPKDCPVCTIEGHTVPHGRKIILNHDDPQRCQLCHCEGKNLQC--NACE 1227          

HSP 3 Score: 140.584 bits (353), Expect = 1.810e-32
Identity = 98/370 (26.49%), Postives = 175/370 (47.30%), Query Frame = 2
Query: 3038 CKTWGETHYESFDGKYFEFQGSCSYVISEDFCGNKLGTFKLISENIACGXXXXXCTKSIKFIYLNRVFQ---FVRGSNPIVSRNTNYPPGGPTAFYWTSDVDTHFILFTMEGIQVKWDKAMSLEIMIPEKYQNKVCGLCGNFDLRIDNDMRARSGEIEKDIVNFADSWKVHSS---CPVPQKPPFMCSKRPDREP------WAKAKCEILK-SDSFKKCHDVVNVEHYYKRCVADACECDRGDDCVCFCTAVEQYVARCNEYE-IGLKWRTNENCPHTCTGKRVWKNCGNICPDSCIDIGKNVTDNTGCKKVCIEGCFCPDGLHWQNNECVERKACECVDPITNLKYNTGDKVIRECEECNCYEGAFRCT 4105
            C  +GE H ++FDG +++F G CSY+++ D C     +F L+++         +  K    +YL   F    F+ G+     ++ + P       +  S+   + +     G  VK D + ++++++P K+ NK CGLCGN++   ++D   + G + ++  +FA+SW +H     C     P   C+   +         W K +C++LK S +F +CH +V+ + Y   C  D CEC   ++  C C    +Y   C ++  I   W T+  C   C     +  C + C  +C    +++  N  C++ CI+GC CPDG     + C+    C C+   +  +Y  G  + R+C  C C  GA+ C+
Sbjct:   24 CSLFGENHIQTFDGTFYDFYGDCSYMLAGD-CNKH--SFSLLAD-------YRNGKKKSVSLYLGEYFDIHLFLDGTATQGEKHISMPYAS-NGIFLESEAGYYKLSSQEHGFMVKIDASGNVQVVLPSKHFNKTCGLCGNYNQFAEDDFMMQEGILTENSYDFANSWALHGGARRCRRTYPPSNTCNISSETAEKVYVGLW-KVECQMLKTSSAFMQCHHLVDPDPYIAICEDDMCEC--AEELNCPCQTFLEYARTCAQHGVITSNWPTHTICKPLCPFGMEYNECVSPCVKTC----QSLNINEVCQEQCIDGCSCPDGKVLDGDRCIPVFECSCIH--SGKRYPPGSAIRRDCNSCTCQNGAWECS 373          

HSP 4 Score: 99.7525 bits (247), Expect = 4.364e-20
Identity = 111/432 (25.69%), Postives = 172/432 (39.81%), Query Frame = 2
Query: 3026 CSGICKTWGETHYESFDGKYFEFQGSCSYVISEDFCGNKLGTFKLISENIACGXX-XXXCTKSIKFIYLNRVFQFVRGSNPIVSRNTNYPPGGPTA---FYWTSDVD-THFILFTMEGIQVKWDKAMSLEIMI--PEKYQNKVCGLCGNFDLRIDNDMRARSGEIEKDIVNFADSWKVHSSCPVPQKPPFMCSKRPDR---EPWAKAKCEILKSDSFKKCHDVVNVEHYYKRCVADACECDRGDDCVCFCTAVEQYVARCNEYEIGLKWRTNENCPHTCTGKRVWKNCGNICPDSCIDIGKNVTDNTGCKKVCIEGCFCPDGLHWQNNECVERKAC-ECVDPITNLKYNTGDKVIR-------ECEECNCYEG------AFRCTKLFSKECLHTSRPEISTKPPHCVNEYEFLCPNNFCARRCNGIIECRDG 4249
            C  +C      H  +FDG  F+  G+CSYV+  D    ++   K+I  N  C ++   +C KS++  +    +  +  SN  VS N +  P  P A   F  T   +  H +     G    +  A +  ++   P  +  +  GLCG  D    ND     G +  D   F   W V  S          C  +PD+   +P + ++C+I+ S +F+ CH +   + Y+  C   +C    G D    C  +  YV  C    + + WRT + CP  C    V+ +C   C   C   GK + + T C     EGCFCP+G    N +CV  K C +C D     +Y    +++         C  C C E       A  C  +    C     P +      C  +YE +C    C    N +  C +G
Sbjct: 1926 CPCMCMGSSTRHIVTFDGLDFKLMGACSYVLFHD----EVHDVKVILHNAECNTTNHQTCMKSVEVKH--NKYSILLSSNMQVSVNGDIVPL-PYANDNFEVTLYGEIVHEVKIPQLGFVFTFTPANNEFVLQLNPAAFSLRTSGLCGICDQNTVNDFTLSDGSVTTDSSKFIKEWTVVDSLG------RTCETKPDKACTQPIS-SECKIMLSKTFEACHTIFPPKPYFTVCEEASC---HGQD---ICEVIAAYVHVCRINGVCINWRTPDFCPMECPRLMVYHHCHMGCNKEC---GKTL-NGTLCSDSSTEGCFCPEGDVIVNGKCVNEKVCSQCTD-----RYGEEHQLLETWIPTNAPCSICMCLENRMINCTAMPCPTVKPLTCGPCEIPRLKKTSEQCCPDYECVCDLTTC--DVNPVPHCENG 2326          

HSP 5 Score: 93.2041 bits (230), Expect = 5.060e-18
Identity = 115/504 (22.82%), Postives = 194/504 (38.49%), Query Frame = 2
Query: 1523 KLNCETCICGM-HGKWQCIENEE-------CEGRCFISGDPHYITFDRRHFFFDGHCEYTAVMTTSDNVLLSNSTIAPLSITIQNTNCQDNSETGCPRTIGVIIGEDEDQVAINLLSSSEIKVNFVKISLPYQHTGNTKVLIDQVSTDILRLKSETGVEILWNGGSRIEIKLS-KKYREKVTGMCGNFNGNEMDDSMTFKGVDEKDIDKFVLSWKTNPTCESDRGIVEYKGACALSRSYSDYANKVCH-------KLYESEEFKKCHSAANADKFFDQCTHDVCTCGMKRNGALDHCE--CEAFSSYARQCALENINLSWRTNELCPKKCPNENMKYNQCGSRCTSTC-RLLQESKCKEECIEGCFCPEGETFDEAA----KECVKISDCKCEFHGRF--YLPYEIRQDRCNNCTCTNGNWI-CTSNDCEGKEFCPKSMAWFDCGIC---------QKTCTNLDLVCPKGQCQ---LPGCFCPENTVLHN-GECIKPFECPCYM 2917
            K+NCE     M H     ++ EE       C   C  S   H +TFD   F   G C Y          +L +  +  + + + N  C   +   C +++ V      ++ +I L S+ ++ VN   + LPY +      L  ++  ++ ++     V       +   ++L+   +  + +G+CG  + N ++D     G    D  KF+  W           +V+     +L R+     +K C        K+  S+ F+ CH+      +F  C    C           H +  CE  ++Y   C +  + ++WRT + CP +CP   M Y+ C   C   C + L  + C +   EGCFCPEG+          K C + +D   E H     ++P       C+ C C     I CT+  C        ++    CG C         ++ C + + VC    C    +P C      VL N G C   +EC C +
Sbjct: 1896 KVNCEKIPKPMCHNNLPAMKIEETCGCRWTCPCMCMGSSTRHIVTFDGLDFKLMGACSY----------VLFHDEVHDVKVILHNAECNTTNHQTCMKSVEV----KHNKYSILLSSNMQVSVNGDIVPLPYANDNFEVTLYGEIVHEV-KIPQLGFVFTFTPANNEFVLQLNPAAFSLRTSGLCGICDQNTVNDFTLSDGSVTTDSSKFIKEWT----------VVD-----SLGRTCETKPDKACTQPISSECKIMLSKTFEACHTIFPPKPYFTVCEEASC-----------HGQDICEVIAAYVHVCRINGVCINWRTPDFCPMECPRL-MVYHHCHMGCNKECGKTLNGTLCSDSSTEGCFCPEGDVIVNGKCVNEKVCSQCTDRYGEEHQLLETWIP---TNAPCSICMCLENRMINCTAMPC-------PTVKPLTCGPCEIPRLKKTSEQCCPDYECVCDLTTCDVNPVPHCENGLVPVLTNPGHCKPNYECACRI 2347          

HSP 6 Score: 55.8398 bits (133), Expect = 9.169e-7
Identity = 67/335 (20.00%), Postives = 119/335 (35.52%), Query Frame = 2
Query:  479 HIKTFDGNVFSYPLRGGYTLFMDCLGAAPLFYVYFNASYDCFDQKTQNDCSISMKITVGTQTIILFPKNEFALVKNNKTKIPFNSEGIIVSSVGSFIKIKGIDDLEILFD----RDRNIYVYAPVTAEKKICGLCGYFNGIMSDDYRDFNQVIQKNVKTFVNSWIDRDPSDLNVYREREQYPCNALKLKNNDQYQKALTLCQDMVKNNLGRTCQSEVKIDKYLDMCQDEICECLQTQPENSTIENCYSTFCKIEEQYSYACTLKGIAVDWRSATTICKQPQCFNGQEFSECGSNCGKNCGQLGMELECESQCLPGCYCPRNRYWDGTMCVPQEKC 1471
            HI TFDG  F       Y LF D +    +  +  NA  +  + +T   C  S+++     +I+L   N    V  +   +P+ ++   V+  G  +    I  L  +F      +  +    P     +  GLCG  +    +D+   +  +  +   F+  W   D    ++ R  E  P  A         Q   + C+ M+       C +      Y  +C++  C                   C++   Y + C + G+ ++WR+    C   +C     +  C   C K CG+      C      GC+CP         CV ++ C
Sbjct: 1937 HIVTFDGLDFKLMGACSYVLFHDEVHDVKV--ILHNAECNTTNHQT---CMKSVEVKHNKYSILL-SSNMQVSVNGDIVPLPYANDNFEVTLYGEIVHEVKIPQLGFVFTFTPANNEFVLQLNPAAFSLRTSGLCGICDQNTVNDFTLSDGSVTTDSSKFIKEWTVVD----SLGRTCETKPDKACT-------QPISSECKIMLSKTF-EACHTIFPPKPYFTVCEEASCH--------------GQDICEVIAAYVHVCRINGVCINWRTP-DFCPM-ECPRLMVYHHCHMGCNKECGKTLNGTLCSDSSTEGCFCPEGDVIVNGKCVNEKVC 2237          
BLAST of von Willebrand factor vs. Ensembl Mouse
Match: Vwf (Von Willebrand factor [Source:MGI Symbol;Acc:MGI:98941])

HSP 1 Score: 514.227 bits (1323), Expect = 4.312e-149
Identity = 357/1264 (28.24%), Postives = 549/1264 (43.43%), Query Frame = 2
Query:  455 ECSVIYGHHIKTFDGNVFSYPLRGGYTLFMDCLGAAPLFYVYFNASYDCFDQKTQNDCSISMKITVGTQTIILFPKNEFALVKNNKTKIPFNSEGIIVSSVGSFIKIKG-IDDLEILFDRDRNIYVYAPVTAEKKICGLCGYFNGIMSDDYRDFNQVIQKNVKTFVNSWIDRDPSDLNVYREREQYPCNALKLKNNDQYQKALTLCQDMVKNNLGRTCQSEVKIDKYLDMCQDEICECLQTQPENSTIENCYSTFCKIEEQYSYACTLKGIAVDWRSATTICKQPQCFNGQEFSECGSNCGKNCGQLGMELECESQCLPGCYCPRNRYWDGTMCVPQEKCPCVRDNGESTYQQGYRLKLNCETCICGMHGKWQCIENEECEGRCFISGDPHYITFDRRHFFFDGHCEYTAVMTTSDNVLLSNSTIAPLSITIQNTNCQDNSETGCPRTIGVIIGEDEDQVAINLLSSSEIKVNFVKISLPYQHTGNTKVLIDQVSTDILRLKSETGVEILWNGGSRIEIKLSKKYREKVTGMCGNFNGNEMDDSMTFKGVDEKDIDKFVLSWKTNPTCESDRGIVEYKGACALSRSYSDYANKVCHKLYESEEFKKCHSAANADKFFDQCTHDVCTCGMKRNGALDHCECEAFSSYARQCALENINLSWRTNELCPKKCPNENMKYNQCGSRCTSTCRLLQ--ESKCKEECIEGCFCPEGETFDEAAKECVKISDCKCEFHGRFYLPYEIRQDRCNNCTCTNGNWICTSNDCEG---------------------------KEFCPKSMAWFDCGICQKTCTNLDLVCPKGQCQLPGCFCPENTVLHNGECIKPFECPCYMNNKMYSENDTIVRGPANCQNPCICKDGKWVCEQNKQCSGICKTWGETHYESFDGKYFEFQGSCSYVISEDFCGNKLGTFKLISENIACGXXXXXCTKSIKFIYLNRVFQFVRGSNPIVSRNTNYPPGGPTAFYWTSDVDTHFILFTMEGIQVKWDKAMSLEIMIPEKYQNKVCGLCGNFDLRIDNDMRARSGEIEKDIVNFADSWKVHSSCPVPQK-----PPFMCSKRPDREPWAKAKCEILKSDSFKKCHDVVNVEHYYKRCVADACECDRGDDCVCFCTAVEQYVARCNEYEIGLKWRTNENCPHTCTGKRVWKN----------CGNICPDSCIDIGKNVTDNTGCKKVCIEGC--FCPDG--LHWQNNECVERKACECVDPITNLKYNTGDKVI------RECEECNC 4081
             CS+     I TFD  ++S+     Y L  DC   +  F +  N          Q+   +S+ + +G    I    N      +    +P+ S+G+ +     + K+           D + N  V        K CGLCG FN    DD+R     +  +   F NSW     S      +R   P    +  + D +Q     CQ +   ++   C   V  + ++ +C+  +C C  T PE +         C +  +Y+  C  +G+ +   +  + C+ P C  G E+ EC S C + C  L +   C+ QC+ GC CP     D   CV    CPCV  +    Y  G  L  +C TCIC  +  W C  NEEC G C ++G  H+ +FD R+F F G C+Y       D+           SI I+   C D+ +  C R++ V +    + + + L     + ++   + LP+   G+ +  I       +RL     +++ W+G  R+ +KLS  Y  K  G+CGN+NGN+ DD +T  G+ E  +  F  +WK    C   R   ++   C+L+   + +A + C  L  S +F+ CH A +   +   C +DVC+C   R+     C C A ++YA +CA + +++ WR    C   CP +   Y QCG+ C  TCR L   + +C E C+EGC+CP G   DE   +CV  + C C + G  + P +I  D    C C +G   CT++   G                           K  CP          C KTC N DL C    C + GC CP   V H  +C+    CPC+     Y+  DT+  G     N C+C++ KW C  N  C   C   G  HY +FDG  + F G C YV+ +D+CG+  GTF+++  N  C   S  C K +  +      +   G   +        P    + +   +   + IL   + + V WD  +S+ +++   YQ +VCGLCGNFD   +ND    S ++E+D VNF +SWKV S C   +K      P  C     ++    + C IL SD F+ C+ +V+ E Y   C+ D C C+   DC CFC  +  Y   C ++   + WRT   CP +C  K V +N          C   CP +C        +   C   C+EGC   CP G  L      CV+ + C   + +   +   G K+         C+ C+C
Sbjct:   34 RCSLFGDDFINTFDETMYSFAGGCSYLLAGDCQKRS--FSILGN---------FQDGKRMSLSVYLGEFFDIHLFANGTVTQGDQSISMPYASQGLYLEREAGYYKLSSETFGFAARIDGNGNFQVLMSDRHFNKTCGLCGDFNIFAEDDFRTQEGTLTSDPYDFANSWAL---SSEEQRCKRASPPSRNCESSSGDMHQAMWEQCQLLKTASVFARCHPLVDPESFVALCEKILCTC-ATGPECA---------CPVLLEYARTCAQEGMVLYGWTDHSACR-PACPAGMEYKECVSPCPRTCQSLSINEVCQQQCVDGCSCPEGELLDEDRCVQSSDCPCV--HAGKRYPPGTSLSQDCNTCIC-RNSLWIC-SNEECPGECLVTGQSHFKSFDNRYFTFSGICQYLLARDCEDHT---------FSIVIETMQCADDPDAVCTRSVSVRLSALHNSL-VKLKHGGAVGIDGQDVQLPFLQ-GDLR--IQHTVMASVRLSYAEDLQMDWDGRGRLLVKLSPVYSGKTCGLCGNYNGNKGDDFLTPAGLVEPLVVDFGNAWKLQGDCSDLRR--QHSDPCSLNPRLTRFAEEAC-ALLTSSKFEACHHAVSPLPYLQNCRYDVCSCSDSRD-----CLCNAVANYAAECARKGVHIGWREPGFCALGCP-QGQVYLQCGNSCNLTCRSLSLPDEECSEVCLEGCYCPPGLYQDERG-DCVPKAQCPCYYDGELFQPADIFSDHHTMCYCEDGFMHCTTSGTLGSLLPDTVLSSPLSHRSKRSLSCRPPMVKLVCPADNPRAQGLECAKTCQNYDLECMSLGC-VSGCLCPPGMVRHENKCVALERCPCFHQGAEYAPGDTVKIG----CNTCVCRERKWNC-TNHVCDATCSAIGMAHYLTFDGLKYLFPGECQYVLVQDYCGSNPGTFQILVGNEGCSYPSVKCRKRVTILVDGGELELFDGEVNVKR------PLRDESHFEVVESGRYVILLLGQALSVVWDHHLSISVVLKHTYQEQVCGLCGNFDGIQNNDFTTSSLQVEEDPVNFGNSWKVSSQCADTRKLSLDVSPATCHNNIMKQTMVDSACRILTSDVFQGCNRLVDPEPYLDICIYDTCSCESIGDCACFCDTIAAYAHVCAQHGQVVAWRTPTLCPQSCEEKNVRENGYECEWRYNSCAPACPVTC-----QHPEPLACPVQCVEGCHAHCPPGRILDELLQTCVDPQDCPVCE-VAGRRLAPGKKITLSPDDPAHCQNCHC 1227          

HSP 2 Score: 127.102 bits (318), Expect = 1.951e-28
Identity = 90/372 (24.19%), Postives = 166/372 (44.62%), Query Frame = 2
Query: 3014 QNKQCSGICKTWGETHYESFDGKYFEFQGSCSYVISEDFCGNKLGTFKLISENIACGXXXXXCTKSIKFIYLNRVFQFVRGSNPIVSRNTNY--PPGGPTAFYWTSDVDTHFILFTMEGIQVKWDKAMSLEIMIPEKYQNKVCGLCGNFDLRIDNDMRARSGEIEKDIVNFADSWKVHSS---CPVPQKPPFMC-SKRPDREPWAKAKCEILKSDS-FKKCHDVVNVEHYYKRCVADACECDRGDDCVCFCTAVEQYVARCNEYEIGL-KWRTNENCPHTCTGKRVWKNCGNICPDSCIDIGKNVTDNTGCKKVCIEGCFCPDGLHWQNNECVERKACECVDPITNLKYNTGDKVIRECEECNCYEGAFRCT 4105
            +++  +  C  +G+    +FD   + F G CSY+++ D C  +  +F ++  N   G       +    +YL   F     +N  V++       P      Y   +   + +     G   + D   + ++++ +++ NK CGLCG+F++  ++D R + G +  D  +FA+SW + S    C     P   C S   D       +C++LK+ S F +CH +V+ E +   C    C C  G +C C    + +Y   C +  + L  W  +  C   C     +K C + CP +C    ++++ N  C++ C++GC CP+G     + CV+   C CV      +Y  G  + ++C  C C    + C+
Sbjct:   27 RDRPSTARCSLFGDDFINTFDETMYSFAGGCSYLLAGD-CQKR--SFSILG-NFQDGK------RMSLSVYLGEFFDIHLFANGTVTQGDQSISMPYASQGLYLEREAGYYKLSSETFGFAARIDGNGNFQVLMSDRHFNKTCGLCGDFNIFAEDDFRTQEGTLTSDPYDFANSWALSSEEQRCKRASPPSRNCESSSGDMHQAMWEQCQLLKTASVFARCHPLVDPESFVALCEKILCTCATGPECAC--PVLLEYARTCAQEGMVLYGWTDHSACRPACPAGMEYKECVSPCPRTC----QSLSINEVCQQQCVDGCSCPEGELLDEDRCVQSSDCPCVH--AGKRYPPGTSLSQDCNTCICRNSLWICS 380          

HSP 3 Score: 105.916 bits (263), Expect = 5.357e-22
Identity = 99/392 (25.26%), Postives = 157/392 (40.05%), Query Frame = 2
Query: 2963 ANCQNPCICKDGKWVCEQNKQCSGICKTWGETHYESFDGKYFEFQGSCSYVISEDFCGNKLGTFKLISENIACGX-XXXXCTKSIKFIYLNRVFQF-------VRGS---NPIVSRNTNYPPGGPTAFYWTSDVDTHFILFTMEGIQVKWDKAMSLEIMIPEKYQNKVCGLCGNFDLRIDNDMRARSGEIEKDIVNFADSWKVHSSCPVPQKPPFMCSKRPDRE-PWA-KAKCEILKSDSFKKCHDVVNVEHYYKRCVADACECDRGDDCVCFCTAVEQYVARCNEYEIGLKWRTNENCPHTCTGKRVWKNCGNICPDSCIDIGKNVTDNTGCKKVCIEGCFCPDGLHWQNNECVERKAC-ECV--DPITNLKYNTGDKVIRECEECNCYEG 4090
            AN Q+P   ++    C     C  +C      H  +FDG+ F+  GSCSYVI +    NK    +++  N AC   +  +C KSI+  +     +        V G     P V  N      G   +        H + +T +  + +         + P+ + +K+ GLCG  D    ND   R G +  D       W V       Q+P + C   P+ + P +  + C++L S SF +CH V+    ++  C  D+C  +R       C  +  Y   C    + + WRT + C  +C    V+ +C   CP  C        + + C     EGCFCP    +    CV  +AC +CV  D + +    T     + C+ C C  G
Sbjct: 1928 ANSQSPVRVEE---TCGCRWTCPCVCTGSSTRHIVTFDGQNFKLTGSCSYVIFQ----NKEQDLEVLLHNGACSPGAKQACMKSIEIKHAGVSAELHSNMEMAVDGRLVLAPYVGENMEVSIYGAIMYEVRFTHLGHILTYTPQNNEFQLQ-------LSPKTFASKMHGLCGICDENGANDFTLRDGTVTTDWKRLVQEWTV-------QQPGYTCQAVPEEQCPVSDSSHCQVLLSASFAECHKVIAPATFHTICQQDSCHQER------VCEVIASYAHLCRTSGVCVDWRTTDFCAMSCPPSLVYNHCERGCPRHCDG------NTSFCGDHPSEGCFCPQHQVFLEGSCVPEEACTQCVGEDGVRHQFLETWVPDHQPCQICMCLSG 2286          

HSP 4 Score: 93.2041 bits (230), Expect = 3.697e-18
Identity = 116/461 (25.16%), Postives = 176/461 (38.18%), Query Frame = 2
Query: 1601 CFISGDPHYITFDRRHFFFDGHCEYTAVMTTSDNVLLSNSTIAPLSITIQNTNCQDNSETGCPRTIGVIIGEDEDQVAINLLSSSEIKVNFVKISLPYQHTGNTKVLIDQVSTDILRLKSETGVEILWNGGSRIEIKLSKK-YREKVTGMCGNFNGNEMDDSMTFKGVDEKDIDKFVLSWKTNPTCESDRGIVEYKGACALSRSYSDYANKVCHKLYESEEFKKCHSAANADKFFDQCTHDVCTCGMKRNGALDHCECEAFSSYARQCALENINLSWRTNELCPKKCPNENMKYNQCGSRCTSTCRLLQESKCKEECIEGCFCPEGETF-------DEAAKECVKISDCKCEFHGRFYLPYEIRQDRCNNCTCTNGNWI-CTSNDCEGKEFCPKSMAWFDCGICQ----KTCTNL-----DLVCPKGQCQLP------GCFCPENTVLHNGECIKPFECPC 2911
            C  S   H +TFD ++F   G C Y        +          L + + N  C   ++  C ++I +        V+  L S+ E+ V+   +  PY    N +V I       +R      +       +  +++LS K +  K+ G+CG  + N  +D     G    D  + V  W       + + + E +  C +S S        C  L  S  F +CH       F   C  D  +C  +R        CE  +SYA  C    + + WRT + C   CP  ++ YN C   C   C     S C +   EGCFCP+ + F       +EA  +CV     + +F   +   ++     C  C C +G  I CT+        CP + A   CG C+    K  TNL     + VC    C LP      G   P  T+ + GEC   F C C
Sbjct: 1950 CTGSSTRHIVTFDGQNFKLTGSCSYVIFQNKEQD----------LEVLLHNGACSPGAKQACMKSIEI----KHAGVSAELHSNMEMAVDGRLVLAPYVGE-NMEVSIYGAIMYEVRFTHLGHILTYTPQNNEFQLQLSPKTFASKMHGLCGICDENGANDFTLRDGTVTTDWKRLVQEWTVQQPGYTCQAVPEEQ--CPVSDSSH------CQVLL-SASFAECHKVIAPATFHTICQQD--SCHQER-------VCEVIASYAHLCRTSGVCVDWRTTDFCAMSCP-PSLVYNHCERGCPRHCD-GNTSFCGDHPSEGCFCPQHQVFLEGSCVPEEACTQCVGEDGVRHQFLETWVPDHQ----PCQICMCLSGRKINCTAQP------CPTARAP-TCGPCEVARLKQSTNLCCPEYECVCDLFNCNLPPVPPCEGGLQP--TLTNPGECRPTFTCAC 2362          

HSP 5 Score: 60.8474 bits (146), Expect = 2.213e-8
Identity = 76/350 (21.71%), Postives = 128/350 (36.57%), Query Frame = 2
Query:  479 HIKTFDGNVFSYPLRGGYTLFMDCLGAAPLFYVYFNASYDCFDQKTQNDCSISMKITVGTQTIILFPKNEFALVKNNKTKIPFNSEGIIVSSVGSFIKIKGIDDLEILFDRDRNIYVY-----------APVTAEKKICGLCGYFNGIMSDDYRDFNQVIQKNVKTFVNSWIDRDPSDLNVYREREQYPCNALKLKNNDQYQKALTLCQDMVKNNLGRTCQSEVKIDKYLDMCQDEICECLQTQPENSTIENCYSTFCKIEEQYSYACTLKGIAVDWRSATTICKQPQCFNGQEFSECGSNCGKNCGQLGMELECESQCLPGCYCPRNRYWDGTMCVPQEKCP-CVRDNG 1492
            HI TFDG  F       Y +F +      L  +  N +        +  C  S++I     +  L    E A V       P+  E + VS  G+ +        E+ F    +I  Y           +P T   K+ GLCG  +   ++D+   +  +  + K  V  W  + P           Y C A+  +         + CQ ++  +    C   +    +  +CQ + C                   C++   Y++ C   G+ VDWR+ T  C    C     ++ C   C ++C   G    C      GC+CP+++ +    CVP+E C  CV ++G
Sbjct: 1957 HIVTFDGQNFKLTGSCSYVIFQN--KEQDLEVLLHNGA---CSPGAKQACMKSIEIKHAGVSAELHSNMEMA-VDGRLVLAPYVGENMEVSIYGAIM-------YEVRFTHLGHILTYTPQNNEFQLQLSPKTFASKMHGLCGICDENGANDFTLRDGTVTTDWKRLVQEWTVQQPG----------YTCQAVPEEQCPVSDS--SHCQVLLSASFAE-CHKVIAPATFHTICQQDSCH--------------QERVCEVIASYAHLCRTSGVCVDWRT-TDFCAM-SCPPSLVYNHCERGCPRHCD--GNTSFCGDHPSEGCFCPQHQVFLEGSCVPEEACTQCVGEDG 2262          
BLAST of von Willebrand factor vs. Ensembl Mouse
Match: Muc5ac (mucin 5, subtypes A and C, tracheobronchial/gastric [Source:MGI Symbol;Acc:MGI:104697])

HSP 1 Score: 489.96 bits (1260), Expect = 4.530e-141
Identity = 372/1281 (29.04%), Postives = 563/1281 (43.95%), Query Frame = 2
Query:  413 AVTRVNNTMYSTYYECSVIYGHHIKTFDGNVFSYPLRGGYTLFMDCLGAAPLFYVYFNASYDCFDQKTQNDCSISMKITVGTQTIILFPKNEFALVKNNKTKIPFNSEGIIVSSVGSFIKIKGIDDLEILFDRDRNIYVYAPVTAEKKICGLCGYFNGIMSDDYRDFNQVIQKNVKTFVNSWIDRDPSDLNVYREREQYPCNALKLKNNDQYQKALTLCQDMVKNNLGRTCQSEVKIDKYLDMCQDEICECLQTQPENSTIENCYSTFCKIEEQYSYACT-LKGIAVDWRSATTICKQPQCFNGQEFSECGSNCGKNCGQLGMELECESQCLPGCYCPRNRYWDG---TMCVPQEKCPCVRDNGESTYQQGYRLKLNCETCICGMHGKWQCIENEECEGRCFISGDPHYITFDRRHFFFDGHCEYTAVMTTSDNVLLSNSTIAPLSITIQNTNCQDNSETGCPRTIGVIIGEDEDQVAINLLSSSEIKVNFVKISLPYQHTGNTKVLIDQVSTDILRLKSETGV--EILWNGGSRIEIKLSKKYREKVTGMCGNFNGNEMDDSMTFKGVDEKDIDKFVLSWKTNPTCESDRGIVEYKGACALSRSYSDYANKVCHKLY-ESEEFKKCHSAANADKFFDQCTHDVCTCGMKRNGALDHCECEAFSSYARQCALENINLS-WRTNELCPKK---CPNENMKYNQCGSRCTSTCRLLQESKCKEEC----IEGCFCPEGETFDEAAKECVKISDCKCEFHGRFYLPYEIRQDRCNNCTCTNGNWICTSNDCEGKEFCPKSMAWFDC---------GICQKTCTNLDLVCPKGQCQLPGCFCPENTVLH-NGECIKPFECPCYMNNKMYSENDTIVRGPANCQNPCICKDGKWVCEQNKQCSGICKTWGETHYESFDGKYFEFQGSCSYVISEDFCGNKLGT---FKLISENIACGXXXXXCTKSIKFIYLNRVFQFVRGSNPIVSRNTNYPPGGPTAFYWTSDVDTHFILFTMEGIQVKWDKAMSLEIMIPEKYQNKVCGLCGNFDLRIDNDMRARSGEIEKDIVNFADSWKVHSSCP---VPQKPPFMCSKRPDREPWAKAKCEILKSDSFKKCHDVVNVEHYYKRCVADACECDRGDDCVCFCTAVEQYVARCNEYEIGLKWRTNENCPHTC-----TGKRVW--KNCGNICPDSCID-IGKNVTDNTGCKKVCIEGCF--CP-------DGLHWQNNECVERKACECVDPITNLKYNTGDKVI--RECEECNCYEGAFRCT 4105
             V R  N  + T   CS     H KTFDG VF +P    Y     C  A    Y  FN       +  +++ +   ++T+    +++       LV N+  ++PF+  G+++     ++K+     L  +++ D ++ +        K CGLCG FNG         N+ +  NV+     + +    D    + ++  P   +  KN         +C+ ++K  L   C + V I  Y++ C+ ++C C    P +          C    +YS  C    G   DWR    +C Q  C    +  ECGS C   C        CE  C+ GC+CP     D      CVP  +C C+ +   + Y  G     +C  C C   G+W C ++  C G C + G  H  TFD R +   G C Y        N           ++ ++   C       C +T+ + +G  + ++ +   ++ E+ VN +   LP   T N      + ST  +  ++  G+  EI  +   +  ++L    R    G+CGNFN  + DD  T  GV E     F  ++KT   C + + I  ++  C+LS     YA   C  L   S  F +CH+  N   FF  C +D C C    +     C C A SSY R CA + + LS WR + +C K    CP ++M Y    S C  TCR L E           ++GC CP+G   D+  K CV+ + C C + G      E  QD    CTCT G   C          C   M +FDC           CQK+C  LD+ C   +C +PGC CP   V   NG C+   +CPC  N   Y   +TI  G   C N C C++  W C  +K C   C  +G+ HY +FDG+ + F G C Y + +D CG    +   F++I+ENI CG++ ++C+KSIK    N   +       +V ++    P      Y+   +  + ++ T  G+ + WDK  S+ + +  +++ +VCGLCGNFD    ND   RS  +  D++ F +SWK+  SCP   VP+ P   C+  P R+ WA+ +C I+ S++F  CH  V    YY+ CV DAC CD G DC CFCT V  Y   C+E  + + WRT + CP  C      G+  W  + CG  C  +C +  G+ + D  G     +EGC+  CP       +G     + C     C     +    Y  G  V   + C+ C C E   RCT
Sbjct:   66 PVVRAFNPGH-TRRVCSTWGNFHYKTFDGQVFYFPGLCNYVFSAHCGDA----YEDFNIQ---LRRVQESNTTTLSRVTMKLDGLVVELTKSSVLVNNHPVQLPFSQSGVLIELSNGYLKVVARLGLLFVWNEDDSLLLELDTKYTNKTCGLCGDFNGSPKS-----NEFLSNNVRLTPLEFGNLQKMDGPTEQCQDPLP---VPQKNCSARSG---ICEMILKGELFSGCAALVDISSYVEACRQDVCLCESLDPSDC--------ICHTLAEYSRQCAHAGGQPQDWR-GPNLCSQ-TCPLNMQHQECGSPCVDTCSNPQHSQVCEDHCIAGCFCPEGMVLDDINQMGCVPVSQCACLYNG--TLYAPGTNYSTDCTKCTCS-GGQWSC-QDIPCAGTCSVMGGSHMSTFDGRQYTVHGDCTYVLSKPCDSNAF---------TVLVELRKCGLTESETCLKTVTLNLGGGQTEIMVK--ATGEVFVNQIYTQLPVS-TANATFF--RPSTFFIVGETNLGLQLEIQLSPIMQTSVRLKPGLRGLTCGLCGNFNSMQADDFQTISGVVEGTAAAFFNTFKTQAACPNVKNI--FQDPCSLSVENEKYAQHWCSLLTNASGPFSQCHATVNPSTFFSNCMYDTCNCEKSED-----CMCAALSSYVRACAAKGVLLSDWR-DGICTKPTITCP-KSMTYQYHISTCQPTCRALNEKDVTCHVSFIPVDGCTCPKGTFLDDLGK-CVQATSCPCYYKGSTVPNGESVQDSGAICTCTQGALTCIGGPAP-TPVCDAPMIYFDCHNATPGDTGAGCQKSCHTLDMTCYSSEC-VPGCVCPNGLVADGNGGCVVTEDCPCVHNEATYRPGETIQVG---CNN-CTCENRMWQCT-DKPCLATCAVYGDGHYITFDGQRYSFNGDCEYTLLQDNCGGNGSSQDAFRVITENIPCGTTGTTCSKSIKIFLGNYELKLSDSKMEVVQKDVGQEPP-----YFVHQMGNYLVVETDIGLVLLWDKKTSIFLRLSPEFKGRVCGLCGNFDDNAINDFTTRSQSVVSDMLEFGNSWKLSPSCPDVLVPKDP---CTANPYRKSWAQKQCSIINSETFSACHAHVEPAKYYEACVNDACACDSGGDCECFCTTVAAYAQACHEVGVCVSWRTPDICPLFCDYYNPEGQCEWHYQPCGAPCMRTCQNPTGQCLQDLRG-----LEGCYPKCPPTAPIFDEGTMQCVSNCTVTFPCR----VNGKLYRPGASVPSDKNCDSCICTESGVRCT 1265          

HSP 2 Score: 201.06 bits (510), Expect = 6.184e-51
Identity = 147/503 (29.22%), Postives = 240/503 (47.71%), Query Frame = 2
Query: 1280 SATTICKQPQCF---NGQEFSECGSNCGKNCGQLGMELECESQCLPGCYCPRNRYWDGTM-CVPQEKCPCVRDNGESTYQQGYRLKLNCETCICGMHGKWQCIENEECEGRCFISGDPHYITFDRRHFFFDGHCEYTAVMTTSDNVLLSNSTIAPLSITIQNTNCQDNSETGCPRTIGVIIGEDEDQVAINLLSSSEIKVNFVKISLPYQHTGNTKVLIDQVSTDILRLKSETGVEILWNGGSRIEIKLSKKYREKVTGMCGNFNGNEMDDSMTFKGVDEKDIDKFVLSWKTNPTCESDRGIVEYKGACALSRSYSDYANKVCHKLYESEEFKKCHSAANADKFFDQCTHDVCTCGMKRNGALDHCECEAFSSYARQCALENINLSWRTNELCPKKCPNENMK------YNQCGSRCTSTCR-----LLQESKCKEECIEGCFCPEGETFDEAAKECVKISDC----KCEFHGRFYLP-YEIRQDR-CNNCTCTNGNWICTSN 2725
            + T +C  P  +   +     + G+ C K+C  L M     S+C+PGC CP     DG   CV  E CPCV +  E+TY+ G  +++ C  C C  +  WQC + + C   C + GD HYITFD + + F+G CEYT +    DN   + S+     +  +N  C   + T C ++I + +G            + E+K++  K+ +  +  G           + L ++++ G+ +LW+  + I ++LS +++ +V G+CGNF+ N ++D  T       D+ +F  SWK +P+C     ++  K  C  +     +A K C  +  SE F  CH+     K+++ C +D C C    +G    C C   ++YA+ C    + +SWRT ++CP  C   N +      Y  CG+ C  TC+      LQ+ +  E C   C  P    FDE   +CV  S+C     C  +G+ Y P   +  D+ C++C CT     CT N
Sbjct:  796 APTPVCDAPMIYFDCHNATPGDTGAGCQKSCHTLDMTCY-SSECVPGCVCPNGLVADGNGGCVVTEDCPCVHN--EATYRPGETIQVGCNNCTC-ENRMWQCTD-KPCLATCAVYGDGHYITFDGQRYSFNGDCEYTLLQ---DNCGGNGSSQDAFRVITENIPC-GTTGTTCSKSIKIFLG------------NYELKLSDSKMEVVQKDVGQEPPYFVHQMGNYLVVETDIGLVLLWDKKTSIFLRLSPEFKGRVCGLCGNFDDNAINDFTTRSQSVVSDMLEFGNSWKLSPSCPD---VLVPKDPCTANPYRKSWAQKQC-SIINSETFSACHAHVEPAKYYEACVNDACAC---DSGGDCECFCTTVAAYAQACHEVGVCVSWRTPDICPLFCDYYNPEGQCEWHYQPCGAPCMRTCQNPTGQCLQDLRGLEGCYPKCP-PTAPIFDEGTMQCV--SNCTVTFPCRVNGKLYRPGASVPSDKNCDSCICTESGVRCTHN 1267          

HSP 3 Score: 113.62 bits (283), Expect = 2.411e-24
Identity = 113/427 (26.46%), Postives = 172/427 (40.28%), Query Frame = 2
Query: 3008 CEQNKQCSGICKTWGETHYESFDGKYFEFQGSCSYVISEDFCGNKLGTFKLISENIACGXX-XXXCTKSIKFIYLNRVFQFVRG------SNPIVSRNTNYPPGGPTAFYWTSDVDTHFILFTME-GIQVKWDKAMSLEIMIP-EKYQNKVCGLCGNFDLRIDNDMRARSGEIEKDIVNFADSWKVHSSCPVPQKPP---------FMCSKRPDREPWAKAKCEILKSDSFKKCHDVVNVEHYYKRCVADACECDRGDDCVCFCTAVEQYVARCNEYEIGLKWR--TNENCPHTCTGKRVWKNCGNICPDSCI---DIGKNVTDNTGCKKVCIEGCFCPDGLH-WQNNECVERKACE-CVDPITNLKYNTGDKVIRECEECNCYEGAFRCTKLFSKECLHTSRPEISTKPPHCVNEYEFLCPNNFCA 4213
            C Q+ QC  +C  WG+ HY +FDG Y+ F  +C+YV+ +       G F+++ +N  C    S SC +SI   Y        R       +N I+  N    PG       TS V     +   E G++V +   +   + +P   + N   G CG       ++ R   G I       +  WK      VP +P           +  +           CE++ S++FK CHDV+    +Y+ C+ D C      D    C+ +E Y + C    + + WR  TN  C  TC   +V++ CG   P  C     I  ++T      K   EGCFCPD    +  N+ +   +C+ C+ P        G  +  +C++C C E    C K   K C   + PE    P     E    CP   CA
Sbjct: 2735 CCQHYQCQCVCSGWGDPHYITFDGTYYTFLDNCTYVLVQQIV-PVFGYFRVLIDNYYCDVGDSVSCPQSIIVEYHQDRVVLTRRPVSGVMTNQIIFNNKVVSPGFQQNGIVTSRVGIKMYVTIQEIGVRVMF-SGLIFSVEVPFNLFANNTEGQCGTCTNDKKDECRLPGGSIASSCSEMSLHWK------VPNQPSCQGPPPTPTSVVPRPSPTPCPPSPLCELILSNTFKLCHDVIPPLQFYQGCLFDYCHM---LDLEVVCSGLELYASLCAAQGVCIPWRSQTNNTCSFTCPDNQVYQPCGPSNPHYCYRDDSISPSLTLQEAGPKT--EGCFCPDSTTLFSTNDSICVPSCQWCLGP-RGEPVEPGHTISIDCQDCICKEATLTCQK---KACPQPTCPEPGFVPVPVALEAGQCCPQFSCA 3144          

HSP 4 Score: 92.4337 bits (228), Expect = 6.751e-18
Identity = 120/496 (24.19%), Postives = 175/496 (35.28%), Query Frame = 2
Query: 1571 CIENEECEGRCFISGDPHYITFDRRHFFFDGHCEYTAVMTTSDNVLLSNSTIAPL----SITIQNTNCQDNSETGCPRTIGVIIGEDEDQVAINLLSSSEIKVNFV-----KISLPYQHTGNTKVLIDQVSTDILRLKSETGVEILWNGGS-RIEIKLSKKYREKVTGMCGNFNGNEMDDSMTFKGVDEKDIDKFVLSWKTNPTCESDRGIVEYKGACALSRSYSDYANKVCHKLYESEEFKKCHSAANADKFFDQCTHDVCTCGMKRNGALD-HCECEAFSSYARQCALENINLSWR--TNELCPKKCPNENMKYNQCGSRCTSTC---------RLLQESKCKEECIEGCFCPEGET-FDEAAKECVKISDCKCEFHGRFYLPYEIRQDRCNNCTCTNGNWICTSNDCEGKE-----FCPKSMAWFDCGICQKTCTNLDLVCPKGQCQLPGCFCPENTVL----HNGECIKPFECP----CYMNNKMYSENDTI 2950
            C ++ +C+  C   GDPHYITFD  ++ F  +C Y  V             I P+     + I N  C       CP++I  I+   +D+V +     S +  N +      +S  +Q  G   ++  +V   +     E GV ++++G    +E+  +  +     G CG    ++ D+     G       +  L WK  P   S +G      +     S +        +L  S  FK CH      +F+  C  D C         LD    C     YA  CA + + + WR  TN  C   CP +N  Y  CG      C           LQE+  K    EGCFCP+  T F      CV          G    P       C +C C      C    C         F P  +A  + G C   C      C    C  P   CP+N+ L      G C     C     C +N  +Y   D +
Sbjct: 2735 CCQHYQCQCVCSGWGDPHYITFDGTYYTFLDNCTYVLVQ-----------QIVPVFGYFRVLIDNYYCDVGDSVSCPQSI--IVEYHQDRVVLTRRPVSGVMTNQIIFNNKVVSPGFQQNG---IVTSRVGIKMYVTIQEIGVRVMFSGLIFSVEVPFN-LFANNTEGQCGTCTNDKKDECRLPGGSIASSCSEMSLHWKV-PNQPSCQGPPPTPTSVVPRPSPTPCPPSPLCELILSNTFKLCHDVIPPLQFYQGCLFDYC-------HMLDLEVVCSGLELYASLCAAQGVCIPWRSQTNNTCSFTCP-DNQVYQPCGPSNPHYCYRDDSISPSLTLQEAGPK---TEGCFCPDSTTLFSTNDSICVPSCQWCLGPRGEPVEPGHTISIDCQDCICKEATLTCQKKACPQPTCPEPGFVPVPVA-LEAGQC---CPQFSCACNSSHCP-PPLHCPKNSSLIVTYEEGACCPTQNCSSQKGCEVNGTLYQPGDVV 3196          
BLAST of von Willebrand factor vs. Ensembl Mouse
Match: Muc5ac (mucin 5, subtypes A and C, tracheobronchial/gastric [Source:MGI Symbol;Acc:MGI:104697])

HSP 1 Score: 486.108 bits (1250), Expect = 6.431e-140
Identity = 371/1281 (28.96%), Postives = 562/1281 (43.87%), Query Frame = 2
Query:  416 VTRVNNTMYSTYYECSVIYGHHIKTFDGNVFSYPLRGGYTLFMDCLGAAPLFYVYFNASYDCFDQKTQNDCSISMKITVGTQTIILFPKNEFALVKNNKTKIPFNSEGIIVSSVGSFIKIKGIDDLEILFDRDRNIYVYAPVTAEKKICGLCGYFNGIMSDDYRDFNQVIQKNVKTFVNSWIDRDPSDLNVYREREQYPCNALKLKNNDQYQKALTLCQDMVKNNLGRTCQSEVKIDKYLDMCQDEICECLQTQPENSTIENCYSTFCKIEEQYSYACT-LKGIAVDWRSATTICKQPQCFNGQEFSECGSNCGKNCGQLGMELECESQCLPGCYCPRNRYWDG---TMCVPQEKCPCVRDNGESTYQQGYRLKLNCETCICGMHGKWQCIENEECEGRCFISGDPHYITFDRRHFFFDGHCEYTAVMTTSDNVLLSNSTIAPLSITIQNTNCQDNSETGCPRTIGVIIGEDEDQVAINLLSSSEIKVNFVKISLPYQHTGNTKVLIDQVSTDILRLKSETGV--EILWNGGSRIEIKLSKKYREKVTGMCGNFNGNEMDDSMTFKGVDEKDIDKFVLSWKTNPTCESDRGIVEYKGACALSRSYSDYANKVCHKLY-ESEEFKKCHSAANADKFFDQCTHDVCTCGMKRNGALDHCECEAFSSYARQCALENINLS-WRTNELCPKK---CPNENMKYNQCGSRCTSTCRLLQESKCKEEC----IEGCFCPEGETFDEAAKECVKISDCKCEFHGRFYLPYEIRQDRCNNCTCTNGNWICTSNDCEGKEFCPKSMAWFDC---------GICQKTCTNLDLVCPKGQCQLPGCFCPENTVLH-NGECIKPFECPCYMNNKMYSENDTIVRGPANCQNPCICKDGKWVCEQNKQCSGICKTWGETHYESFDGKYFEFQGSCSYVISEDFCGNKLGT---FKLISENIACGXXXXXCTKSIKFIYLNRVFQFVRGSNPIVSRNTNYPPGGPTAFYWTSDVDTHFILFTMEGIQVKWDKAMSLEIMIPEKYQNKVCGLCGNFDLRIDNDMRARSGEIEKDIVNFADSWKVHSSCP---VPQKPPFMCSKRPDREPWAKAKCEILKSDSFKKCHDVVNVEHYYKRCVADACECDRGDDCVCFCTAVEQYVARCNEYEIGLKWRTNENCPHTC-----TGKRVW--KNCGNICPDSCID-IGKNVTDNTGCKKVCIEGCF--CP-------DGLHWQNNECVERKACECVDPITNLKYNTGDKVI--RECEECNCYEGAFRCTK 4108
            V R  N  + T   CS     H KTFDG VF +P    Y     C  A    Y  FN       +  +++ +   ++T+    +++       LV N+  ++PF+  G+++     ++K+     L  +++ D ++ +        K CGLCG FNG         N+ +  NV+     + +    D    + ++  P   +  KN         +C+ ++K  L   C + V I  Y++ C+ ++C C    P +          C    +YS  C    G   DWR    +C Q  C    +  ECGS C   C        CE  C+ GC+CP     D      CVP  +C C+ +   + Y  G     +C     G  G+W C ++  C G C + G  H  TFD R +   G C Y        N           ++ ++   C       C +T+ + +G  + ++ +   ++ E+ VN +   LP   T N      + ST  +  ++  G+  EI  +   +  ++L    R    G+CGNFN  + DD  T  GV E     F  ++KT   C + + I  ++  C+LS     YA   C  L   S  F +CH+  N   FF  C +D C C    +     C C A SSY R CA + + LS WR + +C K    CP ++M Y    S C  TCR L E           ++GC CP+G   D+  K CV+ + C C + G      E  QD    CTCT G   C          C   M +FDC           CQK+C  LD+ C   +C +PGC CP   V   NG C+   +CPC  N   Y   +TI  G   C N C C++  W C  +K C   C  +G+ HY +FDG+ + F G C Y + +D CG    +   F++I+ENI CG++ ++C+KSIK    N   +       +V ++    P      Y+   +  + ++ T  G+ + WDK  S+ + +  +++ +VCGLCGNFD    ND   RS  +  D++ F +SWK+  SCP   VP+ P   C+  P R+ WA+ +C I+ S++F  CH  V    YY+ CV DAC CD G DC CFCT V  Y   C+E  + + WRT + CP  C      G+  W  + CG  C  +C +  G+ + D  G     +EGC+  CP       +G     + C     C     +    Y  G  V   + C+ C C E   RCT 
Sbjct:   67 VVRAFNPGH-TRRVCSTWGNFHYKTFDGQVFYFPGLCNYVFSAHCGDA----YEDFNIQ---LRRVQESNTTTLSRVTMKLDGLVVELTKSSVLVNNHPVQLPFSQSGVLIELSNGYLKVVARLGLLFVWNEDDSLLLELDTKYTNKTCGLCGDFNGSPKS-----NEFLSNNVRLTPLEFGNLQKMDGPTEQCQDPLP---VPQKNCSARSG---ICEMILKGELFSGCAALVDISSYVEACRQDVCLCESLDPSDC--------ICHTLAEYSRQCAHAGGQPQDWR-GPNLCSQ-TCPLNMQHQECGSPCVDTCSNPQHSQVCEDHCIAGCFCPEGMVLDDINQMGCVPVSQCACLYNG--TLYAPGTNYSTDCTNTCSG--GQWSC-QDIPCAGTCSVMGGSHMSTFDGRQYTVHGDCTYVLSKPCDSNAF---------TVLVELRKCGLTESETCLKTVTLNLGGGQTEIMVK--ATGEVFVNQIYTQLPVS-TANATFF--RPSTFFIVGETNLGLQLEIQLSPIMQTSVRLKPGLRGLTCGLCGNFNSMQADDFQTISGVVEGTAAAFFNTFKTQAACPNVKNI--FQDPCSLSVENEKYAQHWCSLLTNASGPFSQCHATVNPSTFFSNCMYDTCNCEKSED-----CMCAALSSYVRACAAKGVLLSDWR-DGICTKPTITCP-KSMTYQYHISTCQPTCRALNEKDVTCHVSFIPVDGCTCPKGTFLDDLGK-CVQATSCPCYYKGSTVPNGESVQDSGAICTCTQGALTCIGGPAP-TPVCDAPMIYFDCHNATPGDTGAGCQKSCHTLDMTCYSSEC-VPGCVCPNGLVADGNGGCVVTEDCPCVHNEATYRPGETIQVG---CNN-CTCENRMWQCT-DKPCLATCAVYGDGHYITFDGQRYSFNGDCEYTLLQDNCGGNGSSQDAFRVITENIPCGTTGTTCSKSIKIFLGNYELKLSDSKMEVVQKDVGQEPP-----YFVHQMGNYLVVETDIGLVLLWDKKTSIFLRLSPEFKGRVCGLCGNFDDNAINDFTTRSQSVVSDMLEFGNSWKLSPSCPDVLVPKDP---CTANPYRKSWAQKQCSIINSETFSACHAHVEPAKYYEACVNDACACDSGGDCECFCTTVAAYAQACHEVGVCVSWRTPDICPLFCDYYNPEGQCEWHYQPCGAPCMRTCQNPTGQCLQDLRG-----LEGCYPKCPPTAPIFDEGTMQCVSNCTVTFPCR----VNGKLYRPGASVPSDKNCDSCICTESGVRCTH 1265          

HSP 2 Score: 201.83 bits (512), Expect = 3.710e-51
Identity = 147/503 (29.22%), Postives = 240/503 (47.71%), Query Frame = 2
Query: 1280 SATTICKQPQCF---NGQEFSECGSNCGKNCGQLGMELECESQCLPGCYCPRNRYWDGTM-CVPQEKCPCVRDNGESTYQQGYRLKLNCETCICGMHGKWQCIENEECEGRCFISGDPHYITFDRRHFFFDGHCEYTAVMTTSDNVLLSNSTIAPLSITIQNTNCQDNSETGCPRTIGVIIGEDEDQVAINLLSSSEIKVNFVKISLPYQHTGNTKVLIDQVSTDILRLKSETGVEILWNGGSRIEIKLSKKYREKVTGMCGNFNGNEMDDSMTFKGVDEKDIDKFVLSWKTNPTCESDRGIVEYKGACALSRSYSDYANKVCHKLYESEEFKKCHSAANADKFFDQCTHDVCTCGMKRNGALDHCECEAFSSYARQCALENINLSWRTNELCPKKCPNENMK------YNQCGSRCTSTCR-----LLQESKCKEECIEGCFCPEGETFDEAAKECVKISDC----KCEFHGRFYLP-YEIRQDR-CNNCTCTNGNWICTSN 2725
            + T +C  P  +   +     + G+ C K+C  L M     S+C+PGC CP     DG   CV  E CPCV +  E+TY+ G  +++ C  C C  +  WQC + + C   C + GD HYITFD + + F+G CEYT +    DN   + S+     +  +N  C   + T C ++I + +G            + E+K++  K+ +  +  G           + L ++++ G+ +LW+  + I ++LS +++ +V G+CGNF+ N ++D  T       D+ +F  SWK +P+C     ++  K  C  +     +A K C  +  SE F  CH+     K+++ C +D C C    +G    C C   ++YA+ C    + +SWRT ++CP  C   N +      Y  CG+ C  TC+      LQ+ +  E C   C  P    FDE   +CV  S+C     C  +G+ Y P   +  D+ C++C CT     CT N
Sbjct:  795 APTPVCDAPMIYFDCHNATPGDTGAGCQKSCHTLDMTCY-SSECVPGCVCPNGLVADGNGGCVVTEDCPCVHN--EATYRPGETIQVGCNNCTC-ENRMWQCTD-KPCLATCAVYGDGHYITFDGQRYSFNGDCEYTLLQ---DNCGGNGSSQDAFRVITENIPC-GTTGTTCSKSIKIFLG------------NYELKLSDSKMEVVQKDVGQEPPYFVHQMGNYLVVETDIGLVLLWDKKTSIFLRLSPEFKGRVCGLCGNFDDNAINDFTTRSQSVVSDMLEFGNSWKLSPSCPD---VLVPKDPCTANPYRKSWAQKQC-SIINSETFSACHAHVEPAKYYEACVNDACAC---DSGGDCECFCTTVAAYAQACHEVGVCVSWRTPDICPLFCDYYNPEGQCEWHYQPCGAPCMRTCQNPTGQCLQDLRGLEGCYPKCP-PTAPIFDEGTMQCV--SNCTVTFPCRVNGKLYRPGASVPSDKNCDSCICTESGVRCTHN 1266          

HSP 3 Score: 114.775 bits (286), Expect = 9.533e-25
Identity = 113/427 (26.46%), Postives = 172/427 (40.28%), Query Frame = 2
Query: 3008 CEQNKQCSGICKTWGETHYESFDGKYFEFQGSCSYVISEDFCGNKLGTFKLISENIACGXX-XXXCTKSIKFIYLNRVFQFVRG------SNPIVSRNTNYPPGGPTAFYWTSDVDTHFILFTME-GIQVKWDKAMSLEIMIP-EKYQNKVCGLCGNFDLRIDNDMRARSGEIEKDIVNFADSWKVHSSCPVPQKPP---------FMCSKRPDREPWAKAKCEILKSDSFKKCHDVVNVEHYYKRCVADACECDRGDDCVCFCTAVEQYVARCNEYEIGLKWR--TNENCPHTCTGKRVWKNCGNICPDSCI---DIGKNVTDNTGCKKVCIEGCFCPDGLH-WQNNECVERKACE-CVDPITNLKYNTGDKVIRECEECNCYEGAFRCTKLFSKECLHTSRPEISTKPPHCVNEYEFLCPNNFCA 4213
            C Q+ QC  +C  WG+ HY +FDG Y+ F  +C+YV+ +       G F+++ +N  C    S SC +SI   Y        R       +N I+  N    PG       TS V     +   E G++V +   +   + +P   + N   G CG       ++ R   G I       +  WK      VP +P           +  +           CE++ S++FK CHDV+    +Y+ C+ D C      D    C+ +E Y + C    + + WR  TN  C  TC   +V++ CG   P  C     I  ++T      K   EGCFCPD    +  N+ +   +C+ C+ P        G  +  +C++C C E    C K   K C   + PE    P     E    CP   CA
Sbjct: 2031 CCQHYQCQCVCSGWGDPHYITFDGTYYTFLDNCTYVLVQQIV-PVFGYFRVLIDNYYCDVGDSVSCPQSIIVEYHQDRVVLTRRPVSGVMTNQIIFNNKVVSPGFQQNGIVTSRVGIKMYVTIQEIGVRVMF-SGLIFSVEVPFNLFANNTEGQCGTCTNDKKDECRLPGGSIASSCSEMSLHWK------VPNQPSCQGPPPTPTSVVPRPSPTPCPPSPLCELILSNTFKLCHDVIPPLQFYQGCLFDYC---HMLDLEVVCSGLELYASLCAAQGVCIPWRSQTNNTCSFTCPDNQVYQPCGPSNPHYCYRDDSISPSLTLQEAGPKT--EGCFCPDSTTLFSTNDSICVPSCQWCLGP-RGEPVEPGHTISIDCQDCICKEATLTCQK---KACPQPTCPEPGFVPVPVALEAGQCCPQFSCA 2440          

HSP 4 Score: 93.5893 bits (231), Expect = 2.419e-18
Identity = 118/492 (23.98%), Postives = 172/492 (34.96%), Query Frame = 2
Query: 1571 CIENEECEGRCFISGDPHYITFDRRHFFFDGHCEYTAVMTTSDNVLLSNSTIAPLSITIQNTNCQDNSETGCPRTIGVIIGEDEDQVAINLLSSSEIKVNFV-----KISLPYQHTGNTKVLIDQVSTDILRLKSETGVEILWNGGS-RIEIKLSKKYREKVTGMCGNFNGNEMDDSMTFKGVDEKDIDKFVLSWKTNPTCESDRGIVEYKGACALSRSYSDYANKVCHKLYESEEFKKCHSAANADKFFDQCTHDVCTCGMKRNGALD-HCECEAFSSYARQCALENINLSWR--TNELCPKKCPNENMKYNQCGSRCTSTC---------RLLQESKCKEECIEGCFCPEGET-FDEAAKECVKISDCKCEFHGRFYLPYEIRQDRCNNCTCTNGNWICTSNDCEGKE-----FCPKSMAWFDCGICQKTCTNLDLVCPKGQCQLPGCFCPENTVL----HNGECIKPFECP----CYMNNKMYSENDTI 2950
            C ++ +C+  C   GDPHYITFD  ++ F  +C Y  V                  + I N  C       CP++I  I+   +D+V +     S +  N +      +S  +Q  G   ++  +V   +     E GV ++++G    +E+  +  +     G CG    ++ D+     G       +  L WK  P   S +G      +     S +        +L  S  FK CH      +F+  C  D C         LD    C     YA  CA + + + WR  TN  C   CP +N  Y  CG      C           LQE+  K    EGCFCP+  T F      CV          G    P       C +C C      C    C         F P  +A  + G C   C      C    C  P   CP+N+ L      G C     C     C +N  +Y   D +
Sbjct: 2031 CCQHYQCQCVCSGWGDPHYITFDGTYYTFLDNCTYVLVQQIV-------PVFGYFRVLIDNYYCDVGDSVSCPQSI--IVEYHQDRVVLTRRPVSGVMTNQIIFNNKVVSPGFQQNG---IVTSRVGIKMYVTIQEIGVRVMFSGLIFSVEVPFN-LFANNTEGQCGTCTNDKKDECRLPGGSIASSCSEMSLHWKV-PNQPSCQGPPPTPTSVVPRPSPTPCPPSPLCELILSNTFKLCHDVIPPLQFYQGCLFDYCH-------MLDLEVVCSGLELYASLCAAQGVCIPWRSQTNNTCSFTCP-DNQVYQPCGPSNPHYCYRDDSISPSLTLQEAGPK---TEGCFCPDSTTLFSTNDSICVPSCQWCLGPRGEPVEPGHTISIDCQDCICKEATLTCQKKACPQPTCPEPGFVPVPVA-LEAGQC---CPQFSCACNSSHCP-PPLHCPKNSSLIVTYEEGACCPTQNCSSQKGCEVNGTLYQPGDVV 2492          
BLAST of von Willebrand factor vs. Ensembl Mouse
Match: Muc5ac (mucin 5, subtypes A and C, tracheobronchial/gastric [Source:MGI Symbol;Acc:MGI:104697])

HSP 1 Score: 486.108 bits (1250), Expect = 6.431e-140
Identity = 371/1281 (28.96%), Postives = 562/1281 (43.87%), Query Frame = 2
Query:  416 VTRVNNTMYSTYYECSVIYGHHIKTFDGNVFSYPLRGGYTLFMDCLGAAPLFYVYFNASYDCFDQKTQNDCSISMKITVGTQTIILFPKNEFALVKNNKTKIPFNSEGIIVSSVGSFIKIKGIDDLEILFDRDRNIYVYAPVTAEKKICGLCGYFNGIMSDDYRDFNQVIQKNVKTFVNSWIDRDPSDLNVYREREQYPCNALKLKNNDQYQKALTLCQDMVKNNLGRTCQSEVKIDKYLDMCQDEICECLQTQPENSTIENCYSTFCKIEEQYSYACT-LKGIAVDWRSATTICKQPQCFNGQEFSECGSNCGKNCGQLGMELECESQCLPGCYCPRNRYWDG---TMCVPQEKCPCVRDNGESTYQQGYRLKLNCETCICGMHGKWQCIENEECEGRCFISGDPHYITFDRRHFFFDGHCEYTAVMTTSDNVLLSNSTIAPLSITIQNTNCQDNSETGCPRTIGVIIGEDEDQVAINLLSSSEIKVNFVKISLPYQHTGNTKVLIDQVSTDILRLKSETGV--EILWNGGSRIEIKLSKKYREKVTGMCGNFNGNEMDDSMTFKGVDEKDIDKFVLSWKTNPTCESDRGIVEYKGACALSRSYSDYANKVCHKLY-ESEEFKKCHSAANADKFFDQCTHDVCTCGMKRNGALDHCECEAFSSYARQCALENINLS-WRTNELCPKK---CPNENMKYNQCGSRCTSTCRLLQESKCKEEC----IEGCFCPEGETFDEAAKECVKISDCKCEFHGRFYLPYEIRQDRCNNCTCTNGNWICTSNDCEGKEFCPKSMAWFDC---------GICQKTCTNLDLVCPKGQCQLPGCFCPENTVLH-NGECIKPFECPCYMNNKMYSENDTIVRGPANCQNPCICKDGKWVCEQNKQCSGICKTWGETHYESFDGKYFEFQGSCSYVISEDFCGNKLGT---FKLISENIACGXXXXXCTKSIKFIYLNRVFQFVRGSNPIVSRNTNYPPGGPTAFYWTSDVDTHFILFTMEGIQVKWDKAMSLEIMIPEKYQNKVCGLCGNFDLRIDNDMRARSGEIEKDIVNFADSWKVHSSCP---VPQKPPFMCSKRPDREPWAKAKCEILKSDSFKKCHDVVNVEHYYKRCVADACECDRGDDCVCFCTAVEQYVARCNEYEIGLKWRTNENCPHTC-----TGKRVW--KNCGNICPDSCID-IGKNVTDNTGCKKVCIEGCF--CP-------DGLHWQNNECVERKACECVDPITNLKYNTGDKVI--RECEECNCYEGAFRCTK 4108
            V R  N  + T   CS     H KTFDG VF +P    Y     C  A    Y  FN       +  +++ +   ++T+    +++       LV N+  ++PF+  G+++     ++K+     L  +++ D ++ +        K CGLCG FNG         N+ +  NV+     + +    D    + ++  P   +  KN         +C+ ++K  L   C + V I  Y++ C+ ++C C    P +          C    +YS  C    G   DWR    +C Q  C    +  ECGS C   C        CE  C+ GC+CP     D      CVP  +C C+ +   + Y  G     +C     G  G+W C ++  C G C + G  H  TFD R +   G C Y        N           ++ ++   C       C +T+ + +G  + ++ +   ++ E+ VN +   LP   T N      + ST  +  ++  G+  EI  +   +  ++L    R    G+CGNFN  + DD  T  GV E     F  ++KT   C + + I  ++  C+LS     YA   C  L   S  F +CH+  N   FF  C +D C C    +     C C A SSY R CA + + LS WR + +C K    CP ++M Y    S C  TCR L E           ++GC CP+G   D+  K CV+ + C C + G      E  QD    CTCT G   C          C   M +FDC           CQK+C  LD+ C   +C +PGC CP   V   NG C+   +CPC  N   Y   +TI  G   C N C C++  W C  +K C   C  +G+ HY +FDG+ + F G C Y + +D CG    +   F++I+ENI CG++ ++C+KSIK    N   +       +V ++    P      Y+   +  + ++ T  G+ + WDK  S+ + +  +++ +VCGLCGNFD    ND   RS  +  D++ F +SWK+  SCP   VP+ P   C+  P R+ WA+ +C I+ S++F  CH  V    YY+ CV DAC CD G DC CFCT V  Y   C+E  + + WRT + CP  C      G+  W  + CG  C  +C +  G+ + D  G     +EGC+  CP       +G     + C     C     +    Y  G  V   + C+ C C E   RCT 
Sbjct:   67 VVRAFNPGH-TRRVCSTWGNFHYKTFDGQVFYFPGLCNYVFSAHCGDA----YEDFNIQ---LRRVQESNTTTLSRVTMKLDGLVVELTKSSVLVNNHPVQLPFSQSGVLIELSNGYLKVVARLGLLFVWNEDDSLLLELDTKYTNKTCGLCGDFNGSPKS-----NEFLSNNVRLTPLEFGNLQKMDGPTEQCQDPLP---VPQKNCSARSG---ICEMILKGELFSGCAALVDISSYVEACRQDVCLCESLDPSDC--------ICHTLAEYSRQCAHAGGQPQDWR-GPNLCSQ-TCPLNMQHQECGSPCVDTCSNPQHSQVCEDHCIAGCFCPEGMVLDDINQMGCVPVSQCACLYNG--TLYAPGTNYSTDCTNTCSG--GQWSC-QDIPCAGTCSVMGGSHMSTFDGRQYTVHGDCTYVLSKPCDSNAF---------TVLVELRKCGLTESETCLKTVTLNLGGGQTEIMVK--ATGEVFVNQIYTQLPVS-TANATFF--RPSTFFIVGETNLGLQLEIQLSPIMQTSVRLKPGLRGLTCGLCGNFNSMQADDFQTISGVVEGTAAAFFNTFKTQAACPNVKNI--FQDPCSLSVENEKYAQHWCSLLTNASGPFSQCHATVNPSTFFSNCMYDTCNCEKSED-----CMCAALSSYVRACAAKGVLLSDWR-DGICTKPTITCP-KSMTYQYHISTCQPTCRALNEKDVTCHVSFIPVDGCTCPKGTFLDDLGK-CVQATSCPCYYKGSTVPNGESVQDSGAICTCTQGALTCIGGPAP-TPVCDAPMIYFDCHNATPGDTGAGCQKSCHTLDMTCYSSEC-VPGCVCPNGLVADGNGGCVVTEDCPCVHNEATYRPGETIQVG---CNN-CTCENRMWQCT-DKPCLATCAVYGDGHYITFDGQRYSFNGDCEYTLLQDNCGGNGSSQDAFRVITENIPCGTTGTTCSKSIKIFLGNYELKLSDSKMEVVQKDVGQEPP-----YFVHQMGNYLVVETDIGLVLLWDKKTSIFLRLSPEFKGRVCGLCGNFDDNAINDFTTRSQSVVSDMLEFGNSWKLSPSCPDVLVPKDP---CTANPYRKSWAQKQCSIINSETFSACHAHVEPAKYYEACVNDACACDSGGDCECFCTTVAAYAQACHEVGVCVSWRTPDICPLFCDYYNPEGQCEWHYQPCGAPCMRTCQNPTGQCLQDLRG-----LEGCYPKCPPTAPIFDEGTMQCVSNCTVTFPCR----VNGKLYRPGASVPSDKNCDSCICTESGVRCTH 1265          

HSP 2 Score: 201.83 bits (512), Expect = 3.710e-51
Identity = 147/503 (29.22%), Postives = 240/503 (47.71%), Query Frame = 2
Query: 1280 SATTICKQPQCF---NGQEFSECGSNCGKNCGQLGMELECESQCLPGCYCPRNRYWDGTM-CVPQEKCPCVRDNGESTYQQGYRLKLNCETCICGMHGKWQCIENEECEGRCFISGDPHYITFDRRHFFFDGHCEYTAVMTTSDNVLLSNSTIAPLSITIQNTNCQDNSETGCPRTIGVIIGEDEDQVAINLLSSSEIKVNFVKISLPYQHTGNTKVLIDQVSTDILRLKSETGVEILWNGGSRIEIKLSKKYREKVTGMCGNFNGNEMDDSMTFKGVDEKDIDKFVLSWKTNPTCESDRGIVEYKGACALSRSYSDYANKVCHKLYESEEFKKCHSAANADKFFDQCTHDVCTCGMKRNGALDHCECEAFSSYARQCALENINLSWRTNELCPKKCPNENMK------YNQCGSRCTSTCR-----LLQESKCKEECIEGCFCPEGETFDEAAKECVKISDC----KCEFHGRFYLP-YEIRQDR-CNNCTCTNGNWICTSN 2725
            + T +C  P  +   +     + G+ C K+C  L M     S+C+PGC CP     DG   CV  E CPCV +  E+TY+ G  +++ C  C C  +  WQC + + C   C + GD HYITFD + + F+G CEYT +    DN   + S+     +  +N  C   + T C ++I + +G            + E+K++  K+ +  +  G           + L ++++ G+ +LW+  + I ++LS +++ +V G+CGNF+ N ++D  T       D+ +F  SWK +P+C     ++  K  C  +     +A K C  +  SE F  CH+     K+++ C +D C C    +G    C C   ++YA+ C    + +SWRT ++CP  C   N +      Y  CG+ C  TC+      LQ+ +  E C   C  P    FDE   +CV  S+C     C  +G+ Y P   +  D+ C++C CT     CT N
Sbjct:  795 APTPVCDAPMIYFDCHNATPGDTGAGCQKSCHTLDMTCY-SSECVPGCVCPNGLVADGNGGCVVTEDCPCVHN--EATYRPGETIQVGCNNCTC-ENRMWQCTD-KPCLATCAVYGDGHYITFDGQRYSFNGDCEYTLLQ---DNCGGNGSSQDAFRVITENIPC-GTTGTTCSKSIKIFLG------------NYELKLSDSKMEVVQKDVGQEPPYFVHQMGNYLVVETDIGLVLLWDKKTSIFLRLSPEFKGRVCGLCGNFDDNAINDFTTRSQSVVSDMLEFGNSWKLSPSCPD---VLVPKDPCTANPYRKSWAQKQC-SIINSETFSACHAHVEPAKYYEACVNDACAC---DSGGDCECFCTTVAAYAQACHEVGVCVSWRTPDICPLFCDYYNPEGQCEWHYQPCGAPCMRTCQNPTGQCLQDLRGLEGCYPKCP-PTAPIFDEGTMQCV--SNCTVTFPCRVNGKLYRPGASVPSDKNCDSCICTESGVRCTHN 1266          

HSP 3 Score: 114.775 bits (286), Expect = 9.533e-25
Identity = 113/427 (26.46%), Postives = 172/427 (40.28%), Query Frame = 2
Query: 3008 CEQNKQCSGICKTWGETHYESFDGKYFEFQGSCSYVISEDFCGNKLGTFKLISENIACGXX-XXXCTKSIKFIYLNRVFQFVRG------SNPIVSRNTNYPPGGPTAFYWTSDVDTHFILFTME-GIQVKWDKAMSLEIMIP-EKYQNKVCGLCGNFDLRIDNDMRARSGEIEKDIVNFADSWKVHSSCPVPQKPP---------FMCSKRPDREPWAKAKCEILKSDSFKKCHDVVNVEHYYKRCVADACECDRGDDCVCFCTAVEQYVARCNEYEIGLKWR--TNENCPHTCTGKRVWKNCGNICPDSCI---DIGKNVTDNTGCKKVCIEGCFCPDGLH-WQNNECVERKACE-CVDPITNLKYNTGDKVIRECEECNCYEGAFRCTKLFSKECLHTSRPEISTKPPHCVNEYEFLCPNNFCA 4213
            C Q+ QC  +C  WG+ HY +FDG Y+ F  +C+YV+ +       G F+++ +N  C    S SC +SI   Y        R       +N I+  N    PG       TS V     +   E G++V +   +   + +P   + N   G CG       ++ R   G I       +  WK      VP +P           +  +           CE++ S++FK CHDV+    +Y+ C+ D C      D    C+ +E Y + C    + + WR  TN  C  TC   +V++ CG   P  C     I  ++T      K   EGCFCPD    +  N+ +   +C+ C+ P        G  +  +C++C C E    C K   K C   + PE    P     E    CP   CA
Sbjct: 2031 CCQHYQCQCVCSGWGDPHYITFDGTYYTFLDNCTYVLVQQIV-PVFGYFRVLIDNYYCDVGDSVSCPQSIIVEYHQDRVVLTRRPVSGVMTNQIIFNNKVVSPGFQQNGIVTSRVGIKMYVTIQEIGVRVMF-SGLIFSVEVPFNLFANNTEGQCGTCTNDKKDECRLPGGSIASSCSEMSLHWK------VPNQPSCQGPPPTPTSVVPRPSPTPCPPSPLCELILSNTFKLCHDVIPPLQFYQGCLFDYC---HMLDLEVVCSGLELYASLCAAQGVCIPWRSQTNNTCSFTCPDNQVYQPCGPSNPHYCYRDDSISPSLTLQEAGPKT--EGCFCPDSTTLFSTNDSICVPSCQWCLGP-RGEPVEPGHTISIDCQDCICKEATLTCQK---KACPQPTCPEPGFVPVPVALEAGQCCPQFSCA 2440          

HSP 4 Score: 93.5893 bits (231), Expect = 2.419e-18
Identity = 118/492 (23.98%), Postives = 172/492 (34.96%), Query Frame = 2
Query: 1571 CIENEECEGRCFISGDPHYITFDRRHFFFDGHCEYTAVMTTSDNVLLSNSTIAPLSITIQNTNCQDNSETGCPRTIGVIIGEDEDQVAINLLSSSEIKVNFV-----KISLPYQHTGNTKVLIDQVSTDILRLKSETGVEILWNGGS-RIEIKLSKKYREKVTGMCGNFNGNEMDDSMTFKGVDEKDIDKFVLSWKTNPTCESDRGIVEYKGACALSRSYSDYANKVCHKLYESEEFKKCHSAANADKFFDQCTHDVCTCGMKRNGALD-HCECEAFSSYARQCALENINLSWR--TNELCPKKCPNENMKYNQCGSRCTSTC---------RLLQESKCKEECIEGCFCPEGET-FDEAAKECVKISDCKCEFHGRFYLPYEIRQDRCNNCTCTNGNWICTSNDCEGKE-----FCPKSMAWFDCGICQKTCTNLDLVCPKGQCQLPGCFCPENTVL----HNGECIKPFECP----CYMNNKMYSENDTI 2950
            C ++ +C+  C   GDPHYITFD  ++ F  +C Y  V                  + I N  C       CP++I  I+   +D+V +     S +  N +      +S  +Q  G   ++  +V   +     E GV ++++G    +E+  +  +     G CG    ++ D+     G       +  L WK  P   S +G      +     S +        +L  S  FK CH      +F+  C  D C         LD    C     YA  CA + + + WR  TN  C   CP +N  Y  CG      C           LQE+  K    EGCFCP+  T F      CV          G    P       C +C C      C    C         F P  +A  + G C   C      C    C  P   CP+N+ L      G C     C     C +N  +Y   D +
Sbjct: 2031 CCQHYQCQCVCSGWGDPHYITFDGTYYTFLDNCTYVLVQQIV-------PVFGYFRVLIDNYYCDVGDSVSCPQSI--IVEYHQDRVVLTRRPVSGVMTNQIIFNNKVVSPGFQQNG---IVTSRVGIKMYVTIQEIGVRVMFSGLIFSVEVPFN-LFANNTEGQCGTCTNDKKDECRLPGGSIASSCSEMSLHWKV-PNQPSCQGPPPTPTSVVPRPSPTPCPPSPLCELILSNTFKLCHDVIPPLQFYQGCLFDYCH-------MLDLEVVCSGLELYASLCAAQGVCIPWRSQTNNTCSFTCP-DNQVYQPCGPSNPHYCYRDDSISPSLTLQEAGPK---TEGCFCPDSTTLFSTNDSICVPSCQWCLGPRGEPVEPGHTISIDCQDCICKEATLTCQKKACPQPTCPEPGFVPVPVA-LEAGQC---CPQFSCACNSSHCP-PPLHCPKNSSLIVTYEEGACCPTQNCSSQKGCEVNGTLYQPGDVV 2492          
BLAST of von Willebrand factor vs. Ensembl Mouse
Match: Muc5b (mucin 5, subtype B, tracheobronchial [Source:MGI Symbol;Acc:MGI:1921430])

HSP 1 Score: 467.618 bits (1202), Expect = 1.047e-133
Identity = 354/1258 (28.14%), Postives = 556/1258 (44.20%), Query Frame = 2
Query:  458 CSVIYGHHIKTFDGNVFSYPLRGGYTLFMDCLGAAPLFYVYFNASYDCFDQKTQNDCSISMK----ITVGTQTIILFPKNEFALVKNNKTKIPFNSEGIIVSSVGSFIKIKGIDDLEILFDRDRNIYVYAPVTAEKKICGLCGYFNGIMSDDYRDFNQVIQKNVKTFVNSWIDRDPSDLNVYREREQYPCNALKLKNNDQYQKALTLCQDMVKNNLGRTCQSEVKIDKYLDMCQDEICECLQTQPENSTIENCY-STFCKIEEQYSYACTLKGIAVDWRSATTICKQPQCFNGQEFSECGSNCGKNCGQLGMELECESQCLPGCYCPRNRYWDGTM---CVPQEKCPCVRDNGESTYQQGYRLKLNCETCICGMHGKWQCIENEECEGRCFISGDPHYITFDRRHFFFDGHCEYTAVMTTSDNVLLSNSTIAPLSITIQNTNCQDNSETGCPRTIGVIIGEDEDQVAINLLSSSEIKVNFVKISLPYQHTGNTKVLIDQVSTDILRLKSETGVEILWNGGSRIEIKLSKKYREKVTGMCGNFNGNEMDDSMTFKGVDEKDIDKFVLSWKTNPTCESDRGIVEYKGACALSRSYSDYANKVCHKLYESEE-FKKCHSAANADKFFDQCTHDVCTCGMKRNGALDHCECEAFSSYARQCALENINLSWRTNELCPK---KCPNENMKYNQCGSRCTSTCRLLQES----KCKEECIEGCFCPEGETFDEAAKECVKISDCKCEFHGRFYLPYEIRQDRCNNCTCTNGNWICTSNDCEGKEFCPKSMAWFDC---------GICQKTCTNLDLVCPKGQCQLPGCFCPENTVLH-NGECIKPFECPCYMNNKMYSENDTIVRGPANCQNPCICKDGKWVCEQNKQCSGICKTWGETHYESFDGKYFEFQGSCSYVISEDFC-GNKL--GTFKLISENIACGXXXXXCTKSIKFIYLNRVFQFVRGSNPIVSRNTNYPPGGPTAFYWTSDVDTHFILFTMEGIQVKWDKAMSLEIMIPEKYQNKVCGLCGNFDLRIDNDMRARSGEIEKDIVNFADSWKVHSSCPVPQKPPFMCSKRPDREPWAKAKCEILKSDSFKKCHDVVNVEHYYKRCVADACECDRGDDCVCFCTAVEQYVARCNEYEIGLKWRTNENCPHTC-----TGKRVW--KNCGNICPDSCIDIGKNVTDNTGCKKVCIEGCF--CPDGLHWQNNE---CVERKACECVDPITNLKYNTGDKV--IRECEECNCYEGAFRC 4102
            CS     H KTFDG+VF +P    Y           +F  +  A+Y+ F+ + +     S      + +  Q +++   N   LV  ++ K+P++  G+++     ++KI     L  L++ + +  +        + CGLCG FNG+ +      ++    N +     + +    D    + ++  P       + +       +C+  +       C + V +  YLD C  ++C C            C  +TF +   Q ++A    G   +WR    +C     FN  E+ EC S C   C        CE  C+ GC+CP     D      C+P E+C C   +G   Y  G     +C +C C   G W+C ++  C G C + G  H  TFD + +   G C Y         +L      +  ++ +    C       C + + + +   +  + I +  +  +   F ++ L     GN  +        I++      +++      ++ ++L + Y+ ++ G+CGNFN N+ DD     GV E     F  +WKT  +C + +    Y+  C+ S    ++A + C  L ES   F  CH+  +   F+  C  D C C    +     C C A SSY   CA + + LS   +++C K    CP +   Y    S C  TCR L E+          ++GC CPEG TF      CV + +C C FHG    P E+  D    C+CTNG   C     +    C   M + DC           C K+C  LD+ C   QC + GC CP   V   NG CI   +CPC  N   Y   + I+R   +C N C CK+ +W C  NK C G C  +G+ H+ +FDG+ + F+GSC Y +++D+C GN    GTF++++EN+ CG++ ++C+K+IK    +       G+  +V +    P G P   Y    +    ++    GI V WD+  S+ + + + Y+ +VCGLCGNFD    ND   RS  +  D++ F +SWK   SCP    P   C   P R+ WA+ KC I+ S +F  CH  V+   YY+ CV D C CD G DC CFCTAV  Y   C +  + L WRT + CP  C      G+  W  + CG  C  +C    +N T +       +EGC+  CP    + N +   CV +  C C D   N  ++ G +V     C+ C C  G  +C
Sbjct:   81 CSTWGDFHYKTFDGDVFRFPGLCNY-----------VFSSHCGATYEDFNIQLRRGLEGSRPTVTYVLLRAQGLVIELSNGSVLVNGHREKLPYSRAGLLMEKSSGYVKISIRLVLTFLWNEEDSALLELDSKYINQTCGLCGDFNGLPA-----VSEFYTHNTRLTPVQFGNLQKLDGPTEQCQDVLPSAVSNCTDTED------ICRRTLLGPAFDKCTALVDVSMYLDACVQDLCRC----------PTCPCATFAEYSRQCAHA---GGYPQNWRHPD-LCNWTCPFN-MEYRECSSPCVDTCSNPQRSQLCEDHCMDGCFCPPGTVLDDVRHLGCLPLEQCHCT--HGGRIYAPGESFNTSCRSCTC-FGGLWKC-KDLPCPGTCSVQGGSHIFTFDEKLYNVHGDCSY---------ILTKKCADSSFTVLVDLRKCGVTDTENCLKAVTLNLNSGDTVIRIQVNGAVFLNSIFTQMPL---SAGNITIFKPSSFFIIVQTGMGLQLQVQLVPLMQVFVRLDRSYQGQMCGLCGNFNQNQADDFTALSGVVEGTGAAFSNTWKTQASCPNSKNT--YEDPCSYSVENENFAREWCSMLTESSGVFSACHATVSPVPFYSNCLFDTCNCENSED-----CMCAALSSYVFACAAKGVLLSGWRDKVCYKYTNNCP-QTKGYFYSVSSCQPTCRSLSEADVTCSVPFVTVDGCTCPEG-TFLNDKDHCVPVEECPCYFHGTVVAPREVVTDNGVVCSCTNGKLTCLGALMQKSTECQAPMVYLDCNNASVGHHGAECLKSCHTLDVECFSTQC-VSGCVCPSGLVADGNGGCIAEEDCPCIHNEVTYRPGE-IIR--VDCNN-CTCKNRRWECT-NKPCMGACVAYGDGHFVTFDGERYIFEGSCEYTLAQDYCRGNTSTNGTFRIVTENVPCGTTGTTCSKTIKIFVESYELILHEGNFKVVEQG---PSGDPP--YKIRFMGIFLVIEIRSGIVVSWDRKTSVFVRLQQHYKGRVCGLCGNFDDNAINDFTTRSQSVVGDVLEFGNSWKFSPSCPDAPVPKDPCIANPYRKSWAQKKCSIINSATFAACHSQVDSTKYYEACVHDVCACDSGGDCECFCTAVAAYAQACRDVGVCLSWRTPDICPLFCDYYNPHGECEWHYQPCGAPCLKTC----RNPTGHCLVDLPGLEGCYPQCPASQPFFNEDQMKCVAQ--CGCYDDNGNY-HDIGTQVPTAENCQSCLCTPGGLQC 1258          

HSP 2 Score: 97.4413 bits (241), Expect = 1.890e-19
Identity = 92/373 (24.66%), Postives = 146/373 (39.14%), Query Frame = 2
Query: 3035 ICKTWGETHYESFDGKYFEFQGSCSYVISEDFCGNKLGTFKLISENIACGXXXXXCTKSIKFIYLNRVFQFVRGSNPIVSRNTNYPPGGPTAFYWTSDVDTHFILFTMEGI-QVKWDKAMSLEIMIPEKYQNKVCGLCGNFD-LRIDNDMRARSGEIEKDIVNFADSWKVHSSCPVPQKPPFMCSKRPDREPWAKAKC--------EILKSDSFKKCHDVVNVEHYYKRCVADACECDRGDDCVCFCTAVEQYVARCNEY-EIGLKWRTNENCPHTCTGKRVWKNCGNICPDSCIDIGKNVTDNTGCKKVCIEGCFCPDGLHWQNNE---CVERKACECVDPITNLKYNTGDKVIRECEECNCYEGAFRCTKL 4111
            +C TWG+ HY++FDG  F F G C+YV S   CG     F     NI           ++ ++ L      +  SN  V  N +      +      +  + ++  ++  +    W++  S  + +  KY N+ CGLCG+F+ L   ++    +  +    V F +  K+         P   C    D  P A + C          L   +F KC  +V+V  Y   CV D C C       C C    +Y  +C         WR  + C  TC     ++ C + C D+C     N   +  C+  C++GCFCP G    +     C+  + C C        Y  G+     C  C C+ G ++C  L
Sbjct:   80 VCSTWGDFHYKTFDGDVFRFPGLCNYVFS-SHCGATYEDF-----NIQLRRGLEGSRPTVTYVLLRAQGLVIELSNGSVLVNGHREKLPYSRAGLLMEKSSGYVKISIRLVLTFLWNEEDSALLELDSKYINQTCGLCGDFNGLPAVSEFYTHNTRLTP--VQFGNLQKL-------DGPTEQCQ---DVLPSAVSNCTDTEDICRRTLLGPAFDKCTALVDVSMYLDACVQDLCRCP-----TCPCATFAEYSRQCAHAGGYPQNWRHPDLCNWTCPFNMEYRECSSPCVDTC----SNPQRSQLCEDHCMDGCFCPPGTVLDDVRHLGCLPLEQCHCTH--GGRIYAPGESFNTSCRSCTCFGGLWKCKDL 423          

HSP 3 Score: 96.2857 bits (238), Expect = 4.605e-19
Identity = 98/397 (24.69%), Postives = 166/397 (41.81%), Query Frame = 2
Query: 3008 CEQNKQCSGICKTWGETHYESFDGKYFEFQGSCSYVISEDFCGNKLGTFKLISENIACGXXX--XXCTKSIKFIYLNRVFQFVRGSNPIVSRN------------TNYPPGGPTAFYWTSDVDTHFILFTMEGIQVKWDKAMSLEIMIPEKY----QNKVCGLCGNFDLRIDNDMRARSGEIEKDIVNFADSWKV----HSSC-----PVPQKPP-FMCSKRPDREPWAKAK-CEILKSDSFKKCHDVVNVEHYYKRCVADACECDRGDDCVCFCTAVEQYVARCNEYEIGLKWR--TNENCPHTCTGKRVWKNCGNICPDSCIDIGKNVTDNTGCKKVCIEGCFCPDGLHWQNNE---CVERKACECVDPITNLKYNTGDKVIRECEECNCYEGAF 4096
            C  + +C   C  WG +HY +FDG  + F  +C+ V+  +    + G   +++ +  CG+++  +SC +++  +Y N +   +  S     ++            + +   G T     S   T  +  +  G  + +D  +  +I +P +Y        CG C N  +   +D R   G I  D  + A  W V     SSC     P+P   P    S      P   A  CE++ S  F +CH ++  + +++ CV+D C  +  D     C ++E Y A C    +   WR  T   C  +C   + ++ CG + P SC    ++ T       +  EGCFCP+     N+    CV    C CV P    K+  G+  I  C+ C C  G+ 
Sbjct: 4112 CHFHYECECFCSGWGHSHYLTFDGTSYTFLDNCTSVLMREI-HPRHGNLSILAHSYYCGATTNVTSCPRALS-VYYNSMEIILTISTTESGKDESLIIWDQMWIRSGFSKNGVTVSL--SGATTMSVNISTIGTIITFDGNI-FQIWLPYRYFSSNTEGQCGTCTNSQI---DDCRRPDGTIASDCQDMAKEWLVPGNSSSSCLAQPSPLPSTTPQTPVSSTLTSTPCPSAPLCELMLSQVFAECHRLIPPDAFFRSCVSDHCNANITD---MLCQSLEAYAALCRAQGVCTNWRNATGGLCDLSCPPTKEYRPCGPLHPASCNSRTQDSTTG-----MLAEGCFCPENQLLFNSRMDICVSE--CPCVGPDGLPKF-PGEHWISNCQACVCEPGSV 4489          

HSP 4 Score: 83.9593 bits (206), Expect = 2.204e-15
Identity = 108/423 (25.53%), Postives = 170/423 (40.19%), Query Frame = 2
Query:  464 VIYGH-HIKTFDGNVFSYPLRGGYTLFMD-CLGAAPLFYVYFNASYDCFDQKTQNDCSISMKITVGTQTIILFPKNEFALVKNNKTKIPFNSEGIIVSSVGSFIKIKGIDDLEILFDRDRNIYVYAPVTAEKKICGLCGYFNGIMSDDYRDFNQVIQKNVKTFVNSW----------IDRDPSDLNVYRER-EQYPCNALKLKNNDQYQKALTLCQDMVKNNLGRTCQSEVKIDKYLDMCQDEICECLQTQPENSTIENCYSTFCKIEEQYSYACTLKGIAVDWRSATTICK------QPQCFNGQEFSECGSNCGKNCGQLGMELECESQCLPGCY--CPRNRYW---DGTMCVPQEKCPCVRDNGESTYQQGYRLKL--NCETCICGMHGKWQCIENEEC-----EGRCFISGDPHYITFD 1639
            V YG  H  TFDG  + +     YTL  D C G       +   + +     T   CS ++KI V +  +IL   N F +V+      P       +  +G F+ I+    + + +DR  +++V      + ++CGLCG F+    +D+   +Q +  +V  F NSW          + +DP   N YR+   Q  C+                   ++ +     C S+V   KY + C  ++C C        +  +C   FC     Y+ AC   G+ + WR+   IC        P       +  CG+ C K C         +   L GCY  CP ++ +   D   CV Q  C C  DNG + +  G ++    NC++C+C   G  QC+ N        EGR +   D  Y T D
Sbjct:  900 VAYGDGHFVTFDGERYIFEGSCEYTLAQDYCRGNTSTNGTFRIVTENVPCGTTGTTCSKTIKIFVESYELILHEGN-FKVVEQG----PSGDPPYKIRFMGIFLVIEIRSGIVVSWDRKTSVFVRLQQHYKGRVCGLCGNFDDNAINDFTTRSQSVVGDVLEFGNSWKFSPSCPDAPVPKDPCIANPYRKSWAQKKCS-------------------IINSATFAACHSQVDSTKYYEACVHDVCAC-------DSGGDC-ECFCTAVAAYAQACRDVGVCLSWRTP-DICPLFCDYYNPHGECEWHYQPCGAPCLKTCRNPTGHCLVDLPGLEGCYPQCPASQPFFNEDQMKCVAQ--CGCYDDNG-NYHDIGTQVPTAENCQSCLC-TPGGLQCVYNLTACTCTYEGRTYNYNDVVYNTTD 1285          

HSP 5 Score: 76.2554 bits (186), Expect = 4.674e-13
Identity = 121/492 (24.59%), Postives = 180/492 (36.59%), Query Frame = 2
Query: 1586 ECEGRCFISGDPHYITFDRRHFFFDGHCEYTAVMTTSDNVLLSNSTIAPLSITIQNTNCQDNSE-TGCPRTIGVIIGEDEDQVAINLLSSSEIKVNFVKISLPYQHTGNTK--VLIDQVSTDILRLKSETGVEILWNGGSRIEIKLSKKYREKVT-GMCGNFNGNEMDDSMTFKGVDEKDIDKFVLSWKTNPTCESDRGIVE---YKGACALSRSYSDYANKVCH-----KLYESEEFKKCHSAANADKFFDQCTHDVCTCGMKRNGALDHCECEAFSSYARQCALENINLSWR--TNELCPKKCPNENMKYNQCGSRCTSTCRLLQESKCKEECIEGCFCPEGE-TFDEAAKECVKISDCKC-EFHGRFYLPYEIRQDRCNNCTCTNGNWI--CTSNDCEGKEFCPK-------SMAW--FDCGICQKT-CTNLDLVCPKGQCQLPGCFCPENTVL--HNGECIKPFECP---CYMNNKMYSENDTIVRGP 2962
            ECE  C   G  HY+TFD   + F  +C  T+V+    +    N     LSI   +  C   +  T CPR + V     E  + I+   S + +   +   + +  +G +K  V +       + +   T   I+   G+  +I L  +Y    T G CG    +++DD     G    D       W   P   S   + +          +   S   +  C      +L  S+ F +CH     D FF  C  D C      N  +    C++  +YA  C  + +  +WR  T  LC   CP    +Y  CG    ++C    +        EGCFCPE +  F+     CV  S+C C    G    P E     C  C C  G+    C    CE ++  P+       ++ W   D   C +T C      CPK    LP C      V    N  C   + C    C  N+ +Y    T   GP
Sbjct: 4117 ECECFCSGWGHSHYLTFDGTSYTFLDNC--TSVLMREIHPRHGN-----LSILAHSYYCGATTNVTSCPRALSVYYNSMEIILTISTTESGKDESLIIWDQM-WIRSGFSKNGVTVSLSGATTMSVNISTIGTIITFDGNIFQIWLPYRYFSSNTEGQCGTCTNSQIDDCRRPDGTIASDCQDMAKEWLV-PGNSSSSCLAQPSPLPSTTPQTPVSSTLTSTPCPSAPLCELMLSQVFAECHRLIPPDAFFRSCVSDHC------NANITDMLCQSLEAYAALCRAQGVCTNWRNATGGLCDLSCP-PTKEYRPCGPLHPASCNSRTQDSTTGMLAEGCFCPENQLLFNSRMDICV--SECPCVGPDGLPKFPGEHWISNCQACVCEPGSVSVQCEPVKCESQDKPPQCTEAGFVTVTWPSADNPCCPETLCVCNSTTCPK---SLPTCEPGYELVQTHENSSCCPSYSCRPKLCTYNDTIYGVGTTFPGGP 4587          

HSP 6 Score: 63.929 bits (154), Expect = 2.775e-9
Identity = 82/391 (20.97%), Postives = 140/391 (35.81%), Query Frame = 2
Query:  449 YYECSVI---YGH-HIKTFDGNVFSYPLRGGYTLFMDCLGAAPLFYVYFNASYDCFDQKTQNDCSISMKITVGTQTIILF------PKNEFALVKNNK-TKIPFNSEGIIVSSVGSFIKIKGIDDLEILFDRDRNIY-VYAPVTA-EKKICGLCGYFNGIMSDDYRDFNQVIQKNVKTFVNSWIDRDPSDLNVYREREQYPCNALKLKNNDQYQK----ALTLCQDMVKNNLGRTCQSEVKIDKYLDMCQDEICECLQTQPENSTIENCYSTFCKIEEQYSYACTLKGIAVDWRSATTICKQPQCFNGQEFSECGSNCGKNC------GQLGMELECESQCLPGCYCPRNR-YWDGTMCVPQEKCPCVRDNGESTYQQGYRLKLNCETCIC 1549
            +YEC      +GH H  TFDG  +++ L    ++ M  +            SY C        C  ++ +   +  IIL        K+E  ++ +    +  F+  G+ VS  G+      I  +  +   D NI+ ++ P         G CG       DD R  +  I  + +     W+    S  +   +    P    +   +         +  LC+ M+       C   +  D +   C  + C             N     C+  E Y+  C  +G+  +WR+AT       C   +E+  CG     +C         GM  E       GC+CP N+  ++  M +   +CPCV  +G   +  G     NC+ C+C
Sbjct: 4115 HYECECFCSGWGHSHYLTFDGTSYTF-LDNCTSVLMREIHPRHGNLSILAHSYYCGATTNVTSCPRALSVYYNSMEIILTISTTESGKDESLIIWDQMWIRSGFSKNGVTVSLSGATTMSVNISTIGTIITFDGNIFQIWLPYRYFSSNTEGQCGTCTNSQIDDCRRPDGTIASDCQDMAKEWLVPGNSSSSCLAQPSPLPSTTPQTPVSSTLTSTPCPSAPLCELMLSQVFAE-CHRLIPPDAFFRSCVSDHCN-----------ANITDMLCQSLEAYAALCRAQGVCTNWRNATGGLCDLSCPPTKEYRPCGPLHPASCNSRTQDSTTGMLAE-------GCFCPENQLLFNSRMDICVSECPCVGPDGLPKF-PGEHWISNCQACVC 4484          
BLAST of von Willebrand factor vs. UniProt/SwissProt
Match: sp|Q28295|VWF_CANLF (von Willebrand factor OS=Canis lupus familiaris OX=9615 GN=VWF PE=1 SV=2)

HSP 1 Score: 504.212 bits (1297), Expect = 5.327e-145
Identity = 363/1282 (28.32%), Postives = 557/1282 (43.45%), Query Frame = 2
Query:  443 STYYECSVIYGHHIKTFDGNVFSYPLRGGYTLFMDCLGAAPLFYVYFNASYDCFDQKTQNDCSISMKITVGTQTIILFPKNEFALVKNNKTKIPFNSEGIIVSSVGSFIKIKG-IDDLEILFDRDRNIYVYAPVTAEKKICGLCGYFNGIMSDDYRDFNQVIQKNVKTFVNSWIDRDPSDLNVYREREQYPCNALKLKNNDQYQKAL-TLCQDMVKNNLGRTCQSEVKIDKYLDMCQDEICECLQTQPENSTIENCYSTFCKIEEQYSYACTLKGIAVDWRSATTICKQPQCFNGQEFSECGSNCGKNCGQLGMELECESQCLPGCYCPRNRYWDGTMCVPQEKCPCVRDNGESTYQQGYRLKLNCETCICGMHGKWQCIENEECEGRCFISGDPHYITFDRRHFFFDGHCEYTAVMTTSDNVLLSNSTIAPLSITIQNTNCQDNSETGCPRTIGV-IIGEDEDQVAINL-----LSSSEIKVNFVKISLPYQHTGNTKVLIDQVSTDILRLKSETGVEILWNGGSRIEIKLSKKYREKVTGMCGNFNGNEMDDSMTFKGVDEKDIDKFVLSWKTNPTCESDRGIVEYKGACALSRSYSDYANKVCHKLYESEEFKKCHSAANADKFFDQCTHDVCTCGMKRNGALDHCECEAFSSYARQCALENINLSWRTNELCPKKCPNENMKYNQCGSRCTSTCRLLQ--ESKCKEECIEGCFCPEGETFDEAAKECVKISDCKCEFHGRFYLPYEIRQDRCNNCTCTNGNWICTSNDCEG---------------------------KEFCPKSMAWFDCGICQKTCTNLDLVCPKGQCQLPGCFCPENTVLHNGECIKPFECPCYMNNKMYSENDTIVRGPANCQNPCICKDGKWVCEQNKQCSGICKTWGETHYESFDGKYFEFQGSCSYVISEDFCGNKLGTFKLISENIACGXXXXXCTKSIKFIYLNRVFQFVRGSNPIVSRNTNYPPGGPTAFYWTSDVDTHFILFTMEGIQVKWDKAMSLEIMIPEKYQNKVCGLCGNFDLRIDNDMRARSGEIEKDIVNFADSWKVHSSCPVPQKPPF-----MCSKRPDREPWAKAKCEILKSDSFKKCHDVVNVEHYYKRCVADACECDRGDDCVCFCTAVEQYVARCNEYEIGLKWRTNENCPHTCTGKRVWKN----------CGNICPDSCIDIGKNVTDNTGCKKVCIEGC--FCPDG--LHWQNNECVERKACECVDPITNLKYNTGDKVI------RECEECNCYEGAFRC 4102
            S+   CS+  G  I TFD +++S+     Y L  DC   +      F           QN   +S+ + +G    I    N   L       +P+ S G+ + +   + K+           D + N  V        K CGLCG FN    DD+R     +  +   F NSW                 PCN     ++D+ Q+ L   CQ +   ++   C   V  + ++ +C+  +C C+Q               C +  +Y+ AC  +GI +   +  ++C+ P C  G E+ EC S C + C  L ++  C+ QC+ GC CP  +  D   CV   +C CV  +    Y  G  L  +C TCIC  +  W C  NEEC G C ++G  H+ +FD R+F F G C Y       D+           S+ I+   C D+ +  C R++ V + G     V +       +   +I++  ++  L  QHT    V          RL     +++ W+G  R+ + LS  Y  K  G+CGN+NGN  DD +T  G+ E  ++ F  +WK    CE+ +   +++  C+L+   + +A + C  L  S +F+ CH A     +   C +DVC+C   R+     C C A ++YA  CA   ++++WR    C   CP +   Y QCG+ C  TCR L   E  C E C+EGCFCP G   DE   +CV  + C C + G  + P +I  D    C C +G   CT++   G                           K  CP      +   C KTC N DL C    C + GC CP+  V H   C+    CPC+   + Y+  +T+     +C N C+C+D KW C  +  C   C   G  HY +FDG  + F G C YV+ +D+CG+  GTF+++  N  C   S  C K +  +      +   G       N   P    T F    +   + IL   + + V WD  +S+ + +   YQ +VCGLCGNFD   +ND  + S +IE+D V+F +SWKV+  C   +K P      +C     ++    + C IL SD F+ C+ +V+ E +   C+ D C C+   DC CFC  +  Y   C ++   + WRT   CP  C  + + +N          C   CP +C        +   C   C+EGC   CP G  L      C++ + C   + +   +   G K+I        C+ C+C    F C
Sbjct:   30 SSMARCSLFGGDFINTFDESMYSFAGDCSYLLAGDCQEHSVSLIGGF-----------QNGKRVSLSVYLGEFFDIHLFVNGTMLQGTQSISMPYASNGLYLEAEAGYYKLSSEAYGFVARIDGNGNFQVLLSDRYFNKTCGLCGNFNIFAEDDFRTQEGTLTSDPYDFANSWALSSGEQRCKRVSPPSSPCNV----SSDEVQQVLWEQCQLLKSASVFARCHPLVDPEPFVALCERTLCTCVQGM----------ECPCAVLLEYARACAQQGIVLYGWTDHSVCR-PACPAGMEYKECVSPCTRTCQSLHVKEVCQEQCVDGCSCPEGQLLDEGHCVGSAECSCV--HAGQRYPPGASLLQDCHTCIC-RNSLWIC-SNEECPGECLVTGQSHFKSFDNRYFTFSGVCHYLLAQDCQDHTF---------SVVIETVQCADDLDAVCTRSVTVRLPGHHNSLVKLKHGGGVSMDGQDIQIPLLQGDLRIQHTVMASV----------RLSYGEDLQMDWDGRGRLLVTLSPAYAGKTCGLCGNYNGNRGDDFVTPAGLAEPLVEDFGNAWKLLGACENLQK--QHRDPCSLNPRQARFAEEAC-ALLTSSKFEPCHRAVGPQPYVQNCRYDVCSCSDGRD-----CLCSAVANYAAACARRGVHIAWREPGFCALSCP-QGQVYLQCGTPCNMTCRSLSYPEEDCNEVCLEGCFCPPGLYLDERG-DCVPKAQCPCYYDGEIFQPEDIFSDHHTMCYCEDGFMHCTTSGGLGSLLPNPVLSSPRSHRSKRSLSCRPPMVKLVCPADNPRAEGLECAKTCQNYDLQCMSTGC-VSGCLCPQGMVRHENRCVALERCPCFHQGQEYAPGETV---KIDC-NTCVCRDRKWNC-TDHVCDATCSAIGMAHYLTFDGLKYLFPGECQYVLVQDYCGSNPGTFRILVGNEGCSYPSVKCKKRVTILVEGGEIELFDGE-----VNVKKPMKDETHFE-VVESGQYVILLLGKALSVVWDHRLSISVTLKRTYQEQVCGLCGNFDGIQNNDFTSSSLQIEEDPVDFGNSWKVNPQCADTKKVPLDSSPAVCHNNIMKQTMVDSSCRILTSDIFQDCNRLVDPEPFLDICIYDTCSCESIGDCTCFCDTIAAYAHVCAQHGKVVAWRTATFCPQNCEERNLHENGYECEWRYNSCAPACPITC-----QHPEPLACPVQCVEGCHAHCPPGKILDELLQTCIDPEDCPVCE-VAGRRLAPGKKIILNPSDPEHCQICHCDGVNFTC 1234          

HSP 2 Score: 122.479 bits (306), Expect = 3.341e-26
Identity = 89/368 (24.18%), Postives = 158/368 (42.93%), Query Frame = 2
Query: 3038 CKTWGETHYESFDGKYFEFQGSCSYVISEDFCGNKLGTFKLISENIACGXXXXXCTKSIKF-IYLNRVFQ---FVRGSNPIVSRNTNYPPGGPTAFYWTSDVDTHFILFTMEGIQVKWDKAMSLEIMIPEKYQNKVCGLCGNFDLRIDNDMRARSGEIEKDIVNFADSWKVHSS------CPVPQKPPFMCSKRPDREPWAKAKCEILKSDS-FKKCHDVVNVEHYYKRCVADACECDRGDDCVCFCTAVEQYVARCNEYEIGL-KWRTNENCPHTCTGKRVWKNCGNICPDSCIDIGKNVTDNTGCKKVCIEGCFCPDGLHWQNNECVERKACECVDPITNLKYNTGDKVIRECEECNCYEGAFRCT 4105
            C  +G     +FD   + F G CSY+++ D   + +                    K +   +YL   F    FV G+    +++ + P       Y  ++   + +     G   + D   + ++++ ++Y NK CGLCGNF++  ++D R + G +  D  +FA+SW + S          P  P  + S    +  W +  C++LKS S F +CH +V+ E +   C    C C +G +C C    + +Y   C +  I L  W  +  C   C     +K C + C  +C    +++     C++ C++GC CP+G       CV    C CV      +Y  G  ++++C  C C    + C+
Sbjct:   35 CSLFGGDFINTFDESMYSFAGDCSYLLAGDCQEHSVSLIGGFQNG-----------KRVSLSVYLGEFFDIHLFVNGTMLQGTQSISMPYAS-NGLYLEAEAGYYKLSSEAYGFVARIDGNGNFQVLLSDRYFNKTCGLCGNFNIFAEDDFRTQEGTLTSDPYDFANSWALSSGEQRCKRVSPPSSPCNVSSDEVQQVLWEQ--CQLLKSASVFARCHPLVDPEPFVALCERTLCTCVQGMECPC--AVLLEYARACAQQGIVLYGWTDHSVCRPACPAGMEYKECVSPCTRTC----QSLHVKEVCQEQCVDGCSCPEGQLLDEGHCVGSAECSCVH--AGQRYPPGASLLQDCHTCICRNSLWICS 380          

HSP 3 Score: 97.8265 bits (242), Expect = 1.015e-18
Identity = 112/459 (24.40%), Postives = 183/459 (39.87%), Query Frame = 2
Query: 1601 CFISGDPHYITFDRRHFFFDGHCEYTAVMTTSDNVLLSNSTIAPLSITIQNTNCQDNSETGCPRTIGVIIGEDEDQVAINLLSSSEIKVNFVKISLPYQHTGNTKVLIDQVSTDILRLKSETGVEILWNGGSRIEIKLSKK-YREKVTGMCGNFNGNEMDDSMTFKGVDEKDIDKFVLSWKTNPTCESDRGIVEYKGACALSRSYSDYANKVCHKLYESEEFKKCHSAANADKFFDQCTHDVCTCGMKRNGALDHCECEAFSSYARQCALENINLSWRTNELCPKKCPNENMKYNQCGSRCTSTCRLLQESKCKEECIEGCFCPEGETF-------DEAAKECVKISDCKCEFHGRFYLPYEIRQDRCNNCTCTNGNWI-CTSNDCEGKEFCPKSMAWFDCGICQ--KTCTNLDLVCPKGQ--CQLPGCFCP---------ENTVLHNGECIKPFECPC 2911
            C  S   H +TFD ++F   G C Y         VL  N     L + + N  C   ++  C ++I V      D +++ L S  ++ VN   +S+PY   G+ +V +       +R      +       +  +++LS + +  K  G+CG  + N  +D +   G    D    +  W      ++ + + E +  C +S S        C  L  SE F +CH       F+  C  D  +C  K+        CEA + YA  C  + + + WR    C   CP  ++ YN C   C   C     S C ++  EGCFCP  +         +EA  +C+     + +F   +   ++     C  CTC +G  + CT       + CP + A   CG C+  +   N +  CP+ +  C L  C  P         + T+ + GEC   F C C
Sbjct: 1950 CMGSSTRHIVTFDGQNFKLTGSCSY---------VLFQNKE-QDLEVILHNGACSPGAKETCMKSIEV----KHDGLSVELHSDMQMTVNGRLVSIPYV-GGDMEVNVYGTIMYEVRFNHLGHIFTFTPQNNEFQLQLSPRTFASKTYGLCGICDENGANDFILRDGTVTTDWKALIQEWTVQQLGKTCQPVPEEQ--CPVSSSSH------CQVLL-SELFAECHKVLAPATFYAMCQPD--SCHPKK-------VCEAIALYAHLCRTKGVCVDWRRANFCAMSCP-PSLVYNHCEHGCPRLCE-GNTSSCGDQPSEGCFCPPNQVMLEGSCVPEEACTQCISEDGVRHQFLETWVPAHQ----PCQICTCLSGRKVNCT------LQPCPTARAP-TCGPCEVARLRQNAEQCCPEYECVCDLVSCDLPPVPPCEDGLQMTLTNPGECRPNFTCAC 2362          

HSP 4 Score: 95.9005 bits (237), Expect = 3.554e-18
Identity = 93/371 (25.07%), Postives = 145/371 (39.08%), Query Frame = 2
Query: 3026 CSGICKTWGETHYESFDGKYFEFQGSCSYVISEDFCGNKLGTFKLISENIACGX-XXXXCTKSIKF------IYLNRVFQF-VRG---SNPIVSRNTNYPPGGPTAFYWTSDVDTHFILFTMEGIQVKWDKAMSLEIMIPEKYQNKVCGLCGNFDLRIDNDMRARSGEIEKDIVNFADSWKVHSSCPVPQKPPFMCSKRPDRE--PWAKAKCEILKSDSFKKCHDVVNVEHYYKRCVADACECDRGDDCVCFCTAVEQYVARCNEYEIGLKWRTNENCPHTCTGKRVWKNCGNICPDSCIDIGKNVTDNTGCKKVCIEGCFCPDGLHWQNNECVERKAC-ECV--DPITNLKYNTGDKVIRECEECNCYEG 4090
            C  +C      H  +FDG+ F+  GSCSYV+ +    NK    ++I  N AC   +  +C KSI+       + L+   Q  V G   S P V  +      G   +    +   H   FT +  + +         + P  + +K  GLCG  D    ND   R G +  D       W V       Q+    C   P+ +    + + C++L S+ F +CH V+    +Y  C  D+C   +       C A+  Y   C    + + WR    C  +C    V+ +C + CP  C        + + C     EGCFCP         CV  +AC +C+  D + +    T     + C+ C C  G
Sbjct: 1946 CPCVCMGSSTRHIVTFDGQNFKLTGSCSYVLFQ----NKEQDLEVILHNGACSPGAKETCMKSIEVKHDGLSVELHSDMQMTVNGRLVSIPYVGGDMEVNVYGTIMYEVRFNHLGHIFTFTPQNNEFQLQ-------LSPRTFASKTYGLCGICDENGANDFILRDGTVTTDWKALIQEWTV-------QQLGKTCQPVPEEQCPVSSSSHCQVLLSELFAECHKVLAPATFYAMCQPDSCHPKK------VCEAIALYAHLCRTKGVCVDWRRANFCAMSCPPSLVYNHCEHGCPRLC------EGNTSSCGDQPSEGCFCPPNQVMLEGSCVPEEACTQCISEDGVRHQFLETWVPAHQPCQICTCLSG 2286          

HSP 5 Score: 56.6102 bits (135), Expect = 3.135e-6
Identity = 76/350 (21.71%), Postives = 130/350 (37.14%), Query Frame = 2
Query:  479 HIKTFDGNVFSYPLRGGYTLFMDCLGAAPLFYVYFNASYDCFDQKTQNDCSISMKITVGTQTIILFPKNEFALVKNNKTKIPFNSEGIIVSSVGSFIKIKGIDDLEILFDRDRNIYVY-----------APVTAEKKICGLCGYFNGIMSDDYRDFNQVIQKNVKTFVNSWIDRDPSDLNVYREREQYPCNALKLKNNDQYQKALTLCQDMVKNNLGRTCQSEVKIDKYLDMCQDEICECLQTQPENSTIENCYSTFCKIEEQYSYACTLKGIAVDWRSATTICKQPQCFNGQEFSECGSNCGKNCGQLGMELECESQCLPGCYCPRNRYWDGTMCVPQEKCP-CVRDNG 1492
            HI TFDG  F       Y LF +      L  +  N +     ++T   C  S+++     ++ L    +   V      IP+    + V+  G+ +        E+ F+   +I+ +           +P T   K  GLCG  +   ++D+   +  +  + K  +  W  +           EQ P ++             + CQ ++ + L   C   +    +  MCQ + C      P+           C+    Y++ C  KG+ VDWR A   C    C     ++ C   C + C   G    C  Q   GC+CP N+      CVP+E C  C+ ++G
Sbjct: 1957 HIVTFDGQNFKLTGSCSYVLFQN--KEQDLEVILHNGACSPGAKET---CMKSIEVKHDGLSVELHSDMQMT-VNGRLVSIPYVGGDMEVNVYGTIM-------YEVRFNHLGHIFTFTPQNNEFQLQLSPRTFASKTYGLCGICDENGANDFILRDGTVTTDWKALIQEWTVQQLGKTCQPVPEEQCPVSSS------------SHCQVLL-SELFAECHKVLAPATFYAMCQPDSC-----HPKK---------VCEAIALYAHLCRTKGVCVDWRRAN-FCAM-SCPPSLVYNHCEHGCPRLCE--GNTSSCGDQPSEGCFCPPNQVMLEGSCVPEEACTQCISEDG 2262          
BLAST of von Willebrand factor vs. UniProt/SwissProt
Match: sp|Q8CIZ8|VWF_MOUSE (von Willebrand factor OS=Mus musculus OX=10090 GN=Vwf PE=1 SV=2)

HSP 1 Score: 504.212 bits (1297), Expect = 5.376e-145
Identity = 355/1264 (28.09%), Postives = 547/1264 (43.28%), Query Frame = 2
Query:  455 ECSVIYGHHIKTFDGNVFSYPLRGGYTLFMDCLGAAPLFYVYFNASYDCFDQKTQNDCSISMKITVGTQTIILFPKNEFALVKNNKTKIPFNSEGIIVSSVGSFIKIKG-IDDLEILFDRDRNIYVYAPVTAEKKICGLCGYFNGIMSDDYRDFNQVIQKNVKTFVNSWIDRDPSDLNVYREREQYPCNALKLKNNDQYQKALTLCQDMVKNNLGRTCQSEVKIDKYLDMCQDEICECLQTQPENSTIENCYSTFCKIEEQYSYACTLKGIAVDWRSATTICKQPQCFNGQEFSECGSNCGKNCGQLGMELECESQCLPGCYCPRNRYWDGTMCVPQEKCPCVRDNGESTYQQGYRLKLNCETCICGMHGKWQCIENEECEGRCFISGDPHYITFDRRHFFFDGHCEYTAVMTTSDNVLLSNSTIAPLSITIQNTNCQDNSETGCPRTIGVIIGEDEDQVAINLLSSSEIKVNFVKISLPYQHTGNTKVLIDQVSTDILRLKSETGVEILWNGGSRIEIKLSKKYREKVTGMCGNFNGNEMDDSMTFKGVDEKDIDKFVLSWKTNPTCESDRGIVEYKGACALSRSYSDYANKVCHKLYESEEFKKCHSAANADKFFDQCTHDVCTCGMKRNGALDHCECEAFSSYARQCALENINLSWRTNELCPKKCPNENMKYNQCGSRCTSTCRLLQ--ESKCKEECIEGCFCPEGETFDEAAKECVKISDCKCEFHGRFYLPYEIRQDRCNNCTCTNGNWICTSNDCEG---------------------------KEFCPKSMAWFDCGICQKTCTNLDLVCPKGQCQLPGCFCPENTVLHNGECIKPFECPCYMNNKMYSENDTIVRGPANCQNPCICKDGKWVCEQNKQCSGICKTWGETHYESFDGKYFEFQGSCSYVISEDFCGNKLGTFKLISENIACGXXXXXCTKSIKFIYLNRVFQFVRGSNPIVSRNTNYPPGGPTAFYWTSDVDTHFILFTMEGIQVKWDKAMSLEIMIPEKYQNKVCGLCGNFDLRIDNDMRARSGEIEKDIVNFADSWKVHSSCPVPQK-----PPFMCSKRPDREPWAKAKCEILKSDSFKKCHDVVNVEHYYKRCVADACECDRGDDCVCFCTAVEQYVARCNEYEIGLKWRTNENCPHTCTGKRVWKN----------CGNICPDSCIDIGKNVTDNTGCKKVCIEGC--FCPDG--LHWQNNECVERKACECVDPITNLKYNTGDKVI------RECEECNC 4081
             CS+     I TFD  ++S+     Y L  DC   +  F +  N          Q+   +S+ + +G    I    N   +  +    +P+ S+G+ +     + K+           D + N  V        K CGLCG FN    DD+R     +  +   F NSW     S      +R   P    +  + D +Q     CQ +   ++   C   V  + ++ +C+  +C C  T PE +         C +  +Y+  C  +G+ +   +  + C+ P C  G E+ EC S C + C  L +   C+ QC+ GC CP     D   CV    CPCV  +    Y  G  L  +C TCIC  +  W C  NEEC G C ++G  H+ +FD R+F F G C+Y       D+           SI I+   C D+ +  C R++ V +    + + + L     + ++   + LP+   G+ +  I       +RL     +++ W+G  R+ +KLS  Y  K  G+CGN+NGN+ DD +T  G+ E  +  F  +WK    C   R   ++   C+L+   + +A + C  L  S +F+ CH A +   +   C +DVC+C   R+     C C A ++YA +CA + +++ WR    C   CP +   Y QCG+ C  TCR L   + +C E C+EGC+CP G   DE   +CV  + C C + G  + P +I  D    C C +G   CT++   G                           K  CP          C KTC N DL      C + GC CP   V H  +C+    CPC+     Y+  DT+  G     N C+C++ KW C  N  C       G  HY +FDG  + F G C YV+  D+CG+  GTF+++  N  C   S  C K +  +      +   G   +        P    + +   +   + IL   + + V WD  +S+ +++   YQ +VCGLCGNFD   +ND    S ++E+D VNF +SWKV S C   +K      P  C     ++    + C IL SD F+ C+ +V+ E Y   C+ D C C+   DC CFC  +  Y   C ++   + WRT   CP +C  K V +N          C   CP +C        +   C   C+EGC   CP G  L      CV+ + C   + +   +   G K+         C+ C+C
Sbjct:   34 RCSLFGDDFINTFDETMYSFAGGCSYLLAGDCQKRS--FSILGN---------FQDGKRMSLSVYLGEFFDIHLFANGTVMQGDQSISMPYASQGLYLELEAGYYKLSSETFGFAARIDGNGNFQVLMSDRHFNKTCGLCGDFNIFAEDDFRTQEGTLTSDPYDFANSWAL---SSEEQRCKRASPPSRNCESSSGDMHQAMWEQCQLLKTASVFARCHPLVDPESFVALCEKILCTC-ATGPECA---------CPVLLEYARTCAQEGMVLYGWTDHSACR-PACPAGMEYKECVSPCPRTCQSLSINEVCQQQCVDGCSCPEGELLDEDRCVQSSDCPCV--HAGKRYPPGTSLSQDCNTCIC-RNSLWIC-SNEECPGECLVTGQSHFKSFDNRYFTFSGICQYLLARDCEDHT---------FSIVIETMQCADDPDAVCTRSVSVRLSALHNSL-VKLKHGGAVGIDGQDVQLPFLQ-GDLR--IQHTVMASVRLSYAEDLQMDWDGRGRLLVKLSPVYSGKTCGLCGNYNGNKGDDFLTPAGLVEPLVVDFGNAWKLQGDCSDLRR--QHSDPCSLNPRLTRFAEEAC-ALLTSSKFEACHHAVSPLPYLQNCRYDVCSCSDSRD-----CLCNAVANYAAECARKGVHIGWREPGFCALGCP-QGQVYLQCGNSCNLTCRSLSLPDEECSEVCLEGCYCPPGLYQDERG-DCVPKAQCPCYYDGELFQPADIFSDHHTMCYCEDGFMHCTTSGTLGSLLPDTVLSSPLSHRSKRSLSCRPPMVKLVCPADNPRAQGLECAKTCQNYDLERMSLGC-VSGCLCPPGMVRHENKCVALERCPCFHQGAEYAPGDTVKIG----CNTCVCRERKWNC-TNHVCDATRSAIGMAHYLTFDGLKYLFPGECQYVLVYDYCGSNPGTFQILVGNEGCSYPSVKCRKRVTILVDGGELELFDGEVNVKR------PLRDESHFEVVESGRYVILLLGQALSVVWDHHLSISVVLKHTYQEQVCGLCGNFDGIQNNDSTTSSLQVEEDPVNFGNSWKVSSQCADTRKLSLDVSPATCHNNIMKQTMVDSACRILTSDVFQGCNRLVDPEPYLDICIYDTCSCESIGDCACFCDTIAAYAHVCAQHGQVVAWRTPTLCPQSCEEKNVRENGYECEWRYNSCAPACPVTC-----QHPEPLACPVQCVEGCHAHCPPGRILDELLQTCVDPQDCPVCE-VAGRRLAPGKKITLSPDDPAHCQNCHC 1227          

HSP 2 Score: 125.176 bits (313), Expect = 4.509e-27
Identity = 90/372 (24.19%), Postives = 165/372 (44.35%), Query Frame = 2
Query: 3014 QNKQCSGICKTWGETHYESFDGKYFEFQGSCSYVISEDFCGNKLGTFKLISENIACGXXXXXCTKSIKFIYLNRVFQFVRGSNPIVSRNTNY--PPGGPTAFYWTSDVDTHFILFTMEGIQVKWDKAMSLEIMIPEKYQNKVCGLCGNFDLRIDNDMRARSGEIEKDIVNFADSWKVHSS---CPVPQKPPFMC-SKRPDREPWAKAKCEILKSDS-FKKCHDVVNVEHYYKRCVADACECDRGDDCVCFCTAVEQYVARCNEYEIGL-KWRTNENCPHTCTGKRVWKNCGNICPDSCIDIGKNVTDNTGCKKVCIEGCFCPDGLHWQNNECVERKACECVDPITNLKYNTGDKVIRECEECNCYEGAFRCT 4105
            +++  +  C  +G+    +FD   + F G CSY+++ D C  +  +F ++  N   G       +    +YL   F     +N  V +       P      Y   +   + +     G   + D   + ++++ +++ NK CGLCG+F++  ++D R + G +  D  +FA+SW + S    C     P   C S   D       +C++LK+ S F +CH +V+ E +   C    C C  G +C C    + +Y   C +  + L  W  +  C   C     +K C + CP +C    ++++ N  C++ C++GC CP+G     + CV+   C CV      +Y  G  + ++C  C C    + C+
Sbjct:   27 RDRPSTARCSLFGDDFINTFDETMYSFAGGCSYLLAGD-CQKR--SFSILG-NFQDG------KRMSLSVYLGEFFDIHLFANGTVMQGDQSISMPYASQGLYLELEAGYYKLSSETFGFAARIDGNGNFQVLMSDRHFNKTCGLCGDFNIFAEDDFRTQEGTLTSDPYDFANSWALSSEEQRCKRASPPSRNCESSSGDMHQAMWEQCQLLKTASVFARCHPLVDPESFVALCEKILCTCATGPECAC--PVLLEYARTCAQEGMVLYGWTDHSACRPACPAGMEYKECVSPCPRTC----QSLSINEVCQQQCVDGCSCPEGELLDEDRCVQSSDCPCVH--AGKRYPPGTSLSQDCNTCICRNSLWICS 380          

HSP 3 Score: 105.916 bits (263), Expect = 3.843e-21
Identity = 99/392 (25.26%), Postives = 157/392 (40.05%), Query Frame = 2
Query: 2963 ANCQNPCICKDGKWVCEQNKQCSGICKTWGETHYESFDGKYFEFQGSCSYVISEDFCGNKLGTFKLISENIACGX-XXXXCTKSIKFIYLNRVFQF-------VRGS---NPIVSRNTNYPPGGPTAFYWTSDVDTHFILFTMEGIQVKWDKAMSLEIMIPEKYQNKVCGLCGNFDLRIDNDMRARSGEIEKDIVNFADSWKVHSSCPVPQKPPFMCSKRPDRE-PWA-KAKCEILKSDSFKKCHDVVNVEHYYKRCVADACECDRGDDCVCFCTAVEQYVARCNEYEIGLKWRTNENCPHTCTGKRVWKNCGNICPDSCIDIGKNVTDNTGCKKVCIEGCFCPDGLHWQNNECVERKAC-ECV--DPITNLKYNTGDKVIRECEECNCYEG 4090
            AN Q+P   ++    C     C  +C      H  +FDG+ F+  GSCSYVI +    NK    +++  N AC   +  +C KSI+  +     +        V G     P V  N      G   +        H + +T +  + +         + P+ + +K+ GLCG  D    ND   R G +  D       W V       Q+P + C   P+ + P +  + C++L S SF +CH V+    ++  C  D+C  +R       C  +  Y   C    + + WRT + C  +C    V+ +C   CP  C        + + C     EGCFCP    +    CV  +AC +CV  D + +    T     + C+ C C  G
Sbjct: 1928 ANSQSPVRVEE---TCGCRWTCPCVCTGSSTRHIVTFDGQNFKLTGSCSYVIFQ----NKEQDLEVLLHNGACSPGAKQACMKSIEIKHAGVSAELHSNMEMAVDGRLVLAPYVGENMEVSIYGAIMYEVRFTHLGHILTYTPQNNEFQLQ-------LSPKTFASKMHGLCGICDENGANDFTLRDGTVTTDWKRLVQEWTV-------QQPGYTCQAVPEEQCPVSDSSHCQVLLSASFAECHKVIAPATFHTICQQDSCHQER------VCEVIASYAHLCRTSGVCVDWRTTDFCAMSCPPSLVYNHCERGCPRHCDG------NTSFCGDHPSEGCFCPQHQVFLEGSCVPEEACTQCVGEDGVRHQFLETWVPDHQPCQICMCLSG 2286          

HSP 4 Score: 92.4337 bits (228), Expect = 4.038e-17
Identity = 116/461 (25.16%), Postives = 176/461 (38.18%), Query Frame = 2
Query: 1601 CFISGDPHYITFDRRHFFFDGHCEYTAVMTTSDNVLLSNSTIAPLSITIQNTNCQDNSETGCPRTIGVIIGEDEDQVAINLLSSSEIKVNFVKISLPYQHTGNTKVLIDQVSTDILRLKSETGVEILWNGGSRIEIKLSKK-YREKVTGMCGNFNGNEMDDSMTFKGVDEKDIDKFVLSWKTNPTCESDRGIVEYKGACALSRSYSDYANKVCHKLYESEEFKKCHSAANADKFFDQCTHDVCTCGMKRNGALDHCECEAFSSYARQCALENINLSWRTNELCPKKCPNENMKYNQCGSRCTSTCRLLQESKCKEECIEGCFCPEGETF-------DEAAKECVKISDCKCEFHGRFYLPYEIRQDRCNNCTCTNGNWI-CTSNDCEGKEFCPKSMAWFDCGICQ----KTCTNL-----DLVCPKGQCQLP------GCFCPENTVLHNGECIKPFECPC 2911
            C  S   H +TFD ++F   G C Y        +          L + + N  C   ++  C ++I +        V+  L S+ E+ V+   +  PY    N +V I       +R      +       +  +++LS K +  K+ G+CG  + N  +D     G    D  + V  W       + + + E +  C +S S        C  L  S  F +CH       F   C  D  +C  +R        CE  +SYA  C    + + WRT + C   CP  ++ YN C   C   C     S C +   EGCFCP+ + F       +EA  +CV     + +F   +   ++     C  C C +G  I CT+        CP + A   CG C+    K  TNL     + VC    C LP      G   P  T+ + GEC   F C C
Sbjct: 1950 CTGSSTRHIVTFDGQNFKLTGSCSYVIFQNKEQD----------LEVLLHNGACSPGAKQACMKSIEI----KHAGVSAELHSNMEMAVDGRLVLAPYVGE-NMEVSIYGAIMYEVRFTHLGHILTYTPQNNEFQLQLSPKTFASKMHGLCGICDENGANDFTLRDGTVTTDWKRLVQEWTVQQPGYTCQAVPEEQ--CPVSDSSH------CQVLL-SASFAECHKVIAPATFHTICQQD--SCHQER-------VCEVIASYAHLCRTSGVCVDWRTTDFCAMSCP-PSLVYNHCERGCPRHCD-GNTSFCGDHPSEGCFCPQHQVFLEGSCVPEEACTQCVGEDGVRHQFLETWVPDHQ----PCQICMCLSGRKINCTAQP------CPTARAP-TCGPCEVARLKQSTNLCCPEYECVCDLFNCNLPPVPPCEGGLQP--TLTNPGECRPTFTCDC 2362          

HSP 5 Score: 60.8474 bits (146), Expect = 1.655e-7
Identity = 76/350 (21.71%), Postives = 128/350 (36.57%), Query Frame = 2
Query:  479 HIKTFDGNVFSYPLRGGYTLFMDCLGAAPLFYVYFNASYDCFDQKTQNDCSISMKITVGTQTIILFPKNEFALVKNNKTKIPFNSEGIIVSSVGSFIKIKGIDDLEILFDRDRNIYVY-----------APVTAEKKICGLCGYFNGIMSDDYRDFNQVIQKNVKTFVNSWIDRDPSDLNVYREREQYPCNALKLKNNDQYQKALTLCQDMVKNNLGRTCQSEVKIDKYLDMCQDEICECLQTQPENSTIENCYSTFCKIEEQYSYACTLKGIAVDWRSATTICKQPQCFNGQEFSECGSNCGKNCGQLGMELECESQCLPGCYCPRNRYWDGTMCVPQEKCP-CVRDNG 1492
            HI TFDG  F       Y +F +      L  +  N +        +  C  S++I     +  L    E A V       P+  E + VS  G+ +        E+ F    +I  Y           +P T   K+ GLCG  +   ++D+   +  +  + K  V  W  + P           Y C A+  +         + CQ ++  +    C   +    +  +CQ + C                   C++   Y++ C   G+ VDWR+ T  C    C     ++ C   C ++C   G    C      GC+CP+++ +    CVP+E C  CV ++G
Sbjct: 1957 HIVTFDGQNFKLTGSCSYVIFQN--KEQDLEVLLHNGA---CSPGAKQACMKSIEIKHAGVSAELHSNMEMA-VDGRLVLAPYVGENMEVSIYGAIM-------YEVRFTHLGHILTYTPQNNEFQLQLSPKTFASKMHGLCGICDENGANDFTLRDGTVTTDWKRLVQEWTVQQPG----------YTCQAVPEEQCPVSDS--SHCQVLLSASFAE-CHKVIAPATFHTICQQDSCH--------------QERVCEVIASYAHLCRTSGVCVDWRT-TDFCAM-SCPPSLVYNHCERGCPRHCD--GNTSFCGDHPSEGCFCPQHQVFLEGSCVPEEACTQCVGEDG 2262          
BLAST of von Willebrand factor vs. UniProt/SwissProt
Match: sp|P04275|VWF_HUMAN (von Willebrand factor OS=Homo sapiens OX=9606 GN=VWF PE=1 SV=4)

HSP 1 Score: 499.59 bits (1285), Expect = 1.801e-143
Identity = 353/1264 (27.93%), Postives = 557/1264 (44.07%), Query Frame = 2
Query:  443 STYYECSVIYGHHIKTFDGNVFSYPLRGGYTLFMDCLGAAPLFYVYFNASYDCFDQKTQNDCSISMKITVGTQTIILFPKNEFALVKNNKTKIPFNSEGIIVSSVGSFIKIKG-IDDLEILFDRDRNIYVYAPVTAEKKICGLCGYFNGIMSDDYRDFNQVIQKNVKTFVNSWIDRDPSDLNVYREREQYPCNALKLKNNDQYQKALTLCQDMVKNNLGRTCQSEVKIDKYLDMCQDEICECLQTQPENSTIENCYSTFCKIEEQYSYACTLKGIAVDWRSATTICKQPQCFNGQEFSECGSNCGKNCGQLGMELECESQCLPGCYCPRNRYWDGTMCVPQEKCPCVRDNGESTYQQGYRLKLNCETCICGMHGKWQCIENEECEGRCFISGDPHYITFDRRHFFFDGHCEYTAVMTTSDNVLLSNSTIAPLSITIQNTNCQDNSETGCPRTIGVIIGEDEDQVAINLLSSSEIKVNFVKISLPYQHTGNTKVLIDQVSTDILRLKSETGVEILWNGGSRIEIKLSKKYREKVTGMCGNFNGNEMDDSMTFKGVDEKDIDKFVLSWKTNPTCESDRGIVEYKGACALSRSYSDYANKVCHKLYESEEFKKCHSAANADKFFDQCTHDVCTCGMKRNGALDHCECEAFSSYARQCALENINLSWRTNELCPKKCPNENMKYNQCGSRCTSTCRLLQ--ESKCKEECIEGCFCPEGETFDEAAKECVKISDCKCEFHGRFYLPYEIRQDRCNNCTCTNGNWICTSNDCEG---------------------------KEFCPKSMAWFDCGICQKTCTNLDLVCPKGQCQLPGCFCPENTVLHNGECIKPFECPCYMNNKMYSENDTIVRGPANCQNPCICKDGKWVCEQNKQCSGICKTWGETHYESFDGKYFEFQGSCSYVISEDFCGNKLGTFKLISENIACGXXXXXCTKSIKFIYLNRVFQFVRGSNPIVSRNTNYPPGGPTAFYWTSDVDTHFILFTMEGIQVKWDKAMSLEIMIPEKYQNKVCGLCGNFDLRIDNDMRARSGEIEKDIVNFADSWKVHSSCPVPQKPPF-----MCSKRPDREPWAKAKCEILKSDSFKKCHDVVNVEHYYKRCVADACECDRGDDCVCFCTAVEQYVARCNEYEIGLKWRTNENCPHTCTGKRVWKNC------GNICPDSCIDIGKNVTDNTGCKKVCIEGC--FCPDG--LHWQNNECVERKACECVDPITNLKYNTGDKVI------RECEECNC 4081
            S+   CS+     + TFDG+++S+    GY  ++   G     +              QN   +S+ + +G    I    N      + +  +P+ S+G+ + +   + K+ G         D   N  V        K CGLCG FN    DD+      +  +   F NSW     S    + ER   P ++  + + +  +     CQ +   ++   C   V  + ++ +C+  +CEC                 C    +Y+  C  +G+ +   +  + C  P C  G E+ +C S C + C  L +   C+ +C+ GC CP  +  D  +CV   +CPCV       Y  G  L  +C TCIC  + +W C  NEEC G C ++G  H+ +FD R+F F G C+Y       D+           SI I+   C D+ +  C R++ V +    + + + L   + + ++   + LP        + I    T  +RL     +++ W+G  R+ +KLS  Y  K  G+CGN+NGN+ DD +T  G+ E  ++ F  +WK +  C+  +   ++   CAL+   + ++ + C  L  S  F+ CH A +   +   C +DVC+C   R      C C A +SYA  CA   + ++WR    C   CP   + Y QCG+ C  TCR L   + +C E C+EGCFCP G   DE   +CV  + C C + G  + P +I  D    C C +G   CT +   G                           K  CP      +   C KTC N DL C    C + GC CP   V H   C+    CPC+   K Y+  +T+  G     N C+C+D KW C  +  C   C T G  HY +FDG  + F G C YV+ +D+CG+  GTF+++  N  C   S  C K +  +      +   G       N   P    T F    +   + IL   + + V WD+ +S+ +++ + YQ KVCGLCGNFD   +ND+ + + ++E+D V+F +SWKV S C   +K P       C     ++    + C IL SD F+ C+ +V+ E Y   C+ D C C+   DC CFC  +  Y   C ++   + WRT   CP +C  + + +N        N C  +C  +     +   C   C+EGC   CP G  L      CV+ + C   + +   ++ +G KV         C+ C+C
Sbjct:   30 SSTARCSLFGSDFVNTFDGSMYSF---AGYCSYLLAGGCQKRSFSIIG--------DFQNGKRVSLSVYLGEFFDIHLFVNGTVTQGDQRVSMPYASKGLYLETEAGYYKLSGEAYGFVARIDGSGNFQVLLSDRYFNKTCGLCGNFNIFAEDDFMTQEGTLTSDPYDFANSWAL---SSGEQWCERASPPSSSCNISSGEMQKGLWEQCQLLKSTSVFARCHPLVDPEPFVALCEKTLCEC----------AGGLECACPALLEYARTCAQEGMVLYGWTDHSACS-PVCPAGMEYRQCVSPCARTCQSLHINEMCQERCVDGCSCPEGQLLDEGLCVESTECPCVHSG--KRYPPGTSLSRDCNTCIC-RNSQWIC-SNEECPGECLVTGQSHFKSFDNRYFTFSGICQYLLARDCQDHSF---------SIVIETVQCADDRDAVCTRSVTVRLPGLHNSL-VKLKHGAGVAMDGQDVQLPLL---KGDLRIQHTVTASVRLSYGEDLQMDWDGRGRLLVKLSPVYAGKTCGLCGNYNGNQGDDFLTPSGLAEPRVEDFGNAWKLHGDCQDLQK--QHSDPCALNPRMTRFSEEACAVL-TSPTFEACHRAVSPLPYLRNCRYDVCSCSDGRE-----CLCGALASYAAACAGRGVRVAWREPGRCELNCPKGQV-YLQCGTPCNLTCRSLSYPDEECNEACLEGCFCPPGLYMDERG-DCVPKAQCPCYYDGEIFQPEDIFSDHHTMCYCEDGFMHCTMSGVPGSLLPDAVLSSPLSHRSKRSLSCRPPMVKLVCPADNLRAEGLECTKTCQNYDLECMSMGC-VSGCLCPPGMVRHENRCVALERCPCFHQGKEYAPGETVKIG----CNTCVCQDRKWNC-TDHVCDATCSTIGMAHYLTFDGLKYLFPGECQYVLVQDYCGSNPGTFRILVGNKGCSHPSVKCKKRVTILVEGGEIELFDGE-----VNVKRPMKDETHFE-VVESGRYIILLLGKALSVVWDRHLSISVVLKQTYQEKVCGLCGNFDGIQNNDLTSSNLQVEEDPVDFGNSWKVSSQCADTRKVPLDSSPATCHNNIMKQTMVDSSCRILTSDVFQDCNKLVDPEPYLDVCIYDTCSCESIGDCACFCDTIAAYAHVCAQHGKVVTWRTATLCPQSCEERNLRENGYECEWRYNSCAPAC-QVTCQHPEPLACPVQCVEGCHAHCPPGKILDELLQTCVDPEDCPVCE-VAGRRFASGKKVTLNPSDPEHCQICHC 1227          

HSP 2 Score: 130.568 bits (327), Expect = 1.111e-28
Identity = 97/386 (25.13%), Postives = 171/386 (44.30%), Query Frame = 2
Query: 2984 ICKDGKWVCEQNKQCSGICKTWGETHYESFDGKYFEFQGSCSYVISEDFCGNKLGTFKLISENIACGXXXXXCTKSIKF-IYLNRVFQ---FVRGSNPIVSRNTNYPPGGPTAFYWTSDVDTHFILFTMEGIQVKWDKAMSLEIMIPEKYQNKVCGLCGNFDLRIDNDMRARSGEIEKDIVNFADSWKVHSS---CPVPQKPPFMC---SKRPDREPWAKAKCEILKSDS-FKKCHDVVNVEHYYKRCVADACECDRGDDCVCFCTAVEQYVARCNEYEIGL-KWRTNENCPHTCTGKRVWKNCGNICPDSCIDIGKNVTDNTGCKKVCIEGCFCPDGLHWQNNECVERKACECVDPITNLKYNTGDKVIRECEECNCYEGAFRCT 4105
            +C +G     + +  +  C  +G     +FDG  + F G CSY+++    G +  +F +I +            K +   +YL   F    FV G+     +  + P       Y  ++   + +     G   + D + + ++++ ++Y NK CGLCGNF++  ++D   + G +  D  +FA+SW + S    C     P   C   S    +  W +  C++LKS S F +CH +V+ E +   C    CEC  G +C C   A+ +Y   C +  + L  W  +  C   C     ++ C + C  +C    +++  N  C++ C++GC CP+G       CVE   C CV   +  +Y  G  + R+C  C C    + C+
Sbjct:   21 LCAEGT----RGRSSTARCSLFGSDFVNTFDGSMYSFAGYCSYLLAG---GCQKRSFSIIGD--------FQNGKRVSLSVYLGEFFDIHLFVNGTVTQGDQRVSMPYAS-KGLYLETEAGYYKLSGEAYGFVARIDGSGNFQVLLSDRYFNKTCGLCGNFNIFAEDDFMTQEGTLTSDPYDFANSWALSSGEQWCERASPPSSSCNISSGEMQKGLWEQ--CQLLKSTSVFARCHPLVDPEPFVALCEKTLCECAGGLECAC--PALLEYARTCAQEGMVLYGWTDHSACSPVCPAGMEYRQCVSPCARTC----QSLHINEMCQERCVDGCSCPEGQLLDEGLCVESTECPCVH--SGKRYPPGTSLSRDCNTCICRNSQWICS 380          

HSP 3 Score: 101.679 bits (252), Expect = 7.298e-20
Identity = 118/461 (25.60%), Postives = 178/461 (38.61%), Query Frame = 2
Query: 1601 CFISGDPHYITFDRRHFFFDGHCEYTAVMTTSDNVLLSNSTIAPLSITIQNTNCQDNSETGCPRTIGVIIGEDEDQVAINLLSSSEIKVNFVKISLPYQHTGNTKVLIDQVSTDILRLKSETGVEILWNGGSRIEIKLSKK-YREKVTGMCGNFNGNEMDDSMTFKGVDEKDIDKFVLSWKTNPTCESDRGIVEYKGACALSRSYSDYANKVCHKLYESEEFKKCHSAANADKFFDQCTHDVCTCGMKRNGALDHCE--CEAFSSYARQCALENINLSWRTNELCPKKCPNENMKYNQCGSRCTSTCRLLQESKCKEECIEGCFCPEGETF-------DEAAKECVKISDCKCEFHGRFYLPYEIRQDRCNNCTCTNGNWI-CTSNDCEGKEFCPKSMAWFDCGICQ--KTCTNLDLVCPKGQC----------QLPGCFCPENTVLHN-GECIKPFECPC 2911
            C  S   H +TFD ++F   G C Y         VL  N     L + + N  C   +  GC ++I V        +++ L S  E+ VN   +S+PY   GN +V +       +R      +       +  +++LS K +  K  G+CG  + N  +D M   G    D    V  W      ++ + I+E +  C +  S        C  L     F +CH       F+  C  D C           H E  CE  +SYA  C    + + WRT + C   CP  ++ YN C   C   C     S C +   EGCFCP  +         +EA  +C+     + +F   +   ++     C  CTC +G  + CT+        CP + A   CG+C+  +   N D  CP+ +C           +P C       L N GEC   F C C
Sbjct: 1950 CTGSSTRHIVTFDGQNFKLTGSCSY---------VLFQNKE-QDLEVILHNGACSPGARQGCMKSIEV----KHSALSVELHSDMEVTVNGRLVSVPYV-GGNMEVNVYGAIMHEVRFNHLGHIFTFTPQNNEFQLQLSPKTFASKTYGLCGICDENGANDFMLRDGTVTTDWKTLVQEWTVQRPGQTCQPILEEQ--CLVPDSSH------CQVLL-LPLFAECHKVLAPATFYAICQQDSC-----------HQEQVCEVIASYAHLCRTNGVCVDWRTPDFCAMSCP-PSLVYNHCEHGCPRHCD-GNVSSCGDHPSEGCFCPPDKVMLEGSCVPEEACTQCIGEDGVQHQFLEAWVPDHQ----PCQICTCLSGRKVNCTTQP------CPTAKAP-TCGLCEVARLRQNADQCCPEYECVCDPVSCDLPPVPHCERGLQPTLTNPGECRPNFTCAC 2362          

HSP 4 Score: 90.8929 bits (224), Expect = 1.175e-16
Identity = 92/371 (24.80%), Postives = 141/371 (38.01%), Query Frame = 2
Query: 3026 CSGICKTWGETHYESFDGKYFEFQGSCSYVISEDFCGNKLGTFKLISENIACGXXXXX-CTKSIKFIYLNRVFQF-------VRG---SNPIVSRNTNYPPGGPTAFYWTSDVDTHFILFTMEGIQVKWDKAMSLEIMIPEKYQNKVCGLCGNFDLRIDNDMRARSGEIEKDIVNFADSWKVHSSCPVPQKPPFMCSKRPDREPWA--KAKCEILKSDSFKKCHDVVNVEHYYKRCVADACECDRGDDCVCFCTAVEQYVARCNEYEIGLKWRTNENCPHTCTGKRVWKNCGNICPDSCIDIGKNVTDNTGCKKVCIEGCFCPDGLHWQNNECVERKAC-ECV--DPITNLKYNTGDKVIRECEECNCYEG 4090
            C  +C      H  +FDG+ F+  GSCSYV+ +    NK    ++I  N AC   +   C KSI+  +     +        V G   S P V  N      G        +   H   FT +  + +         + P+ + +K  GLCG  D    ND   R G +  D       W V       Q+P   C    + +      + C++L    F +CH V+    +Y  C  D+C  ++       C  +  Y   C    + + WRT + C  +C    V+ +C + CP  C     NV+    C     EGCFCP         CV  +AC +C+  D + +          + C+ C C  G
Sbjct: 1946 CPCVCTGSSTRHIVTFDGQNFKLTGSCSYVLFQ----NKEQDLEVILHNGACSPGARQGCMKSIEVKHSALSVELHSDMEVTVNGRLVSVPYVGGNMEVNVYGAIMHEVRFNHLGHIFTFTPQNNEFQLQ-------LSPKTFASKTYGLCGICDENGANDFMLRDGTVTTDWKTLVQEWTV-------QRPGQTCQPILEEQCLVPDSSHCQVLLLPLFAECHKVLAPATFYAICQQDSCHQEQ------VCEVIASYAHLCRTNGVCVDWRTPDFCAMSCPPSLVYNHCEHGCPRHC---DGNVSS---CGDHPSEGCFCPPDKVMLEGSCVPEEACTQCIGEDGVQHQFLEAWVPDHQPCQICTCLSG 2286          

HSP 5 Score: 56.225 bits (134), Expect = 3.868e-6
Identity = 73/351 (20.80%), Postives = 126/351 (35.90%), Query Frame = 2
Query:  476 HHIKTFDGNVFSYPLRGGYTLFMDCLGAAPLFYVYFNASYDCFDQKTQNDCSISMKITVGTQTIILFPKNEFALVKNNKTKIPFNSEGIIVSSVGSFIKIKGIDDLEILFDRDRNIYVY-----------APVTAEKKICGLCGYFNGIMSDDYRDFNQVIQKNVKTFVNSWIDRDPSDLNVYREREQYPCNALKLKNNDQYQKALTLCQDMVKNNLGRTCQSEVKIDKYLDMCQDEICECLQTQPENSTIENCYSTFCKIEEQYSYACTLKGIAVDWRSATTICKQPQCFNGQEFSECGSNCGKNCGQLGMELECESQCLPGCYCPRNRYWDGTMCVPQEKCP-CVRDNG 1492
             HI TFDG  F       Y LF +      L  +  N +        +  C  S+++     ++ L    E   V      +P+    + V+  G+ +        E+ F+   +I+ +           +P T   K  GLCG  +   ++D+   +  +  + KT V  W  + P         EQ       L  +  + + L L        L   C   +    +  +CQ + C   Q               C++   Y++ C   G+ VDWR+    C    C     ++ C   C ++C   G    C      GC+CP ++      CVP+E C  C+ ++G
Sbjct: 1956 RHIVTFDGQNFKLTGSCSYVLFQN--KEQDLEVILHNGA---CSPGARQGCMKSIEVKHSALSVELHSDMEVT-VNGRLVSVPYVGGNMEVNVYGAIMH-------EVRFNHLGHIFTFTPQNNEFQLQLSPKTFASKTYGLCGICDENGANDFMLRDGTVTTDWKTLVQEWTVQRPGQTCQPILEEQC------LVPDSSHCQVLLL-------PLFAECHKVLAPATFYAICQQDSCHQEQV--------------CEVIASYAHLCRTNGVCVDWRTP-DFCAM-SCPPSLVYNHCEHGCPRHCD--GNVSSCGDHPSEGCFCPPDKVMLEGSCVPEEACTQCIGEDG 2262          
BLAST of von Willebrand factor vs. UniProt/SwissProt
Match: sp|P98088|MUC5A_HUMAN (Mucin-5AC OS=Homo sapiens OX=9606 GN=MUC5AC PE=1 SV=4)

HSP 1 Score: 490.73 bits (1262), Expect = 2.667e-140
Identity = 367/1280 (28.67%), Postives = 565/1280 (44.14%), Query Frame = 2
Query:  416 VTRVNNTMYSTYYECSVIYGHHIKTFDGNVFSYPLRGGYTLFMDCLGAAPLFYVYFNASYDCFDQKTQNDCSISM-KITVGTQTIILFPKNEFALVKNNKTKIPFNSEGIIVSSVGSFIKIKGIDDLEILFDRDRNIYVYAPVTAEKKICGLCGYFNGIMSDDYRDFNQVIQKNVKT----FVNSWIDRDPSDLNVYREREQYPCNALKLKNNDQYQKALTLCQDMVKNNLGRTCQSEVKIDKYLDMCQDEICECLQTQPENSTIENCYSTFCKIEEQYSYACT-LKGIAVDWRSATTICKQPQCFNGQEFSECGSNCGKNCGQLGMELECESQCLPGCYCPRNRYWDG---TMCVPQEKCPCVRDNGESTYQQGYRLKLNCETCICGMHGKWQCIENEECEGRCFISGDPHYITFDRRHFFFDGHCEYTAVMTTSDNVLLSNSTIAPLSITIQNTNCQDNSETGCPRTIGVIIGEDEDQVAINLLSSSEIKVNFVKISLPYQHTGNTKVLIDQVSTDILRLKSETGVEILWNGGSRIEI--KLSKKYREKVTGMCGNFNGNEMDDSMTFKGVDEKDIDKFVLSWKTNPTCESDRGIVEYKGACALSRSYSDYANKVCHKLYESE-EFKKCHSAANADKFFDQCTHDVCTCGMKRNGALDHCECEAFSSYARQCALENINLSWRTNELCPKK---CPNENMKYNQCGSRCTSTCRLLQESKCKEEC----IEGCFCPEGETFDEAAKECVKISDCKCEFHGRFYLPYEIRQDRCNNCTCTNGNWICTSNDCEGKEFCPKSMAWFDC---------GICQKTCTNLDLVCPKGQCQLPGCFCPENTVLHN-GECIKPFECPCYMNNKMYSENDTIVRGPANCQNPCICKDGKWVCEQNKQCSGICKTWGETHYESFDGKYFEFQGSCSYVISEDFCGNKLGT---FKLISENIACGXXXXXCTKSIKFIYLNRVFQFVRGSNPIVSRNTNYPPGGPTAFYWTSDVDTHFILFTMEGIQVKWDKAMSLEIMIPEKYQNKVCGLCGNFDLRIDNDMRARSGEIEKDIVNFADSWKVHSSCPVPQKPPFMCSKRPDREPWAKAKCEILKSDSFKKCHDVVNVEHYYKRCVADACECDRGDDCVCFCTAVEQYVARCNEYEIGLKWRTNENCPHTC-----TGKRVW--KNCGNICPDSCIDI-GKNVTDNTGCKKVCIEGCF--CPDG---LHWQNNECVERKACECVDP---ITNLKYNTGDKVI--RECEECNCYEGAFRCT 4105
            V R +N  ++    CS     H KTFDG+VF +P    Y +F +  GAA   Y  FN       +++Q   + ++ ++ +    +++       LV  +   +PF+  G+++    S+ K++    L ++++ D ++ +        K CGLCG FNG+        ++++  N K     F N     DP+D           C     +          +C++++   L   C + V +  YL+ C+ ++C C     E++ + +C    C    +YS  CT   G+  DWR     C Q +C N  ++ EC S C   C        CE  C+ GC+CP     D    T CVP  KC CV +   + Y  G     +C  C C   G+W C E   C G C + G  H+ TFD + +   G C Y         VL      +  ++  +   C       C ++  V +  D  Q  + + +S E+ +N +   LP        V I + ST  +  ++  G+++       +++  +L+ K R +  G+CGNFN  + DD  T  GV E     F  ++KT   C + R    ++  C+LS     YA   C +L +++  F +CH+A     ++  C  D C C    +     C C A SSY   CA + + L    + +C K    CP ++M Y+   S C  TCR L E           ++GC CP+G   D+  K CV+ S+C C   G      E   D    CTCT+G   C          C   M +FDC           CQK+C  LD+ C   QC +PGC CP+  V    G CI   +CPC  N   Y    TI  G   C N C C    W C  +  C   C  +G+ HY +FDG+ + F G C Y + ++ CG K  T   F++++EN+ CG++ ++C+K+IK        +   G   ++  + +         Y    +  + ++ T  G+ + WDK  S+ I +  +++ +VCGLCGNFD    ND   RS  +  D++ F +SWK+  SCP    P   C+  P R+ WA+ +C IL   +F  CH  V    YY+ CV DAC CD G DC CFCTAV  Y   C+E  + + WRT   CP  C      G+  W  + CG  C  +C +  G  + D  G     +EGC+  CP           +CV       + P   +    Y  G  V   + C+ C C E    CT
Sbjct:   68 VVRASNPAHNGRV-CSTWGSFHYKTFDGDVFRFPGLCNY-VFSEHCGAA---YEDFNIQL----RRSQESAAPTLSRVLMKVDGVVIQLTKGSVLVNGHPVLLPFSQSGVLIQQSSSYTKVEARLGLVLMWNHDDSLLLELDTKYANKTCGLCGDFNGMPV-----VSELLSHNTKLTPMEFGNLQKMDDPTDQ----------CQDPVPEPPRNCSTGFGICEELLHGQLFSGCVALVDVGSYLEACRQDLCFC-----EDTDLLSC---VCHTLAEYSRQCTHAGGLPQDWR-GPDFCPQ-KCPNNMQYHECRSPCADTCSNQEHSRACEDHCVAGCFCPEGTVLDDIGQTGCVPVSKCACVYNG--AAYAPGATYSTDCTNCTCS-GGRWSCQE-VPCPGTCSVLGGAHFSTFDGKQYTVHGDCSY---------VLTKPCDSSAFTVLAELRRCGLTDSETCLKS--VTLSLDGAQTVVVIKASGEVFLNQIYTQLPIS---AANVTIFRPSTFFIIAQTSLGLQLNLQLVPTMQLFMQLAPKLRGQTCGLCGNFNSIQADDFRTLSGVVEATAAAFFNTFKTQAACPNIRN--SFEDPCSLSVENEKYAQHWCSQLTDADGPFGRCHAAVKPGTYYSNCMFDTCNCERSED-----CLCAALSSYVHACAAKGVQLGGWRDGVCTKPMTTCP-KSMTYHYHVSTCQPTCRSLSEGDITCSVGFIPVDGCICPKGTFLDDTGK-CVQASNCPCYHRGSMIPNGESVHDSGAICTCTHGKLSCIGGQAPAP-VCAAPMVFFDCRNATPGDTGAGCQKSCHTLDMTCYSPQC-VPGCVCPDGLVADGEGGCITAEDCPCVHNEASYRAGQTIRVG---C-NTCTCDSRMWRCTDDP-CLATCAVYGDGHYLTFDGQSYSFNGDCEYTLVQNHCGGKDSTQDSFRVVTENVPCGTTGTTCSKAIKIFLGGFELKLSHGKVEVIGTDESQ-----EVPYTIRQMGIYLVVDTDIGLVLLWDKKTSIFINLSPEFKGRVCGLCGNFDDIAVNDFATRSRSVVGDVLEFGNSWKLSPSCPDALAPKDPCTANPFRKSWAQKQCSILHGPTFAACHAHVEPARYYEACVNDACACDSGGDCECFCTAVAAYAQACHEVGLCVSWRTPSICPLFCDYYNPEGQCEWHYQPCGVPCLRTCRNPRGDCLRDVRG-----LEGCYPKCPPEAPIFDEDKMQCVATCPTPPLPPRCHVHGKSYRPGAVVPSDKNCQSCLCTERGVECT 1269          

HSP 2 Score: 106.686 bits (265), Expect = 1.967e-21
Identity = 101/413 (24.46%), Postives = 153/413 (37.05%), Query Frame = 2
Query: 3008 CEQNKQCSGICKTWGETHYESFDGKYFEFQGSCSYVISEDFCGNKLGTFKLISENIACGXX-XXXCTKSIKFIYLNRVFQFVRG------SNPIVSRNTNYPPGGPTAFYWTSDVDTHFILFTME-GIQVKWDKAMSLEIMIP-EKYQNKVCGLCGNFDLRIDNDMRARSGEIEKDIVNFADSWKVH---------------------------------SSCPVPQKPPFMCSKRPDREPWAKAKCEILKSDSFKKCHDVVNVEHYYKRCVADACECDRGDDCVCFCTAVEQYVARCNEYEIGLKWR--TNENCPHTCTGKRVWKNCGNICPDSCIDIGKNVTDNTGCKKVCIEGCFCPDGLHWQNNE---CVERKACECVDPITNLKYNTGDKVIRECEECNCYEGAFRCT 4105
            C  + QC  +C  WG+ HY +FDG Y+ F  +C+YV+ +       G F+++ +N  CG+    SC +SI   Y        R       +N I+  N    PG        S +         E G+QV +   +   + +P  K+ N   G CG       ++ R   G +       +  W V                                  S+   P  PP  C   P         C+++ S  F+ CH V+    +Y+ CV D C      D    C+++E Y A C  ++I + WR  T   CP TC   +V++ CG   P  C                  EGCFCP+G+   +     CV      C+ P        G  V  +C+EC C    +  T
Sbjct: 4911 CCHHYQCQCVCSGWGDPHYITFDGTYYTFLDNCTYVLVQQIV-PVYGHFRVLVDNYFCGAEDGLSCPRSIILEYHQDRVVLTRKPVHGVMTNEIIFNNKVVSPGFRKNGIVVSRIGVKMYATIPELGVQVMFS-GLIFSVEVPFSKFANNTEGQCGTCTNDRKDECRTPRGTVVASCSEMSGLWNVSIPDQPACHRPHPTPTTVGPTTVGSTTVGPTTVGSTTVGPTTPPAPCLPSP--------ICQLILSKVFEPCHTVIPPLLFYEGCVFDRCHMT---DLDVVCSSLELYAALCASHDICIDWRGRTGHMCPFTCPADKVYQPCGPSNPSYCYGNDSASLGALPEAGPITEGCFCPEGMTLFSTSAQVCVPTGCPRCLGP-HGEPVKVGHTVGMDCQECTCEAATWTLT 5309          

HSP 3 Score: 91.2781 bits (225), Expect = 1.093e-16
Identity = 103/425 (24.24%), Postives = 166/425 (39.06%), Query Frame = 2
Query: 1571 CIENEECEGRCFISGDPHYITFDRRHFFFDGHCEYTAVMTTSDNVLLSNSTIAPL----SITIQNTNCQDNSETGCPRTIGVIIGEDEDQV-----AINLLSSSEIKVNFVKISLPYQHTGNTKVLIDQVSTDILRLKSETGVEILWNGGS-RIEIKLSKKYREKVTGMCGNFNGNEMDDSMTFKGVDEKDIDKFVLSWKTN----PTCESDRGIVEYK---------------GACALSRSYSD---YANKVCHKLYESEEFKKCHSAANADKFFDQCTHDVCTCGMKRNGALDHCECEAFSSYARQCALENINLSWR--TNELCPKKCPNENMKYNQCGSRCTSTC-----RLLQESKCKEECIEGCFCPEGET-FDEAAKECVKISDCKC-EFHGR-FYLPYEIRQDRCNNCTCTNGNWICT 2719
            C  + +C+  C   GDPHYITFD  ++ F  +C Y  V             I P+     + + N  C       CPR+I  I+   +D+V      ++ + ++EI  N   +S  ++  G   +++ ++   +     E GV+++++G    +E+  SK +     G CG    +  D+  T +G       +    W  +    P C                         G+  +  +        + +C +L  S+ F+ CH+      F++ C  D C         LD   C +   YA  CA  +I + WR  T  +CP  CP + + Y  CG    S C       L          EGCFCPEG T F  +A+ CV     +C   HG    + + +  D C  CTC    W  T
Sbjct: 4911 CCHHYQCQCVCSGWGDPHYITFDGTYYTFLDNCTYVLVQQ-----------IVPVYGHFRVLVDNYFCGAEDGLSCPRSI--ILEYHQDRVVLTRKPVHGVMTNEIIFNNKVVSPGFRKNG---IVVSRIGVKMYATIPELGVQVMFSGLIFSVEVPFSK-FANNTEGQCGTCTNDRKDECRTPRGTVVASCSEMSGLWNVSIPDQPACHRPHPTPTTVGPTTVGSTTVGPTTVGSTTVGPTTPPAPCLPSPIC-QLILSKVFEPCHTVIPPLLFYEGCVFDRC-----HMTDLD-VVCSSLELYAALCASHDICIDWRGRTGHMCPFTCPADKV-YQPCGPSNPSYCYGNDSASLGALPEAGPITEGCFCPEGMTLFSTSAQVCVPTGCPRCLGPHGEPVKVGHTVGMD-CQECTCEAATWTLT 5309          

HSP 4 Score: 76.6406 bits (187), Expect = 3.117e-12
Identity = 98/423 (23.17%), Postives = 171/423 (40.43%), Query Frame = 2
Query:  458 CSVIYGHHIKTFDGNVFSYPLRGGYTLFMDCLGAAPLFYVYFNASYDCFDQKTQN--------DCSISMKITVGTQTIILFPKNEFALVKNNKTKIPFNSEGIIVSSVGSFIKIKGIDDLEILFDRDRNIYVYAPVTAEKKICGLCGYFNGIMSDDYRDFNQVIQKNVKTFVNSWIDRDPSDLNVYREREQYPCNALKLKNNDQYQKALTLCQ-DMVKNNLGRTCQSEVKIDKYLDMCQDEICECLQTQPENSTIENCYSTFCKIEEQYSYACTLKGIAVDWRSATTICK------QPQCFNGQEFSECGSNCGKNCGQLGMELECESQCLPGCY--CPRNRYW---DGTMCV---PQEKCPCVRDNGESTYQQGYRLKL--NCETCICGMHGKWQCIENEEC----EGRCFISGDPHYITFD 1639
            C+V    H  TFDG  +S+     YTL  +  G         +++ D F   T+N         CS ++KI +G   + L       +  +   ++P+      +  +G ++ +     L +L+D+  +I++      + ++CGLCG F+ I  +D+   ++ +  +V  F NSW    PS  +    ++  PC A      + ++K+    Q  ++       C + V+  +Y + C ++ C C        +  +C   FC     Y+ AC   G+ V WR+ + IC        P+      +  CG  C + C     +   + + L GCY  CP        D   CV   P    P        +Y+ G  +    NC++C+C   G     + E C     G+ F  GD  Y T D
Sbjct:  903 CAVYGDGHYLTFDGQSYSFNGDCEYTLVQNHCGGK-------DSTQDSFRVVTENVPCGTTGTTCSKAIKIFLGGFELKLSHGKVEVIGTDESQEVPYT-----IRQMGIYLVVDTDIGLVLLWDKKTSIFINLSPEFKGRVCGLCGNFDDIAVNDFATRSRSVVGDVLEFGNSW-KLSPSCPDALAPKD--PCTA------NPFRKSWAQKQCSILHGPTFAACHAHVEPARYYEACVNDACAC-------DSGGDC-ECFCTAVAAYAQACHEVGLCVSWRTPS-ICPLFCDYYNPEGQCEWHYQPCGVPCLRTCRNPRGDCLRDVRGLEGCYPKCPPEAPIFDEDKMQCVATCPTPPLPPRCHVHGKSYRPGAVVPSDKNCQSCLCTERGVECTYKAEACVCTYNGQRFHPGDVIYHTTD 1295          
BLAST of von Willebrand factor vs. UniProt/SwissProt
Match: sp|Q9HC84|MUC5B_HUMAN (Mucin-5B OS=Homo sapiens OX=9606 GN=MUC5B PE=1 SV=3)

HSP 1 Score: 473.781 bits (1218), Expect = 8.826e-135
Identity = 353/1252 (28.19%), Postives = 544/1252 (43.45%), Query Frame = 2
Query:  458 CSVIYGHHIKTFDGNVFSYPLRGGYTLFMDCLGAAPLFYVYFNASYDCFDQKTQNDCSISMKITVGTQTIILFPKNEFALVKNNKTKIPFNSEGIIVSSVGSFIKIKGIDDLEILFDRDRNIYVYAPVTAEKKICGLCGYFNGIMSDDYRDFNQVIQKNVKTFVNSWIDRDPSDLNVYREREQYPCNALKLKNNDQYQKALTLCQDMVKNNLGRTCQSEVKIDKYLDMCQDEICECLQTQPENSTIENCYSTFCKIEEQYSYACTLKGIAVDWRSATTICKQPQCFNGQEFSECGSNCGKNCGQLGMELECESQCLPGCYCPRNRYWDG---TMCVPQEKCPCVRDNGESTYQQGYRLKLNCETCICGMHGKWQCIENEECEGRCFISGDPHYITFDRRHFFFDGHCEYTAVMTTSDNVLLSNSTIAPLSITIQNTNCQDNSETGCPRTIGVIIGEDEDQVAINLLSSSEIKVNFVKISLPYQHTGNTKVLIDQVSTDILRLKSETGVEILWNGGSRIEIKLSKKYREKVTGMCGNFNGNEMDDSMTFKGVDEKDIDKFVLSWKTNPTCESDRGIVEYKGACALSRSYSDYANKVCHKLYE-SEEFKKCHSAANADKFFDQCTHDVCTCGMKRNGALDHCECEAFSSYARQCALENINLSWRTNELCPK---KCPNENMKYNQCGSRCTSTCRLLQESKCKEEC----IEGCFCPEGETFDEAAKECVKISDCKCEFHGRFYLPYEIRQDRCNNCTCTNGNWICTSNDCEGKEFCPKSMAWFDC---------GICQKTCTNLDLVCPKGQCQLPGCFCPENTVLH-NGECIKPFECPCYMNNKMYSENDTIVRGPANCQNPCICKDGKWVCEQNKQCSGICKTWGETHYESFDGKYFEFQGSCSYVISEDFCGNKL--GTFKLISENIACGXXXXXCTKSIKFIYLNRVFQFVRGSNPIVSRNTNYPPGGPTAFYWTSDVDTHFILFTMEGIQVKWDKAMSLEIMIPEKYQNKVCGLCGNFDLRIDNDMRARSGEIEKDIVNFADSWKVHSSCPVPQKPPFMCSKRPDREPWAKAKCEILKSDSFKKCHDVVNVEHYYKRCVADACECDRGDDCVCFCTAVEQYVARCNEYEIGLKWRTNENCPHTCT-----GKRVW--KNCGNICPDSCIDIGKNVTDNTGCKKVCIEGCF--CPDGLHWQNNE---CVERKACECVDPITNLKYNTGDKV--IRECEECNCYEGAFRC 4102
            CS     H KTFDG+VF +P    Y     C  A    Y  FN       +       +  ++ +  Q ++L   N   L+   + ++P++  G++V   G +IK+     L  L++ + +  +        + CGLCG FNG+ +     FN+    N +     + +    D    +  +  P  A    + +       +C   +       C + V    YL  C  ++C C  T P         +TF +   Q ++A    G   +WR    +C +    N Q   ECGS C   C        CE  C+ GC+CP     D    + C+P  +CPC   +G  TY  G      C +C C   G WQC ++  C G C + G  H  T+D + +   G C Y      +D+     + +    +T  N NC             V +  D    AI + +   + +N +   LP     N  +        +++      + +      ++ ++L   ++ ++ G+CGNFN N+ DD     GV E     F  +WK    C + R    ++  C+LS    +YA   C +L + +  F +CHS  N   F   C  D C C    +     C C A SSY   CA + + LS   + +C K    CP ++ +Y      C  TCR L E+          ++GC CP G TF   A  CV   +C C  HG    P E+  D    C+CT G   C     +    C   M + DC           C ++C  LD+ C    C + GC CP   V   +G CI   +CPC  N   Y   +TI     +C N C C++ +W C  ++ C G C  +G+ H+ +FDG  + F+GSC Y++++D+CG+    GTF++++ENI CG++ ++C+K+IK    +       G+   V+R    P G P        +   F++    G+ V WD+  S+ I + + Y+ +VCGLCGNFD    ND   RS  +  D + F +SWK+  SCP    P   C+  P R+ WA+ +C IL   +F  C   V+   YY+ CV DAC CD G DC CFCTAV  Y   C++  + + WRT + CP  C      G   W  + CG  C  +C    +N + +       +EGC+  CP    + N +   CV +  C C D   N  Y+ G +V     C+ CNC     +C
Sbjct:   77 CSTWGDFHYKTFDGDVFRFPGLCNYVFSEHCRAA----YEDFNVQ---LRRGLVGSRPVVTRVVIKAQGLVLEASNGSVLINGQREELPYSRTGLLVEQSGDYIKVSIRLVLTFLWNGEDSALLELDPKYANQTCGLCGDFNGLPA-----FNEFYAHNARLTPLQFGNLQKLDGPTEQCPDPLPLPAGNCTDEE------GICHRTLLGPAFAECHALVDSTAYLAACAQDLCRC-PTCP--------CATFVEYSRQCAHA---GGQPRNWR-CPELCPRTCPLNMQH-QECGSPCTDTCSNPQRAQLCEDHCVDGCFCPPGTVLDDITHSGCLPLGQCPCT--HGGRTYSPGTSFNTTCSSCTCS-GGLWQC-QDLPCPGTCSVQGGAHISTYDEKLYDLHGDCSYVLSKKCADSSFTVLAELRKCGLT-DNENCLK----------AVTLSLDGGDTAIRVQADGGVFLNSIYTQLPLS-AANITLFTPSSFFIVVQTGLGLQLLVQLVPLMQVFVRLDPAHQGQMCGLCGNFNQNQADDFTALSGVVEATGAAFANTWKAQAACANARN--SFEDPCSLSVENENYARHWCSRLTDPNSAFSRCHSIINPKPFHSNCMFDTCNCERSED-----CLCAALSSYVHACAAKGVQLSDWRDGVCTKYMQNCP-KSQRYAYVVDACQPTCRGLSEADVTCSVSFVPVDGCTCPAG-TFLNDAGACVPAQECPCYAHGTVLAPGEVVHDEGAVCSCTGGKLSCLGASLQKSTGCAAPMVYLDCSNSSAGTPGAECLRSCHTLDVGCFSTHC-VSGCVCPPGLVSDGSGGCIAEEDCPCVHNEATYKPGETI---RVDC-NTCTCRNRRWEC-SHRLCLGTCVAYGDGHFITFDGDRYSFEGSCEYILAQDYCGDNTTHGTFRIVTENIPCGTTGTTCSKAIKLFVESYELILQEGTFKAVARG---PGGDPPYKIRYMGI---FLVIETHGMAVSWDRKTSVFIRLHQDYKGRVCGLCGNFDDNAINDFATRSRSVVGDALEFGNSWKLSPSCPDALAPKDPCTANPFRKSWAQKQCSILHGPTFAACRSQVDSTKYYEACVNDACACDSGGDCECFCTAVAAYAQACHDAGLCVSWRTPDTCPLFCDFYNPHGGCEWHYQPCGAPCLKTC----RNPSGHCLVDLPGLEGCYPKCPPSQPFFNEDQMKCVAQ--CGCYDKDGNY-YDVGARVPTAENCQSCNCTPSGIQC 1252          

HSP 2 Score: 91.6633 bits (226), Expect = 7.952e-17
Identity = 98/398 (24.62%), Postives = 162/398 (40.70%), Query Frame = 2
Query: 2978 PCICKDGKWVCEQNKQCSGICKTWGETHYESFDGKYFEFQGSCSYVISEDFCGNKLGTFKLISENIACGXXXXX----CTKSIKFIYLNR----VFQFVRGSNP--IVSRNTNYPPGGPTAFYWTSDVDTHFILFTME--GIQVKWDKAMSLEIMIPEKYQNKVCGLCGNFDLRIDNDMRARSGEIEKDIVNFADSWKVHSS----CPVPQ-KPPFMCSKRPDREPWAKAK------CEILKSDSFKKCHDVVNVEHYYKRCVADACECDRGDDCVCFCTAVEQYVARCNEYEIGLKWR--TNENCPHTCTGKRVWKNCGNICPDSCIDIGKNVTDNTGCKKVCIEGCFCP-DGLHWQNNECVERKACECVDPITNLKYNTGDKVIRECEECNCYEGA 4093
            P    D    C+ + +C  IC  WG +HY +FDG  + F+G+C+YV+  +    + G   L  +N  C +S+++    C +++   Y +         V G     I+        G        S + T  +   +   G+ V ++  +    +    + N   G CG       +D   R G       + A +W V  S    C  P   PP      P               C+++ S  F +CH++V    ++  C++D C   RG   V  C ++E Y   C    +   WR  T   C  TC   +V+K CG I P +C     N  + +   +   EGCFCP D + +  +  +  +AC CV P    K+  G++ +  C+ C C EG+
Sbjct: 5055 PIKVSDPSQPCDFHYECECICSMWGGSHYSTFDGTSYTFRGNCTYVLMREIHA-RFGNLSLYLDNHYCTASATAAAARCPRALSIHYKSMDIVLTVTMVHGKEEGLILFDQIPVSSGFSKNGVLVSVLGTTTMRVDIPALGVSVTFNGQVFQARLPYSLFHNNTEGQCGTCTNNQRDDCLQRDGTTAASCKDMAKTWLVPDSRKDGCWAPTGTPPTASPAAPVSSTPTPTPCPPQPLCDLMLSQVFAECHNLVPPGPFFNACISDHC---RGRLEVP-CQSLEAYAELCRARGVCSDWRGATGGLCDLTCPPTKVYKPCGPIQPATC-----NSRNQSPQLEGMAEGCFCPEDQILFNAHMGICVQACPCVGPDGFPKF-PGERWVSNCQSCVCDEGS 5441          

HSP 3 Score: 86.2705 bits (212), Expect = 3.448e-15
Identity = 126/548 (22.99%), Postives = 190/548 (34.67%), Query Frame = 2
Query: 1571 CIENEECEGRCFISGDPHYITFDRRHFFFDGHCEYTAVMTTSDNVLLSNSTIAPLSITIQNTNCQDNSETG---CPRTIGVIIGEDEDQVAINLLSSSE---IKVNFVKISLPYQHTGNTKVLIDQVSTDILRLK-SETGVEILWNGG---SRIEIKLSKKYREKVTGMCGNFNGNEMDDSMTFKGVDEKDIDKFVLSW----KTNPTCESDRGIVEYKGACALSRSYSDYANKVCHKLYE---SEEFKKCHSAANADKFFDQCTHDVCTCGMKRNGALDHCECEAFSSYARQCALENINLSWR--TNELCPKKCPNENMKYNQCGSRCTSTCRLLQESKCKEECIEGCFCPEGET-FDEAAKECVKISDCKCEFHGRFYLPYEIRQDRCNNCTCTNGNWI--CTSNDCEGK---------------------EFCPKSMAWFDCGICQKTCTNLDLVCPKGQ----CQLPGCFCPE----------NTVLHNGECIKPFECPCYMNNKMYSE-NDTIVRGPANCQNPCICKDGKWVCEQNKQCSGIC 3040
            C  + ECE  C + G  HY TFD   + F G+C Y  +          ++    LS+ + N  C  ++      CPR + +     +  + + ++   E   I  + + +S  +   G   VL+  + T  +R+     GV + +NG    +R+   L   +     G CG    N+ DD +   G           +W         C +  G        A   S           L +   S+ F +CH+      FF+ C  D C       G L+   C++  +YA  C    +   WR  T  LC   CP   + Y  CG    +TC    +S   E   EGCFCPE +  F+     CV+   C     G    P E     C +C C  G+    C    C+ +                       CP+++    C     TC     VCP GQ     Q  G  CP           N   +      P   PC+M   +  +  D  V+   +  N   C  G        QC G C
Sbjct: 5065 CDFHYECECICSMWGGSHYSTFDGTSYTFRGNCTYVLMREI-------HARFGNLSLYLDNHYCTASATAAAARCPRALSIHYKSMDIVLTVTMVHGKEEGLILFDQIPVSSGFSKNG---VLVSVLGTTTMRVDIPALGVSVTFNGQVFQARLPYSL---FHNNTEGQCGTCTNNQRDDCLQRDGTTAASCKDMAKTWLVPDSRKDGCWAPTGTPPTASPAAPVSSTPTPTPCPPQPLCDLMLSQVFAECHNLVPPGPFFNACISDHC------RGRLE-VPCQSLEAYAELCRARGVCSDWRGATGGLCDLTCPPTKV-YKPCGPIQPATCNSRNQSPQLEGMAEGCFCPEDQILFNAHMGICVQACPCVGP-DGFPKFPGERWVSNCQSCVCDEGSVSVQCKPLPCDAQGQPPPCNRPGFVTVTRPRAENPCCPETV----CVCNTTTCPQSLPVCPPGQESICTQEEGDCCPTFRCRPQLCSYNGTFYGVGATFPGALPCHMCTCLSGDTQDPTVQCQEDACNNTTCPQGFEYKRVAGQCCGEC 5586          
BLAST of von Willebrand factor vs. TrEMBL
Match: A0A267GUZ7 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig026350g1 PE=4 SV=1)

HSP 1 Score: 1118.61 bits (2892), Expect = 0.000e+0
Identity = 564/1360 (41.47%), Postives = 790/1360 (58.09%), Query Frame = 2
Query:  209 NGVCKDGRCSCSLGWQGNRCSDPICVGGCSNGGKCVAPNQCLCLDNYSGPNCNTLLIKSSQSDVSNYGAVTRVNNTMYSTYYECSVIYGHHIKTFDGNVFSYPLRGGYTLFMDCLGAAPLFYVYFNASYDCFDQKTQNDCSISMKITVGTQTIILFPKNEFALVKNNKTKIPFNSEGIIVSSVGSFIKIKGIDDLEILFDRDRNIYVYAPVTAEKKICGLCGYFNGIMSDDYRDFNQVIQKNVKTFVNSWIDRDPSDLNVYRE---REQYPCNALKLKNNDQYQKALTLCQDMVK-NNLGRTCQSEVKIDKYLDMCQDEICECLQTQPENSTIENCYSTFCKIEEQYSYACTLKGIAVDWRSATTICKQPQCFNGQEFSECGSNCGKNCGQLGMELECESQCLPGCYCPRNRYWDGTMCVPQEKCPCVRDNGESTYQQGYRLKLNCETCICGMHGKWQCIENEECEGRCFISGDPHYITFDRRHFFFDGHCEYTAVMTTSDNVLLSNSTIAPLSITIQNTNCQDNSETGCPRTIGVIIGEDEDQVAINLLSSSEIKVNFVKISLPYQHTGNTKVLIDQVSTDILRLKSETGVEILWNGGSRIEIKLSKKYREKVTGMCGNFNGNEMDDSMTFKGVDEKDIDKFVLSWKTNPTCESDRGIVEYKGACALSRSYSDYANKVCHKLYESEEFKKCHSAANADKFFDQCTHDVCTCGMKRNGALDHCECEAFSSYARQCALENINLSWRTNELCPKKCPNENMKYNQCGSRCTSTCRLLQESKCKEECIEGCFCPEGETFDEAAKECVKISDCKCEFHGRFYLPYEIRQDRCNNCTCTNGNWICTSNDCEGKEFCPKSMAWFDCGICQKTCTNLDLVCPKGQCQLPGCFCPENTVLHNGECIKPFECPCYMNNKMYSENDTIVRGPANCQNPCICKDGKWVCEQNKQCSGICKTWGETHYESFDGKYFEFQGSCSYVISEDFCGNKLGTFKLISENIACGXXXXXCTKSIKFIYLNRVFQFVRGSNPIVSRNTNYPPGGPTAFYWTSDVDTHFILFTMEGIQVKWDKAMSLEIMIPEKYQNKVCGLCGNFDLRIDNDMRARSGEIEKDIVNFADSWKVHSSC-PVPQKPPFMCSKRPDREPWAKAKCEILKSDSFKKCHDVVNVEHYYKRCVADACECDRGDDCVCFCTAVEQYVARCNEYEIGLKWRTNENCPHTCTGKRVWKNCGNICPDSCIDIGKNVTDNTGCKKVCIEGCFCPDGLHWQNNECVERKACECVDPITNLKYNTGDKVIRECEECNCYEGAFRCTKLFSKECLHTSRPEISTKPPHCVNEYEFLC--PNNFCARRCNGIIECRDGEDEDLC 4267
            NG C  GRC C+LG++G++C  P+C   C++ G C+APN+C C D Y G  C    + +S  D + + AV  VNNT Y     CS   G H  TFDG  F +P  G Y L  DC+ +   + VYFN S +C D   Q  C +S+KI  G   + + P      V      +P  +  + VS+  + I ++G+DDL I +D DRNI VYAP T  + +CGLCG F+G  ++D+ D        V  F  +W D  P D NVY       Q+PC  L+ K+    + A +LC  +   ++    C S V    Y  MC  ++C CL     N+T+  C    C     YS ACT +GI ++WR +  +C  P+C NG+ FSEC  +C + CG   ++ +C + C+ GC+CP  R+WDG  CV ++ CPC R     +Y  G +    CE C+C   G W+C   +EC G C +SGDP Y TFD RHF F+GHCEY  +M        + S   P+++ ++N  C   ++  C + + + +G  E Q  I L S S +KV+   +SLP +      + I  VST +LR+++  G ++LWNG +RI+I+LSK +R KVTG+CGNFN +  DD+++  G+D KDI +F  SWKTNPTC++    V Y GACA S+ +  YA  VC+KLY    FK CHS  +     +QC HDVC+CG +R G +  CEC AF+SYAR CAL+   L+WR++ LCP KCP   M+Y +CGS C  TC+ ++ S C EEC+EGC CP G+  DE    CV  + CKC ++G  Y   ++R+D+CNNCTCT+GNW CT+  C     CP  M W +C  CQ++C N+++ CPK  C+  GC CP+  VLH G+C+    CPC M  K+Y+EN  + RG   C N C+C+ G W C  NK C   C+ WG+ HYE+FDG+Y++F G+CSYV++ED+CG   GTF++  ENI CG+   SCTKS+K  Y + V   VRG++PI+SRN  +P   P A Y       +    T +GI+V+WD  M + + +   +  KVCGLCGNF+ + D+D+RAR+GE+ +D V FADSWKV ++C   P  P   CS   +R+ WA+ KC IL+S  F  CH  V V  +Y +CV D C C + DDC+C+CTAV QYV RCNE  + +KWR  ++CP  C    V+K CG+ CP  CIDI K  T  + CK  C+EGCFCPDG   ++  C +R+ C CV  +   K   G K+I +C+EC C  G+  C   +  +C         T  P C      +C     +CA+RC+G  EC  G+DE  C
Sbjct:  167 NGKCVRGRCVCNLGYKGDKCELPLCKNNCNSVGTCLAPNKCRCPDGYHGDLCQVSALYAS--DSTAFVAVRAVNNTRYRNSAVCSAFGGKHFLTFDGKYFDFPAHGSYVLLQDCVNSEAKYQVYFNGSRNCADA-AQTRCQVSLKIVAGPAKVEIMPGGSV-FVNEKPVTLPTIAGIVSVSNTANHITVRGLDDLAITYDGDRNINVYAPKTMSRTVCGLCGRFDGKAANDFTDLMNKPLTRVVDFAKAWRDESPDDKNVYPSVPADAQHPCARLRSKSTSLLESAQSLCSILRSGSSTFSACHSRVNSSVYESMCMKDMCTCLLNG--NATV--CNEQRCNSATLYSRACTQQGIVINWRQSN-LCPAPKCSNGKVFSECSHDCNQKCGTNTVDDDCGTHCVDGCFCPSGRFWDGHKCVIRDNCPCNRAGDSRSYPVGSKYSHKCEQCVCDRGGSWKCSPTDECYGYCTVSGDPTYRTFDGRHFSFEGHCEYIMMMPQRS---AAESLEYPVAVYVENKYCDSVTDVLCAKLVTLQMGSGEKQHTIRLESLSRVKVDSAYVSLPVKVH---DITIRLVSTSMLRVETNKGFDLLWNGRTRIQIRLSKAFRNKVTGLCGNFNNDMKDDTISPTGIDVKDIRQFAKSWKTNPTCDAKTRFV-YNGACATSKEFDSYATSVCNKLYTESVFKACHSRVDPKWALEQCKHDVCSCGSRRKGVMSQCECTAFASYARSCALDGKVLNWRSSSLCPVKCP-PTMEYQECGSNCGKTCKRVEASPCIEECVEGCQCPSGQALDEEKGTCVPRNQCKCVYNGVSYTNGQVRKDKCNNCTCTDGNWECTNLTCTDSNTCPAGMVWSECSDCQRSCENINIECPKSSCKSGGCVCPKGQVLHQGKCVDKGNCPCAMAGKVYAENSVVPRGSTRCYNYCMCRKGSWQCTNNK-CPSTCRVWGDPHYETFDGRYYDFMGTCSYVLAEDYCGGTAGTFRITGENIKCGAEGMSCTKSVKITYRDVVVHLVRGTDPIISRNLYWPVTLPKAKYEIYPAGFYLFFRTEDGIEVQWDMKMKVSVTLQPNWMEKVCGLCGNFNNKRDDDLRARTGEVVEDKVAFADSWKVRNTCPKPPPTPIAPCSS--ERKRWAEKKCAILRSSEFTSCHSKVEVNEFYDKCVMDTCAC-KLDDCLCYCTAVSQYVLRCNEMGVKIKWRNPDDCPVMCPKTMVYKRCGSTCPQRCIDISKGETITSDCKSTCVEGCFCPDGEFLEDGVCKKREQCSCV--VGGKKIAYGKKIIYKCQECTCTAGSLECKPYYLGDCATFPTTVPPTTTPFCTGPGLIICRGERKYCAKRCDGNRECMYGDDEQCC 1503          

HSP 2 Score: 92.4337 bits (228), Expect = 1.260e-14
Identity = 105/467 (22.48%), Postives = 185/467 (39.61%), Query Frame = 2
Query:  200 DCVNGVCKDGRCSCSLGWQGNRCSDPICVGGCSNGGKCVAPNQCLCLDNYSGPNCNTLLIKSSQSDVSNY-----GAVTRVNNTMYSTYYECSVIYGHHIKTFDGNVFSYPLRGGYTLFMDCLGAAPLFYVYFNASYDCFDQKTQNDCSISMKITVGTQTIILFPKNEFALVKNNKTKIPFNSEGIIVSSVGSFIKIKGIDDLEILFDRDRNIYVYAPVTAEKKICGLCGYFNGIMSDDYRDFNQVIQKNVKTFVNSWIDRDPSDLNVYREREQYPCNALKLKNNDQYQKALTLCQDMVKNNLGRTCQSEVKIDKYLDMCQDEICECLQTQPENSTIENCYSTFCKIEEQYSYACTLKGIAVDWRSATTICKQPQCFNGQEFSECGSNCGKNCGQLG----MELECESQCLPGCYCPRNRYWDGTMCVPQEKCPCVRDNGESTYQQGYRLKLNCETCICGMHGKWQC 1573
            +C    CK G C C  G   ++             GKCV    C C         N+++ + S +   NY     G+    NN   ST   C V    H +TFDG  + +     Y L  D  G     +     +  C  +     C+ S+KIT     + L    +  + +N    +        +   G ++  +  D +E+ +D    + V       +K+CGLCG FN    DD R     + ++   F +SW  R+             PC++      ++ + A   C  +++++   +C S+V+++++ D C  + C C         +++C   +C    QY   C   G+ + WR+         C     +  CGS C + C  +     +  +C+S C+ GC+CP   + +  +C  +E+C CV    +  Y  G ++   C+ C C   G  +C
Sbjct: 1022 ECPKSSCKSGGCVCPKGQVLHQ-------------GKCVDKGNCPCAMAGKVYAENSVVPRGS-TRCYNYCMCRKGSWQCTNNKCPST---CRVWGDPHYETFDGRYYDFMGTCSYVLAEDYCGGTAGTFRITGENIKCGAEGMS--CTKSVKITYRDVVVHLVRGTDPIISRNLYWPVTLPKAKYEIYPAGFYLFFRTEDGIEVQWDMKMKVSVTLQPNWMEKVCGLCGNFNNKRDDDLRARTGEVVEDKVAFADSWKVRN--TCPKPPPTPIAPCSS------ERKRWAEKKCA-ILRSSEFTSCHSKVEVNEFYDKCVMDTCAC--------KLDDCL-CYCTAVSQYVLRCNEMGVKIKWRNPDDC--PVMCPKTMVYKRCGSTCPQRCIDISKGETITSDCKSTCVEGCFCPDGEFLEDGVCKKREQCSCVVGGKKIAY--GKKIIYKCQECTC-TAGSLEC 1446          

HSP 3 Score: 56.225 bits (134), Expect = 6.043e-8
Identity = 87/364 (23.90%), Postives = 162/364 (44.51%), Query Frame = 2
Query: 4322 DQNEIMKSGETKIVDQCIKYICDDGNIVTKTKFCNITCDEHSEILKQHVDSDKCCECVSIRTTTLMVSATTTRLVTCEMYTLTVEKNFNILYKLKSDSIGNSIENVI----YDSDKSWTV-VSNNAVLIVEFLPKQPXXXXXXXXXXXXXXXXXXXXXDIVEKDDTWKDADSYTLAKSSTKDGNLFSYTFTSATKDGIPGRFVRFSFILSNQITEVIVIRKLMIKICGSQKTTEIQPSSTSGMVSCPPKGTTIRQNECLITMCIDGEWITKMNCPISCLPGEIKVTYDDERCCQCVNANQTTISMPVISSTKLVSTKGPCKPPL-IHKCIDDCEGICHYLQENQCHNLLTSTNRICKDACVCPQ 5395
            D++ +  S  +     C  Y C  G +++  K CN+TC     + +   +  +CCEC  + TTT++V+ TTT L  C  + +T+  +    +++++ S  N+I+ +       ++ SW+   S++   +V  +  +P    +I ++ + A    +V ++     D W     Y+   ++     L S +F++ T DG+    VR +F   + +     +  L+I  C    TT + P++T    S    G     +EC+  +C  G WI K +C I C      V +  + CC+C     TT  +   ++    +T   C  P+    C+  C   CHY+ E +C    +     C+  C CP 
Sbjct: 1799 DKDGVKHSEGSTWRSGCAIYTCTKG-VISSRKECNVTCAPGFILRQYPTNPTRCCECERLATTTVIVTPTTTTLTKCTHHEITLASDSGSKFEMRASS--NNIDRLKALKGAPANSSWSPDASDDEPRLVFAITPRPGSRTIITKLELTATRARSVEVEFTSGSDIW-----YSKRVATPSSSGLVSLSFSNETTDGVSATAVRVTFPRGSGVKVNPSVSGLLISACFEVSTTVVAPTTTPICAS----GDKKVISECISQVCESGAWIRKKSCSIECGSSCSIVHFSGDACCKCSCGTTTTTRVVTTTTAPPTTTTPMCAAPMEPSDCMRKCRK-CHYI-EPECS---SEGKFPCESGCQCPS 2145          

HSP 4 Score: 33.4982 bits (75), Expect = 6.043e-8
Identity = 13/37 (35.14%), Postives = 19/37 (51.35%), Query Frame = 3
Query: 5418 CVDTRQCECVDNDGKIRKPNETWTDRCNQYRCVDNQV 5528
            CV +  C C   DGK+R   + W   C +Y C +N +
Sbjct: 2155 CVKSEDCSCRSPDGKVRSAGDVWVVDCIRYTCANNTI 2191          

HSP 5 Score: 63.929 bits (154), Expect = 5.322e-6
Identity = 29/62 (46.77%), Postives = 37/62 (59.68%), Query Frame = 2
Query:  191 CSPDCVNGVC-KDGRCSCSLGWQGNRCSDPICVGGCSNGGKCVAPNQCLCLDNYSGPNCNTL 373
            CSP C NG+C     C+CS GW G  C+ P+C   C+NGG CVAPN C C   + G  C ++
Sbjct:   91 CSPKCDNGMCVAPNSCNCSSGWSGATCNKPVCAKECANGGICVAPNTCRCAAGFDGEQCQSV 152          
BLAST of von Willebrand factor vs. TrEMBL
Match: A0A267DLR6 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig026350g2 PE=4 SV=1)

HSP 1 Score: 1113.98 bits (2880), Expect = 0.000e+0
Identity = 564/1360 (41.47%), Postives = 791/1360 (58.16%), Query Frame = 2
Query:  209 NGVCKDGRCSCSLGWQGNRCSDPICVGGCSNGGKCVAPNQCLCLDNYSGPNCNTLLIKSSQSDVSNYGAVTRVNNTMYSTYYECSVIYGHHIKTFDGNVFSYPLRGGYTLFMDCLGAAPLFYVYFNASYDCFDQKTQNDCSISMKITVGTQTIILFPKNEFALVKNNKTKIPFNSEGIIVSSVGSFIKIKGIDDLEILFDRDRNIYVYAPVTAEKKICGLCGYFNGIMSDDYRDFNQVIQKNVKTFVNSWIDRDPSDLNVYRE---REQYPCNALKLKNNDQYQKALTLCQDMVK-NNLGRTCQSEVKIDKYLDMCQDEICECLQTQPENSTIENCYSTFCKIEEQYSYACTLKGIAVDWRSATTICKQPQCFNGQEFSECGSNCGKNCGQLGMELECESQCLPGCYCPRNRYWDGTMCVPQEKCPCVRDNGESTYQQGYRLKLNCETCICGMHGKWQCIENEECEGRCFISGDPHYITFDRRHFFFDGHCEYTAVMTTSDNVLLSNSTIAPLSITIQNTNCQDNSETGCPRTIGVIIGEDEDQVAINLLSSSEIKVNFVKISLPYQHTGNTKVLIDQVSTDILRLKSETGVEILWNGGSRIEIKLSKKYREKVTGMCGNFNGNEMDDSMTFKGVDEKDIDKFVLSWKTNPTCESDRGIVEYKGACALSRSYSDYANKVCHKLYESEEFKKCHSAANADKFFDQCTHDVCTCGMKRNGALDHCECEAFSSYARQCALENINLSWRTNELCPKKCPNENMKYNQCGSRCTSTCRLLQESKCKEECIEGCFCPEGETFDEAAKECVKISDCKCEFHGRFYLPYEIRQDRCNNCTCTNGNWICTSNDCEGKEFCPKSMAWFDCGICQKTCTNLDLVCPKGQCQLPGCFCPENTVLHNGECIKPFECPCYMNNKMYSENDTIVRGPANCQNPCICKDGKWVCEQNKQCSGICKTWGETHYESFDGKYFEFQGSCSYVISEDFCGNKLGTFKLISENIACGXXXXXCTKSIKFIYLNRVFQFVRGSNPIVSRNTNYPPGGPTAFYWTSDVDTHFILFTMEGIQVKWDKAMSLEIMIPEKYQNKVCGLCGNFDLRIDNDMRARSGEIEKDIVNFADSWKVHSSC-PVPQKPPFMCSKRPDREPWAKAKCEILKSDSFKKCHDVVNVEHYYKRCVADACECDRGDDCVCFCTAVEQYVARCNEYEIGLKWRTNENCPHTCTGKRVWKNCGNICPDSCIDIGKNVTDNTGCKKVCIEGCFCPDGLHWQNNECVERKACECVDPITNLKYNTGDKVIRECEECNCYEGAFRCTKLFSKECLHTSRPEISTKPPHCVNEYEFLC--PNNFCARRCNGIIECRDGEDEDLC 4267
            NG C  GRC C+LG++G++C  P+C   C++ G C+APN+C C D Y G  C    + +S  D + + AV  VNNT Y     CS   G H  TFDG  F +P  G Y L  DC+ +   + VYFN S +C D   Q  C +S+KI  G   + + P      V      +P  +  + VS+  + I ++G+DDL I +D DRNI VYAP T  + +CGLCG F+G  ++D+ D       +V  F  +W D  P D NVY       Q+PC  L+ K+    + A +LC  +   ++    C S V    Y  MC  ++C CL     N+T+  C    C     YS ACT +GI ++WR  + +C  P+C NG+ FSEC  +C + CG   ++ +C + C+ GC+CP  R+WDG  CV ++ CPC R     +Y  G +    CE C+C   G W+C   +EC G C +SGDP Y TFD RHF F+GHCEY  +M        + S   P+++ ++N  C   ++  C + + + +G  E Q  I L S S +KV+   +SLP +      + I  VST +LR+++  G ++LWNG +RI+I+LSK +R KVTG+CGNFN +  DD+++  G+D KDI +F  SWKTNPTC++    V Y GACA S+ +  YA  VC+KLY    FK CHS  +     +QC HDVC+CG +R G +  CEC AF+SYAR CAL+   L+WR++ LCP KCP   M+Y +CGS C  TC+ ++ S C EEC+EGC CP G+  DE    CV  + CKC ++G  Y   ++R+D+CNNCTCT+GNW CT+  C     CP  M W +C  CQ++C N+++ CPK  C+  GC CP+  VLH G+C+    CPC M  K+Y+EN  + RG   C N C+C+ G W C  NK C   C+ WG+ HYE+FDG+Y++F G+CSYV++ED+CG   GTF++  ENI CG+   SCTKS+K  Y + V   VRG++PI+SRN  +P   P A Y       +    T +GI+V+WD  M + + +   +  KVCGLCGNF+ + D+D+RAR+GE+ +D V FADSWKV ++C   P  P   CS   +R+ WA+ KC IL+S  F  CH  V V  +Y +CV D C C + DDC+C+CTAV QYV RCNE  + +KWR  ++CP  C    V+K CG+ CP  CIDI K  T  + CK  C+EGCFCPDG   ++  C +R+ C CV  +   K   G K+I +C+EC C  G+  C   +  +C         T  P C      +C     +CA+RC+G  EC  G+DE  C
Sbjct:  167 NGKCVRGRCVCNLGYKGDKCELPLCKNNCNSVGTCLAPNKCRCPDGYHGDLCQVSALYAS--DSTAFVAVRAVNNTRYRNSAVCSAFGGKHFLTFDGKYFDFPAHGSYVLLQDCVNSEAKYQVYFNGSRNCADA-AQTRCQVSLKIVAGPAKVEIMPGGSV-FVNEKPVTLPTIAGIVSVSNTANHITVRGLDDLAITYDGDRNINVYAPKTMSRTVCGLCGRFDGKAANDFTDLMNKPLTHVVDFAKAWRDESPDDKNVYPSVPADAQHPCARLRSKSTSLLESAQSLCSILRSGSSTFSACHSRVNSSVYESMCMKDMCTCLLNG--NATV--CNEQRCNSATLYSRACTQQGIVINWRQ-SNLCPAPKCSNGKVFSECSHDCNQKCGTNTVDDDCGTHCVDGCFCPSGRFWDGHKCVIRDNCPCNRAGDSRSYPVGSKYSHKCEQCVCDRGGSWKCSPTDECYGYCTVSGDPTYRTFDGRHFSFEGHCEYIMMMPQRS---AAESLEYPVAVYVENKYCDSVTDVLCAKLVTLQMGSGEKQHTIRLESLSRVKVDSAYVSLPVKVH---DITIRLVSTSMLRVETNKGFDLLWNGRTRIQIRLSKAFRNKVTGLCGNFNNDMKDDTISPTGIDVKDIRQFAKSWKTNPTCDAKTRFV-YNGACATSKEFDSYATSVCNKLYTESVFKACHSRVDPKWALEQCKHDVCSCGSRRKGVMSQCECTAFASYARSCALDGKVLNWRSSSLCPVKCP-PTMEYQECGSNCGKTCKRVEASPCIEECVEGCQCPSGQALDEEKGTCVPRNQCKCVYNGVSYTNGQVRKDKCNNCTCTDGNWECTNLTCTDSNTCPAGMVWSECSDCQRSCENINIECPKSSCKSGGCVCPKGQVLHQGKCVDKGNCPCAMAGKVYAENSVVPRGSTRCYNYCMCRKGSWQCTNNK-CPSTCRVWGDPHYETFDGRYYDFMGTCSYVLAEDYCGGTAGTFRITGENIKCGAEGMSCTKSVKITYRDVVVHLVRGTDPIISRNLYWPVTLPKAKYEIYPAGFYLFFRTEDGIEVQWDMKMKVSVTLQPNWMEKVCGLCGNFNNKRDDDLRARTGEVVEDKVAFADSWKVRNTCPKPPPTPIAPCSS--ERKRWAEKKCAILRSSEFTSCHSKVEVNEFYDKCVMDTCAC-KLDDCLCYCTAVSQYVLRCNEMGVKIKWRNPDDCPVMCPKTMVYKRCGSTCPQRCIDISKGETITSDCKSTCVEGCFCPDGEFLEDGVCKKREQCSCV--VGGKKIAYGKKIIYKCQECTCTAGSLECKPYYLGDCATFPTTVPPTTTPFCTGPGLIICRGERKYCAKRCDGNRECMYGDDEQCC 1503          

HSP 2 Score: 95.9005 bits (237), Expect = 1.096e-15
Identity = 103/467 (22.06%), Postives = 183/467 (39.19%), Query Frame = 2
Query:  200 DCVNGVCKDGRCSCSLGWQGNRCSDPICVGGCSNGGKCVAPNQCLCLDNYSGPNCNTLLIKSSQSDVSNY-----GAVTRVNNTMYSTYYECSVIYGHHIKTFDGNVFSYPLRGGYTLFMDCLGAAPLFYVYFNASYDCFDQKTQNDCSISMKITVGTQTIILFPKNEFALVKNNKTKIPFNSEGIIVSSVGSFIKIKGIDDLEILFDRDRNIYVYAPVTAEKKICGLCGYFNGIMSDDYRDFNQVIQKNVKTFVNSWIDRDPSDLNVYREREQYPCNALKLKNNDQYQKALTLCQDMVKNNLGRTCQSEVKIDKYLDMCQDEICECLQTQPENSTIENCYSTFCKIEEQYSYACTLKGIAVDWRSATTICKQPQCFNGQEFSECGSNCGKNCGQLG----MELECESQCLPGCYCPRNRYWDGTMCVPQEKCPCVRDNGESTYQQGYRLKLNCETCICGMHGKWQC 1573
            +C    CK G C C  G   ++             GKCV    C C         N+++ + S +   NY     G+    NN   ST   C V    H +TFDG  + +     Y L  D  G     +     +  C  +     C+ S+KIT     + L    +  + +N    +        +   G ++  +  D +E+ +D    + V       +K+CGLCG FN    DD R     + ++   F +SW  R+                     ++++ + A   C  +++++   +C S+V+++++ D C  + C C         +++C   +C    QY   C   G+ + WR+         C     +  CGS C + C  +     +  +C+S C+ GC+CP   + +  +C  +E+C CV    +  Y  G ++   C+ C C   G  +C
Sbjct: 1022 ECPKSSCKSGGCVCPKGQVLHQ-------------GKCVDKGNCPCAMAGKVYAENSVVPRGS-TRCYNYCMCRKGSWQCTNNKCPST---CRVWGDPHYETFDGRYYDFMGTCSYVLAEDYCGGTAGTFRITGENIKCGAEGMS--CTKSVKITYRDVVVHLVRGTDPIISRNLYWPVTLPKAKYEIYPAGFYLFFRTEDGIEVQWDMKMKVSVTLQPNWMEKVCGLCGNFNNKRDDDLRARTGEVVEDKVAFADSWKVRNTCPKPPPTPIAPC--------SSERKRWAEKKCA-ILRSSEFTSCHSKVEVNEFYDKCVMDTCAC--------KLDDCL-CYCTAVSQYVLRCNEMGVKIKWRNPDDC--PVMCPKTMVYKRCGSTCPQRCIDISKGETITSDCKSTCVEGCFCPDGEFLEDGVCKKREQCSCVVGGKKIAY--GKKIIYKCQECTC-TAGSLEC 1446          

HSP 3 Score: 67.0106 bits (162), Expect = 4.362e-11
Identity = 87/364 (23.90%), Postives = 163/364 (44.78%), Query Frame = 2
Query: 4322 DQNEIMKSGETKIVDQCIKYICDDGNIVTKTKFCNITCDEHSEILKQHVDSDKCCECVSIRTTTLMVSATTTRLVTCEMYTLTVEKNFNILYKLKSDSIGNSIENVI----YDSDKSWTV-VSNNAVLIVEFLPKQPXXXXXXXXXXXXXXXXXXXXXDIVEKDDTWKDADSYTLAKSSTKDGNLFSYTFTSATKDGIPGRFVRFSFILSNQITEVIVIRKLMIKICGSQKTTEIQPSSTSGMVSCPPKGTTIRQNECLITMCIDGEWITKMNCPISCLPGEIKVTYDDERCCQCVNANQTTISMPVISSTKLVSTKGPCKPPL-IHKCIDDCEGICHYLQENQCHNLLTSTNRICKDACVCPQ 5395
            D++ +  S  +     C  Y C  G +++  K CN+TC     + +   +  +CCEC  + TTT++V+ TTT L+ C  + +T+  +    +++++ S  N+I+ +       ++ SW+   S++   +V  +  +P    +I ++ + A    +V ++     D W     Y+   ++     L S +F++ T DG+    VR +F   + +     +  L+I  C    TT + P++T    S    G     +EC+  +C  G WI K +C I C      V +  + CC+C     TT  +   ++    +T   C  P+    C+  C   CHY+ E +C    +     C+  C CP 
Sbjct: 1799 DKDGVKHSEGSTWRSGCAIYTCSKG-VISSRKECNVTCAPGFILRQYPTNPTRCCECERLATTTVIVTPTTTTLMKCTHHEITLASDSGSKFEMRASS--NNIDRLKALKGAPANSSWSPDASDDEPRLVFAITPRPGSRTIITKLELTATRARSVEVEFTSGSDIW-----YSKRVATPSSSGLVSLSFSNETTDGVSATAVRVTFPRGSGVKVNPSVSGLLISACFEVSTTVVAPTTTPICAS----GDKKVISECISQVCESGAWIRKKSCSIECGSSCSIVHFSGDACCKCSCGTTTTTRVVTTTTAPPTTTTPMCAAPMEPSDCMRKCRK-CHYI-EPECS---SEGKFPCESGCQCPS 2145          

HSP 4 Score: 33.113 bits (74), Expect = 4.362e-11
Identity = 13/37 (35.14%), Postives = 19/37 (51.35%), Query Frame = 3
Query: 5418 CVDTRQCECVDNDGKIRKPNETWTDRCNQYRCVDNQV 5528
            CV +  C C   DGK+R   + W   C +Y C +N +
Sbjct: 2155 CVKSEDCSCRSPDGKVRSAGDVWVVDCIRYTCANNTI 2191          

HSP 5 Score: 63.5438 bits (153), Expect = 6.517e-6
Identity = 32/76 (42.11%), Postives = 41/76 (53.95%), Query Frame = 2
Query:  191 CSPDCVNGVC-KDGRCSCSLGWQGNRCSDPICVGGCSNGGKCVAPNQCLCLDNYSGPNCNTLLIKSSQSDVSNYGA 415
            CSP C NG+C     C+CS GW G  C+ P+C   C+NGG CVAPN C C   + G  C ++    S   V   G+
Sbjct:   91 CSPKCDNGMCVAPNSCNCSSGWSGATCNKPVCAKECANGGICVAPNTCRCAAGFDGEQCQSVATTVSSVCVGGCGS 166          
BLAST of von Willebrand factor vs. TrEMBL
Match: A0A1I8GY38 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 1090.49 bits (2819), Expect = 0.000e+0
Identity = 558/1360 (41.03%), Postives = 783/1360 (57.57%), Query Frame = 2
Query:  209 NGVCKDGRCSCSLGWQGNRCSDPICVGGCSNGGKCVAPNQCLCLDNYSGPNCNTLLIKSSQSDVSNYGAVTRVNNTMYSTYYECSVIYGHHIKTFDGNVFSYPLRGGYTLFMDCLGAAPLFYVYFNASYDCFDQKTQNDCSISMKITVGTQTIILFPKNEFALVKNNKTKIPFNSEGIIVSSVGSFIKIKGIDDLEILFDRDRNIYVYAPVTAEKKICGLCGYFNGIMSDDYRDFNQVIQKNVKTFVNSWIDRDPSDLNVYRE---REQYPCNALKLKNNDQYQKALTLCQDMVK-NNLGRTCQSEVKIDKYLDMCQDEICECLQTQPENSTIENCYSTFCKIEEQYSYACTLKGIAVDWRSATTICKQPQCFNGQEFSECGSNCGKNCGQLGMELECESQCLPGCYCPRNRYWDGTMCVPQEKCPCVRDNGESTYQQGYRLKLNCETCICGMHGKWQCIENEECEGRCFISGDPHYITFDRRHFFFDGHCEYTAVMTTSDNVLLSNSTIAPLSITIQNTNCQDNSETGCPRTIGVIIGEDEDQVAINLLSSSEIKVNFVKISLPYQHTGNTKVLIDQVSTDILRLKSETGVEILWNGGSRIEIKLSKKYREKVTGMCGNFNGNEMDDSMTFKGVDEKDIDKFVLSWKTNPTCESDRGIVEYKGACALSRSYSDYANKVCHKLYESEEFKKCHSAANADKFFDQCTHDVCTCGMKRNGALDHCECEAFSSYARQCALENINLSWRTNELCPKKCPNENMKYNQCGSRCTSTCRLLQESKCKEECIEGCFCPEGETFDEAAKECVKISDCKCEFHGRFYLPYEIRQDRCNNCTCTNGNWICTSNDCEGKEFCPKSMAWFDCGICQKTCTNLDLVCPKGQCQLPGCFCPENTVLHNGECIKPFECPCYMNNKMYSENDTIVRGPANCQNPCICKDGKWVCEQNKQCSGICKTWGETHYESFDGKYFEFQGSCSYVISEDFCGNKLGTFKLISENIACGXXXXXCTKSIKFIYLNRVFQFVRGSNPIVSRNTNYPPGGPTAFYWTSDVDTHFILFTMEGIQVKWDKAMSLEIMIPEKYQNKVCGLCGNFDLRIDNDMRARSGEIEKDIVNFADSWKVHSSC-PVPQKPPFMCSKRPDREPWAKAKCEILKSDSFKKCHDVVNVEHYYKRCVADACECDRGDDCVCFCTAVEQYVARCNEYEIGLKWRTNENCPHTCTGKRVWKNCGNICPDSCIDIGKNVTDNTGCKKVCIEGCFCPDGLHWQNNECVERKACECVDPITNLKYNTGDKVIRECEECNCYEGAFRCTKLFSKECLHTSRPEISTKPPHCVNEYEFLC--PNNFCARRCNGIIECRDGEDEDLC 4267
            NG C  GRC C+LG++G++C  P+C   C++ G C+APN+C C D Y G  C    + +S  D + + AV  VNNT Y     CS   G H  TFDG  F +P  G Y L  DC+ +   + VYFN S +C D   Q  C +S+KI  G   + + P      V      +P  +  + VS+  + I ++G+DDL I +D DRNI VYAP T  + +CGLCG F+G  ++D+ D       +V  F  +W D  P D NVY       Q+PC  L+ K+    + A +LC  +   ++    C S V    Y  MC  ++C CL     N+T+  C    C     YS ACT +GI ++WR  + +C  P+C NG+ FSEC  +C + CG   ++ +C + C+ GC+CP  R+WDG  CV ++ CPC R     +Y  G +    CE C+C   G W+C   +EC G C +SGDP Y TFD RHF F+GHCEY  +M        + S   P+++ ++N  C   ++  C + + + +G  E Q  I L S S +KV+   +SLP +      + I  VST +LR+++  G ++L +        LSK +R KVTG+CGNFN +  DD+++  G+D KDI +F  SWKTNPTC++    V Y GACA S+ +  YA  VC+KLY    FK CHS  +     +QC HDVC+CG +R G +  CEC AF+SYAR CAL+   L+WR++ LCP KCP   M+Y +CGS C  TC+ ++ S C EEC+EGC CP G+  DE    CV  + CKC ++G  Y   ++R+D+CNNCTCT+GNW CT+  C     CP  M W +C  CQ++C N+++ CPK  C+  GC CP+  VLH G+C+    CPC M  K+Y+EN  + RG   C N C+C+ G W C  NK C   C+ WG+ HYE+FDG+Y++F G+CSYV++ED+CG   GTF++  ENI CG+   SCTKS+K  Y + V   VRG++PI+SRN  +P   P A Y       +    T +GI+V+WD  M + + +   +  KVCGLCGNF+ + D+D+RAR+GE+ +D V FADSWKV ++C   P  P   CS   +R+ WA+ KC IL+S  F  CH  V V  +Y +CV D C C + DDC+C+CTAV QYV RCNE  + +KWR  ++CP  C    V+K CG+ CP  CIDI K  T  + CK  C+EGCFCPDG   ++  C +R+ C CV  +   K   G K+I +C+EC C  G+  C   +  +C         T  P C      +C     +CA+RC+G  EC  G+DE  C
Sbjct:  167 NGKCVRGRCVCNLGYKGDKCELPLCKNNCNSVGTCLAPNKCRCPDGYHGDLCQVSALYAS--DSTAFVAVRAVNNTRYRNSAVCSAFGGKHFLTFDGKYFDFPAHGSYVLLQDCVNSEAKYQVYFNGSRNCADA-AQTRCQVSLKIVAGPAKVEIMPGGSV-FVNEKPVTLPTIAGIVSVSNTANHITVRGLDDLAITYDGDRNINVYAPKTMSRTVCGLCGRFDGKAANDFTDLMNKPLTHVVDFAKAWRDESPDDKNVYPSVPADAQHPCARLRSKSTSLLESAQSLCSILRSGSSTFSACHSRVNSSVYESMCMKDMCTCLLNG--NATV--CNEQRCNSATLYSRACTQQGIVINWRQ-SNLCPAPKCSNGKVFSECSHDCNQKCGTNTVDDDCGTHCVDGCFCPSGRFWDGHKCVIRDNCPCNRAGDSRSYPVGSKYSHKCEQCVCDRGGSWKCSPTDECYGYCTVSGDPTYRTFDGRHFSFEGHCEYIMMMPQRS---AAESLEYPVAVYVENKYCDSVTDVLCAKLVTLQMGSGEKQHTIRLESLSRVKVDSAYVSLPVKVH---DITIRLVSTSMLRVETNKGFDLLSD--------LSKAFRNKVTGLCGNFNNDMKDDTISPTGIDVKDIRQFAKSWKTNPTCDAKTRFV-YNGACATSKEFDSYATSVCNKLYTESVFKACHSRVDPKWALEQCKHDVCSCGSRRKGVMSQCECTAFASYARSCALDGKVLNWRSSSLCPVKCP-PTMEYQECGSNCGKTCKRVEASPCIEECVEGCQCPSGQALDEEKGTCVPRNQCKCVYNGVSYTNGQVRKDKCNNCTCTDGNWECTNLTCTDSNTCPAGMVWSECSDCQRSCENINIECPKSSCKSGGCVCPKGQVLHQGKCVDKGNCPCAMAGKVYAENSVVPRGSTRCYNYCMCRKGSWQCTNNK-CPSTCRVWGDPHYETFDGRYYDFMGTCSYVLAEDYCGGTAGTFRITGENIKCGAEGMSCTKSVKITYRDVVVHLVRGTDPIISRNLYWPVTLPKAKYEIYPAGFYLFFRTEDGIEVQWDMKMKVSVTLQPNWMEKVCGLCGNFNNKRDDDLRARTGEVVEDKVAFADSWKVRNTCPKPPPTPIAPCSS--ERKRWAEKKCAILRSSEFTSCHSKVEVNEFYDKCVMDTCAC-KLDDCLCYCTAVSQYVLRCNEMGVKIKWRNPDDCPVMCPKTMVYKRCGSTCPQRCIDISKGETITSDCKSTCVEGCFCPDGEFLEDGVCKKREQCSCV--VGGKKIAYGKKIIYKCQECTCTAGSLECKPYYLGDCATFPTTVPPTTTPFCTGPGLIICRGERKYCAKRCDGNRECMYGDDEQCC 1495          

HSP 2 Score: 96.2857 bits (238), Expect = 8.566e-16
Identity = 103/467 (22.06%), Postives = 183/467 (39.19%), Query Frame = 2
Query:  200 DCVNGVCKDGRCSCSLGWQGNRCSDPICVGGCSNGGKCVAPNQCLCLDNYSGPNCNTLLIKSSQSDVSNY-----GAVTRVNNTMYSTYYECSVIYGHHIKTFDGNVFSYPLRGGYTLFMDCLGAAPLFYVYFNASYDCFDQKTQNDCSISMKITVGTQTIILFPKNEFALVKNNKTKIPFNSEGIIVSSVGSFIKIKGIDDLEILFDRDRNIYVYAPVTAEKKICGLCGYFNGIMSDDYRDFNQVIQKNVKTFVNSWIDRDPSDLNVYREREQYPCNALKLKNNDQYQKALTLCQDMVKNNLGRTCQSEVKIDKYLDMCQDEICECLQTQPENSTIENCYSTFCKIEEQYSYACTLKGIAVDWRSATTICKQPQCFNGQEFSECGSNCGKNCGQLG----MELECESQCLPGCYCPRNRYWDGTMCVPQEKCPCVRDNGESTYQQGYRLKLNCETCICGMHGKWQC 1573
            +C    CK G C C  G   ++             GKCV    C C         N+++ + S +   NY     G+    NN   ST   C V    H +TFDG  + +     Y L  D  G     +     +  C  +     C+ S+KIT     + L    +  + +N    +        +   G ++  +  D +E+ +D    + V       +K+CGLCG FN    DD R     + ++   F +SW  R+                     ++++ + A   C  +++++   +C S+V+++++ D C  + C C         +++C   +C    QY   C   G+ + WR+         C     +  CGS C + C  +     +  +C+S C+ GC+CP   + +  +C  +E+C CV    +  Y  G ++   C+ C C   G  +C
Sbjct: 1014 ECPKSSCKSGGCVCPKGQVLHQ-------------GKCVDKGNCPCAMAGKVYAENSVVPRGS-TRCYNYCMCRKGSWQCTNNKCPST---CRVWGDPHYETFDGRYYDFMGTCSYVLAEDYCGGTAGTFRITGENIKCGAEGMS--CTKSVKITYRDVVVHLVRGTDPIISRNLYWPVTLPKAKYEIYPAGFYLFFRTEDGIEVQWDMKMKVSVTLQPNWMEKVCGLCGNFNNKRDDDLRARTGEVVEDKVAFADSWKVRNTCPKPPPTPIAPC--------SSERKRWAEKKCA-ILRSSEFTSCHSKVEVNEFYDKCVMDTCAC--------KLDDCL-CYCTAVSQYVLRCNEMGVKIKWRNPDDC--PVMCPKTMVYKRCGSTCPQRCIDISKGETITSDCKSTCVEGCFCPDGEFLEDGVCKKREQCSCVVGGKKIAY--GKKIIYKCQECTC-TAGSLEC 1438          

HSP 3 Score: 63.929 bits (154), Expect = 6.156e-6
Identity = 32/76 (42.11%), Postives = 41/76 (53.95%), Query Frame = 2
Query:  191 CSPDCVNGVC-KDGRCSCSLGWQGNRCSDPICVGGCSNGGKCVAPNQCLCLDNYSGPNCNTLLIKSSQSDVSNYGA 415
            CSP C NG+C     C+CS GW G  C+ P+C   C+NGG CVAPN C C   + G  C ++    S   V   G+
Sbjct:   91 CSPKCDNGMCVAPNSCNCSSGWSGATCNKPVCAKECANGGICVAPNTCRCAAGFDGEQCQSVATTVSSVCVGGCGS 166          
BLAST of von Willebrand factor vs. TrEMBL
Match: A0A1I8G0U9 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 1087.79 bits (2812), Expect = 0.000e+0
Identity = 558/1363 (40.94%), Postives = 783/1363 (57.45%), Query Frame = 2
Query:  209 NGVCKDGRCSCSLGWQGNRCSDPICVGGCSNGGKCVAPNQCLCLDNYSGPNCNTLLIKSSQSDVSNYGAVTRVNNTMYSTYYECSVIYGHHIKTFDGNVFSYPLRGGYTLFMDCLGAAPLFYVYFNASYDCFDQKTQNDCSISMKITVGTQTIILFPKNEFALVKNNKTKIPFNSEGIIVSSVGSFIKIKGIDDLEILFDRDRNIYVYAPVTAEKKICGLCGYFNGIMSDDYRDFNQVIQKNVKTFVNSWIDRDPSDLNVYRE---REQYPCNALKLKNNDQYQKALTLCQDMVK-NNLGRTCQSEVKIDKYLDMCQDEICECLQTQPENSTIENCYSTFCKIEEQYSYACTLKGIAVDWRSATTICKQPQCFNGQEFSECGSNCGKNCGQLGMELECESQCLPGCYCPRNRYWDGTMCVPQEKCPCVRDNGESTYQQGYRLKLNCETCICGMHGKWQCIENEECEGRCFISGDPHYITFDRRHFFFDGHCEYTAVMTTSDNVLLSNSTIAPLSITIQNTNCQDNSETGCPRTIGVIIGEDEDQVAINLLSSSEIKVNFVKISLPYQHTGNTKVLIDQVSTDILRLKSETGVEILWNGGSRIEIKLSKKYREKVTGMCGNFNGNEMDDSMTFKGVDEKDIDKFVLSWKTNPTCESDRGIVEYKGACALSRSYSDYANKVCHKLYESEEFKKCHSAANADKFFDQCTHDVCTCGMKRNGALDHCECEAFSSYARQCALENINLSWRTNELCPKKCPNENMKYNQCGSRCTSTCRLLQESKCKEECIEGCFCPEGETFDEAAKECVKISDCKCEFHGRFYLPYEIRQDRCNNCTCTNGNWICTSNDCEGKEFCPKSMAWFDCGICQKTCTNLDLVCPKGQCQLPGCFCPENTVLHNGECIKPFECPCYMNNKMYSENDTIVRGPANCQNPCICKDGKWVCEQNKQCSGICKTWGETHYESFDGKYFEFQGSCSYVISEDFCGNKLGTFKLISENIACGXXXXXCTKSIKFIYLNRVFQFVR---GSNPIVSRNTNYPPGGPTAFYWTSDVDTHFILFTMEGIQVKWDKAMSLEIMIPEKYQNKVCGLCGNFDLRIDNDMRARSGEIEKDIVNFADSWKVHSSC-PVPQKPPFMCSKRPDREPWAKAKCEILKSDSFKKCHDVVNVEHYYKRCVADACECDRGDDCVCFCTAVEQYVARCNEYEIGLKWRTNENCPHTCTGKRVWKNCGNICPDSCIDIGKNVTDNTGCKKVCIEGCFCPDGLHWQNNECVERKACECVDPITNLKYNTGDKVIRECEECNCYEGAFRCTKLFSKECLHTSRPEISTKPPHCVNEYEFLC--PNNFCARRCNGIIECRDGEDEDLC 4267
            NG C  GRC C+LG++G++C  P+C   C++ G C+APN+C C D Y G  C    + +S  D + + AV  VNNT Y     CS   G H  TFDG  F +P  G Y L  DC+ +   + VYFN S +C D   Q  C +S+KI  G   + + P      V      +P  +  + VS+  + I ++G+DDL I +D DRNI VYAP T  + +CGLCG F+G  ++D+ D        V  F  +W D  P D NVY       Q+PC  L+ K+    + A +LC  +   ++    C S V    Y  MC  ++C CL     N+T+  C    C     YS ACT +GI ++WR  + +C  P+C NG+ FSEC  +C + CG   ++ +C + C+ GC+CP  R+WDG  CV ++ CPC R     +Y  G +    CE C+C   G W+C   +EC G C +SGDP Y TFD RHF F+GHCEY  +M        + S   P+++ ++N  C   ++  C + + + +G  E Q  I L S S +KV+   +SLP +      + I  VST +LR+++  G ++LWNG +RI+I+LSK +R KVTG+CGNFN +  DD+++  G+D KDI +F  SWKTNPTC++    V Y GACA S+ +  YA  VC+KLY    FK CHS  +     +QC HDVC+CG +R G +  CEC AF+SYAR CAL+   L+WR++ LCP KCP   M+Y +CGS C  TC+ ++ S C EEC+EGC CP G+  DE    CV  + CKC ++G  Y   ++R+D+CNNCTCT+GNW CT+  C     CP  M W +C  CQ++C N+++ CPK  C+  GC CP+  VLH G+C+    CPC M  K+Y+EN  + RG   C N C+C+ G W C  NK C   C+ WG+ HYE+FDG+Y++F G+CSYV++ED+CG   GTF++  ENI CG+   SCTKS+K  Y + V    +     +P  ++   YP G    FY            T +GI+V+WD  M + + +   +  KVCGLCGNF+ + D+D+RAR+GE+ +D V FADSWKV ++C   P  P   CS   +R+ WA+ KC IL+S  F  CH  V V  +Y +CV D C C + DDC+C+CTAV QYV RCNE  + +KWR  ++CP  C    V+K CG+ CP  CIDI K  T  + CK  C+EGCFCPDG   ++  C +R+ C CV  +   K   G K+I +C+EC C  G+  C   +  +C         T  P C      +C     +CA+RC+G  EC  G+DE  C
Sbjct:  167 NGKCVRGRCVCNLGYKGDKCELPLCKNNCNSVGTCLAPNKCRCPDGYHGDLCQVSALYAS--DSTAFVAVRAVNNTRYRNSAVCSAFGGKHFLTFDGKYFDFPAHGSYVLLQDCVNSEAKYQVYFNGSRNCADA-AQTRCQVSLKIVAGPAKVEIMPGGSV-FVNEKPVTLPTIAGIVSVSNTANHITVRGLDDLAITYDGDRNINVYAPKTMSRTVCGLCGRFDGKAANDFTDLMNKPLTRVVDFAKAWRDESPDDKNVYPSVPADAQHPCARLRSKSTSLLESAQSLCSILRSGSSTFSACHSRVNSSVYESMCMKDMCTCLLNG--NATV--CNEQRCNSATLYSRACTQQGIVINWRQ-SNLCPAPKCSNGKVFSECSHDCNQKCGTNTVDDDCGTHCVDGCFCPSGRFWDGHKCVIRDNCPCNRAGDSRSYPVGSKYSHKCEQCVCDRGGSWKCSPTDECYGYCTVSGDPTYRTFDGRHFSFEGHCEYIMMMPQRS---AAESLEYPVAVYVENKYCDSVTDVLCAKLVTLQMGSGEKQHTIRLESLSRVKVDSAYVSLPVKVH---DITIRLVSTSMLRVETNKGFDLLWNGRTRIQIRLSKAFRNKVTGLCGNFNNDMKDDTISPTGIDVKDIRQFAKSWKTNPTCDAKTRFV-YNGACATSKEFDSYATSVCNKLYTESVFKACHSRVDPKWALEQCKHDVCSCGSRRKGVMSQCECTAFASYARSCALDGKVLNWRSSSLCPVKCP-PTMEYQECGSNCGKTCKRVEASPCIEECVEGCQCPSGQALDEEKGTCVPRNQCKCVYNGVSYTNGQVRKDKCNNCTCTDGNWECTNLTCTDSNTCPAGMVWSECSDCQRSCENINIECPKSSCKSGGCVCPKGQVLHQGKCVDKGNCPCAMAGKVYAENSVVPRGSTRCYNYCMCRKGSWQCTNNK-CPSTCRVWGDPHYETFDGRYYDFMGTCSYVLAEDYCGGTAGTFRITGENIKCGAEGMSCTKSVKITYRDVVVHLPKPLLAGHPAKAKYEIYPAG----FY--------LFFRTEDGIEVQWDMKMKVSVTLQPNWMEKVCGLCGNFNNKRDDDLRARTGEVVEDKVAFADSWKVRNTCPKPPPTPIAPCSS--ERKRWAEKKCAILRSSEFTSCHSKVEVNEFYDKCVMDTCAC-KLDDCLCYCTAVSQYVLRCNEMGVKIKWRNPDDCPVMCPKTMVYKRCGSTCPQRCIDISKGETITSDCKSTCVEGCFCPDGEFLEDGVCKKREQCSCV--VGGKKIAYGKKIIYKCQECTCTAGSLECKPYYLGDCATFPTTVPPTTTPFCTGPGLIICRGERKYCAKRCDGNRECMYGDDEQCC 1494          

HSP 2 Score: 93.5893 bits (231), Expect = 6.542e-15
Identity = 105/467 (22.48%), Postives = 185/467 (39.61%), Query Frame = 2
Query:  200 DCVNGVCKDGRCSCSLGWQGNRCSDPICVGGCSNGGKCVAPNQCLCLDNYSGPNCNTLLIKSSQSDVSNY-----GAVTRVNNTMYSTYYECSVIYGHHIKTFDGNVFSYPLRGGYTLFMDCLGAAPLFYVYFNASYDCFDQKTQNDCSISMKITVGTQTIILFPKNEFALVKNNKTKIPFNSEGIIVSSVGSFIKIKGIDDLEILFDRDRNIYVYAPVTAEKKICGLCGYFNGIMSDDYRDFNQVIQKNVKTFVNSWIDRDPSDLNVYREREQYPCNALKLKNNDQYQKALTLCQDMVKNNLGRTCQSEVKIDKYLDMCQDEICECLQTQPENSTIENCYSTFCKIEEQYSYACTLKGIAVDWRSATTICKQPQCFNGQEFSECGSNCGKNCGQLG----MELECESQCLPGCYCPRNRYWDGTMCVPQEKCPCVRDNGESTYQQGYRLKLNCETCICGMHGKWQC 1573
            +C    CK G C C  G   ++             GKCV    C C         N+++ + S +   NY     G+    NN   ST   C V    H +TFDG  + +     Y L  D  G     +     +  C  +     C+ S+KIT     ++  PK    L+  +  K  +      +   G ++  +  D +E+ +D    + V       +K+CGLCG FN    DD R     + ++   F +SW  R+                     ++++ + A   C  +++++   +C S+V+++++ D C  + C C         +++C   +C    QY   C   G+ + WR+         C     +  CGS C + C  +     +  +C+S C+ GC+CP   + +  +C  +E+C CV    +  Y  G ++   C+ C C   G  +C
Sbjct: 1022 ECPKSSCKSGGCVCPKGQVLHQ-------------GKCVDKGNCPCAMAGKVYAENSVVPRGS-TRCYNYCMCRKGSWQCTNNKCPST---CRVWGDPHYETFDGRYYDFMGTCSYVLAEDYCGGTAGTFRITGENIKCGAEGMS--CTKSVKITY-RDVVVHLPK---PLLAGHPAKAKYE-----IYPAGFYLFFRTEDGIEVQWDMKMKVSVTLQPNWMEKVCGLCGNFNNKRDDDLRARTGEVVEDKVAFADSWKVRNTCPKPPPTPIAPC--------SSERKRWAEKKCA-ILRSSEFTSCHSKVEVNEFYDKCVMDTCAC--------KLDDCL-CYCTAVSQYVLRCNEMGVKIKWRNPDDC--PVMCPKTMVYKRCGSTCPQRCIDISKGETITSDCKSTCVEGCFCPDGEFLEDGVCKKREQCSCVVGGKKIAY--GKKIIYKCQECTC-TAGSLEC 1437          

HSP 3 Score: 51.9878 bits (123), Expect = 8.903e-7
Identity = 85/359 (23.68%), Postives = 154/359 (42.90%), Query Frame = 2
Query: 4322 DQNEIMKSGETKIVDQCIKYICDDGNIVTKTKFCNITCDEHSEILKQHVDSDKCCECVSIRTTTLMVSATTTRLVTCEMYTLTVEKNFNILYKLKSDSIGNSIENVIYDSDKSWTVVSNNAVLIVEFLPKQPXXXXXXXXXXXXXXXXXXXXXDIVEKDDTWKDADSYTLAKSSTKDGNLFSYTFTSATKDGIPGRFVRFSFILSNQITEVIVIRKLMIKICGSQKTTEIQPSSTSGMVSCPPKGTTIRQNECLITMCIDGEWITKMNCPISCLPGEIKVTYDDERCCQCVNANQTTISMPVISSTKLVSTKGPCKPPL-IHKCIDDCEGICHYLQENQCHNLLTSTNRICKDACVCPQ 5395
            D++ +  S  +     C  Y C  G +++  K CN+TC     + +   +  +CCEC  + TTT++V+ TTT L  C  + +T+  +    +++++ S  N+I+ +     K+       AV +            +I ++ + A    +V ++     D W     Y+   ++     L S +F++ T DG+    VR +F   + +     +  L+I  C    TT + P++T    S    G     +EC+  +C  G WI K +C I C      V +  + CC+C     TT  +   ++    +T   C  P+    C+  C   CHY+ E +C    +     C+  C CP 
Sbjct: 1790 DKDGVKHSEGSTWRSGCAIYTCTKG-VISSRKECNVTCAPGFILRQYPTNPTRCCECERLATTTVIVTPTTTTLTKCTHHEITLASDSGSKFEMRASS--NNIDRL-----KALKGAPLTAVGVQTHRMMSQGFRTIITKLELTATRARSVEVEFTSGSDIW-----YSKRVATPSSSGLVSLSFSNETTDGVSATAVRVTFPRGSGVKVNPSVSGLLISACFEVSTTVVAPTTTPICAS----GDKKVISECISQVCESGAWIRKKSCSIECGSSCSIVHFSGDACCKCSCGTTTTTRVVTTTTAPPTTTTPMCAAPMEPSDCMRKCRK-CHYI-EPECS---SEGKFPCESGCQCPS 2126          

HSP 4 Score: 33.4982 bits (75), Expect = 8.903e-7
Identity = 13/37 (35.14%), Postives = 19/37 (51.35%), Query Frame = 3
Query: 5418 CVDTRQCECVDNDGKIRKPNETWTDRCNQYRCVDNQV 5528
            CV +  C C   DGK+R   + W   C +Y C +N +
Sbjct: 2136 CVKSEDCSCRSPDGKVRSAGDVWVVDCIRYTCANNTI 2172          

HSP 5 Score: 63.929 bits (154), Expect = 6.062e-6
Identity = 32/76 (42.11%), Postives = 41/76 (53.95%), Query Frame = 2
Query:  191 CSPDCVNGVC-KDGRCSCSLGWQGNRCSDPICVGGCSNGGKCVAPNQCLCLDNYSGPNCNTLLIKSSQSDVSNYGA 415
            CSP C NG+C     C+CS GW G  C+ P+C   C+NGG CVAPN C C   + G  C ++    S   V   G+
Sbjct:   91 CSPKCDNGMCVAPNSCNCSSGWSGATCNKPVCAKECANGGICVAPNTCRCAAGFDGEQCQSVATTVSSVCVGGCGS 166          
BLAST of von Willebrand factor vs. TrEMBL
Match: A0A0L8GSF5 (Uncharacterized protein OS=Octopus bimaculoides OX=37653 GN=OCBIM_22028776mg PE=4 SV=1)

HSP 1 Score: 667.537 bits (1721), Expect = 0.000e+0
Identity = 368/975 (37.74%), Postives = 543/975 (55.69%), Query Frame = 2
Query:  719 IPFNSEGIIVSSVGSFIKIKGIDDLEILFDRDRNIYVYAPVTAEKKICGLCGYFNGIMSDDYRDFNQVIQKNVKTFVNSWID-RDPSDLNVYREREQYPCNALKLKNNDQYQKALTLCQDM-VKNNLGRTCQSEVKIDKYLDMCQDEICECLQTQPENSTIENCYSTFCKIEEQYSYACTLKGIAVDWRSATTICKQPQCFNGQEFSECGSNCGKNCGQLGMELECESQCLPGCYCPRNRYWDGTM--CVPQEKCPCVRDNGESTYQQGYRLKLNCETCICGMHGKWQCIENEECEGRCFISGDPHYITFDRRHFFFDGHCEYTAVMTTSDNVLLSNSTIAPLSITIQNTNCQDNSETGCPRTIGVIIGEDEDQVAINLLSSSEIKVNFVKISLPYQHTGNTKVLIDQVSTDILRLKSETGVEILWNGGSRIEIKLSKKYREKVTGMCGNFNGNEMDDSMTFKGVDEKDIDKFVLSWKTNPTCESDRGIVEYKGACALSRSYSDYANKVCHKLYESEEFKKCHSAANADKFFDQCTHDVCTCGMKRNGALDHCECEAFSSYARQCALENINLSWRTNELCPKKCPNENMKYNQCGSRCTSTCRLLQESKCKEECIEGCFCPEGETFDEAAKECVKISDCKCEFHGRFYLPYEIRQDRCNNCTCTNGNWICTSNDCEGKEFCPKSMAWFDCGICQKTCTNLDLVCPKGQCQLPGCFCPENTVLHNGE---CIKPFECPCYMNNKMYSENDTIVRGPANCQNPCICKDGKWVCEQNKQCSGICKTWGETHYESFDGKYFEFQGSCSYVISEDFCGNKLGTFKLISENIACGXXXXXCTKSIKFIYLNRVFQFVRGSNPIVSRNTNYPPGGPTAFYWTSDVDTHFILFTMEGIQVKWDKAMSLEIMIPEKYQNKVCGLCGNFDLRIDNDMRARSG--EIEKDIVNFADSWKVHSSCPVPQKP-PFMCSKRPDREPWAK 3613
            +P     + +S + ++  +KGIDDL IL+D   ++Y +AP     K+CGLCG F+G  ++++ ++ +        F N W+D  +   +   +E   +PC  L+ K +         C    +   + + C S V  D+Y+ MC  E+C CL      ++++ C    C++  QY+ AC+  G  + WRS  T C    C     F EC  NC ++CG  G E ECE  C+ GC+C     WD +   CV +  CPC R N +  Y  G   K  CE+C C   G+W CI +++C G C +SGDPH+ TFD R FFF+G CEY      + +   S       ++ I+N  C   ++  C + + +  G  ++   I  L S +++VN + I LPY+   +  V+I +VS  ++RL +  G+++LW+G +RI +KLS KY+ KVTGMCGNFN +  DD++T  G +E ++ KF + WKTN  C S    + Y GACALS+ Y   A +VC+K+++ E FK CH A N  KF DQC HDVC CG +R+G    CEC AF++YAR C L+ I L+WR + LC   C  + M Y +CG  C  TCR +Q   C+EECIEGC CP GE +DE    CV + +CKC +   +Y P   RQ+ CN C C +G+W CT+  C   + C   M W +C  C +TC +L++ C    C   GC CPE  V  N +   C++P ECPC      Y   D I +   +C N C CK G W C + + C+  C+ +G+ HY +FDGK + FQG+C+Y++++DFC    GTF++ +EN+ CG+   SCTKS+KF+  + +    RG+N   + N   P G P A +   +V T +I+    GI + WDK+M L I +  KY  +VCGLCGN+D   +ND R +S   E  +  + FA+SW+V  SC +  K  P  C     R+ WA+
Sbjct:   19 LPHQVGDLELSEIANYTVVKGIDDLIILYDGLSSVYAFAPPQMLGKLCGLCGQFDGNKTNEFVNYVRKPVATKADFSNVWLDPMEQRSIPSVKEDSVHPCVRLRNKFSKAADNVEAFCSVFSLDYVVFQKCHSTVPPDEYIAMCSREMCTCLL----GNSLQECSHKRCEVATQYARACSHHGKIMKWRS-NTFCPPHTCPKNMVFKECSKNCRQSCGSEGFEAECEEFCVDGCFCKEGTLWDTSTSSCVHRGDCPCYRGNDQRAYPIGTLEKSGCESCTCAEGGRWNCIMSKDCPGICTLSGDPHFQTFDGRQFFFEGECEYVLSQYQAKDGGES------FAVWIENKYCNKITDAVCTKVVTIKFG-SKNNTQIIRLRSFKVEVNSMSIGLPYK---DDDVVIRKVSNILIRLTASIGLDVLWDGRTRIYLKLSNKYQGKVTGMCGNFNNDVNDDNLTPNGENEFNVTKFAMEWKTNTACNSRPSTI-YLGACALSKQYEKLATEVCNKMWKEESFKSCHFAVNPSKFVDQCKHDVCMCG-QRHGDPRDCECAAFATYARACVLKGITLNWRKSNLCFINC-TKGMIYQECGYNCDQTCRGIQPQNCEEECIEGCNCPPGEKYDEEDNVCVPVEECKCYYRNEYYEPKSSRQELCNECICIDGHWQCTTESCNVHDLCSGDMVWSNCSDCIRTCDSLNVDC-VATCSQQGCICPEGKVQLNKDSQNCVEPSECPCNHLGYQYKNGDKIKK---DC-NQCYCKHGTWKCTE-RHCAATCEAFGDPHYVTFDGKPYNFQGACAYIVAQDFCNETGGTFQVTTENVPCGTLGYSCTKSVKFLIYDTIINLARGTNITYTINNKAPEGTPMANFTIKEVGT-YIMIEAHGITLVWDKSMRLYITLENKYMGRVCGLCGNYDQIANNDFRDKSSFPEHTQSPLAFANSWRVRESCAIVDKELPNPCVLNSHRQSWAE 968          

HSP 2 Score: 165.622 bits (418), Expect = 2.210e-37
Identity = 142/472 (30.08%), Postives = 219/472 (46.40%), Query Frame = 2
Query: 2747 CPKSMAWFDCGI-CQKTCTNLDLVCPKGQCQLPGCFCPENTVL--HNGECIKPFECPCYMNNKMYSENDTIVRGPANCQNPCICKDGKWVCEQNKQCSGICKTWGETHYESFDGKYFEFQGSCSYVISEDFCGNKLGTFKLISENIACGXXX-XXCTK--SIKFIYLNRVFQFVRGSNPIVSRNTNYPPGGPTAFYWTSDVDTHFI------LFTMEGIQVKWDKAMSLEIMIPEKYQNKVCGLCGNFDLRIDNDMRARSGEIEKDIVNFADSWKVHSSCPVPQKPPFM--CSKRPDREPWAKAKC-EILKSDSFKKCHDVVNVEHYYKRCVADACECDR--GDDCVCFCTAVEQYVARCNEYEIGLKWRTNENCPHTCTGKRVWKNCGNICPDSCIDIGKNVTDNTGCKKVCIEGCFCPDGLHW--QNNECVERKACECVDPITNLKYNTGDKVIRECEECNCYEGAFRCT 4105
            CPK+M + +C   C+++C +        +  + GCFC E T+       C+   +CPCY  N   +     +   + C++    + G+W C  +K C GIC   G+ H+++FDG+ F F+G C YV+S+    +   +F +  EN  C   + + CTK  +IKF   N   Q +R  +  V  N+    G P   Y   DV    +      L    G+ V WD    + + +  KYQ KV G+CGNF+  +++D    +GE E ++  FA  WK +++C       ++  C+     E  A   C ++ K +SFK CH  VN   +  +C  D C C +  GD   C C A   Y   C    I L WR +  C   CT   +++ CG  C  +C  I         C++ CIEGC CP G  +  ++N CV  + C+C     N  Y         C EC C +G ++CT
Sbjct:  213 CPKNMVFKECSKNCRQSCGSEGFEAECEEFCVDGCFCKEGTLWDTSTSSCVHRGDCPCYRGNDQRAYPIGTLE-KSGCESCTCAEGGRWNCIMSKDCPGICTLSGDPHFQTFDGRQFFFEGECEYVLSQYQAKDGGESFAVWIENKYCNKITDAVCTKVVTIKFGSKNNT-QIIRLRSFKVEVNS-MSIGLP---YKDDDVVIRKVSNILIRLTASIGLDVLWDGRTRIYLKLSNKYQGKVTGMCGNFNNDVNDDNLTPNGENEFNVTKFAMEWKTNTACNSRPSTIYLGACALSKQYEKLATEVCNKMWKEESFKSCHFAVNPSKFVDQCKHDVCMCGQRHGDPRDCECAAFATYARACVLKGITLNWRKSNLCFINCTKGMIYQECGYNCDQTCRGIQPQ-----NCEEECIEGCNCPPGEKYDEEDNVCVPVEECKCY--YRNEYYEPKSSRQELCNECICIDGHWQCT 671          

HSP 3 Score: 107.071 bits (266), Expect = 2.629e-19
Identity = 110/399 (27.57%), Postives = 175/399 (43.86%), Query Frame = 2
Query:  458 CSVIYGHHIKTFDGNVFSYPLRGGYTLFM-DCLGAAPLFYVYFNASYDCFDQKTQNDCSISMKITVGTQ--TIILFPKNEFALVKNNKTKIPFNSEGIIVSSVGS-FIKIKGIDDLEILFDRDRNIYVYAPVTAEKKICGLCGYFNGIMSDDYRDFNQVIQKNVKTFVNSW-----IDRDPSDLNVYREREQYPCNALKLKNNDQYQKALT-LCQDMVKNNLGRTCQSEVKIDKYLDMCQDEICECLQTQPENSTIENCYSTFCKIEEQYSYACTLKGIAVDWRSATTICKQPQCFNGQEFSECGSNCGKNCGQLGMELECESQCLPGCYCPRNRYWD--GTMCVPQEKCPCVRDNGESTYQQGYRLKLNCETCICGMHGKWQCIENEECEGRCFISGD 1618
            C++    H +TFDG  F +     Y L           F V+    Y   ++ T   C+  + I  G++  T I+  ++    V +    +P+  + +++  V +  I++     L++L+D    IY+      + K+ G+CG FN  ++DD    N   + NV  F   W      +  PS + +          A  L  + QY+K  T +C  M K    ++C   V   K++D C+ ++C C Q   +    E      C     Y+ AC LKGI ++WR  + +C    C  G  + ECG NC + C  +  +  CE +C+ GC CP    +D    +CVP E+C C   N E    +  R +L C  CIC + G WQC   E C      SGD
Sbjct:  312 CTLSGDPHFQTFDGRQFFFEGECEYVLSQYQAKDGGESFAVWIENKY--CNKITDAVCTKVVTIKFGSKNNTQIIRLRSFKVEVNSMSIGLPYKDDDVVIRKVSNILIRLTASIGLDVLWDGRTRIYLKLSNKYQGKVTGMCGNFNNDVNDDNLTPNGENEFNVTKFAMEWKTNTACNSRPSTIYL---------GACAL--SKQYEKLATEVCNKMWKEESFKSCHFAVNPSKFVDQCKHDVCMCGQRHGDPRDCE------CAAFATYARACVLKGITLNWRK-SNLCF-INCTKGMIYQECGYNCDQTCRGIQPQ-NCEEECIEGCNCPPGEKYDEEDNVCVPVEECKCYYRN-EYYEPKSSRQEL-CNECIC-IDGHWQCT-TESCNVHDLCSGD 684          

HSP 4 Score: 95.5153 bits (236), Expect = 9.981e-16
Identity = 77/285 (27.02%), Postives = 119/285 (41.75%), Query Frame = 2
Query: 3323 SDVDTHFILFTMEGIQVKWDKAMSLEIMIPEKYQNKVCGLCGNFDLRIDNDMRARSGEIEKDIVNFADSW----KVHSSCPVPQKPPFMCSKRPDREPWA----KAKCEILKSD--SFKKCHDVVNVEHYYKRCVADACECDRGDDCV----CFCTAVEQYVARCNEYEIGLKWRTNENC-PHTCTGKRVWKNCGNICPDSCIDIGKNVTDNTGCKKVCIEGCFCPDGLHW--QNNECVERKACECVDPITNLKYNTGDKVIRECEECNCYEGAFRCTKLFSKEC 4126
            S++  + ++  ++ + + +D   S+    P +   K+CGLCG FD    N+      +      +F++ W    +  S   V +     C +  ++   A    +A C +   D   F+KCH  V  + Y   C  + C C  G+         C    QY   C+ +   +KWR+N  C PHTC    V+K C   C  SC   G        C++ C++GCFC +G  W    + CV R  C C        Y  G      CE C C EG  R   + SK+C
Sbjct:   29 SEIANYTVVKGIDDLIILYDGLSSVYAFAPPQMLGKLCGLCGQFDGNKTNEFVNYVRKPVATKADFSNVWLDPMEQRSIPSVKEDSVHPCVRLRNKFSKAADNVEAFCSVFSLDYVVFQKCHSTVPPDEYIAMCSREMCTCLLGNSLQECSHKRCEVATQYARACSHHGKIMKWRSNTFCPPHTCPKNMVFKECSKNCRQSCGSEGFEAE----CEEFCVDGCFCKEGTLWDTSTSSCVHRGDCPCYRGNDQRAYPIGTLEKSGCESCTCAEGG-RWNCIMSKDC 308          
BLAST of von Willebrand factor vs. Ensembl Cavefish
Match: vwf (von Willebrand factor [Source:NCBI gene;Acc:103041546])

HSP 1 Score: 539.265 bits (1388), Expect = 1.842e-157
Identity = 362/1275 (28.39%), Postives = 564/1275 (44.24%), Query Frame = 2
Query:  455 ECSVIYGHHIKTFDGNVFSYPLRGGYTLFMDCLGAAPLFYVYFNASYDCFDQKTQNDCSISMKITVGTQTIILFPKNEFALVKNNKTKIPFNSEGIIVS-SVGSFIKIKGIDDLEILFDRDRNIYVYAPVTAEKKICGLCGYFNGIMSDDYRDFNQVIQKNVKTFVNSWIDRDPSDLNVYREREQYPCNALKLKNNDQYQKALTLCQDMVKNNLGRTCQSEVKIDKYLDMCQDEICECLQTQPENSTIENCYSTFCKIEEQYSYACTLKGIAV-DWRSATTICKQPQCFNGQEFSECGSNCGKNCGQLGMELECESQCLPGCYCPRNRYWDGTMCVPQEKCPCVRDNGESTYQQGYRLKLNCETCICGMHGKWQCIENEECEGRCFISGDPHYITFDRRHFFFDGHCEYTAVMTTSDNVLLSNSTIAPLSITIQNTNCQDNSETGCPRTIGVIIGEDEDQVAINLLSSSEIKVNFVKISLPYQHTGNTKVLIDQVSTDILRLKSETGVEILWNGGSRIEIKLSKKYREKVTGMCGNFNGNEMDDSMTFKGVDEKDIDKFVLSWKTNPTCESDRGIVEYKGACALSRSYSDYANKVCHKLYESEEFKKCHSAANADKFFDQCTHDVCTCGMKRNGALDHCECEAFSSYARQCALENINLSWRTNELCPKKCPNENMKYNQCGSRCTSTCRL--LQESKCKEECIEGCFCPEGETFDEAAKECVKISDCKCEFHGRFYLPYEIRQDRCNNCTCTNGNWICTSNDCEGKEF------------------CPKSMAWFDC------GI-CQKTCTNLDLVCPKGQCQLPGCFCPENTVLHNGECIKPFECPCYMNNKMYSENDTIVRGPANCQNPCICKDGKWVCEQNKQCSGICKTWGETHYESFDGKYFEFQGSCSYVISEDFCGNKLGTFKLISENIACGXXXXXCTKSIKFIYLNRVFQF----VRGSNPIVSRNTNYPPGGPTAFYWTSDVDT-----HFILFTMEGIQVKWDKAMSLEIMIPEKYQNKVCGLCGNFDLRIDNDMRARSGEIEKDIVNFADSWKVHSSCPVPQKPPFMCSKRPDREPWAKAKCEILKSDSFKKCHDVVNVEHYYKRCVADACECDRGDDCVCFCTAVEQYVARCNEYEIGLKWRTNENCPHTCTGKR-------VWK--NCGNICPDSCIDIGKNVTDNTGCKKVCIEGCF--CPDG--LHWQNNECVERKAC-------ECVDPITNLKYNTGDKVIRECEECNCYEGAFRCT 4105
             CS+   HH+ TFDG ++ +P    Y L  DC       +  F+   D    + +      + + +G    +             +  +P+ S  +     +GS           I  D   NI +          CGLCG +N + +D+Y      + ++   F NSW     S+           CN       D     ++ C+ +  + +   C   V  D +  +C+ ++C C+  Q             C+   +Y+  C   G+ + +W + +     P+C  G ++SEC   C  +C  L +   C  +C+ GC C   +  DG  CV   +C C   +    Y  G  +  +C TC+C  HG W+C  NEEC G+C +SG  HY TFD + F F G C+Y        N+          S  I    C D+ +  C R++ +   E  +Q  + L     + V+ + + +P     N  + +       +RL     +++ W+G  R+ ++LS  Y  K+ G+CGN+NGN+ DD +T  G+ E  ++ F  +WK N  C++ +   +    C+L+     +A + C  L  S +F+ CH   N   +   C +DVC+C   +      C C A S+YA  C+   + ++WR    C   CP  N  Y  CGS C  TCR   L +S C+  C EGCFCP G    +   ECV    C C + G  Y P ++  D  + C C NG+  C+S++                        CP  +    C      GI C +TC NLDL C    C + GC CP  TV H  EC+ P +CPC+ NN  YS   +I     +C N C+C   +W C Q + C G+C T G++HY SFDG  F F G C Y++++D+C    GTF+++ EN ACG+    C KSI   Y+  +       V+   P++                 +DV+      ++I+   + I + WD    + + I  +Y+ KVCGLCGNFD   +ND+ + + +IE D ++F +SWKV  SC    + P  CS    ++   +  C +L SD F++C+ VV+ E Y++ C  D C C    DC CFC A+  Y   C +  + + WR+N+ CP +C           +W+   C   CP +C        +   C   C+EGC   CP G  L      CVE   C       E +     +  N GD  +  C+ C+C E    C 
Sbjct:   27 RCSLFGRHHVHTFDGVIYEFPGDCSYKLAGDC------HHRTFSILGDLSHGRRKG-----VTVFLGETFELHLSVGGVLSQGAERLPLPYASSSVFAGFELGSVRLWSEEFGFSIRIDPAHNIQLTLSKHHANHTCGLCGNYNSVPTDEYTAQEGFLTEDPYDFANSWAMNGASEACKRVTPPAQTCNNTGASARD----LMSRCETLRTSPVFLHCAHLVDTDAFAAVCESDVCHCVDGQ----------ECVCQALLEYARTCASHGLVLPNWHTQSQC--TPKCPIGMQYSECSQACSTSCQSLNIHEVCREECVDGCSCAVGKVLDGDRCVEVSQCSC--QHTGKRYPPGSTISQDCNTCVC-RHGSWECT-NEECPGQCVVSGQSHYKTFDDKFFTFSGFCQYLLAKDCQTNLF---------SAIIDTVQCADDQDAVCTRSVTLKFHELANQT-VRLKHGGVVSVDGLDVQMPLI---NGLLRVQSTVLSSVRLNYGDDLQLDWDGRGRVVLRLSPVYAGKMCGLCGNYNGNQGDDFLTAGGLVETRVEGFGNAWKMNAECDNIQK--QPSDPCSLNPKRVRFAEEAC-ALLLSPKFEPCHHEVNPYPYLKNCRYDVCSCADGQE-----CLCAAVSNYAAACSARGVLINWRGQGYCELTCPG-NQVYEVCGSVCNQTCRSRSLPDSACRSMCEEGCFCPRGLYLTDTG-ECVPPDQCSCHYDGEIYQPNDMFADHHSICYCENGSMRCSSSELPASVLSDLFFDEPPLSRERRSVSCPAPLQQLRCESVRDVGIECARTCQNLDLECVSQGC-ISGCVCPPGTVRHRRECVPPDQCPCFHNNHAYSPGQSI---KIDC-NTCVCGGRQWKCTQ-RVCDGVCHTVGDSHYISFDGLKFTFPGPCQYILAQDYCNGLDGTFRILVENSACGTIGHRCRKSISVFYMGGLIVMEQEEVKMKKPVMKE---------------TDVEIVRSGFYYIVLLGKNISITWDTGTRIILQISGQYRGKVCGLCGNFDGSQNNDLLSSNNQIEVDPLDFGNSWKVQPSCANAVQVPSQCSTDMSKQVTVEQSCRVLNSDLFRECNSVVDPEPYWEICTHDTCSCASVGDCACFCDAIAAYAHECAQKGVVVDWRSNDLCPLSCEELNKDAGVECMWRFNACDTACPKTC-----QHPEQLSCPIACLEGCHASCPQGQILDEVLRRCVEPSECQVCMHNGERISHGKQIILNHGDPHL--CQICHCEENTLTCA 1219          

HSP 2 Score: 144.821 bits (364), Expect = 5.904e-34
Identity = 106/384 (27.60%), Postives = 162/384 (42.19%), Query Frame = 2
Query: 1595 GRCFISGDPHYITFDRRHFFFDGHCEYTAVMTTSDNVLLSNSTIAPLSITIQNTNCQDNSETGCPRTIGVIIGEDEDQVAINLLSSSEIKVNFVKISLPYQHTGNTKVLIDQVSTDILRLKSETGVEILWNGGSRIEIKLSKKYREKVTGMCGNFNGNEMDDSMTFKGVDEKDIDKFVLSWKTNPTCESDRGIVEYKGACALSRSYSDYANKVCHKLYESEEFKKCHSAANADKFFDQCTHDVCTCGMKRNGALDHCECEAFSSYARQCALENINL-SWRTNELCPKKCPNENMKYNQCGSRCTSTCRLLQ-ESKCKEECIEGCFCPEGETFDEAAKECVKISDCKCEFHGRFYLPYEIRQDRCNNCTCTNGNWICTSNDCEGK 2740
            GRC + G  H  TFD   + F G C Y       D    + S +  LS              G  + + V +GE  +   ++L     +     ++ LPY    ++ V        +     E G  I  +    I++ LSK +     G+CGN+N    D+    +G   +D   F  SW  N   E+ + +      C  + + +      C  L  S  F  C    + D F   C  DVC C   +      C C+A   YAR CA   + L +W T   C  KCP   M+Y++C   C+++C+ L     C+EEC++GC C  G+  D     CV++S C C+  G+ Y P       CN C C +G+W CT+ +C G+
Sbjct:   26 GRCSLFGRHHVHTFDGVIYEFPGDCSYK---LAGDCHHRTFSILGDLS-------------HGRRKGVTVFLGETFE---LHLSVGGVLSQGAERLPLPY---ASSSVFAGFELGSVRLWSEEFGFSIRIDPAHNIQLTLSKHHANHTCGLCGNYNSVPTDEYTAQEGFLTEDPYDFANSWAMNGASEACKRVTPPAQTCNNTGASARDLMSRCETLRTSPVFLHCAHLVDTDAFAAVCESDVCHCVDGQE-----CVCQALLEYARTCASHGLVLPNWHTQSQCTPKCPI-GMQYSECSQACSTSCQSLNIHEVCREECVDGCSCAVGKVLD--GDRCVEVSQCSCQHTGKRYPPGSTISQDCNTCVCRHGSWECTNEECPGQ 379          

HSP 3 Score: 132.109 bits (331), Expect = 4.216e-30
Identity = 96/369 (26.02%), Postives = 166/369 (44.99%), Query Frame = 2
Query: 3032 GICKTWGETHYESFDGKYFEFQGSCSYVISEDFCGNKLGTFKLISENIACGXXXXXCTKSIKFIYLNRVFQFVRGSNPIVSRNTNYPPGGPTAFYWTSDVDTHFILFTME------GIQVKWDKAMSLEIMIPEKYQNKVCGLCGNFDLRIDNDMRARSGEIEKDIVNFADSWKVHS---SCPVPQKPPFMCSKRPDREPWAKAKCEILK-SDSFKKCHDVVNVEHYYKRCVADACECDRGDDCVCFCTAVEQYVARCNEYEIGLK-WRTNENCPHTCTGKRVWKNCGNICPDSCIDIGKNVTDNTGCKKVCIEGCFCPDGLHWQNNECVERKACECVDPITNLKYNTGDKVIRECEECNCYEGAFRCT 4105
            G C  +G  H  +FDG  +EF G CSY ++ D C ++  TF ++      G  S    K +  ++L   F+       ++S+     P      Y +S V   F L ++       G  ++ D A ++++ + + + N  CGLCGN++    ++  A+ G + +D  +FA+SW ++    +C     P   C+          ++CE L+ S  F  C  +V+ + +   C +D C C  G +CV  C A+ +Y   C  + + L  W T   C   C     +  C   C  SC    +++  +  C++ C++GC C  G     + CVE   C C    T  +Y  G  + ++C  C C  G++ CT
Sbjct:   26 GRCSLFGRHHVHTFDGVIYEFPGDCSYKLAGD-CHHR--TFSIL------GDLSHGRRKGVT-VFLGETFELHLSVGGVLSQGAERLP----LPYASSSVFAGFELGSVRLWSEEFGFSIRIDPAHNIQLTLSKHHANHTCGLCGNYNSVPTDEYTAQEGFLTEDPYDFANSWAMNGASEACKRVTPPAQTCNNTGASARDLMSRCETLRTSPVFLHCAHLVDTDAFAAVCESDVCHCVDGQECV--CQALLEYARTCASHGLVLPNWHTQSQCTPKCPIGMQYSECSQACSTSC----QSLNIHEVCREECVDGCSCAVGKVLDGDRCVEVSQCSCQH--TGKRYPPGSTISQDCNTCVCRHGSWECT 372          

HSP 4 Score: 112.079 bits (279), Expect = 5.259e-24
Identity = 124/479 (25.89%), Postives = 192/479 (40.08%), Query Frame = 2
Query:  191 CSPDCVNGVCKDGRCSCSLG--WQGNRCSDPICVGGCSNGGKCVAPNQCLCLDNYSGPNCNTLLIKSSQSDVSNYGAVTRVNNTMYSTYYECSVIYGHHIKTFDGNVFSYPLRGGYTLFMDCLGAAPLFYVYFNASYDCFDQKTQNDCSISMKITVGTQTIILFPKNEFALVKNNKTKIPF-NSEGIIVSSVGSFIKIKGIDDLEILFD-RDRNIYVYAPVTAEKKICGLCGYFNGIMSDDYRDFNQVIQKNVKTFVNSW--------IDRDPSDLNVYREREQYPCNALKLKNNDQYQKALTLCQDMVKNNLGRTCQSEVKIDKYLDMCQDEICECLQTQPENSTIENCYSTFCKIEEQYSYACTLKGIAVDWRSATTICKQPQCFNGQEFSECGSNCGKNCGQLGM-ELECESQCLPGCYCPRNRYW-DGTMCVPQEKCPCVRDNGESTYQQGYRLKLNCETCICGMHGKWQCIENE 1585
            C  +CV+G      CSC++G    G+RC + +    C + GK   P   +  D      CNT + +    + +N                +C V    H KTFD   F++     Y L  DC     LF    +      DQ      S+++K        +         V     ++P  N    + S+V S +++   DDL++ +D R R +   +PV A  K+CGLCG +NG   DD+     +++  V+ F N+W        I + PSD          PC+     N  + + A   C  ++       C  EV    YL  C+ ++C C   Q             C     Y+ AC+ +G+ ++WR       +  C   Q +  CGS C + C    + +  C S C  GC+CPR  Y  D   CVP ++C C  D GE  YQ       +   C C  +G  +C  +E
Sbjct:  313 CREECVDG------CSCAVGKVLDGDRCVE-VSQCSCQHTGKRYPPGSTISQD------CNTCVCRHGSWECTNE-----------ECPGQCVVSGQSHYKTFDDKFFTFSGFCQYLLAKDC--QTNLFSAIIDTVQCADDQDAVCTRSVTLKFHELANQTVRLKHGGVVSVDGLDVQMPLINGLLRVQSTVLSSVRLNYGDDLQLDWDGRGRVVLRLSPVYA-GKMCGLCGNYNGNQGDDFLTAGGLVETRVEGFGNAWKMNAECDNIQKQPSD----------PCSL----NPKRVRFAEEACALLLSPKF-EPCHHEVNPYPYLKNCRYDVCSCADGQ----------ECLCAAVSNYAAACSARGVLINWRGQGYC--ELTCPGNQVYEVCGSVCNQTCRSRSLPDSACRSMCEEGCFCPRGLYLTDTGECVPPDQCSCHYD-GE-IYQPNDMFADHHSICYC-ENGSMRCSSSE 734          

HSP 5 Score: 92.4337 bits (228), Expect = 4.350e-18
Identity = 117/441 (26.53%), Postives = 184/441 (41.72%), Query Frame = 2
Query:  308 KCVAPNQCLCLDN---YSGP-----NCNTLLIKSSQSDVSNYGAVTRVNNTMYSTYYECSVIYGHHIKTFDGNVFSYPLRGGYTLFMD-CLGAAPLFYVYF-NASYDCFDQKTQNDCSISMKITVGTQTIILFPKNEFALVKNNKTKIPFNSEGIIVSSVGSFIKIKGIDDLEILFDRDRNIYVYAPVTAEKKICGLCGYFNGIMSDDYRDFNQVIQKNVKTFVNSWIDRDPSDLNVYREREQYPCNALKLKNNDQYQKALTLCQDMVKNNLGRTCQSEVKIDKYLDMCQDEICECLQTQPENSTIENCYSTFCKIEEQYSYACTLKGIAVDWRS---ATTICKQPQCFNGQE----FSECGSNCGKNCGQLGMELECESQCLPGCY--CPRNRYWDGTM--CVPQEKCPCVRDNGESTYQQGYRLKLN------CETCIC 1549
            +CV P+QC C  N   YS       +CNT +    Q     +    RV + +      C  +   H  +FDG  F++P    Y L  D C G    F +   N++      + +   SIS+    G   +I+  + E  +    K  +   ++  IV S   +I + G  ++ I +D    I +        K+CGLCG F+G  ++D    N  I+ +   F NSW    PS  N  +   Q   +  K    +Q  + L        ++L R C S V  + Y ++C  + C C       +++ +C + FC     Y++ C  KG+ VDWRS       C++     G E    F+ C + C K C Q   +L C   CL GC+  CP+ +  D  +  CV   +C     NGE     G ++ LN      C+ C C
Sbjct:  810 ECVPPDQCPCFHNNHAYSPGQSIKIDCNTCVCGGRQ-----WKCTQRVCDGV------CHTVGDSHYISFDGLKFTFPGPCQYILAQDYCNGLDGTFRILVENSACGTIGHRCRK--SISVFYMGG---LIVMEQEEVKM----KKPVMKETDVEIVRSGFYYIVLLG-KNISITWDTGTRIILQISGQYRGKVCGLCGNFDGSQNNDLLSSNNQIEVDPLDFGNSW-KVQPSCANAVQVPSQCSTDMSKQVTVEQSCRVL-------NSDLFRECNSVVDPEPYWEICTHDTCSC-------ASVGDC-ACFCDAIAAYAHECAQKGVVVDWRSNDLCPLSCEELNKDAGVECMWRFNACDTACPKTC-QHPEQLSCPIACLEGCHASCPQGQILDEVLRRCVEPSECQVCMHNGER-ISHGKQIILNHGDPHLCQICHC 1211          

HSP 6 Score: 72.4034 bits (176), Expect = 6.126e-12
Identity = 105/481 (21.83%), Postives = 183/481 (38.05%), Query Frame = 2
Query: 1586 ECEGRCFISGDPHYITFDRRHFFFDGHCEYTAVMTTSDNVLLSNSTIAPLSITIQNTNCQDNSETGCPRTIGVIIGEDEDQVAINLLSSSEIKVNFVKISLPYQHTGNTKVLIDQVSTDILRLKSET-GVEILWNGGSR---IEIKLSKKYREKVTGMCGNFNGNEMDDSMTFKGVDEKDIDKFVLSWKTNPTCESDRGIVEYKGACALSRSYSDYANKVCH--KLYESEEFKKCHSAANADKFFDQCTHDVCTCGMKRNGALDHCECEAFSSYARQCALENINLSWRTNELCPKKCPNENMKYNQCGSRCTSTC---------------RLLQESKCKEECIEGCFCPEGETFDEAAKECVKISDCK--CEFHGRFYLPYE---IRQDRCNNCTCTNGNWI-CTSNDCEGKEFCPKSMAWFDCGICQ--------KTCTNLDLVCPKGQCQL---PGCFCPENTVLHN-GECIKPFECPC 2911
            +C   C  S   H ++F        G C Y  + +    ++L  +T            C  +    C +++ +     E   ++ L    ++ V+    ++P++  G   V + Q+   + +L+SET G  + +   S    I + L+       TG+CG+ + ++    +   G    D D ++ +W                G C  +++ S     V    +L  S  F +CH+      + + C    C        A+    C+  ++Y+  C  + + ++WR  +LC +K    +M+Y+ C + C   C                L   S+C     EGCFCP G    E   ECV    C    + HG+ +   E      + C  C C +   I CT+  C       K+ A   CG C+        K C   + VC    C++   P C    + VL N GEC   ++C C
Sbjct: 1954 KCPCMCMGSSTSHVVSFGGTALKLKGACSYLLLHSGGTELVLHTAT------------CDSSPNQICMKSLEL----KEGGTSVMLKDDMKVTVDGAVTAVPFRRGG---VSVTQIGALLHQLRSETQGFTLTFTPHSNEFTISLDLTMITNTSTTGICGSCSDDQAH-LLLPDGSPSTDPDAYLQAWAV--------------GECVWNKNVSVCEAGVAQGCELLASSVFGQCHAVLPPQDYVEMCKQLAC-----HPTAM----CDLITAYSSVCRQQGVCVNWRNADLC-RKSLLFSMEYDACRTGCVEQCGHGQAALGDMDVRGDGLGGSSQCWSAPTEGCFCPHGTVLLEG--ECVGREACSQCVDQHGQAHQLMESWTPNDNPCILCVCLDKQRINCTALPCT------KAKAPV-CGKCEILLEKTDSKCCPEYECVCDTANCKVSDPPQCENGLSPVLTNPGECAPIYQCVC 2381          

HSP 7 Score: 65.0846 bits (157), Expect = 8.508e-10
Identity = 86/388 (22.16%), Postives = 143/388 (36.86%), Query Frame = 2
Query: 2945 TIVRGPANCQN--PCICKDGKWVCEQNK------QCSGICKTWGETHYESFDGKYFEFQGSCSYVISEDFCGNKLGTFKLISENIAC-GXXXXXCTKSIKF-------IYLNRVFQFVRGSN---PIVSRNTNYPPGGPTAFYWTSDVDTHFILFTMEGIQVKWDKAMSLEI-MIPEKYQNKVCGLCGNFDLRIDNDMRARSGEIEKDIVNFADSWKVHSSCPVPQKPPFMCSKRPDREPWAKAKCEILKSDSFKKCHDVVNVEHYYKRCVADACECDRGDDCVCFCTAVEQYVARCNEYEIGLKWRTNENCPHTCTGKRVWKNCGNICPDSC---------IDI-GKNVTDNTGCKKVCIEGCFCPDGLHWQNNECVERKAC-ECVD 4015
            T++    NC+   P +CK+       N+      +C  +C     +H  SF G   + +G+CSY++         G  +L+     C  S +  C KS++        +  + +   V G+    P      +    G       S+     + FT    +      +SL++ MI       +CG C +        +    G    D   +  +W V     V  K   +C      E      CE+L S  F +CH V+  + Y + C   AC           C  +  Y + C +  + + WR  + C  +      +  C   C + C         +D+ G  +  ++ C     EGCFCP G      ECV R+AC +CVD
Sbjct: 1920 TLLSHRVNCERMEPPVCKNNLRAVRVNQTCGCSWKCPCMCMGSSTSHVVSFGGTALKLKGACSYLLLHS------GGTELVLHTATCDSSPNQICMKSLELKEGGTSVMLKDDMKVTVDGAVTAVPFRRGGVSVTQIGALLHQLRSETQGFTLTFTPHSNEF----TISLDLTMITNTSTTGICGSCSDDQAH----LLLPDGSPSTDPDAYLQAWAVGEC--VWNKNVSVC------EAGVAQGCELLASSVFGQCHAVLPPQDYVEMCKQLACHP------TAMCDLITAYSSVCRQQGVCVNWRNADLCRKSLLFSMEYDACRTGCVEQCGHGQAALGDMDVRGDGLGGSSQCWSAPTEGCFCPHGTVLLEGECVGREACSQCVD 2279          
BLAST of von Willebrand factor vs. Ensembl Cavefish
Match: scospondin (subcommissural organ spondin [Source:ZFIN;Acc:ZDB-GENE-051114-1])

HSP 1 Score: 493.812 bits (1270), Expect = 2.548e-142
Identity = 359/1267 (28.33%), Postives = 546/1267 (43.09%), Query Frame = 2
Query:  359 NCNTLLIKSSQSD--VSNYGAVTRVNNTMYSTYYECSVIYGHHIKTFDGNVFSYPLRGGYTLFMDCLGAAPLFYVYFNASYDCFDQKTQNDCSISMKITVGTQTIILFPKNEFALVKNNKTKIPFNSEGIIVSSVGSFIKIKGIDDLEILFDRDRNIYVYAPVTAEKKICGLCGYFNGIMSDDYRDFNQVIQKNVKTFVNSWIDRDPSDLNVYREREQYPCNALKLKNNDQYQKALTLCQDMVKNNLGRTCQSEVKIDKYLDMCQDEICECLQTQPENSTIENCYSTFCKIEEQYSYACTLKGIAVDWRSATTICKQPQCFNGQEFSEC--GSNCGKNCGQLGMELECESQCLPGCYCPRNRYWDGTMCVPQEKCPCVRDNGESTYQQGYRLKLNCETCICGMHGKWQCIENEECEGRCFISGDPHYITFDRRHFFFD-GHCEYTAVMTTSDNVLLSNSTIAPLSITIQNTNCQDNSETGCPRTIGVIIGEDEDQVAINLLSSSEIKVNFVKISLPYQHTGNTKVLIDQVSTDILRLKSETGVEILWN-GGSRIEIKLSKKYREKVTGMCGNFNGNEMDDSMTFKGVDEKDIDKFVLSWKTNPTCESDRGIVEYKGACALSRSYSDYANKVCHKLYESEEFKKCHSAANADKFFDQCTHDVCTCGMKRNGALDHCECEAFSSYARQCALENINLSWRTNELCPKKCPNENMKYNQCGSRCTSTCRLLQESKCKEE------CIEGCFCPEGETFDEAAKECVKISDCKCEFHGRFYLPYEIRQDRCNNCTCTNGNWICTSNDCEGKEFCPKSMAWFDCGICQKTCTNLDLVCPKGQCQLP--GCFCPENTVLHNGECIKPFECPCYMNNKMYSENDTIVRGPANCQNPCICKDGKWVCEQNKQCSGICKTWGETHYESFDGKYFEFQGSCSYVISEDFCGNKLGTFKLISENIACGXXXXXCTKSIKFIYLNRVFQFVRGSNPIV-SRNTNYPPGGPTAFYWTSDVDTHFILFTMEGIQVKWDKAMSLEIMIPEKYQNKVCGLCGNFDLRIDNDMRARSGEIEKDIVNFADSWKVHSSCP--VPQKPPFMCSKRPDREPWAKAKCEILKSDSFKKCHDVVNVEHYYKRCVADACECDRGDDCVCFCTAVEQYVARCNEYEIGLKWRTNENCPHTCTGKRVWKNCGNICPDSCIDIGKNVTDNTGCKKV-CIEGCFCPDGLHWQNNECVERKACECVDPITNLKYNTGDKVIRECEECNCYEGAFRCT 4105
            +C+  L+   Q+   +   G +  ++N   S    C    G H ++FD   F +     Y L     G    + VY +   D         CS ++++ +G   + +   N            P    G+ +  +G F+ ++    + I FD    +Y+           GLCG +N    DD+   +  I +   +F NSW   D          E    ++  +  +   ++        +K +    C  +V    Y+D C    C   + +             C     Y+  C  + I + WR    +C++  C  GQ FS+C        +        +C  +C+ GC CP   Y     C+ ++ CPC       TYQ+G  +K  C TC+C   G+WQC  +E C  +C I G  H  TFD++ +    G C++  V    D  L         ++TI+   C     TGCP+ + V          + + S   + +N    +LP      T  L  + +T    L    G  +LW+  GS + I L   +  KV G+CG    N+ DD  T +G  E  +  F   +    +C     +      C+       YA  VC  L+ S  F+ CH     + +   C  +VC+C   R      C C   ++YA+ CA E + +SWR +  CP +C    + Y +CG  C  +C  LQ+S   EE      C+ GC CPEG   D+   +CV +  C C   G  + P    Q  CN C C  G W C+ + C     CP S+  F  G C +TC++LD   P+  C  P  GC CPE TVL   +C+ P ECPC+ N +++  NDTI +   +C N C+CK  +W C Q + C+G C   G+ HY +FDG+ + F G C Y+++++      G F + +EN+ CGS+  +CTKS+     N     +RG +  V       P     +      V     L +  G+ + WD  M + + +    Q +V GLCGNFD   +ND   R G +E     F +SWKV  SCP    Q     C   P R  WAK KC ++  + F  CH  V  + YY  CV DAC CD G DC C CTA+  Y   CN   + + WR+ E CP  C    V++ CG+ C   C     +V  ++ C  + C+EGCFCP G     + C+    C C        +  G  + + C+ C C  G + CT
Sbjct:  165 SCSYTLLPDPQTSPLLLRKGHLGGLHNPKASA--TCMSWGGVHYRSFDRKHFHFQGGCTYVLASSTDGT---WAVYISTVCD-----GGGHCSKALQMMLGRDLVSVNKSNMSLNGLIIAQGEPVFQNGVSIHWLGDFVFVESGLGVRIKFDLSNTVYLTVNTEHFAATRGLCGVYNNNAEDDFTGRSGSISQYAASFGNSWRVPDQQTEGCSDAAELG--HSCDVTGDVSLRRGAESACHQLKESPFSHCHHQVDPGPYVDTCLYVYCSLGEKER--------VGAVCDTLASYARECAQQHIILSWRRPD-LCER-VCPGGQLFSDCVSSCPPSCSSALPPASGQCREECVGGCECPPGLYLHRGQCLRKDDCPCFHR--RHTYQEGDTIKQKCNTCVC-QGGQWQC-SSERCAAQCSIIGAMHISTFDKKSYNLQAGGCQFIVVEDFVDKKL---------AVTIRAGECVTGGRTGCPQEMSVTA----LHTTVTVNSKGSVILNGQPEALPVL----TADLAVRRATSSFLLVQVFGARLLWHTDGSLVVITLEPGFAHKVRGLCGTLTWNQHDDFTTPEGDVENSVPSFAAKFNIG-SCPLSSAVT--SDPCSTYTQRRQYAESVCAVLH-SAVFQACHDVVEREPYVRMCQTEVCSCATHR-----LCHCTVVTAYAQHCAQEGVLVSWRNHTFCPVQCSGGQV-YQECGRACGGSCADLQQSWVCEENAGSRTCVPGCQCPEGLMQDDQG-QCVPVDMCPCVHGGAVHQPGSSVQINCNTCVCGKGVWNCSDDPCPEVRECPGSLI-FSPGSCLRTCSSLDS--PQALCTEPIYGCVCPEGTVLLGDQCVTPDECPCHHNGRLFFTNDTISK---DC-NTCVCKQRRWHCTQ-QLCAGTCVATGDPHYVTFDGRCYSFLGDCEYMLAQEM----SGLFSVSAENVPCGSTGVTCTKSVTLTVGNTAIHLLRGKSVTVNGMPVTLPKSYSGSGLVLEKVGMFVSLSSRLGVTLLWDGGMRVYVRLEPHLQGRVGGLCGNFDGDTENDFTTRQGIVESTPELFGNSWKVSPSCPDVAEQDLRDPCVINPHRVTWAKKKCAVITQELFSLCHAEVPYQQYYDWCVFDACGCDSGGDCECLCTAIAAYAEECNRRGVYIHWRSQELCPLQCEDGLVYEPCGSTCSAVCPSSTPSV--HSHCSPLSCVEGCFCPHGTVRHGDGCITPSECPCE--WEGSLFPAGAVLTQHCQNCTCSNGTWDCT 1361          

HSP 2 Score: 56.9954 bits (136), Expect = 2.840e-7
Identity = 36/92 (39.13%), Postives = 44/92 (47.83%), Query Frame = 2
Query: 3836 GKRVWKNCGNICPDSCIDIGKNVTDNTGCKKVCIEGCFCPDGLHWQNNECVERKACECVDPITN--LKYNTGDKVIRECEECNCYEGAFRCT 4105
            G+    NC N CP SC D+ ++V    G    C  GC CPDG   Q  ECV   AC C  P  N  L+ + G  V  +C  C C  G+  CT
Sbjct: 4500 GRVYEANCANQCPRSCADLWEHVQCLQG---TCHPGCRCPDGWLLQEGECVRVTACRCGLPTENGTLELSPGQNVTVDCNTCVCINGSLVCT 4588          

HSP 3 Score: 55.8398 bits (133), Expect = 6.200e-7
Identity = 58/211 (27.49%), Postives = 84/211 (39.81%), Query Frame = 2
Query: 2441 LCP-KKCPNENMKYNQ-CGSRCTSTCR-LLQESKCKE-ECIEGCFCPEGETFDEAAKECVKISDCKCEF---HGRFYL-PYEIRQDRCNNCTCTNGNWICTSNDCEG-------------------------------------------KEFCPKSMAWFDC-GICQKTCTNL--DLVCPKGQCQLPGCFCPENTVLHNGECIKPFECPC 2911
            LCP ++C +    Y   C ++C  +C  L +  +C +  C  GC CP+G    E   ECV+++ C+C     +G   L P +     CN C C NG+ +CT+  C                                              + CP    +  C G C  +C +L  +  C  G C  PGC CP  TV+ NG C+   ECPC
Sbjct: 4490 LCPGERCEDRGRVYEANCANQCPRSCADLWEHVQCLQGTCHPGCRCPDGWLLQEG--ECVRVTACRCGLPTENGTLELSPGQNVTVDCNTCVCINGSLVCTNQPCPTYGSWGSWSECSVSCGTGQRIRRRSCTHKPGGPPCSETEQNQTCTQPCPAGQVFSACAGSCPFSCQDLWPESECVPGACS-PGCACPPATVMFNGTCVPHSECPC 4697          
BLAST of von Willebrand factor vs. Ensembl Cavefish
Match: ENSAMXT00000041370.1 (pep primary_assembly:Astyanax_mexicanus-2.0:5:1809499:1822580:1 gene:ENSAMXG00000037407.1 transcript:ENSAMXT00000041370.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 454.521 bits (1168), Expect = 5.292e-131
Identity = 357/1234 (28.93%), Postives = 542/1234 (43.92%), Query Frame = 2
Query:  458 CSVIYGHHIKTFDGNVFSYPLRGGYTLFMDCLGAAPLFYVYFNASYDCFDQKTQNDCSISMKITVGTQTIILFPKNEFALVKNNKTKIPFNSEGIIVSSVGSFIKIKGIDDLEILFDRDRNIYVYAPVTAEKKICGLCGYFNGIMSDDYRDF-NQVIQKNVKTFVNSWIDRDPSDL-NVYREREQYPCNALKLKNNDQYQKALTLCQDMVKNNLGRTCQSEVKIDKYLDMCQDEICECLQTQPENSTIENCYSTFCKIEEQYSYACT-LKGIAVDWRSATTICKQPQCFNGQEFSECGSNCGKNCGQLGMELECESQCLPGCYCPRNRYWD---GTMCVPQEKCPCVRDNGESTYQQGYRLKLNCETCICGMHGKWQCIENEECEGRCFISGDPHYITFDRRHFFFDGHCEYTAVMTTSDNVLLSNSTIAPLSITIQNTNCQDNSETGCPRTIGVIIGEDEDQVAINLLSSSEIKVNFVKISLPYQHTGNTKVLIDQVSTDILRLKSETGV--EILWNGGSRIEIKLSKKYREKVTGMCGNFNGNEMDDSMTFKGVDEKDIDKFVLSWKTNPTCESDRGIVEYKGACALSRSYSDYANKVCHKLYE-SEEFKKCHSAANADKFFDQCTHDVCTCGMKRNGALDHCECEAFSSYARQCALENINL-SWRTNELCPK---KCPNENMKYNQCGSRCTSTCRLLQES--KCKEE--CIEGCFCPEGETFDEAAKECVKISDCKCEFHGRFYLPYEIRQDRCNNCTCTNGNWICTSNDCEGK-EFCPKSMAWFDCGI---------CQKTCTNLDLVCPKGQCQ-----LPGCFCPENTVLH-NGECIKPFECPCYMNNKMYSENDTIVRGPANCQNPCICKDGKWVCEQNKQCSGICKTWGETHYESFDGKYFEFQGSCSYVISEDFCG--NKLGTFKLISENIACGXXXXXCTKSIKFIYLNRVFQFVRGSNPIVSRNTNYPPGGPTAFYWTSDVDTHFILFTMEGIQVKWDKAMSLEIMIPEKYQNKVCGLCGNFDLRIDNDMRARSGEIEKDIVNFADSWKVHSSCP---VPQKPPFMCSKRPDREPWAKAKCEILKSDSFKKCHDVVNVEHYYKRCVADACECDRGDDCVCFCTAVEQYVARCNEYEIGLKWRTNENCPHTC-----TGKRVW--KNCGNICPDSCIDIGKNVTDNTGCKKVCIEGCF--CPDGLHWQNNE---CVERKACEC 4009
            CS    +H KT+DG+VF  P    + L   C G+    Y  FN       ++ +N      KIT+     ++              K P    G+ + ++ S+I +K    L  +++ D  + +        + CGLCG FNG+ +  Y +F     Q +   + N W    P++      ER    C       N    KA + C D+V             ++ +  +C +++C+C      NS+  +  S  C    +YS  C    G   +WR+    C   +C   + + ECGS C   C        C   C+ GC+CP +  +D    T C+P   C C+  +G   Y  G     +C  C C   G+W C++ ++C G C + G  H ITFD + + F G C Y         VL    T    +I      C       C + + + +         N+  S E+ +N +   +       + + I + S+  + +++  G+  EI      ++ I    K++ ++ G+CGNFN  + DD  T  G+ E     F  +WKT  +C   +    ++  C+LS     YA   C  L + S  F  CHS  N   +   C +D C C    +     C C A SSY   CA + I +  WR +  C      CPN  M Y+   + C  +CR L ++   C  +   ++GC C EG   +E  +ECV  S C C        P E        CTC  G   C  +   GK + C   M + +C           C K+C  LD+ C     +     + GC CP   V   NG CI    CPC  N   Y   +T+     +C N C CKD +W C  N QCS  C  +G+ HY +FD K + F G+C Y +++DFC   N  GTF++I+ENI CG++ ++C+K+IK    +       GS  +V R+      G    Y    +  + ++ T  G+ + WD+  S+ I +   +  +VCGLCGNFD   +ND   RS E+  + ++F +SWK   +CP   V Q+P   C+  P RE WA+ +C I+ SD F  CH  V+   +Y  CV DAC CD G DC CFCTAV  Y   CN   + + WRT + CP  C      G+  W  K CG  C  +C    +N       +   +EGC+  CP GL + + +   CV  + C C
Sbjct:   29 CSTWGNYHFKTYDGDVFQLPSTCNHILTSQCRGS----YEAFNIQ---LRRQVENGEPTISKITMKLDGTVV------------DVKAPHLGSGVFIETISSYIMVKATVGLTAMWNEDDALMIELNAKFINQTCGLCGDFNGVPT--YNEFIKDGAQLSATDYGNLWKMDGPTETCEEQPERVNENCGDENFCQNLFLSKAFSSCTDLVS------------VEPFTKVCIEDLCQC------NSSAGS--SCLCDTLAEYSRQCVHAGGQPANWRTEH-FCPM-KCPESKVYMECGSPCMDTCSNPERGQVCGEHCIDGCFCPSDTVFDDVTNTGCIPLSNCSCI--HGGKAYASGEGYSSSCRECTCS-GGQWNCVD-KQCPGTCSVEGGAHIITFDGKPYTFHGDCSY---------VLSKECTGTDFTILGDLVKCGITDSETCLKAVTLALSN-----GTNVSLSCELNINLLFKKIFRLTQTESDISIFKPSSFYIVIQTTIGLRLEIQLTPIMQVYITADPKFQGQMCGLCGNFNNIQADDFTTMGGLTEGTAVDFANTWKTRASCLDVQRT--FENPCSLSTENEKYAQYWCSLLSDASGVFSSCHSEINPATY-KNCIYDTCNCEKTED-----CMCAALSSYVHACAAKGIYIKGWR-DVACKSYTLSCPN-TMVYSYNMTSCGRSCRSLSQTDFSCSSQFVAVDGCGCAEGTYLNEK-EECVDPSGCPCYDSNTVIQPGETVSREGTTCTCKQGQLNCIGS---GKVQECTSPMTYLNCSAAVPGSTGSECAKSCKTLDMACVSYHIKYTRGCVSGCVCPSGLVSDDNGGCITEDLCPCVHNGASYKPGETVKE---DC-NTCTCKDRRWQCTTN-QCSATCSIYGDGHYITFDDKRYVFNGNCEYTLAQDFCSSSNTNGTFRVITENIPCGTTGTTCSKAIKLFIGSNELVLSDGSYQVVQRD-----AGQEIPYQIRTMGNYLVIETNNGVVLIWDRKTSMYIKLTPDFNGRVCGLCGNFDGNANNDFTTRSQELVVNALDFGNSWKFSPTCPEAMVVQEP---CAHNPYREAWAQRQCSIINSDVFSACHSKVDPASFYSACVRDACACDTGGDCECFCTAVAAYAEACNAVGVCVAWRTPKVCPLFCDYYNPPGECEWHYKPCGAPCMKTC----RNPAGTCSLQLPAMEGCYPECPAGLPFFDEDTMKCVALEECGC 1170          

HSP 2 Score: 169.859 bits (429), Expect = 1.036e-41
Identity = 141/488 (28.89%), Postives = 222/488 (45.49%), Query Frame = 2
Query: 2747 CPKSMAWFDCG-ICQKTCTNLDLVCPKGQCQLPGCFCPENTV---LHNGECIKPFECPCYMNNKMYSENDTIVRGPANCQNPCICKDGKWVCEQNKQCSGICKTWGETHYESFDGKYFEFQGSCSYVISEDFCGNKLGTFKLISENIACGXX-XXXCTKSIKF-----------------IYLNRVFQFVRGSNPIVSRNTNYPPGGPTAFYWTSDVDTHFILFTMEGI--QVKWDKAMSLEIMIPEKYQNKVCGLCGNFDLRIDNDMRARSGEIEKDIVNFADSWKVHSSCPVPQKP-PFMCSKRPDREPWAKAKCEILKSDS--FKKCHDVVNVEHYYKRCVADACECDRGDDCVCFCTAVEQYVARCNEYEIGLK-WRT------NENCPHTCTGKRVWKNCGNICPDSCIDIGKNVTDNT-GCKKVCIEGCFCPDGLHW-QNNECVERKACECVDPITNLKYNTGDKVIRECEECNCYEGAFRC 4102
            CP+S  + +CG  C  TC+N +     G+  + GCFCP +TV   + N  CI    C C    K Y+  +    G ++    C C  G+W C  +KQC G C   G  H  +FDGK + F G CSYV+S++  G     F ++ + + CG + S +C K++                   +   ++F+  +  + I           P++FY         ++ T  G+  +++    M + I    K+Q ++CGLCGNF+    +D     G  E   V+FA++WK  +SC   Q+     CS   + E +A+  C +L   S  F  CH  +N    YK C+ D C C++ +DC+C   A+  YV  C    I +K WR         +CP+T        +CG     SC  + +  TD +   + V ++GC C +G +  +  ECV+   C C D  +N     G+ V RE   C C +G   C
Sbjct:  273 CPESKVYMECGSPCMDTCSNPERGQVCGEHCIDGCFCPSDTVFDDVTNTGCIPLSNCSCIHGGKAYASGE----GYSSSCRECTCSGGQWNC-VDKQCPGTCSVEGGAHIITFDGKPYTFHGDCSYVLSKECTGTD---FTILGDLVKCGITDSETCLKAVTLALSNGTNVSLSCELNINLLFKKIFRLTQTESDISIFK-------PSSFY--------IVIQTTIGLRLEIQLTPIMQVYITADPKFQGQMCGLCGNFNNIQADDFTTMGGLTEGTAVDFANTWKTRASCLDVQRTFENPCSLSTENEKYAQYWCSLLSDASGVFSSCHSEIN-PATYKNCIYDTCNCEKTEDCMC--AALSSYVHACAAKGIYIKGWRDVACKSYTLSCPNTMVYSYNMTSCGR----SCRSLSQ--TDFSCSSQFVAVDGCGCAEGTYLNEKEECVDPSGCPCYD--SNTVIQPGETVSREGTTCTCKQGQLNC 726          

HSP 3 Score: 119.783 bits (299), Expect = 1.926e-26
Identity = 92/375 (24.53%), Postives = 156/375 (41.60%), Query Frame = 2
Query: 3011 EQNKQCSGICKTWGETHYESFDGKYFEFQGSCSYVISEDFCGNKLGTFKLISENIACGXXXXXCTKSIKFIYLNRVFQFVRGSNPIVSRNTNYPPGGPTAFYWTSDVDTHFILFTMEGIQVKWDKAMSLEIMIPEKYQNKVCGLCGNFDLRIDNDMRARSGEIEKDIVNFADSWKVHSSCPVPQKPPFMCSKRPDREPWAKAKC-------EILKSDSFKKCHDVVNVEHYYKRCVADACECDRGDDCVCFCTAVEQYVARC-NEYEIGLKWRTNENCPHTCTGKRVWKNCGNICPDSCIDIGKNVTDNTGCKKVCIEGCFCPDGLHWQ---NNECVERKACECVDPITNLKYNTGDKVIRECEECNCYEGAFRC 4102
            E N Q   +C TWG  H++++DG  F+   +C+++++   C      F     NI       +   +I  I +      V         +   P  G   F  T  + ++ ++    G+   W++  +L I +  K+ N+ CGLCG+F+     +   + G  +    ++ + WK+         P   C ++P+R       C        +  S +F  C D+V+VE + K C+ D C+C+      C C  + +Y  +C +       WRT   CP  C   +V+  CG+ C D+C     N      C + CI+GCFCP    +    N  C+    C C+       Y +G+     C EC C  G + C
Sbjct:   23 EHNGQ---VCSTWGNYHFKTYDGDVFQLPSTCNHILTSQ-CRGSYEAF-----NIQLRRQVENGEPTISKITMKLDGTVV---------DVKAPHLGSGVFIET--ISSYIMVKATVGLTAMWNEDDALMIELNAKFINQTCGLCGDFNGVPTYNEFIKDG-AQLSATDYGNLWKMDG-------PTETCEEQPER---VNENCGDENFCQNLFLSKAFSSCTDLVSVEPFTKVCIEDLCQCNSSAGSSCLCDTLAEYSRQCVHAGGQPANWRTEHFCPMKCPESKVYMECGSPCMDTC----SNPERGQVCGEHCIDGCFCPSDTVFDDVTNTGCIPLSNCSCIH--GGKAYASGEGYSSSCRECTCSGGQWNC 360          
BLAST of von Willebrand factor vs. Ensembl Cavefish
Match: ENSAMXT00000019204.2 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02001825.1:10421:34530:-1 gene:ENSAMXG00000018303.2 transcript:ENSAMXT00000019204.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 441.425 bits (1134), Expect = 1.852e-128
Identity = 331/1150 (28.78%), Postives = 510/1150 (44.35%), Query Frame = 2
Query:  458 CSVIYGHHIKTFDGNVFSYPLRGGYTLFMDCLGAAPLFYVYFNASYDCFDQKTQNDCSISMKITVGTQTIILFPKNEFALVKNNKTKIPFNSEGIIVSSVGSFIKIKGIDDLEILFDRDRNIYVYAPVTAEKKICGLCGYFNGIMSDDYRDFNQVIQKNVKTFVNSWIDRDPSDLNVYREREQYPCNALKLKNNDQYQKALTLCQDMVKNNLGRTCQSEVKIDKYLDMCQDEICECLQTQPENSTIENCYSTFCKIEEQYSYACT-LKGIAVDWRSATTICKQPQCFNGQEFSECGSNCGKNCGQLGMELECESQCLPGCYCPRNRYWDGTM---CVPQEKCPCVRDNGESTYQQGYRLKLNCETCICGMHGKWQCIENEECEGRCFISGDPHYITFDRRHFFFDGHCEYTAVMTTSDNVLLSNSTIAPLSITIQNTNCQDNSETGCPRTIGVIIGEDEDQVAINLLSSSEIKVNFVKISLPYQHTGNTKVLIDQVSTDILRLKSETGV--EILWNGGSRIEIKLSKKYREKVTGMCGNFNGNEMDDSMTFKGVDEKDIDKFVLSWKTNPTCESDRGIVEYKGACALSRSYSDYANKVCHKLYESE-EFKKCHSAANADKFFDQCTHDVCTCGMKRNGALDHCECEAFSSYARQCALENINLSWRTNELCPK---KCP-NENMKYNQCGSRCTSTCRLLQESKCKEE--CIEGCFCPEGETFDEAAKECVKISDCKCEFHGRFYLPYEIRQDRCNNCTCTNGNWICTSNDCEGKEFCPKSMAWFDC--------GI-CQKTCTNLDLVCPKGQCQLPGCFCPENTVLHN-GECIKPFECPCYMNNKMYSENDTIVRGPANCQNPCICKDGKWVCEQNKQCSGICKTWGETHYESFDGKYFEFQGSCSYVISEDFCGNKLGTFKLISENIACGXXXXXCTKSIKFIYLNRVFQFVRGSNPIVSRNTNYPPGGPTAFYWTSDVDTHFILFTMEGIQVKWDKAMSLEIMIPEKYQNKVCGLCGNFDLRIDNDMRARSGEIEKDIVNFADSWKVHSSCP--VPQKPPFMCSKRPDREPWAKAKCEILKSDSFKKCHDVVNVEHYYKRCVADACECDRGDDCVCFCTAVEQYVARCNEYEIGLKWRTNENCPHTC 3832
            CS+    H KTFDG+V+ +     Y L   C G+   F V+   S    D K        + +T+G   I L       +V ++  K+P    G+++    ++IK+     L +++++D  + V        + CGLCG FNG+                   +N +I             E   C+         Y      C +++++   ++C S V  + Y+  C  + C       E+S         C    +YS  C+   G   +WR     C   +C    E+SE GS C   C      L CE   + GCYCP    +D      C+PQE+C C  +     Y  G  L +  + C+C  HG W C E+    G C +    H+ TFD + F F G C Y         +L  +   +  ++  Q   C D+    C +++ V++  ++   A+ +     +K N   ++LPY    +  +++ + S+  + +++  G+  ++      ++ I L + Y+ K  G+CGNFN    D+  T +G+ E     F  SWK    C  DR        C+ +     YA   C KL E E  F KCHS+ N + ++ +C +  CTC    N     C C  FSSY R C  + I L    + +C K    CP  +   Y   G + T     L+   C      ++GC CP+G  ++     CV +  C C  +G    P +    +  +C CTNG   C S      + CP    +F+C        G+ C KTC    + C    C   GC CP   +    G C+    CPC  N   Y     I      C N C CK GKW C + K C G C  +G  HY +FD + F F G C Y+ +++ CGNK GTF +I+EN+ CG++ ++C+KS++ +        + G       NT+    G    Y   +V  +  +    G+ V WD+  ++ I++  ++  +VCGLCGNF+    +D   +      D++ FA+SWKV+S CP  VP   P  CSK  +R  WAK +C I+   +FK+CH +V+   Y+  CV D+C CD G DC CFCTAV  Y   CNE  + + WRT E CP  C
Sbjct:    4 CSMWGNFHFKTFDGDVYQFQGICEYNLVSHCHGSVQDFSVHVKRSEFTGDSKINR-----VLVTIGDMAIKL--TKNLVMVNDDVVKLPHYVAGVLLEQYATYIKLYAKLGLSVMWNKDDAVMVELEAKYTNQTCGLCGDFNGM-----------------AILNEFI------------SEAQACD---------YSSQRPGCSELLEDKAWKSCTSIVSPEPYIQACVVDRCWSRPGDIEDSL------PLCTTLSEYSRQCSHAGGTPPNWRKPD-FCAV-KCPYNMEYSESGSPCVDTCSHTDTSLLCEEHKMDGCYCPPGTVFDDISDRGCIPQEQCQCKHNK---VYNSGDVLHMEDKECVC-HHGSWTC-ESLPTPGLCAVEEGSHFTTFDGKEFTFHGECYY---------ILSQDCEESKFTVLGQLIPCVDHETDTCLKSV-VLLPNNDKNNALVIKDDGTVKQNG-DLTLPY---ASANIIVFRPSSFHIIVQTSFGLRMQVQLVPVMQLYITLDRSYQTKTCGLCGNFNMVLSDELKTPQGLVEGTASSFANSWKAQSNCR-DRS-ESLDDPCSYNIDSESYAEHWCSKLLEKEGPFAKCHSSVNPESYYKRCKYSTCTCEKTEN-----CLCGVFSSYVRACTAKGIFLQGWRDTVCKKYTEHCPATQTFSYKLQGCQRTCDSLSLERPACINTYLPVDGCACPDG-LYENENGVCVALDKCSCYHNGERIKPGKSITIKNEHCVCTNGKLHCHSWKPSVMD-CPAPKVFFNCSEAGPEEHGLECAKTCAQKTVDCFLTGCT-SGCQCPSGLLDDGRGHCVPQHNCPCKHNGHYYPPGSQITD---QC-NTCTCKQGKWKCTEEK-CPGTCTIYGSGHYNTFDNRRFGFSGDCGYIAAQNKCGNKTGTFHVITENVPCGTTGTTCSKSVRIVLGKTQLDLIDGK----VTNTDLE-SGTLIKYRVRNVGLYLAIEADIGLTVLWDRKTTVRIILQPQHMGEVCGLCGNFNGNGKDDFTTQGQLQVSDVLEFANSWKVNSHCPDAVPDFDP--CSKAHNRHTWAKMQCSIITGKTFKECHSMVDPAPYFDNCVRDSCACDTGGDCECFCTAVAAYAQACNEAGVCVAWRTPEICPVFC 1059          

HSP 2 Score: 101.679 bits (252), Expect = 6.309e-21
Identity = 91/378 (24.07%), Postives = 159/378 (42.06%), Query Frame = 2
Query: 3035 ICKTWGETHYESFDGKYFEFQGSCSYVIS-------EDFC-----GNKLGTFKLISENIACGXXXXXCTKSIKFIYLNRVFQFVRGSNPIVSRNTNYPPGGPTAFYWTSDVDTHFILFTMEGIQVKWDKAMSLEIMIPEKYQNKVCGLCGNFD-LRIDNDMRARSGEIEKDIVNFADSWKVHSSCPVPQKPPFMCSKRPDREPWAKAKCEILKSDSFKKCHDVVNVEHYYKRCVADACECDRGD--DCVCFCTAVEQYVARCNEY-EIGLKWRTNENCPHTCTGKRVWKNCGNICPDSCIDIGKNVTDNTGCKKVCIEGCFCPDGLHW---QNNECVERKACECVDPITNLKYNTGDKVIRECEECNCYEGAFRCTKL 4111
            +C  WG  H+++FDG  ++FQG C Y +        +DF          G  K+    +  G  +   TK++  +            N  V +  +Y  G     Y      T+  L+   G+ V W+K  ++ + +  KY N+ CGLCG+F+ + I N+  + +   +                          S+RP          E+L+  ++K C  +V+ E Y + CV D C    GD  D +  CT + +Y  +C+        WR  + C   C     +   G+ C D+C     ++     C++  ++GC+CP G  +    +  C+ ++ C+C     N  YN+GD +  E +EC C+ G++ C  L
Sbjct:    3 VCSMWGNFHFKTFDGDVYQFQGICEYNLVSHCHGSVQDFSVHVKRSEFTGDSKINRVLVTIGDMAIKLTKNLVMV------------NDDVVKLPHYVAGVLLEQY-----ATYIKLYAKLGLSVMWNKDDAVMVELEAKYTNQTCGLCGDFNGMAILNEFISEAQACDYS------------------------SQRP-------GCSELLEDKAWKSCTSIVSPEPYIQACVVDRCWSRPGDIEDSLPLCTTLSEYSRQCSHAGGTPPNWRKPDFCAVKCPYNMEYSESGSPCVDTCSHTDTSLL----CEEHKMDGCYCPPGTVFDDISDRGCIPQEQCQCKH---NKVYNSGDVLHMEDKECVCHHGSWTCESL 325          
BLAST of von Willebrand factor vs. Ensembl Cavefish
Match: otog (otogelin [Source:ZFIN;Acc:ZDB-GENE-120228-1])

HSP 1 Score: 444.121 bits (1141), Expect = 1.995e-126
Identity = 333/1229 (27.10%), Postives = 547/1229 (44.51%), Query Frame = 2
Query:  242 SLGWQGNRCSDPICVGGCSNGGKCVAPNQCLC-LDNYSGPNCNTLLIKSSQSDVSNYGAVTRVNNTMYSTYYECSVIYGHHIKTFDGNVFSYPLRGGYTLFMDC---LGAAPLFYVYFNASYDCFDQKTQNDCSISMKITVGTQTIILFPKNEFALVKNNKTKIPFNSEGIIVSSVGSFIKIKGIDDLEILFD-RDRNIYVYAPVTAEKKICGLCGYFNGIMSDDYRDFNQVIQKNVKTFVNSWIDRDPSDLNVYREREQYPCNALKLKNNDQYQKALTLCQDMVKNNLGRTCQSEVKIDKYLDMCQDEICECLQTQPENSTIENCYSTFCKIEEQYSYACTLKGIAVD-WRSATTICKQPQCFNGQEFSECGSNCGKNCGQLGMELECESQCLPGCYCPRNRYWDGTMCVPQEKCPCVRDNGESTYQQGYRLKLNCETCICGMHGKWQCIENEECEGRCFISGDPHYITFDRRHFFFDGHCEYTAVMTTSDNVLLSNSTIAPLSITIQNTNCQDNSETGCPRTIGVIIGEDEDQVAINLLSSSEI-KVNFVKISLPYQHTGNTKVLIDQVSTDILRLKSETGVEILWNGGS-RIEIKLSKKYREKVTGMCGNFNGNEMDDSMTFKGVDEKDIDKFVLSWKTNPTCESDRGIVEYKGACALSRSYSDYANKVCHKLYESEEFKKCHSAANADKFFDQCTHDVCTCGMKRNGALDHCECEAFSSYARQCALENINLSWRTN-ELCPKKCPNENMKYNQCGSRCTSTC-RLLQESKCKEECIEGCFCPEGETFDEAAKECVKISDCKCEFHGRFYLPYEIRQDRCNNCTCTNGNWICTSNDCEGKEFCPKSMAWFDCG------------ICQKTCTN--LDLVCPKGQCQLPGCFCPENTVLHNGECIKPFECPCYMNNKMYSENDTIVRGPANCQNPCICKDGKWVCEQNKQCSGICKTWGETHYESFDGKYFEFQGSCSYVISEDFCGNKLGTFKLISENIACGXXXXXCTKSIKFIYLNRVFQFV------RGSNPIVSRNTNYPPGGPTAFYWTSDVDTHFILFTMEGIQVKWDKAMSLEIMIPEKYQNKVCGLCGNFDLRIDNDMRARSGEIEKDIVNFADSWKVHS--SCPVPQKPPFMCSKRPDREPWAKAKCEILKSDSFKKCHDVVNVEHYYKRCVADACECDRGDDCVCFCTAVEQYVARCNEYEIGLKWRTNENCPHTC 3832
            +L W+G R   P C   C NGG+CV P+ C C L   +G +C T                  V N+       C     ++ +TFDG  + +P +  YTL  DC   +  + L  V+ +     F       C+ S+ + +  +  I   ++     K    K+P N   + +  +  ++ +       + +   + +IY+        + CGLCG FN  ++DD +    V  +++  F NSW++ +P           YP +    +++    K   +C  ++K    ++C   V    Y+  C +++C    + P    +       C++  +Y+ AC      ++ WR+   +C   +C    ++ EC   C  +C    M ++ + QCL GCYC  +  ++  +CV    CPC  ++    Y  G+ ++  C  C C   G W C E ++C G C ++GD ++ +FD R + F   C+Y         VL  +      ++TIQN  C  N +  C +++ V++ ED  +  + L  S E+   +  +ISLPY    +    I ++S+  +++K+  G+ + +N    R+ ++L + +R+   G+CG FNGN  DD +   G+ E     F  +W+ +  C   R  +     C   +  + YA + C  L + E F  CH   +   F  QC  DVC CG         C C A + YAR C   N+ + +R++   C   CP   M+Y  C S C   C        C +EC EGC CP+G  +      CVK ++C C F G  Y P ++         C +G  +  S   +  + CP    + DCG             C +TC +  L+L C   +  +PGC CP   + H  EC +P  CPC    K Y   D +    + C   C+C+ G + CE  + C  +C  +G+ HY +FDG  F++ G+C   + +      +    + +ENI C  S   C K++  I + R F            + ++ R             W++   T   L   E + V WD+  ++ I    ++Q K+ GLCGNFDL+  N+MR            F +SW      + P  + P   CS  P RE +AK +C IL S+ F+ CH VV+V  +Y  C+AD C C RG DC CFC++V  Y  RC    + + WR+   CP+ C
Sbjct:   78 ALRWEGRRARGP-CTFPCLNGGQCVYPDSCNCSLYQATGTHCQT------------------VPNSGLEREMTCRSWGQYNYETFDGLYYYFPGKCSYTLLKDCEENIQPSLLIQVHNDPECTSFPYS----CTRSVSLFLPWEGEIRL-QDLNVTFKGQSVKLPHNIHDLELEQIADYVLVSQPQVFTLAWHGLNGSIYIKMSPEFVGRTCGLCGNFNADVNDDLKTSYGVFTEDLAMFGNSWVEEEPQKATCSMIPYLYP-SPCSGQDSHVLLKVEEVCATLLKEPF-KSCHEFVSPYSYMASCSNDLC---LSGPNGDVV-------CQVFTEYARACAHADHPLNKWRTHVPVCGV-ECPAELQYRECIPCCPVHCRTEQMCIDSKLQCLDGCYCQDDLIYEDGLCVKASDCPC--EHRGMLYPSGHTIQEECNNCTCS-GGAWNCTE-QKCPGECSVTGDMYFQSFDGRVYTFLATCQY---------VLAKSRNSGGFTVTIQNAPCGPNLDGACIQSVNVVLNEDP-RTEVTLSHSGEVFMASQFRISLPY---SDDVFQIQELSSLFVQVKTSQGLLLQYNWREFRLYLQLGELWRDDTVGLCGTFNGNIQDDFLAPSGMIESTPQLFGNAWRVSSAC-VPRPSLPQLDPCDTHQQAASYAVEKCEVLMQ-EVFAVCHEHVSPVGFQLQCRADVCKCGTP-------CLCSALAHYARTCRKHNVIIEFRSHVPECSVACP-ATMEYGLCVSSCQRRCLSFSMPQSCGDECEEGCVCPQGTYYSTHTHSCVKRNECPCSFLGTDYSPGDVIMTSSGVQICRDGQIVLQSTITD--KLCPPGQIYEDCGNMVDGPSVSKGLACDRTCESYLLNLTCSTHEPCVPGCVCPTGLLKHGDECFEPVACPCLWKGKEYYPGDKVS---STCHL-CVCQQGTFQCE-FRPCPSMCTAYGDRHYRTFDGLLFDYVGACKVYLLKSSADVMVS---VTTENIDCFESGVICRKAL-LISVGRSFIVFDDETGKPSPSSVIDRQN--------VLIWSAGYFTIVHLSQYE-LSVLWDRKTTIHIQAGPRWQGKLSGLCGNFDLKTVNEMRTPDNMDSATPQEFGNSWTAAECVNSPDIRHP---CSLNPLREAFAKKQCGILLSEVFQVCHPVVDVTWFYMNCLADTCGCSRGGDCECFCSSVAAYAHRCCHQGVTVDWRSPSLCPYDC 1219          

HSP 2 Score: 156.762 bits (395), Expect = 1.443e-37
Identity = 120/461 (26.03%), Postives = 206/461 (44.69%), Query Frame = 2
Query: 2747 CPKSMAWFDCGICQKTCTNLDLVCPKGQCQ-LPGCFCPENTVLHNGECIKPFECPCYMNNKMYSENDTIVRGPANCQNPCICKDGKWVCEQNKQCSGICKTWGETHYESFDGKYFEFQGSCSYVISEDFCGNKLGTFKLISENIACGXXXX-XCTKSIKFIY----LNRVFQFVRGSNPIVSRNTNYPPGGPTAFYWTSDVDTHFI-LFTMEGIQVKWD-KAMSLEIMIPEKYQNKVCGLCGNFDLRIDNDMRARSGEIEKDIVNFADSWKVHSSC-PVPQKPPF-MCSKRPDREPWAKAKCEILKSDSFKKCHDVVNVEHYYKRCVADACECDRGDDCVCFCTAVEQYVARCNEYEIGLKWRTN-ENCPHTCTGKRVWKNCGNICPDSCIDIGKNVTDNTGCKKVCIEGCFCPDGLHW--QNNECVERKACECVDPITNLKYNTGDKVIRECEECNCYEG 4090
            CP  + + +C  C       + +C   + Q L GC+C ++ +  +G C+K  +CPC     +Y    TI      C N C C  G W C + K C G C   G+ +++SFDG+ + F  +C YV+++       G F +  +N  CG +   +C +S+  +        V     G   + S+     P     F    ++ + F+ + T +G+ ++++ +   L + + E +++   GLCG F+  I +D  A SG IE     F ++W+V S+C P P  P    C        +A  KCE+L  + F  CH+ V+   +  +C AD C+C       C C+A+  Y   C ++ + +++R++   C   C     +  C + C   C+           C   C EGC CP G ++    + CV+R  C C        Y+ GD ++       C +G
Sbjct:  403 CPAELQYRECIPCCPVHCRTEQMCIDSKLQCLDGCYCQDDLIYEDGLCVKASDCPCEHRGMLYPSGHTIQE---ECNN-CTCSGGAWNCTEQK-CPGECSVTGDMYFQSFDGRVYTFLATCQYVLAK---SRNSGGFTVTIQNAPCGPNLDGACIQSVNVVLNEDPRTEVTLSHSGEVFMASQFRISLPYSDDVFQ-IQELSSLFVQVKTSQGLLLQYNWREFRLYLQLGELWRDDTVGLCGTFNGNIQDDFLAPSGMIESTPQLFGNAWRVSSACVPRPSLPQLDPCDTHQQAASYAVEKCEVLMQEVFAVCHEHVSPVGFQLQCRADVCKCGTP----CLCSALAHYARTCRKHNVIIEFRSHVPECSVACPATMEYGLCVSSCQRRCLSFSMP----QSCGDECEEGCVCPQGTYYSTHTHSCVKRNECPCS--FLGTDYSPGDVIMTSSGVQICRDG 844          

HSP 3 Score: 118.627 bits (296), Expect = 5.834e-26
Identity = 112/438 (25.57%), Postives = 181/438 (41.32%), Query Frame = 2
Query: 2870 LHNGECIKPFECPCYMNNKMYSENDTIVRGPANCQNPCICKDGKWVCEQNKQCSGICKTWGETHYESFDGKYFEFQGSCSYVISEDFCGNKLGTFKLIS--ENIACGXXXXXCTKSIKF-------IYLNRVFQFVRGSNPIVSRNTNYPPGGPTAFYWTSDVDTHFILFTMEGIQVKWDKA-MSLEIMIPEKYQNKVCGLCGNFDLRIDNDMRARSGEIEKDIVNFADSW----KVHSSCP-VPQKPPFMCSKRPDREPWAKAK--CEILKSDSFKKCHDVVNVEHYYKRCVADACECDRGDDCVCFCTAVEQYVARCNEYEIGL-KWRTN-ENCPHTCTGKRVWKNCGNICP------DSCIDIGKNVTDNTGCKKVCIEGCFCPDGLHWQNNECVERKACECVDPITNLKYNTGDKVIRECEECNCYEGAFRCTK 4108
            L+ G+C+ P  C C     +Y    T      +CQ          V     +    C++WG+ +YE+FDG Y+ F G CSY + +D C   +    LI    +  C S   SCT+S+         I L  +    +G +  +  N +              +  + ++   +   + W     S+ I +  ++  + CGLCGNF+  +++D++   G   +D+  F +SW       ++C  +P   P  CS + D     K +  C  L  + FK CH+ V+   Y   C  D C      D VC      +Y   C   +  L KWRT+   C   C  +  ++ C   CP        CID           K  C++GC+C D L +++  CV+   C C      + Y +G  +  EC  C C  GA+ CT+
Sbjct:   95 LNGGQCVYPDSCNC----SLYQATGT------HCQT---------VPNSGLEREMTCRSWGQYNYETFDGLYYYFPGKCSYTLLKD-CEENIQPSLLIQVHNDPECTSFPYSCTRSVSLFLPWEGEIRLQDLNVTFKGQSVKLPHNIHD--------LELEQIADYVLVSQPQVFTLAWHGLNGSIYIKMSPEFVGRTCGLCGNFNADVNDDLKTSYGVFTEDLAMFGNSWVEEEPQKATCSMIPYLYPSPCSGQ-DSHVLLKVEEVCATLLKEPFKSCHEFVSPYSYMASCSNDLCLSGPNGDVVC--QVFTEYARACAHADHPLNKWRTHVPVCGVECPAELQYRECIPCCPVHCRTEQMCID----------SKLQCLDGCYCQDDLIYEDGLCVKASDCPCEH--RGMLYPSGHTIQEECNNCTCSGGAWNCTE 489          

HSP 4 Score: 68.9366 bits (167), Expect = 6.751e-11
Identity = 60/242 (24.79%), Postives = 102/242 (42.15%), Query Frame = 2
Query: 3326 DVDTHFILFTMEGIQVKWDKAMSLEIMIPEKYQNKVC--GLCGNFDLRIDNDMRARSGEI---EKDIVNFADSWKVHSSCPVPQKPPFMCSKRPDREPWAKAKCE----ILKSDSFKKCHDVVNVEHYYKRCVADACECDRGDDCVCFCTAVEQYVARCNEYEIGLKWRTNENCPHTCTGKRVWKNCGNICPDSCIDIGKNVTDNTGCKKVCIEGCFCPDG--LHWQNNE-CVERKACECVD 4015
            D    +++ +  G++++W  +  + ++  E Y +K+   GLCG  D    ND+   +G I    +D   F DSW+V      P    ++   R      + + C     +L + +F  CH  V    + +  V DA   +        C A+  YVA C+++ I ++WR+ + CP  C     ++ C   C        +   D   C  +  EGC CP G  LH   +  C+    C C D
Sbjct: 2466 DTGNMYLIRSPAGLKIQWFHSTGMMVIETETYTHKLSTMGLCGCCDGNPLNDLTLSNGSIMAESEDPAVFIDSWQV------PNTTSYISHSRRREVNCSTSDCSACLNMLNNLTFTACHPFVPPATFCEVWVRDAEYVNNP------CVALAAYVASCHKFNICIEWRSPDYCPFICPESLRYQACLPACTAPSCPNQEFEYDAGQCSGLA-EGCVCPQGTLLHRPYSALCIPPNKCACTD 2694          

HSP 5 Score: 67.3958 bits (163), Expect = 2.048e-10
Identity = 86/374 (22.99%), Postives = 145/374 (38.77%), Query Frame = 2
Query: 1568 QCIENEECEGRCFISGDPHYITFDRRHFFFDGHCEYTAVMTTSDNVLLSNSTIAPLSITIQNTNCQDNSETGCPRTI---GVIIGEDEDQVAINLL------SSSEIKVNFVKISLPYQHTGNTKVLIDQVSTDILRLKSETGVEILWNGGSRIEIKLSKKYREKVT--GMCGNFNGNEMDDSMTFKG---VDEKDIDKFVLSWKTNPTCESDRGIVEYKGACALSRSYSDYANKVCHKLYESEEFKKCHSAANADKFFDQCTHDVCTCGMKRNGALDHCECEAFSSYARQCALENINLSWRTNELCPKKCPNENMKYNQCGSRCTSTCRLLQE-----SKCKEECIEGCFCPEGETFDEA-AKECVKISDCKC 2629
            +C    +C  RC +  D + +TFD  +        Y           L N T+   SI +Q  N  DN+       +    + I  + +QV IN L      ++   K  F K       TGN           +  ++S  G++I W   + + +  ++ Y  K++  G+CG  +GN ++D     G    + +D   F+ SW+   T       + +     ++ S SD +   C  +  +  F  CH       F +            R+    +  C A ++Y   C   NI + WR+ + CP  CP E+++Y  C   CT+     QE      +C     EGC CP+G       +  C+  + C C
Sbjct: 2357 KCCPKWDCPCRCSVFPDLNVVTFDGNNVAIFKAASYVVTQ-------LPNETV---SILVQECNSSDNTLVWNFTNLCLAALNITHESNQVLINRLQRRLYVNTRYAKPRFKKYGFEILDTGN-----------MYLIRSPAGLKIQWFHSTGMMVIETETYTHKLSTMGLCGCCDGNPLNDLTLSNGSIMAESEDPAVFIDSWQVPNT----TSYISHSRRREVNCSTSDCS--ACLNMLNNLTFTACHPFVPPATFCEVWV---------RDAEYVNNPCVALAAYVASCHKFNICIEWRSPDYCPFICP-ESLRYQACLPACTAPSCPNQEFEYDAGQCS-GLAEGCVCPQGTLLHRPYSALCIPPNKCAC 2692          
BLAST of von Willebrand factor vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008773.1 (pep scaffold:Pmarinus_7.0:GL476328:703641:749596:1 gene:ENSPMAG00000007891.1 transcript:ENSPMAT00000008773.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 474.167 bits (1219), Expect = 7.375e-138
Identity = 345/1181 (29.21%), Postives = 551/1181 (46.66%), Query Frame = 2
Query:  458 CSVIYGHHIKTFDGNVFSYPLRGGYTLFMDCLGAAPLFYVYFNASYDCFDQKTQNDCSISMKITVGTQTIILFPKNEFALVKNNKTKIPFNSEGIIVSSVGSFIKIKGID-DLEILFDRDRNIYVYAPVTAEKKICGLCGYFNGIMSDDYRDFNQVIQKNVKTFVNSWIDRDPSDLNVYREREQYPCNALKLKNNDQYQKALTLCQDMVKNNLGRTCQSEVKIDKYLDMCQDEICECLQTQPENSTIENCYSTFCKIEEQYSYACTLKGIAVDWRSATTIC-KQPQCFNGQEFSECGSNCGKNCGQLGMELECESQCLPGCYCPRNRYWDGTM---CVPQEKCPCVRDNGESTYQQGYRLKLNCETCICGMHGKWQCIENEECEGRCFISGDPHYITFDRRHFFFDGHCEYTAVMTTSDNVLLSNSTIAPLSITIQNTNCQDNSETGCPRTIGVIIGEDEDQVAINLLSSSEIKVNFVKISLPYQHTGNTKVLIDQVSTDILRLKSETGVEILWNGGSRIEIKLS--KKYREKVTGMCGNFNGNEMDDSMTFKGVDEKDIDKFVLSWKTNPTCESDRGIVEYKGACALSRSYSDYANKVCHKLYESE-EFKKCHSAANADKFFDQCTHDVCTCGMKRNGALDHCECEAFSSYARQCALENINLSWRTNELCPK---KCPNENMKYNQCGSRCTSTCRLLQE--SKCKEE--CIEGCFCPEGETFDEAAKECVKISDCKCEFHGRFY-LPYEIRQDRCNNCTCTNGNWICTSNDCEGKEFCPKSMAWFDCG---------ICQKTCTNLDLVCPKGQCQLPGCFCPENTVLHN-GECIKPFECPCYMNNKMYSENDTIVRGPANCQNPCICKDGKWVCEQNKQCSGICKTWGETHYESFDGKYFEFQGSCSYVISEDFC--GNKLGTFKLISENIACGXXXXXCTKSIKFIYLNRVFQFVRGSNPIVSRNTNYPPGGPTAF--YWTSDVDTHFILFTMEGIQVKWDKAMSLEIMIPEKYQNKVCGLCGNFDLRIDNDMRARSGEIEKDIVNFADSWKVHSSCPVPQKPPFMCSKRPDREPWAKAKCEILKSDSFKKCHDVVNVEHYYKRCVADACECDRGDDCVCFCTAVEQYVARCNEYEIGLKWRTNENCPHTCTGKRV-------WKNCGNICPDSCID 3889
            CS    +H KTFDG  F   +   Y    +C  A P F V          +++ N+  I   I +    I +    E A V      +PFN  GI + ++G  +KI   +   ++ +++  ++ +    +   K CGLCG +NG    +Y +F   I    +  +N+    DP  +    + EQ P         D      +LC+ ++       C++ + +  Y+  C  + C C    P+  T+E  YS  C+         ++ G   +WR+ +  C   P+C  G  + ECG  C  +C Q  +   C  +C+PGC+CPR   WD      C+P E+C CV +  + TY  G  L  +C+ C+C   G W C E + C   C + G  H  TFD+  F F G C Y   M    ++          ++ ++   C+  ++  C +++ +I+G +  ++ I+   S E+ VN V+++LPY    +  + I   S+  + L +  GV +L      +++ L+    +     G+CG++NG + DD  T  G+ E     F  SWK   TC       E    C LS ++  YA  +C  +   +  F  CH   + + F+ +C +D C+C        + C C A SSYA  CA +++ L      LC K    CP   + Y+     C +TCR+LQE  S+C      ++GC CP+G T+D     C+   +C C + G    L   ++Q +   C C  G  +C +      + CP  M +F+C           C +TC+  +   P+      GC CP+  V  + G CI+P  CPC  N +  +  ++I     +C N C C + KW C  N  C   C  +G+ HY +FDG+ F F+GSC+YVI++D C   N  GTF + +EN+ CG++ ++C++SI     N V +  + S  I     ++   GP     +       + ++ T   I + WDK   + I +  +Y+  VCGLCGN D R  ND+  R+  + +D + F +SWK+   C   ++    C+    R PWA+ +C ILKSD+F  CH +V+V  +++ CV DAC CD G DC C C AV  Y   CNE    +KWRT + CP  C            ++ CG  CP +C D
Sbjct:    1 CSTWGQNHFKTFDGKFFDLGISCNYLFASNCKDATPNFNVII--------RRSVNNPQIISSINISIIDINIDLSAEGAAVNKESQDLPFNQYGIQIIALGDDVKITATNIGFKLFWNKKDSLLLQVTESYRNKTCGLCGDYNG--DAEYPEFKGGILSVAEYALNNKY-YDP--MVQCDQIEQPP-------TPDDCSMHESLCELVLNTPEFADCKARLDVRPYIGACIVDQCSCTSDCPDFGTVEE-YSRECR---------SIGGTPGNWRNTSETCGAAPECLPGTIYQECGIPCPNSCSQPSLSNMCIEECVPGCFCPRGTIWDDLTDKGCIPLEECSCVFN--KHTYNAGDILHQDCQDCVC-HGGVWNC-EEQPCTRTCALEGGSHIKTFDQNQFTFHGDCYYFMAMDCRTHLF---------NLMVKLKPCE--TKNTCLKSLALILGRNVLKIMIS--DSGEVSVNDVEVNLPYD---SNAITIFYQSSFYIHLHTSIGVNLLVQLSPVMQLYLTLDPSFHTATCGLCGDYNGIQSDDFKTSNGLIEGTAIYFANSWKAQNTCPPPTESTEEP--CMLSLNHKQYAEDMCSNMKTPDGPFSACHGTVSPEAFYKRCLYDTCSCQDS-----EACLCAALSSYALACASKHVVLEGWREHLCAKYTENCPGSQV-YSYNALPCVNTCRVLQETGSQCFSSGVAVDGCTCPKG-TYDSGGGFCMAPEECPCYYRGNVLPLGNSVQQGK-YICECRAGTMLCMNPQGPTPQPCPHPMVYFNCNQSTANGNSFPCHQTCSLQECYNPECN---SGCVCPKGLVYSDDGTCIQPEACPCEHNGQKTAPGESI---EVDC-NTCTCVNRKWECTNNT-CLSTCSLYGQGHYRTFDGQRFLFEGSCTYVIAQDNCQNPNNEGTFNITTENVPCGTTGTTCSRSINVQVGNWVIKLFQKSYSI-----DFLGSGPETINPFQIKHRGLYLVVETSNRITLTWDKNTGVFISLGPEYKGTVCGLCGNHDGRAANDLTTRTHMVVEDPLEFGNSWKLSGLCADAKETSSPCALMSHRLPWAQQRCGILKSDTFASCHALVDVLPFHEACVHDACGCDTGGDCECLCNAVAVYAKACNEAGQCIKWRTPDLCPLFCEYYDAPDDCTWHYRPCGQSCPKTCRD 1108          

HSP 2 Score: 113.235 bits (282), Expect = 4.232e-25
Identity = 101/371 (27.22%), Postives = 163/371 (43.94%), Query Frame = 2
Query: 3038 CKTWGETHYESFDGKYFEFQGSCSYVISEDFCGNKLGTFKLISENIACGXXXXXCTKSIKFIYLNRVFQFVRGSNPIVSRNTNYPPGGPTAFYWTSDVDTHFILFTMEGIQVKWDKAMSLEIMIPEKYQNKVCGLCGNFDLRIDNDMRARSGEIEKDIVNFADS------WKVHSSCPVPQKPPFMCSKRPDREPWAKAKCE-ILKSDSFKKCHDVVNVEHYYKRCVADACECDRGDDCVCFCTAVEQYVARCNEYEIGL---KWR-TNENCPHT--CTGKRVWKNCGNICPDSCIDIGKNVTDNTGCKKVCIEGCFCPDGLHWQN---NECVERKACECVDPITNLKYNTGDKVIRECEECNCYEGAFRC 4102
            C TWG+ H+++FDGK+F+   SC+Y+ + + C +    F +I               S   I +  +   +      V++ +   P         +  D   I  T  G ++ W+K  SL + + E Y+NK CGLCG+++        A   E +  I++ A+       +     C   ++PP      PD     ++ CE +L +  F  C   ++V  Y   C+ D C C    DC  F T VE+Y   C    IG     WR T+E C     C    +++ CG  CP+SC       + +  C + C+ GCFCP G  W +     C+  + C CV       YN GD + ++C++C C+ G + C
Sbjct:    1 CSTWGQNHFKTFDGKFFDLGISCNYLFASN-CKDATPNFNVIIRRSVNNPQ----IISSINISIIDINIDLSAEGAAVNKESQDLPFNQYGIQIIALGDDVKITATNIGFKLFWNKKDSLLLQVTESYRNKTCGLCGDYN------GDAEYPEFKGGILSVAEYALNNKYYDPMVQCDQIEQPP-----TPDDCSMHESLCELVLNTPEFADCKARLDVRPYIGACIVDQCSCT--SDCPDFGT-VEEYSRECRS--IGGTPGNWRNTSETCGAAPECLPGTIYQECGIPCPNSC----SQPSLSNMCIEECVPGCFCPRGTIWDDLTDKGCIPLEECSCV--FNKHTYNAGDILHQDCQDCVCHGGVWNC 344          

HSP 3 Score: 110.923 bits (276), Expect = 1.945e-24
Identity = 117/427 (27.40%), Postives = 177/427 (41.45%), Query Frame = 2
Query: 3023 QCSGICKTWGETHYESFDGKYFEFQGSCSYVISEDFCGNKLGTFKLISENI-ACGXXXXXCTKSIKFIY--LNRVFQFVRGSNPI--------VSRNTNYPPGGPTAFYWTSDVDTHFILFTMEGIQVKWDKAMSLEIMIPEK-YQNKVCGLCGNFDLRIDNDMRARSGEIEKDIVNFADSWKVHSSCPVPQ-KPPFMCSKRPDREPWAKAKCEILKSDSFKKCHDVVNVEHYYKRCVADACECDRGDDCVCFCTAVEQYVARCNEYEIGLKWR--TNENCPHTCTGKRVWKNCGNICPDSC---------IDIGKNVTDNTGCKKVCIEGCFCPDGLHWQNNEC-VERKACECVDPITNLKYNTGDKVIRECEECNCYEGAFRCTKLFSKECLHTSRPEISTKPP---HCVNEYEFLCPNNFCARR 4219
            +C  IC  WG+ HY +FDG Y+ F   C+YV+ E      L  F++   N   C     +C +SI   Y   N + +  +   P         V     Y   G T    +S + T   +  +E +     + +   I +P K + N   G CG       +D R R+G ++K  VN A  WKV    P P  K     S  PD        C ++ SD F +C  V++ + +   C  D C   R DD  C   +++ Y ++C +  I + WR  TN  C +TC   +V+  CG   P +C         +   KN       +    EGCFCP+G    N++  +   +C C  P        GD+ I  C +C C E +       S  C++ S P +  KPP     +N  E   P++ C  R
Sbjct: 1327 ECECICSAWGDPHYTTFDGTYYTFTDDCTYVLVEQIIP-VLPDFRVTVNNFRGCSGGGPACPRSITITYNGTNVIMETSQRKKPTRLFVKFNGVGVTPVYSENGMTVA--SSGISTRVDIPEIEAVITF--EYVRFSITLPYKFFFNNTQGQCGTCTNNRQDDCRMRNGVVDKSCVNMARDWKV----PDPSCKTNPSSSPPPDVTCPPHPLCNLIGSDLFAECKRVIDPQPFVMGCQFDWCA-TRKDDIPCL--SIKAYASQCLDRGICVDWRNFTNNRCSYTCPIGKVYNACGPSIPPTCDTRLVWQSYLCYYKNFVYWLTMED---EGCFCPEGTILHNSQTDICTTSCGCTGP-NGYPKQYGDRWISNCLDCVCDEHS------SSVVCVNHSCPPVP-KPPCQGQGMNLVEVQDPSDACCTR 1730          

HSP 4 Score: 82.8037 bits (203), Expect = 7.542e-16
Identity = 104/409 (25.43%), Postives = 158/409 (38.63%), Query Frame = 2
Query: 1586 ECEGRCFISGDPHYITFDRRHFFFDGHCEYTAVMTTSDNVLLSNSTIAPLSITIQNTNCQDNSETGCPRTI-------GVIIGEDEDQVAINLLSSSEIKVNFVKISLPYQHTGNTKVLIDQVST--DILRLKSETGVEILWNGGSRIEIKLSKK-YREKVTGMCGNFNGNEMDDSMTFKGVDEKDIDKFVLSWKT-NPTCESDRGIVEYKGACALSRSYSDYANKVCHKLYESEEFKKCHSAANADKFFDQCTHDVCTCGMKRNGALDHCECEAFSSYARQCALENINLSWR--TNELCPKKCPNENMKYNQCGSRCTSTC--RLLQESK-CKEECI--------EGCFCPEGETFDEAAKECVKISDCKCEFHGRFYLPYEIRQ-DRCNNCTCT--NGNWICTSNDC 2731
            ECE  C   GDPHY TFD  ++ F   C Y  V    + ++     +    +T+ N          CPR+I        VI+   + +    L     +K N V ++  Y   G T V    +ST  DI  +++    E +     R  I L  K +     G CG    N  DD     GV +K        WK  +P+C+++        + +     +   + +C+ L  S+ F +C    +   F   C  D C          D   C +  +YA QC    I + WR  TN  C   CP   + YN CG     TC  RL+ +S  C  +          EGCFCPEG     +  + +  + C C     +   Y  R    C +C C   + + +C ++ C
Sbjct: 1327 ECECICSAWGDPHYTTFDGTYYTFTDDCTYVLV----EQII---PVLPDFRVTVNNFRGCSGGGPACPRSITITYNGTNVIMETSQRKKPTRLF----VKFNGVGVTPVYSENGMT-VASSGISTRVDIPEIEAVITFEYV-----RFSITLPYKFFFNNTQGQCGTCTNNRQDDCRMRNGVVDKSCVNMARDWKVPDPSCKTNP-------SSSPPPDVTCPPHPLCN-LIGSDLFAECKRVIDPQPFVMGCQFDWCA------TRKDDIPCLSIKAYASQCLDRGICVDWRNFTNNRCSYTCPIGKV-YNACGPSIPPTCDTRLVWQSYLCYYKNFVYWLTMEDEGCFCPEGTILHNSQTD-ICTTSCGCTGPNGYPKQYGDRWISNCLDCVCDEHSSSVVCVNHSC 1702          

HSP 5 Score: 72.0182 bits (175), Expect = 1.459e-12
Identity = 102/446 (22.87%), Postives = 173/446 (38.79%), Query Frame = 2
Query:  236 SCSLGWQGNRCSDPICVGGC--------SNGGKCVAPNQCLCLDNYSGPNCNTLLIKSSQSDVSNYGAVTR----VNNTMYSTYYECSVIYGHHIKTFDGNVFSYPLRGGYTLFMDCLGAAPLFYVYFNASYDCFD-QKTQNDCSISMKITVGTQTIILFPKNEFA--LVKNNKTKIPFNSEGIIVSSVGSFIKIKGIDDLEILFDRDRNIYVYAPVTAEKKICGLCGYFNGIMSDDYRDFNQVIQKNVKTFVNSWIDRDPSDLNVYREREQYPCNALKLKNNDQYQKALTLCQDMVKNNLGRTCQSEVKIDKYLDMCQDEICECLQTQPENSTIENCYSTFCKIEEQYSYACTLKGIAVDWRSATTICKQPQCFNGQE-----FSECGSNCGKNCGQLGMELECESQCLPGCY--CPRNRYW---DGTMCVPQEKCPCVRDNGES 1498
            +CSL      C +P C  GC        S+ G C+ P  C C  N       T   +S + D +    V R     NNT  ST   CS+    H +TFDG  F +     Y +  D     P     FN + +      T   CS S+ + VG   I LF K+     L    +T  PF      +   G ++ ++  + + + +D++  +++      +  +CGLCG  +G  ++D      ++ ++   F NSW     S L    +    PC  +  +     Q+       ++K++   +C + V +  + + C  + C C        T  +C    C     Y+ AC   G  + WR+        + ++  +     +  CG +C K C     E     Q   GCY  C  ++ +   D  +CV  + C    ++G S
Sbjct:  744 TCSL----QECYNPECNSGCVCPKGLVYSDDGTCIQPEACPCEHNGQ----KTAPGESIEVDCNTCTCVNRKWECTNNTCLST---CSLYGQGHYRTFDGQRFLFEGSCTYVIAQDNC-QNPNNEGTFNITTENVPCGTTGTTCSRSINVQVGNWVIKLFQKSYSIDFLGSGPETINPFQ-----IKHRGLYLVVETSNRITLTWDKNTGVFISLGPEYKGTVCGLCGNHDGRAANDLTTRTHMVVEDPLEFGNSW---KLSGLCADAKETSSPCALMSHRLPWAQQRC-----GILKSDTFASCHALVDVLPFHEACVHDACGC-------DTGGDC-ECLCNAVAVYAKACNEAGQCIKWRTPDLCPLFCEYYDAPDDCTWHYRPCGQSCPKTCRDPHAECREGVQRFEGCYPKCTESKPYFDEDNMLCVSWDSCGTCSESGIS 1156          

HSP 6 Score: 52.7582 bits (125), Expect = 8.668e-7
Identity = 95/407 (23.34%), Postives = 137/407 (33.66%), Query Frame = 2
Query:  458 CSVIYGHHIKTFDGNVFSYPLRGGYTLFMDCLGAAPLFYVYFNASYDCFDQKTQNDCSISMKITVGTQTIIL----FPKNEFALVKNNKTKI-PFNSE-GIIVSSVGSFIKIKGIDDLEILFDRDRNIYVYAPVTAEKKIC-----GLCGYFNGIMSDDYRDFNQVIQKNVKTFVNSWIDRDPSDLNVYREREQYPCNALKLKNNDQYQKALTLCQDMVKNNLGRTCQSEVKIDKYLDMCQDEICECLQTQPENSTIENCYSTFCKIEEQYSYACTLKGIAVDWRSATTICKQPQCFNGQEFSECGSNCGKNCGQ-----------------LGMELECESQCLPGCYCPRNRYWDGTMC-VPQEKCPCVRDNGESTYQQGYRLKLNCETCICGMHGKWQCIENEEC 1591
            CS     H  TFDG  +++     Y L    +   P F V  N    C        C  S+ IT     +I+      K     VK N   + P  SE G+ V+S G   ++  I ++E +   +   YV   +T   K       G CG       DD R  N V+ K+       W   DPS             N       D       LC +++ ++L   C+  +    ++  CQ + C   +               C   + Y+  C  +GI VDWR+ T       C  G+ ++ CG +    C                   L ME E       GC+CP       +   +    C C   NG    Q G R   NC  C+C  H       N  C
Sbjct: 1332 CSAWGDPHYTTFDGTYYTFTDDCTYVLVEQIIPVLPDFRVTVNNFRGCSGGGPA--CPRSITITYNGTNVIMETSQRKKPTRLFVKFNGVGVTPVYSENGMTVASSGISTRVD-IPEIEAVITFE---YVRFSITLPYKFFFNNTQGQCGTCTNNRQDDCRMRNGVVDKSCVNMARDWKVPDPSCKT----------NPSSSPPPDVTCPPHPLC-NLIGSDLFAECKRVIDPQPFVMGCQFDWCATRKDD-----------IPCLSIKAYASQCLDRGICVDWRNFTNNRCSYTCPIGKVYNACGPSIPPTCDTRLVWQSYLCYYKNFVYWLTMEDE-------GCFCPEGTILHNSQTDICTTSCGCTGPNGYPK-QYGDRWISNCLDCVCDEHSSSVVCVNHSC 1702          
BLAST of von Willebrand factor vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010519.1 (pep scaffold:Pmarinus_7.0:GL477612:23664:47127:1 gene:ENSPMAG00000009527.1 transcript:ENSPMAT00000010519.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 412.149 bits (1058), Expect = 2.120e-121
Identity = 354/1248 (28.37%), Postives = 532/1248 (42.63%), Query Frame = 2
Query:  458 CSVIYGHHIKTFDGNVFSYPLRGGYTLFMDCLGAAPLFYVYFNASYDCFDQKTQNDCSISMKITVGTQTIILFPKNEFALVKNNKTKIPFNSEGIIVSSVGSFIKIKGIDDLEILFDRDRNIYVYAPVTAEKKICGLCGYFNGIMSDDYRDFNQVIQKNVKTFVNSWIDRDPSDLNVYREREQYPCNALKLKNNDQYQKALTLCQDMVKNNLGRTCQSEVKIDKYLDMCQDEICECLQTQPENSTIENCYSTFCKIEEQYSYACTLKGIAVD-WRSATTICKQPQCFNGQEFSECGSNCGKNCGQLGMELECESQCLPGCYCPRNR---YWD---GTMCVPQEKCPCVRDNGESTYQQGYRLKLNCETCICGMHGKWQCIENEECEGRCFISGDPHYITFDRRHFFFDGHCEYTAVMTTSDNVLLSNSTIAPLSITIQNTNCQDNSETGCPRTIGVIIGEDEDQVAINLLSSSEIKVNFVKISLPYQHTGNTKVLIDQVSTDILRLKSETGVE--ILWNGGSRIEIKLSKKYREKVTGMCGNFNGNEMDDSMTFKGVDEKDIDKFVLSWKTNPTCESDRGIVEYKGACALSRSYSDYANKVCHKLYESE-EFKKCHSAANADKFFDQCTHDVCTCGMKRNGALDHCECEAFSSYARQCALENINL-SWRTN--ELCPKKCP-NENMKYN--QCGSRCTST----CRLLQESKCK---EECIEGCFCPEGETFDEAAKECVKISDCKC--EFHGRFYLPYEIRQDRCNNCTCTNGNWIC------TSNDCEGKEFCPKSMAWFDC--------GICQKTCTNLDLVCPKGQCQLPGCFCPENTVL-HNGECIKPFECPCYMNNKMYSENDTIVRGPANCQNPCICKDGKWVCEQNKQCSGICKTWGETHYESFDGKYFEFQGSCSYVISEDFCGNKLGTFKLISENIACGXXXXXCTKSIKFIYLNRVFQFVRGSNPIVSRNTNYPPGGPTAFYWTSDVDTHFILFTMEGIQVKWDKAMSLEIMIPEKYQNKVCGLCGNFDLRIDNDMRARSGEIEKDIVNFADSWK-VHSSCPVPQKPPFMCSKRPDREPWAKAKCEILKSDSFKKCHDVVNVEHYYKRCVADACECDRGDDCVCFCTAVEQYVARCNEYEIGLKWRTNENCPHTC------TGKRVW--KNCGNICPDSCIDIGKNVTDNTGCKKVCIEGCF--CPDGLHWQNNE---CVERKACECVDPITNLKYN 4039
            CSV    H+ TFD      PL     L +  +  +P   + F        Q++  D      + V  + I L    E   +   + ++P+    I +  VGS+IK   I    +L+D++  I V        K  GLCG FNGI  D Y   N +   +V        D     +    E E   C ++     D   K+L     +V       C+ +      L  C                        C    ++S  CT    +   WRS    C    C  GQ   ECGS C   C      + C S C+ GC+CP       WD   G+ C+PQ  C C    G+S Y  G  L   C+ C C   G+W C ++  C G C I G  ++ TFD + + F G C YT     + N           S+  + T C+      C  ++   I   +    +   +S ++ V+  K+ LP+    +  V I Q S+  LR ++  G+   +      ++ I  +  Y  K  G+CGNFN    DD  T  G+ +     F   WK   TC  DR  V     C++  + ++YA   C  L +++  F  CHS  +AD+++ +C +D C+C        + C C A S+YA  C+   + L  WR++   L  + CP +    Y   +CGS    T    CR ++    +      +EGC C  G  +D+    CV  SDC C  E  G               C CT G   C      + N CEG       M + +C          CQ+TC N   +C    C + GC CP   ++ HNG C+   +C C  N + Y   DTI +      N C C + +W C  ++ C G+C  +GE H+ +FDGK + F GSC Y++S+D CGN  G+F++ +EN  CG++ ++C+K + F           G+   V  ++   PG P   +    +  + ++ T  G+ + WD   ++ + +  + + +VCGLCG++D ++ ND   R+G +      FA  WK   S CP   +    C+    RE WA  +C +LK   FK+CH++V    YY  CV D+C CD G DC C CTA+  Y   C    + L+WRT + CP  C       G+  W  + CG  C  SC +     T N       +EGC+  CP    + N     CVER  C+CV   T  K N
Sbjct:    2 CSVWGTSHLLTFDHASMDLPLSS-CALNLVSITDSPSLSLSF--------QRSALDRMSVENVVVTMEGISLSLTREGQSISGQRVQLPYKDHSIQIEMVGSYIKCSSIMGFSLLWDQNNAITVKLDPKFNTKTTGLCGDFNGIADDFY--LNVMSTTSVLFSFLLTCDEPTQHIEHLFEDELLSCVSVM----DHQLKSL-----LVNILWSDICRLDCNGTAGLYPCDG----------------------CATIAEFSRRCTQANESPGTWRSPE-FCGV-TCPRGQVHRECGSVCKDTCSNPSASVNCPSTCVDGCFCPEGTAGTVWDDVSGSGCIPQSNCGC-NQLGQS-YASGESLITGCKNCTC-EQGQWNC-DSRPCYGTCKILGGSYFSTFDSKTYRFHGDCFYTLTTDCAGN---------KFSVLGELTKCEGRDSKTCLNSVIFYI---DGIRTVVFKASGDVLVHENKVPLPFV---SASVTIVQESSFYLRAETNFGLRLRVQLKPLMQLYITAATAYHNKTCGLCGNFNEVTGDD-FTHSGIVDATAATFCNVWKAQATCP-DREEVTMD-PCSVYITNNEYAKAHCGLLMDNDGPFSTCHSVVSADEYYTRCKYDTCSCSYP-----EPCLCAALSAYAYACSAHGVVLVGWRSDICSLDAENCPVSHEFSYAAPECGSASCRTSREVCRGVRPPPFELPSPSPVEGCVCGAG-LYDDEHGVCVLKSDCPCYSEMSGDLIRAGVTVDLHDTQCLCTGGELHCFGLSPISGNTCEGL------MTYHNCSDGSSEGSAACQRTCANPHSICYSPGC-VSGCVCPGGLIVDHNGNCVSEEQCTCEHNGRHYDPGDTITQ----LCNKCTCMNARWSC-TSEVCQGLCFVYGEGHHTTFDGKQYVFDGSCQYILSQDSCGNSSGSFRITTENEPCGTTGTTCSKKVHFYAGADELVLTDGT---VKGSSLDFPGSP---FHVRRMGIYTVVETSLGVTIIWDGHTAVSVHVNPQLKGRVCGLCGDYDGKVANDFVTRTGSVAASAPEFAAGWKESGSGCPDLSRVSDPCTINHHRESWAHKQCSVLKDGVFKQCHNMVEYLPYYAACVRDSCGCDTGGDCHCLCTALASYAQACGSAGVCLRWRTPDLCPLGCDLYNKDEGQCEWHYRECGRGCQRSCTNRNAICTANL----PPLEGCYPTCPSDRPFLNESSMTCVER--CDCVSNGTTYKVN 1153          

HSP 2 Score: 161.77 bits (408), Expect = 3.882e-40
Identity = 139/486 (28.60%), Postives = 217/486 (44.65%), Query Frame = 2
Query: 2747 CPKSMAWFDCG-ICQKTCTN--LDLVCPKGQCQLPGCFCPENTV------LHNGECIKPFECPCYMNNKMYSENDTIVRGPANCQNPCICKDGKWVCEQNKQCSGICKTWGETHYESFDGKYFEFQGSCSYVISEDFCGNKLGTFKLISENIAC-GXXXXXCTKSIKFIYLNRVFQFVRGSNPIVSRNTNYPPGGPTAFYWTSDVDTHFIL-----FTMEGIQVKWDKAMSLEIMIPEKYQNKVCGLCGNFDLRIDNDMRARSGEIEKDIVNFADSWKVHSSCP----VPQKPPFMCSKRPDREPWAKAKCEILKSD--SFKKCHDVVNVEHYYKRCVADACECDRGDDCVCFCTAVEQYVARCNEYEIGL-KWRTN------ENCPHTCTGKRVWKNCGNICPDSCIDIGKNVTDNTG--CKKVCIEGCFCPDGLHW-QNNECVERKACECVDPITNLKYNTGDKVIRECEECNCYEGAFRCTKL 4111
            CP+     +CG +C+ TC+N    + CP   C + GCFCPE T       +    CI    C C    + Y+  ++++ G   C+N C C+ G+W C+ ++ C G CK  G +++ +FD K + F G C Y ++ D  GNK   F ++ E   C G  S +C  S+ F Y++ +   V  ++  V  + N  P    +   T   ++ F L     F +  ++V+    M L I     Y NK CGLCGNF+  +  D    SG ++     F + WK  ++CP    V   P   CS       +AKA C +L  +   F  CH VV+ + YY RC  D C C   + C+C   A+  Y   C+ + + L  WR++      ENCP +         CG+    +  ++ + V            +EGC C  GL+  ++  CV +  C C   ++      G  V     +C C  G   C  L
Sbjct:  243 CPRGQVHRECGSVCKDTCSNPSASVNCPS-TC-VDGCFCPEGTAGTVWDDVSGSGCIPQSNCGCNQLGQSYASGESLITG---CKN-CTCEQGQWNCD-SRPCYGTCKILGGSYFSTFDSKTYRFHGDCFYTLTTDCAGNK---FSVLGELTKCEGRDSKTCLNSVIF-YIDGIRTVVFKASGDVLVHENKVPLPFVSASVTIVQESSFYLRAETNFGLR-LRVQLKPLMQLYITAATAYHNKTCGLCGNFN-EVTGDDFTHSGIVDATAATFCNVWKAQATCPDREEVTMDP---CSVYITNNEYAKAHCGLLMDNDGPFSTCHSVVSADEYYTRCKYDTCSCSYPEPCLC--AALSAYAYACSAHGVVLVGWRSDICSLDAENCPVSHEFSYAAPECGSASCRTSREVCRGVRPPPFELPSPSPVEGCVCGAGLYDDEHGVCVLKSDCPCYSEMSGDLIRAGVTVDLHDTQCLCTGGELHCFGL 710          

HSP 3 Score: 99.7525 bits (247), Expect = 4.199e-21
Identity = 100/406 (24.63%), Postives = 150/406 (36.95%), Query Frame = 2
Query:  449 YYECSVIYGHHIKTFDGNVFSYPLRGGYTLFMDCLGAAPLFYVYFNASYDCFDQKTQNDCSISMKITVGTQTIILFPKNEFALVKNNKTKIPFNSEGIIVSSVGSFIKIKGID---DLEILFDRDRNIYVYAPVTAEKKICGLCGYFNGIMSDDYRDFNQVIQKNVKTFVNSWIDRDPSDLNVYREREQYPCNALKLKNNDQYQKALTLCQDMVKNNLG--RTCQSEVKIDKYLDMCQDEICECLQTQPENSTIENCYSTFCKIEEQYSYACTLKGIA-VDWRSATTICKQPQCFNGQEFSECGSNCGKNCGQLGMELECESQCLP-----------GCYCPRNRYWD-GTMCVPQEKCPCVRDNGESTYQQGYRLKLNCETCICGMHGKWQC-----IENEECEG 1597
            Y  C ++ G +  TFD   + +     YTL  DC G     +        C + +    C  S+   +     ++F  +   LV  NK  +PF S  + +    SF      +    L +       +Y+ A      K CGLCG FN +  DD+   + ++     TF N W  +  +      E    PC+      N++Y KA      ++ +N G   TC S V  D+Y   C+ + C C   +P            C     Y+YAC+  G+  V WRS         C    EFS     CG    +   E+ C     P           GC C    Y D   +CV +  CPC  +      + G  + L+   C+C   G+  C     I    CEG
Sbjct:  339 YGTCKILGGSYFSTFDSKTYRFHGDCFYTLTTDCAGNK---FSVLGELTKC-EGRDSKTCLNSVIFYIDGIRTVVFKASGDVLVHENKVPLPFVSASVTIVQESSFYLRAETNFGLRLRVQLKPLMQLYITAATAYHNKTCGLCGNFNEVTGDDFT-HSGIVDATAATFCNVW--KAQATCPDREEVTMDPCSV--YITNNEYAKAHC---GLLMDNDGPFSTCHSVVSADEYYTRCKYDTCSCSYPEP----------CLCAALSAYAYACSAHGVVLVGWRSDICSLDAENCPVSHEFSYAAPECGSASCRTSREV-CRGVRPPPFELPSPSPVEGCVCGAGLYDDEHGVCVLKSDCPCYSEMSGDLIRAGVTVDLHDTQCLC-TGGELHCFGLSPISGNTCEG 720          

HSP 4 Score: 72.4034 bits (176), Expect = 1.012e-12
Identity = 99/444 (22.30%), Postives = 166/444 (37.39%), Query Frame = 2
Query:  266 CSDPICVGGC--------SNGGKCVAPNQCLCLDN---YSGPNCNTLLIKSSQSDVSNYGAVTRVNNTMYSTYYECSVIYGHHIKTFDGNVFSYPLRGGYTLFMDCLGAAPLFYVYFNASYDCFDQKTQNDCSISMKITVGTQTIILFPKNEFALVKNNKTKIPFNSEGIIVSSVGSFIKIKGIDDLEILFDRDRNIYVYAPVTAEKKICGLCGYFNGIMSDDYRDFNQVIQKNVKTFVNSWIDRDPSDLNVYREREQYPCNALKLKNNDQYQKALTLCQDMVKNNLGRTCQSEVKIDKYLDMCQDEICECLQTQPENSTIENCYSTFCKIEEQYSYACTLKGIAVDWRSATTICKQPQCFNGQE------FSECGSNCGKNCGQLGMELECESQCLPGCY--CPRNRYW---DGTMCVPQEKCPCVRDNGESTYQQGYRLKLN 1531
            C  P CV GC         + G CV+  QC C  N   Y   +  T L        + +   + V   +   Y E     GHH  TFDG  + +     Y L  D  G +   +     +  C    T   CS  +    G   ++L        VK +    P       V  +G +  ++    + I++D    + V+     + ++CGLCG ++G +++D+      +  +   F   W +      ++ R  +  PC      N+ +   A   C  ++K+ + + C + V+   Y   C  + C C        T  +C+   C     Y+ AC   G+ + WR+          +N  E      + ECG  C ++C             L GCY  CP +R +       CV  E+C CV +   +TY+   R+  N
Sbjct:  749 CYSPGCVSGCVCPGGLIVDHNGNCVSEEQCTCEHNGRHYDPGDTITQLCNKCTCMNARWSCTSEVCQGLCFVYGE-----GHH-TTFDGKQYVFDGSCQYILSQDSCGNSSGSFRITTENEPC--GTTGTTCSKKVHFYAGADELVLTD----GTVKGSSLDFP--GSPFHVRRMGIYTVVETSLGVTIIWDGHTAVSVHVNPQLKGRVCGLCGDYDGKVANDFVTRTGSVAASAPEFAAGWKESGSGCPDLSRVSD--PCTI----NHHRESWAHKQCS-VLKDGVFKQCHNMVEYLPYYAACVRDSCGC-------DTGGDCH-CLCTALASYAQACGSAGVCLRWRTPDLCPLGCDLYNKDEGQCEWHYRECGRGCQRSCTNRNAICTANLPPLEGCYPTCPSDRPFLNESSMTCV--ERCDCVSNG--TTYKVNDRIPSN 1159          
BLAST of von Willebrand factor vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008716.1 (pep scaffold:Pmarinus_7.0:GL476328:595486:663084:-1 gene:ENSPMAG00000007851.1 transcript:ENSPMAT00000008716.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 383.645 bits (984), Expect = 4.961e-108
Identity = 354/1270 (27.87%), Postives = 547/1270 (43.07%), Query Frame = 2
Query:  458 CSVIYGHHIKTFDGNVFSYPLRGGYTLFMDCLGAAPLFYVYFNASYDCFDQKTQNDCSISM-KITVGTQTIILFPKNEFALVKNNKTKIPFNSEGIIVSSVGSFIKIKGIDDLEI-LFDRDRNIYVYAPVTAEKKICGLCGYFNG--IMSDDYRDFNQVIQKNVKTFVNSWIDRDPSDLNVYREREQYPCNALKLKNNDQY---QKALTLCQDMVKNNLGRTCQSEVKIDKYLDMCQDEICECLQTQPENSTIENCYSTFCKIEEQYSYACTLKGIAV-DWRSATTICKQPQCFNGQEFSECGSNCGKNCGQLGMELECESQCLPGCYCPRNRYWDGT---MCVPQEKCPCVRDNGESTYQQGYRLKLNCETCICGMHGKWQCIENEECEGRCFISGDPHYITFDRRHFFFDGHCEYTAVMTTSDNVLLSNSTIAPLSITIQNTNCQDNSETGCPRTIGVI--IGEDEDQVAINLLSSSEIKVNFVKISLPYQHTGNTKVLIDQVSTDILRLKSETGVEILWNGGSRIEIKL----SKKYREKV---TGMCGNFNGNEMDDSMTFKGVDEKDIDKFVLSWKTNPTCESDRGIVEYKGACALSRSYSDYANKVCHKLYESEEF-KKCHSAANADKFFDQCTHDVCTCGMKRNGALDHCECEAFSSYARQCALENINL-SWR-TNELCPKKCPNENMKYNQCGSRCTSTCRLLQ--ESKCKEECI--EGCFCPEGETFDEAAKECVKISDCKCEFHGRFYLPYEIRQDRCNNCTCTNGNWICTSNDCEGK--EFCPKSMAWFDCGICQKT--CTNLDLVCPKGQCQLPGCFCPENTVLH-NGECIKPFECPCYMNNKMYSENDTIVRGPANCQNPCICKDGKWVCEQNKQCSGICKTWGETHYESFDGKYFEFQGSCSYVISEDFCGN--KLGTFKLISENIACGXXXXXCTKSIKFIYLNRVFQFVRGSNPIVSRNTNYPPGGPTAFYWTSDVDTHFILFTMEGIQVKWDKAMSLEIMIPEKYQNKVCGLCGNFDLRIDNDMRARSGEIEKDIVNFADSWKVHSSCPVPQKPPFMCSKRPDREPWAKAKCEILKSDSFKKCHDVVNVEHYYKRCVADACECDRGDDCVCFCTAVEQYVARCNEYEIGLKWRTNE---------NCPHTCT------GKRVWKNCGNICPDSCIDIGKNVTDNTGCKKVCIEGCF--CPDGLHWQNNE---CVERKACECVDPITNLKYNTGDKVIRE-CEECNCYEGAFRC 4102
            C+   G   KTFD   F +     Y  F DC            +SY+ F+ K  +  +    +I     T +    N      N    +PF++  I++ + GS +K+     LEI  +  D    V A     +++CGLCG F+G   ++  Y     ++  +              ++  + +  Q   N   L    QY    K+   C  +V ++   +C   +  + Y  MC  E C+C           +  +  C     YS  C+L+   + +WRS+  +C    C    E+ ECGS C   C  +    +C+  C+ GC CP            C+  E+C C   NG  TY    ++ ++C +C C   G W C     C   C +    H+ TFD R + F G C Y          L        L    Q   C   +    P  +G I  + + +   ++   S+ +I  + + +SLPY    +  V I + S+  +++ +  G+ +L      +++ +    S  +RE V   TG+CGNFNG   DD M+ +G+ E     F  SWK NP CE D G V  +  C L+ + +  A   C  L  S  F K CH   +   ++ +C  D C+C   ++     C  E F SYA  CA + +   +WR   +    +CPN  + Y+   + C  TCR L   +  C+E  +  EGC C EG  F      CV    C C  +G    P E        C C  G  +C+ +  E     + P  +A  +     +   C  L  +    QCQ PGC CPE  + + NG+C+     PC + + + S         A+      C  G W C +  QC   CK +G+ HY +FDG+ F+F G+C YV+++DFC +  K+GTF++I+ENI CGS S+ C+KSI+F   N+  +   G   I   + +   G    F     V  + I+    GI++ WD+  SL I+ P   QN++CGLCG ++  + +D   R   +    ++F +SWK   +C         C   P R+ W++ KC ILK+D F  CH  V+   +Y+ CV D+C C+ G DC CFCT+V  Y   C      + WRT +         N P +CT      G    K CGN    + ID+G             +EGC+  CP    + +     CV    C C +  + +    G  V R+ CE C C  G   C
Sbjct:    6 CTTWGGGFFKTFDEAFFKFSSNCSYMFFQDC-----------RSSYEEFNIKISHGANEQFSEILFKIDTDVAQFANGKVSFNNRILTLPFSNNKILIQTHGSGVKL-AFRQLEISAYLNDDAFTVVAGDEFRQQLCGLCGNFDGSSTVTTSYSRLKMLLSFSAY------------EVLFFVKCSQLHLNLKTLPAIQQYLIQPKSSGKCTAVVTSSCKGSCG--LNQEGYAAMCAIEKCQC----------GSATTCGCAALSAYSRECSLQYKPLPNWRSSQ-MCPPQDCPGNLEYQECGSTCPPTCANMDPS-KCQEPCVAGCVCPSGTVLSAINEETCIAPEECRC-NYNG-ITYDASDKITIDCNSCTCEA-GSWTCT-TRLCPKACSLESGAHFNTFDSRSYTFHGVCSY---------YLAVKQAHVALRALGQKLECSAKN----PSDLGSISSLTDKKRIRSLEFKSNGKIISSQMSVSLPYI---SDSVKIFRKSSMFIQVDTSYGMMMLVQNSPTMQVYIGLIDSVMFRETVCTPTGLCGNFNGIASDDFMSSQGLVEGTAAAFANSWKVNPDCE-DVGTV-IRDPCQLNTAVAKQAELRCAILRNSTAFFKDCHYLVDPYSYYSRCKQDACSCPSGQD-----CITETFLSYALACASKGLIFENWRKATDSQLVECPNAEV-YSYNANACNQTCRSLSSVDLACQESGLVAEGCQCAEG-LFANDEGMCVPAVSCPCYVNGDILKPGEKVTIADIPCYCREGQLLCSESKKEDHVDPYPPPPVAIQNISTLVRINECVVLYFLQLGRQCQ-PGCICPEGLINNGNGDCVN--NSPCSVCHLVMSGRKEQCHCGASVYK---CYSGSWNCTE-LQCDSTCKMYGDGHYTTFDGQRFQFDGNCEYVVAQDFCVSDPKVGTFQIITENIPCGSMST-CSKSIRFFLQNKEIKLADGKYEIHDVSGSASKGSEEVFT-VHTVGLYLIVKASNGIKLIWDRRTSLFIIAPPDKQNQLCGLCGKYNFDMSDDFTMRDHSLSASPLHFGNSWKASDACSDVTDEASPCEMNPYRKAWSERKCSILKTDVFDACHSQVDHIPFYEACVRDSCACNIGGDCECFCTSVAAYAEACTSAGQCVAWRTPDLCPVFCDYYNSPDSCTWHYRPCGIVNTKTCGN---PAGIDLGNFPQ---------LEGCYPKCPAKTPYLDEHMMTCVSMDKCSC-EMGSQIVPANGTVVNRDTCETCTCVMGNMEC 1186          

HSP 2 Score: 107.071 bits (266), Expect = 3.565e-23
Identity = 94/377 (24.93%), Postives = 162/377 (42.97%), Query Frame = 2
Query: 3032 GICKTWGETHYESFDGKYFEFQGSCSYVISEDFCGNKLGTFKLISENIACGXXXXXCTKSIKFIYLNRVFQFVRGSNPIVSRNTNYPPGGPTAFYWTSDVDTHFILFTMEGIQVKWDKAMSLEIMIPEKYQNKVCGLCGNFDLRID-----NDMRARSGEIEKDIVNFADSWKVHSSC-PVPQKPPFMCSKRPDREPWAKAKCEILKSDSFKKCHDVVNVEHYYKRCVADACECDRGDDCVCFCTAVEQYVARCN-EYEIGLKWRTNENCP-HTCTGKRVWKNCGNICPDSCIDIGKNVTDNTGCKKVCIEGCFCPDG--LHWQNNE-CVERKACECVDPITNLKYNTGDKVIRECEECNCYEGAFRC-TKLFSKEC 4126
             +C TWG   +++FD  +F+F  +CSY+  +D C +    F     NI     ++     I F     V QF  G     +R    P         T           +E      D A +  ++  ++++ ++CGLCGNFD         + ++        +++ F    ++H +   +P    ++       +P +  KC  + + S K    + N E Y   C  + C+C  G    C C A+  Y   C+ +Y+    WR+++ CP   C G   ++ CG+ CP +C ++     D + C++ C+ GC CP G  L   N E C+  + C C      + Y+  DK+  +C  C C  G++ C T+L  K C
Sbjct:    4 AVCTTWGGGFFKTFDEAFFKFSSNCSYMFFQD-CRSSYEEF-----NIKISHGANEQFSEILFKIDTDVAQFANGKVSFNNRILTLPFSNNKILIQTHGSGVKLAFRQLEISAYLNDDAFT--VVAGDEFRQQLCGLCGNFDGSSTVTTSYSRLKMLLSFSAYEVLFFVKCSQLHLNLKTLPAIQQYLI------QPKSSGKCTAVVTSSCKGSCGL-NQEGYAAMCAIEKCQC--GSATTCGCAALSAYSRECSLQYKPLPNWRSSQMCPPQDCPGNLEYQECGSTCPPTCANM-----DPSKCQEPCVAGCVCPSGTVLSAINEETCIAPEECRCN--YNGITYDASDKITIDCNSCTCEAGSWTCTTRLCPKAC 356          

HSP 3 Score: 81.6481 bits (200), Expect = 1.851e-15
Identity = 117/474 (24.68%), Postives = 189/474 (39.87%), Query Frame = 2
Query:  260 NRCSDPICVGGCS----------NGGKCVAPNQCLCLDN---YSGPNCNTLLIKSSQSDVSNYGAVTRVNNTMYSTYYECSVIYGHHIKTFDGNVFSYPLRGGYTLFMDCLGAAPLFYVYFNASYDCFDQKTQNDCSISMKITVGTQTIILFPKNEFALVKNNKTKIPFNSEGI-IVSSVGSFIKIKGIDDLEILFDRDRNIYVYA----PVTAEKKIC---GLCGYFNGIMSDDYRDFNQVIQKNVKTFVNSW-IDRDPSDL-NVYREREQYPCNALKLKNNDQYQKALTLCQDMVKNNLG--RTCQSEVKIDKYLDMCQDEICECLQTQPENSTIENCYS-TFCKIEEQYSYACTLKGIAVD-WRSATTICKQPQCFNGQEFSECGSNCGKNCGQL-GMELECESQCL--PGCYCPRNRYW-DGTMCVPQEKCPCVRDNGESTYQQGYRLKLNCETCICGMHGKWQCIENEE 1588
            ++C +P CV GC           N   C+AP +C C  N   Y   +  T+   S   +  ++   TR+          CS+  G H  TFD    SY   G  + ++  +  A +         +C  +   +  SIS          + F  N   +       +P+ S+ + I      FI++     + +L      + VY      V   + +C   GLCG FNGI SDD+     +++     F NSW ++ D  D+  V R+    PC       N    K   L   +++N+    + C   V    Y   C+ + C C   Q       +C + TF      Y+ AC  KG+  + WR AT   +  +C N + +S   + C + C  L  ++L C+   L   GC C    +  D  MCVP   CPC   NG+   + G ++ +    C C   G+  C E+++
Sbjct:  284 SKCQEP-CVAGCVCPSGTVLSAINEETCIAPEECRCNYNGITYDASDKITIDCNSCTCEAGSWTCTTRLCPKA------CSLESGAHFNTFDSR--SYTFHGVCSYYL-AVKQAHVALRALGQKLECSAKNPSDLGSISSLTDKKRIRSLEFKSNGKIISSQMSVSLPYISDSVKIFRKSSMFIQVDTSYGMMMLVQNSPTMQVYIGLIDSVMFRETVCTPTGLCGNFNGIASDDFMSSQGLVEGTAAAFANSWKVNPDCEDVGTVIRD----PCQL-----NTAVAKQAELRCAILRNSTAFFKDCHYLVDPYSYYSRCKQDACSCPSGQ-------DCITETFLS----YALACASKGLIFENWRKATD-SQLVECPNAEVYSYNANACNQTCRSLSSVDLACQESGLVAEGCQCAEGLFANDEGMCVPAVSCPCYV-NGD-ILKPGEKVTIADIPCYC-REGQLLCSESKK 723          

HSP 4 Score: 72.7886 bits (177), Expect = 8.153e-13
Identity = 96/410 (23.41%), Postives = 150/410 (36.59%), Query Frame = 2
Query: 1565 WQCIENEECEGRCFISGDPHYITFDRRHFFFDGHCEYTAVMTTSDNVLLSNSTIAPLSITIQNTNCQDNSETGCPRTIGVIIGEDEDQVAINLLSSSEIKVNFV-----KISLPYQHTGNTKVLIDQVSTDILRLKSETGVEILWNGGSRIEIKLSKKYREKVTGMCGNFNGNEMDDSMTFKGVDEK------DIDKFVLSWKTNPTC--ESDRGIVEYKGACALSRSY--SDYANKVCHKLYESEEFKKCHSAANADKFFDQCTHDVCTCGMKRNGALDHCECEAFSSYARQCALENINLSWR--TNELCPKKCPNENMKYNQCGSRCTSTCRLLQESKCKEECIEGCFCPEG-ETFDEAAKECVKISDCKCEF-HGRFYLPYEIRQDRCNNCTC--TNGNWICTSNDC 2731
            W+C  N +C+G     GDPHY TFD + + F   C YT V    +            S+ + N      +     R I V    +   +++      +  +N V      ++ P+   G    +I    T IL      G  + + G           +     G CG  N    DD M   GV E           +++   + P C  ++  G          +R Y  +D A  +C  +  +  F  C  A +  +FFD C +D C        AL+   C +    A QCA     + WR  T  +C   C +   +Y   G +   +C     +       EGCFCP+G + F+  A+ CV   +C C    G+  +     Q  C  C C   + +  C  N C
Sbjct: 1953 WKC--NCQCQGW----GDPHYRTFDGQKYTFLEDCTYTLVEEKINKYA--------FSVLVDNYYFYKQTPASFVRGITVNYNGNSANISLPAAKGRQTVINKVIFNGQAVAFPFVGKG---FVITNHETQILVEIPAIGASVSFTGMMFTVDLPYSLFGNNTQGQCGTCNNARGDDCMRQSGVVEDASCCAVTAADWMVPDASKPHCRAKAPTGQKPCPSTTPTTRPYCTADTAT-ICDIITSNRAFAGCAEATDLSEFFDSCVYDTCAVPT----ALE-VGCASLQVAAEQCAALGFYVDWRSLTRGMCQYNC-SSGFEYQPIGPKEQLSCDYSGATIQTSILEEGCFCPKGMKMFNSQAQTCV--VECGCMGPQGKPVMFGNSWQSDCKECVCDKASASVRCAPNKC 2336          

HSP 5 Score: 64.3142 bits (155), Expect = 3.325e-10
Identity = 95/413 (23.00%), Postives = 156/413 (37.77%), Query Frame = 2
Query: 3023 QCSGICKTWGETHYESFDGKYFEFQGSCSYVISEDFCGNKLGTFKLISENIACGXXXXXCTKSIKFIY----LNRVFQFVRGSNPIVSR------NTNYPPGGPTAFYWTSDVDTHFILFTMEGIQVKWDKAMSLEIMIPEKYQNKVCGLCGNFDLRIDNDMRARSGEIEKD---IVNFADSWKV--------HSSCPVPQKPPFMCSKRPDREPWAKAK----CEILKSD-SFKKCHDVVNVEHYYKRCVADACECDRGDDCVCFCTAVEQYVARCNEYEIGLKWR--TNENCPHTCTGKRVWKNCGNICPDSCIDIGKNVTDNTGCKKVCIEGCFCPDGLHWQNNE---CVERKACECVDPITNLKYNTGDKVIRECEECNC--YEGAFRCTKLFSKECLHTSRPEISTKP 4162
            +C+  C+ WG+ HY +FDG+ + F   C+Y + E+   NK     L+        + +S  + I   Y     N      +G   ++++         +P  G   F  T+      +     G  V +   M    +    + N   G CG  +    +D   +SG +E      V  AD W V         +  P  QKP    S  P   P+  A     C+I+ S+ +F  C +  ++  ++  CV D C      +    C +++    +C      + WR  T   C + C+    ++  G     SC   G  +  +     +  EGCFCP G+   N++   CV    C C+ P        G+    +C+EC C     + RC      E      PE S KP
Sbjct: 1954 KCNCQCQGWGDPHYRTFDGQKYTFLEDCTYTLVEEKI-NKYAFSVLVDNYYFYKQTPASFVRGITVNYNGNSANISLPAAKGRQTVINKVIFNGQAVAFPFVG-KGFVITNHETQILVEIPAIGASVSFTGMMFTVDLPYSLFGNNTQGQCGTCNNARGDDCMRQSGVVEDASCCAVTAAD-WMVPDASKPHCRAKAPTGQKP--CPSTTPTTRPYCTADTATICDIITSNRAFAGCAEATDLSEFFDSCVYDTCAVPTALEV--GCASLQVAAEQCAALGFYVDWRSLTRGMCQYNCSSGFEYQPIGPKEQLSCDYSGATIQTS-----ILEEGCFCPKGMKMFNSQAQTCVVE--CGCMGP-QGKPVMFGNSWQSDCKECVCDKASASVRCAPNKCPE-----NPEHSCKP 2346          
BLAST of von Willebrand factor vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008652.1 (pep scaffold:Pmarinus_7.0:GL477625:577100:586386:1 gene:ENSPMAG00000007836.1 transcript:ENSPMAT00000008652.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 338.576 bits (867), Expect = 5.213e-101
Identity = 220/659 (33.38%), Postives = 314/659 (47.65%), Query Frame = 2
Query: 1949 RLKSETGVEILWNGGSRIEIKLSKKYREKVTGMCGNFNGNEMDDSMTFKGVDEKDIDKFVLSWK-----TNPTCESDRGIVEYKGACALSRSYSDYANKVCHKLYESEEFKKCHSAANADKFFDQCTHDVCTCGMKRNGALDHCECEAFSSYARQCALENINLS-WRTNELCPKKCPNENMKYNQCGSRCTSTCRLLQE-SKCKEECIEGCFCPEGETFDEAAKECVKISDCKCEFHGRFYLPYEIRQDRCNNCTCTNGNWICTSND--CEGKEFCPKSMAWFDC-GICQKTCTNLD----LVCPKGQCQLPGCFCPENTVLHNGECIKPFECPCYMNNKMYSENDTIVRGPANCQNPCICKDGKWVCEQNKQCSGICKTWGETHYESFDGKYFEFQGSCSYVISE------DFCGNKL--------GTFKLISENIACGXXXXXCTKSIKFIYLNR----VFQ--FVRGSNPIVSRNTNYPPGGPTAFYWTSDVDTHFILFTMEGIQVKWDKAMSLEIMIPEKYQNKVCGLCGNFDLRIDNDMRARSGEIEKDIVN-FADSWKVHSSCPVPQKPPFMCSKRPDREPWAKAKCEILKSDSFKKCHDVVNVEHYYKRCVADACECDRGDDCVCFCTAVEQYVARCNEYEIGLKWRTNENC 3820
            ++  + G+ I+W+G  R+ +    +    V G+CG F  ++ DD MT  G  E ++  F   WK     TN   E++   +     C      +  A + C+KL  ++ F  CH+  N D F   CT++VCT      GAL   EC+ F+ YA  CA   + L+ WR    C   CP + M Y QC S C STC  L     C EEC EGC CP+G   D     CV  S CKC +    Y P  I Q  C NCTC  G W C S++   +    CP++M W  C   C  TC N++      C    C   GC C    V    +C++P  CPCY   + +    +I     +C N C+C    W CE  K+C G+C  +G+ HY++FDG+ ++FQG+C YV++       D+    L          F L  EN+ CGSS  +CTK+I   Y       +F+   VRG N +           PT  +       +  + T  G+ ++WD +  L I +  KY   V GLCGNF+   ++D    +    +++ N F DSWKVH+ C         C   P R  W++ KC +L+S  F  C  VV V  Y  RC+ DAC CD G DC C CTA+  Y   C+   + ++WR++E C
Sbjct:    1 QVTLDNGMRIVWDGVRRLYVTAPPELEGTVAGLCGTFTRDQRDDFMTRAGDVEIEVWAFTARWKVAQGATNSCPEANS--LALASPCNTYAQLNSAAQETCNKLM-NDPFNLCHTRVNPDAFKKDCTYEVCT-----AGALTGAECKTFADYAYICASRGVVLANWRLLLDCTVTCPGD-MVYQQCASSCRSTCASLSNIEDCHEECAEGCNCPDGLLLDFDGLSCVDQSQCKCSYSSTNYAPGSILQMGCKNCTCEYGGWSCWSSEGCVDDSGLCPENMQWSPCKSSCPVTCGNMNNPSLSSCITETCD-AGCECSTGLVWDGSKCVQPANCPCYHGGQSFQTGQSIT---LDCNN-CVCNGQVWECEH-KRCPGVCSVYGDPHYKTFDGRAYDFQGNCQYVLARTIYSLIDYSSLNLTDMGDVDNDGFVLTVENVPCGSSGVTCTKNIGLKYWRAHNGDIFKIDLVRGKNVV----------DPTGNFIIRRAGLYLFVDTPIGVSIQWDYSTRLYIRLHPKYMGLVEGLCGNFNGDQNDDFVTPAAGPPEEMPNIFGDSWKVHAYCAPAVVINDTCLTHPHRAAWSQRKCGVLRSSLFADCQGVVAVAPYVDRCLYDACGCDSGGDCECLCTAIAAYAYECSANGVPIEWRSDELC 634          

HSP 2 Score: 162.155 bits (409), Expect = 2.188e-41
Identity = 115/406 (28.33%), Postives = 180/406 (44.33%), Query Frame = 2
Query: 1274 WRSATTICKQPQCFNGQEFSECGSNCGKNCGQL---GMELECESQCLPGCYCPRNRYWDGTMCVPQEKCPCVRDNGESTYQQGYRLKLNCETCICGMHGKWQCIENEECEGRCFISGDPHYITFDRRHFFFDGHCEYTAVMTTSDNVLLSNSTIAPLS--------ITIQNTNCQDNSETGCPRTIGVIIGEDEDQVAINLLSSSEIKVNFVKISLPYQHTGNTKVLIDQVSTDILRLKSETGVEILWNGGSRIEIKLSKKYREKVTGMCGNFNGNEMDDSMT-FKGVDEKDIDKFVLSWKTNPTCESDRGIVEYKGACALSRSYSDYANKVCHKLYESEEFKKCHSAANADKFFDQCTHDVCTCGMKRNGALDHCECEAFSSYARQCALENINLSWRTNELCPKK 2455
            W S   +     C    ++S C S+C   CG +    +       C  GC C     WDG+ CV    CPC   +G  ++Q G  + L+C  C+C     W+C E++ C G C + GDPHY TFD R + F G+C+Y    T    +  S+  +  +         +T++N  C  +  T C + IG+      +            K++ V+       TGN    I + +   L + +  GV I W+  +R+ I+L  KY   V G+CGNFNG++ DD +T   G  E+  + F  SWK +  C      V     C      + ++ + C  L  S  F  C        + D+C +D C C    +G    C C A ++YA +C+   + + WR++ELC K 
Sbjct:  255 WSSEGCVDDSGLCPENMQWSPCKSSCPVTCGNMNNPSLSSCITETCDAGCECSTGLVWDGSKCVQPANCPCY--HGGQSFQTGQSITLDCNNCVCNGQ-VWEC-EHKRCPGVCSVYGDPHYKTFDGRAYDFQGNCQYVLARTIYSLIDYSSLNLTDMGDVDNDGFVLTVENVPCGSSGVT-CTKNIGLKYWRAHN--------GDIFKIDLVRGKNVVDPTGN---FIIRRAGLYLFVDTPIGVSIQWDYSTRLYIRLHPKYMGLVEGLCGNFNGDQNDDFVTPAAGPPEEMPNIFGDSWKVHAYCAP---AVVINDTCLTHPHRAAWSQRKCGVL-RSSLFADCQGVVAVAPYVDRCLYDACGC---DSGGDCECLCTAIAAYAYECSANGVPIEWRSDELCRKS 637          

HSP 3 Score: 104.375 bits (259), Expect = 7.248e-23
Identity = 75/256 (29.30%), Postives = 110/256 (42.97%), Query Frame = 2
Query: 3362 GIQVKWDKAMSLEIMIPEKYQNKVCGLCGNFDLRIDNDMRARSGEIEKDIVNFADSWKVH----SSCPVPQKPPFM--CSKRPDREPWAKAKCEILKSDSFKKCHDVVNVEHYYKRCVADACECDRGDDCVCFCTAVEQYVARCNEYEIGLK-WRTNENCPHTCTGKRVWKNCGNICPDSCIDIGKNVTDNTGCKKVCIEGCFCPDG--LHWQNNECVERKACECVDPITNLKYNTGDKVIRECEECNCYEGAFRC 4102
            G+++ WD    L +  P + +  V GLCG F     +D   R+G++E ++  F   WKV     +SCP          C+        A+  C  L +D F  CH  VN + + K C  + C    G      C     Y   C    + L  WR   +C  TC G  V++ C + C  +C  +  N+ D   C + C EGC CPDG  L +    CV++  C+C    TN  Y  G  +   C+ C C  G + C
Sbjct:    7 GMRIVWDGVRRLYVTAPPELEGTVAGLCGTFTRDQRDDFMTRAGDVEIEVWAFTARWKVAQGATNSCPEANSLALASPCNTYAQLNSAAQETCNKLMNDPFNLCHTRVNPDAFKKDCTYEVCT--AGALTGAECKTFADYAYICASRGVVLANWRLLLDCTVTCPGDMVYQQCASSCRSTCASL-SNIED---CHEECAEGCNCPDGLLLDFDGLSCVDQSQCKCSYSSTN--YAPGSILQMGCKNCTCEYGGWSC 254          

HSP 4 Score: 82.8037 bits (203), Expect = 4.645e-16
Identity = 70/273 (25.64%), Postives = 106/273 (38.83%), Query Frame = 2
Query:  791 LEILFDRDRNIYVYAPVTAEKKICGLCGYFNGIMSDDYRDFNQVIQKNVKTFVNSWIDRDPSDLNVYRERE---QYPCNALKLKNNDQYQKALTLCQDMVKNNLGRTCQSEVKIDKYLDMCQDEICECLQTQPENSTIENCYSTFCKIEEQYSYACTLKGIAV-DWRSATTICKQPQCFNGQEFSECGSNCGKNCGQLGMELECESQCLPGCYCPRNRY--WDGTMCVPQEKCPCVRDNGESTYQQGYRLKLNCETCICGMHGKWQCIENEEC 1591
            + I++D  R +YV AP   E  + GLCG F     DD+      ++  V  F   W     +  +           PCN     N+     A   C  ++ N+    C + V  D +   C  E+C          T        CK    Y+Y C  +G+ + +WR          C     + +C S+C   C  L    +C  +C  GC CP      +DG  CV Q +C C   +  + Y  G  L++ C+ C C  +G W C  +E C
Sbjct:    8 MRIVWDGVRRLYVTAPPELEGTVAGLCGTFTRDQRDDFMTRAGDVEIEVWAFTARWKVAQGATNSCPEANSLALASPCNTYAQLNS----AAQETCNKLM-NDPFNLCHTRVNPDAFKKDCTYEVC----------TAGALTGAECKTFADYAYICASRGVVLANWRLLLDC--TVTCPGDMVYQQCASSCRSTCASLSNIEDCHEECAEGCNCPDGLLLDFDGLSCVDQSQCKCSYSS--TNYAPGSILQMGCKNCTC-EYGGWSCWSSEGC 260          
BLAST of von Willebrand factor vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005510.1 (pep scaffold:Pmarinus_7.0:GL476588:620363:669144:-1 gene:ENSPMAG00000004964.1 transcript:ENSPMAT00000005510.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 296.59 bits (758), Expect = 1.795e-81
Identity = 312/1310 (23.82%), Postives = 502/1310 (38.32%), Query Frame = 2
Query:  299 NGGKCVAPNQCLCLDN-----------YSGPNCNTLLIKSSQSDVSNYGAVTRVNNT----------MYSTYYECSVIYGHHIKTFDGNVFSYPLRGGYTLFMDCLGAAPLFYVYFNASYDCFDQKTQNDCSISMKITVGTQTI-ILFPKNEFALVKNNKTKIPFNSEGIIVSSVGSFIKIKGIDDLEILFDRDRNIYVYAPVTAEKKICGLCGYFNGIMSDDYRDFNQVIQKNVKTFVNSWIDRDPSDLNVYRER-EQYPCNALKLKNNDQYQKALTLCQDMV-KNNLGRTCQSEVKIDKYLDMCQDEICECLQTQPENSTIENCYSTFCKIEEQYSYACTLKGIAVDWRSATTICKQPQCFNGQEFSECGSNCGKNCGQLGMELECESQCLPGCYCPRNRYWDGTMCVPQEKCPCVRDNGE-STYQQGYRLKLNC-ETCICGMH-----GKWQCIENEEC-------------EGRCFISGDPHYITFDRRHFFFDGHCEYTAVMTTSDNVLLSNSTIAPLSITIQNTNCQDNSETGCPRTIGVIIGEDEDQVAINLLSSSEIKVNFVKISLPYQHTGNTKVLIDQVSTDILRLKSETGVEILWNGGSRIEIKLSKKYREKVTGMCGNFNGNEMDDSMTFKGVDEKDIDKFVLSWK----TNPTCESDRGIVEYKGACALSRSYSDYANKVCHKLYESE-EFKKCHSAANADKFFDQCTHDVCTCGMKRNGALDHCECEAFSSYARQCALENINLSWRTNELCPKKCPNENMKYNQCGSRCTSTCRLLQ-ESKCKEECIEGCFCPEGETFDEAAKECVKISDCKC-EFHGRFYLPYEIRQDRCNNCTCTNGNWICTSNDCEGKEFCPKSMAWFDCGICQKTCTNL---DLVCPKGQCQLPGCFCPENTVLHNGECIKPFECPCYMNNKMYSENDTIVRGPANCQNPCICKDGKWVCEQNKQCSGICKTWGETHYESFDGKYFEFQGSCSYVISEDFC--GNKLGTFKLISEN-IACGXXXXXCTKSIKFIYLNRVFQFVRGSNPIV-SRNTNYPPGGPTAFYWTSDVDTHFILFTMEGIQVKWDKAMSLEIMIPEKYQNKVCGLCGNFDLRIDNDMRARSGEIEKDIVNFADSWKVHSS---------CPVPQKP--PFMCSKRPDREPWAKAKCEILKSDS--FKKCHDVVNVEHYYKRCVADACECDRGDDCVCFCTAVEQYVARCNEYEIGLKWRTNENCPHTCTGKRVWKNCGNICPDSCIDIGKNVTDNTGCKKVCIEGCFCPDGLHWQNNECVERKACECVD 4015
            +G KCV  +QC CLDN           +   +C+   I  +  +V+    V   + T            S   +C +    H  TFD     +     YT  + C  ++ L   +FN       +      S   ++ V          K    LV   +   PF   G+ +   GS++ ++   +L + FD + ++ +  P     ++CG+CG FNG  SDD    +     +     NSW   + SD +   +  E  PC+    +N+    ++ T C  +       + C + +    + D C  ++C               + + C+  + Y+  C   G+ V WR+  T C  P C  G  +  C   C   C        C  QC  GC C       G  CVP ++C C+ +NG      + +    +C + CIC        G W C ++E C              G C I+GDPHYITFD+    F G C YTA +  + +  L +         ++ TN      T       V +  D       L     + V+ ++++ P   +G   V I Q+S   + L+++  + + ++G   +EI +  +Y  ++ G+CGNFNG+  DD++   G      ++   SW+    ++  C+   G +     C  +      ++  C  + + E  FK+CH+      FFD C  D+C      +G+L    C+A  +YA QCA   + ++WR N  CP  C      Y  C   C +TC        C ++C EGC C +G  F  +  +CV +  C C +F  +++                                 P   +WF+ G C + CT L   D+ C   +C+       E+ +L                       D   R P +C    I  D  ++                    +FD     F G C+Y  +   C   + L  F + + N    GS++ S  K +        F   +G   +V  +    P  G           ++ +L T  G+ VK+D    LEI  P  Y NK+CGLCGN++    +D    +G++        DSWK               V  KP  P +    P  E   K  CE++ S S  F KCH  ++ E + K C+ D C+    +  +  C   + Y   C    I + WR    CP  C     +  C + CP +C DI     D       C EGC C  G    ++ CV  +AC C D
Sbjct:   44 SGDKCVPTDQCGCLDNNGHYHPIGESWFESQDCSQRCICVNPGNVNCEAWVCEDDETCGVEDGILGCHGSAPGDCVITGDPHYITFDKTTHHFMGECTYTAAIPCNQSSTL-PPHFNVETTNEFRGGSTAVSYVKEVHVDVYGHRFTLAKGRRVLVDGLRVTPPFFMSGVYIQLSGSYVVLETDFNLVVRFDGNHHVEIVVPGEYAGQLCGICGNFNGDGSDDNLKPDGSAAASSSELGNSWRVFNSSDDDCQDDTGEIPPCD----ENDKNLYESDTFCGIITDPEGAFKECHAVLPPQIFFDNCVFDLC----------ATGGDHGSLCQALQAYADQCAQAGVIVTWRN-NTFCPFP-CEPGSHYESCAPPCPATCSNANPPAGCNQQCAEGCVCDDGFVLSGDKCVPTDQCGCLDNNGHYHPIGESWFESQDCSQRCICVNPGNVNCGAWVCEDDETCGVEDGILGCHGSAPGDCVITGDPHYITFDKTTHHFMGECTYTAAIPCNQSSTLPH-------FNVETTNEFRGGSTAVSYVKEVHV--DVYGHRFTLAKGRRVLVDGLRVTPPVFMSG---VYI-QLSGSYVVLETDFNLVVRFDGNHHVEIVVPGEYAGQLCGICGNFNGDGSDDNLKPDGSAAASSNELGNSWRVFNSSDDDCQDGTGEIP---PCDENDKDVYESDSFCGIIIDDEGAFKECHAVLPPQVFFDNCVFDLCATD-GDHGSL----CQALQAYADQCAQAGVIVTWRNNTFCPFPC-EPGSHYESCAPPCPATCSNASLPGGCNQQCAEGCVCDDG--FVLSGDKCVPVELCGCLDFDNQYH---------------------------------PLGESWFESGNCSRRCTCLGAGDVHCEDWECEEHEVCSVEDGIL-----------------------DCYAREPGDC---VITGDPHYI--------------------TFDKTTHHFMGECTYTAAVP-CNQSSTLPHFNVETTNEFRGGSTTVSYVKEVHVEVYGYRFTLAKGRRVLVDDKRVKTPIEGLVPGVKIGISGSYVLLETDFGVTVKFDGKHHLEINTPSTYFNKLCGLCGNYNQNGTDDYLMPNGKLATSAAQLGDSWKAEGDDDAGSTLWVGEVSCKPDEPHIPGCDPINEEAYKKMCEVVISTSGAFAKCHAEIDPEPFLKTCIYDMCQFHGMESTL--CDNFQAYAEACRAKGINILWRNETFCPLPCPPNTHYTPCASPCPATCSDI--YAEDGCQSAARCAEGCVCDQGFVLSDDLCVSLEACGCWD 1228          

HSP 2 Score: 209.92 bits (533), Expect = 1.273e-54
Identity = 216/886 (24.38%), Postives = 346/886 (39.05%), Query Frame = 2
Query:  299 NGGKCVAPNQCLCLDN-----------YSGPNCNTLLIKSSQSDVSNYGAVTRVNNT----------MYSTYYECSVIYGHHIKTFDGNVFSYPLRGGYTLFMDCLGAAPLFYVYFNASYDCFDQKTQNDCSISMKITVGTQTIILFPKNEFALVKNNKTKIPFNSEGIIVSSVGSFIKIKGIDDLEILFDRDRNIYVYAPVTAEKKICGLCGYFNGIMSDDYRDFNQVIQKNVKTFVNSWIDRDPSDLNVYR-EREQYPCNALKLKNNDQYQKALTLCQDMVKNNLG-RTCQSEVKIDKYLDMCQDEICECLQTQPENSTIENCYSTFCKIEEQYSYACTLKGIAVDWRSATTICKQPQCFNGQEFSECGSNCGKNCGQLGMELECESQCLPGCYCPRNRYWDGTMCVPQEKCPCVR-DN-----GESTYQQGYRLKLNC-ETCICGMHGK-----WQCIENEECE-------------GRCFISGDPHYITFDRRHFFFDGHCEYTAVMTTSDNVLLSNSTIAPLSITIQNTNCQDNSETGCPRTIGVIIGEDEDQV---AINLLSSSEIKVNFVKISLPYQHTGNTKVLIDQVSTDILRLKSETGVEILWNGGSRIEIKLSKKYREKVTGMCGNFNGNEMDDSMTFKGVDEKDIDKFVLSWKTNPTCESDRGIVEYKG--ACALSRSYSDYANKVCHKLYE---------SEEFKKCHSAANADKFFDQCTHDVCTCGMKRNGALDHCECEAFSSYARQCALENINLSWRTNELCPKKCPNENMKYNQCGSRCTSTCR-LLQESKCKE--ECIEGCFCPEGETFDEAAKECVKISDCKCEFHGRFYLPYE--IRQDRC-NNCTCT-NGNWICTSNDCEGKEFC 2749
            +G KCV  +QC CLDN           +   +C+   I  +  +V+    V   + T            S   +C +    H  TFD     +     YT  + C  ++ L +     + +     T       + + V      L  K    LV   +   P    G+ +   GS++ ++   +L + FD + ++ +  P     ++CG+CG FNG  SDD    +     +     NSW   + SD +      E  PC+    +N+    ++ + C  ++ +    + C + +    + D C  ++C            +  + + C+  + Y+  C   G+ V WR+  T C  P C  G  +  C   C   C    +   C  QC  GC C       G  CVP E C C+  DN     GES ++ G     NC   C C   G      W+C E+E C              G C I+GDPHYITFD+    F G C YTA +  +             S T+ + N +  +E     T    + E   +V      L     + V+  ++  P +  G    +   +S   + L+++ GV + ++G   +EI     Y  K+ G+CGN+N N  DD +   G       +   SWK     + D G   + G  +C     +    + +  + Y+         S  F KCH+  + + F   C +D+C     +   ++   C+ F +YA  C  + IN+ WR    CP  CP  N  Y  C S C +TC  +  E  C+    C EGC C +G  F  +   CV +  C C      Y  +E     D C   C C+  GN  C ++ C   E C
Sbjct:  431 SGDKCVPTDQCGCLDNNGHYHPIGESWFESQDCSQRCICVNPGNVNCGAWVCEDDETCGVEDGILGCHGSAPGDCVITGDPHYITFDKTTHHFMGECTYTAAIPCNQSSTLPHFNVETTNEFRGGSTAVSYVKEVHVDVYGHRFTL-AKGRRVLVDGLRVTPPVFMSGVYIQLSGSYVVLETDFNLVVRFDGNHHVEIVVPGEYAGQLCGICGNFNGDGSDDNLKPDGSAAASSNELGNSWRVFNSSDDDCQDGTGEIPPCD----ENDKDVYESDSFCGIIIDDEGAFKECHAVLPPQVFFDNCVFDLC----------ATDGDHGSLCQALQAYADQCAQAGVIVTWRN-NTFCPFP-CEPGSHYESCAPPCPATCSNASLPGGCNQQCAEGCVCDDGFVLSGDKCVPVELCGCLDFDNQYHPLGESWFESG-----NCSRRCTCLGAGDVHCEDWECEEHEVCSVEDGILDCYAREPGDCVITGDPHYITFDKTTHHFMGECTYTAAVPCNQ------------SSTLPHFNVETTNEFRGGSTTVSYVKEVHVEVYGYRFTLAKGRRVLVDDKRVKTPIE--GLVPGVKIGISGSYVLLETDFGVTVKFDGKHHLEINTPSTYFNKLCGLCGNYNQNGTDDYLMPNGKLATSAAQLGDSWKAEG--DDDAGSTLWVGEVSCKPDEPHIPGCDPINEEAYKKMCEVVISTSGAFAKCHAEIDPEPFLKTCIYDMC-----QFHGMESTLCDNFQAYAEACRAKGINILWRNETFCPLPCP-PNTHYTPCASPCPATCSDIYAEDGCQSAARCAEGCVCDQG--FVLSDDLCVSLEACGCWDDENNYHSFEEAWLSDNCKRKCVCSVPGNASCEAHSCVEHESC 1270          

HSP 3 Score: 176.022 bits (445), Expect = 3.081e-44
Identity = 180/751 (23.97%), Postives = 304/751 (40.48%), Query Frame = 2
Query:  455 ECSVIYGHHIKTFDGNVFSYPLRGGYTLFMDCLGAAPLFYVYFNASYDCFDQKTQNDCSISMKITVGTQTIILFPKNEFALVKNNKTKIPFNS--EGIIVSSVGSFIKIKGIDDLEILFDRDRNIYVYAPVTAEKKICGLCGYFNGIMSDDYRDFNQVIQKNVKTFVNSWIDRDPSDLNVYREREQYPCNALKLK-------NNDQYQKALTLCQDMVKNNLG-RTCQSEVKIDKYLDMCQDEICECLQTQPENSTIENCYSTFCKIEEQYSYACTLKGIAVDWRSATTICKQPQCFNGQEFSECGSNCGKNCGQLGMELECES--QCLPGCYCPRNRYWDGTMCVPQEKCPCVRD-NGESTYQQGYRLKLNCE-TCICGMHG-----KWQCIENEECE-------------GRCFISGDPHYITFDRRHFFFDGHCEYTAVMTTSDNVLLSNSTIAPLSITIQNTNCQDNSETGCPRTIGVIIGEDEDQVAINLLSSSEIKVNFVKISLPYQHTGNTKVLIDQVSTDI-LRLKSETGVEILWNGGSRIEIKLSKKYREKVTGMCGNFNGNEMDDSMTFKGVDEKDIDKFVLSWKTNPTC----ESDRGIVEYKGACALS---RSYSDYANKVCHKLYE--SEEFKKCHSAANADKFFDQCTHDVCTCGMKRNGALDHCECEAFSSYARQCALENINL-SWRTNELCPKKCPNENMKYNQCGSRCTSTC-RLLQESKCKEECIEGCFCPEG 2575
            +C +    H  TFD     +     YT  + C  ++ L +     + +     T       + + V      L  K    LV + + K P      G+ +   GS++ ++    + + FD   ++ +  P T   K+CGLCG +N   +DDY   N  +  +     +SW      D        +  C   +         N + Y+K   +C+ ++  +     C +E+  + +L  C  ++C+               ST C   + Y+ AC  KGI + WR+ T  C  P C     ++ C S C   C  +  E  C+S  +C  GC C +       +CV  E C C  D N   ++++ + L  NC+  C+C + G        C+E+E C+               C ISGDPHY TFD+R + F G   YT V +  D     N+ + P+ I  +N     N        + + +        I      + ++N V+   P     N K  ++ V T   + L+++ G+ ++++  S  ++ +   Y  +V G+CGN NG++ D+  T  G      D F  SW+ N       +S R + E +    LS     +++  NK    ++   +  F +C   A  D ++  C +D+C      N       C +   Y   C  E I   +WR    C ++C   N+ Y +  S C STC  L   S C+   +EGC C  G
Sbjct:  890 DCVITGDPHYITFDKTTHHFMGECTYTAAVPCNQSSTLPHFNVETTNEFRGGSTTVSYVKEVHVEVYGYRFTL-AKGRRVLVDDKRVKTPIEGLVPGVKIGISGSYVLLETDFGVTVKFDGKHHLEINTPSTYFNKLCGLCGNYNQNGTDDYLMPNGKLATSAAQLGDSWKAEGDDDAGSTLWVGEVSCKPDEPHIPGCDPINEEAYKK---MCEVVISTSGAFAKCHAEIDPEPFLKTCIYDMCQ----------FHGMESTLCDNFQAYAEACRAKGINILWRNET-FCPLP-CPPNTHYTPCASPCPATCSDIYAEDGCQSAARCAEGCVCDQGFVLSDDLCVSLEACGCWDDENNYHSFEEAW-LSDNCKRKCVCSVPGNASCEAHSCVEHESCQLNNGKESCQPVSYSTCSISGDPHYQTFDKRLYHFMGRETYTLVQSCGD-----NNNLLPIRILGKNKRVGHNHRVSFLDAVYIYV----YGFKIKFTDRKDFELNGVRTKPP----SNPKEGLEIVHTSHKMVLRTDFGLTVIFDRKSHADVTIPSSYAGQVCGLCGNSNGDKSDEFKTPDGSLVTSEDVFGNSWEVNDRRSLFEQSKRLVEEPRNDLNLSCSDEQWAELENKSSCGVFHDPAGPFVQCWIPAPVDPYYTNCMYDMC-----ENIGDKELFCSSLEVYTSACQQEGITPNNWRIYTGCAQQCAAHNI-YVERMSACPSTCGDLAASSNCELPDVEGCQCMPG 1604          

HSP 4 Score: 172.555 bits (436), Expect = 3.386e-43
Identity = 141/511 (27.59%), Postives = 217/511 (42.47%), Query Frame = 2
Query: 1310 CFNGQEFSECGSNCGKNCGQLGMELECESQCLPGCYCPRNRYWDGTMCVPQEKCPCVRDNGE-STYQQGYRLKLNC-ETCICGMHG-----KWQCIENEEC-------------EGRCFISGDPHYITFDRRHFFFDGHCEYTAVMTTSDNVLLSNSTIAPLSITIQNTNCQDNSETGCPRTIGVIIGEDEDQVAINLLSSSEIKVNFVKISLPYQHTGNTKVLIDQVSTDILRLKSETGVEILWNGGSRIEIKLSKKYREKVTGMCGNFNGNEMDDSMTFKGVDEKDIDKFVLSWK----TNPTCESDRGIVEYKGACALSRSYSDYANKVCHKLYESE-EFKKCHSAANADKFFDQCTHDVCTCGMKRNGALDHCECEAFSSYARQCALENINLSWRTNELCPKKCPNENMKYNQCGSRCTSTCRLLQ-ESKCKEECIEGCFCPEGETFDEAAKECVKISDCKCEFHGRFYLP----YEIRQDRCNNCTCTN-GNWICTSNDCEGKEFC 2749
            C  G  +  C   C   C        C  QC  GC C       G  CVP ++C C+ +NG      + +    +C + CIC   G      W C ++E C              G C I+GDPHYITFD+    F G C YTA       +  + S+  P    ++ TN      T       V +  D       L     + V+ ++++ P+  +G   V I Q+S   + L+++  + + ++G   +EI +  +Y  ++ G+CGNFNG+  DD++   G       +   SW+    ++  C+ D G +     C  +      ++  C  + + E  FK+CH+      FFD C  D+C  G   +G+L    C+A  +YA QCA   + ++WR N  CP  C      Y  C   C +TC      + C ++C EGC C +G  F  +  +CV    C C  +   Y P    +   QD    C C N GN  C +  CE  E C
Sbjct:    1 CEPGSHYESCAPPCPATCSNANPPAGCNQQCAEGCVCDDGFVLSGDKCVPTDQCGCLDNNGHYHPIGESWFESQDCSQRCICVNPGNVNCEAWVCEDDETCGVEDGILGCHGSAPGDCVITGDPHYITFDKTTHHFMGECTYTAA------IPCNQSSTLPPHFNVETTNEFRGGSTAVSYVKEVHV--DVYGHRFTLAKGRRVLVDGLRVTPPFFMSG---VYI-QLSGSYVVLETDFNLVVRFDGNHHVEIVVPGEYAGQLCGICGNFNGDGSDDNLKPDGSAAASSSELGNSWRVFNSSDDDCQDDTGEIP---PCDENDKNLYESDTFCGIITDPEGAFKECHAVLPPQIFFDNCVFDLCATG-GDHGSL----CQALQAYADQCAQAGVIVTWRNNTFCPFPC-EPGSHYESCAPPCPATCSNANPPAGCNQQCAEGCVCDDG--FVLSGDKCVPTDQCGCLDNNGHYHPIGESWFESQDCSQRCICVNPGNVNCGAWVCEDDETC 488          

HSP 5 Score: 144.05 bits (362), Expect = 1.633e-34
Identity = 131/511 (25.64%), Postives = 207/511 (40.51%), Query Frame = 2
Query: 2783 CQKTCTNLDLVCPKGQCQLPGCFCPENTVLHNGECIKPFECPCYMNNKMYSENDTIVRGPANCQNPCICKD------GKWVCEQNKQCS-------------GICKTWGETHYESFDGKYFEFQGSCSYVISEDFC--GNKLGTFKLISEN-IACGXXXXXCTKSIKFIYLNRVFQFVRGSNPIVSRNTNYPPGGPTAFYWTSDVDTHFILFTMEGIQVKWDKAMSLEIMIPEKYQNKVCGLCGNFDLRIDNDMRARSGEIEKDIVNFADSWKVHSSCP------VPQKPPFMCSKRPDREPWAKAKCEILKSD--SFKKCHDVVNVEHYYKRCVADACECDRGDDCVCFCTAVEQYVARCNEYEIGLKWRTNENCPHTCTGKRVWKNCGNICPDSCIDIGKNVTDNTGCKKVCIEGCFCPDGLHWQNNECVERKACECVD------PITNLKYNTGDKVIR--------------ECEE---CNCYEGAFRCTKLFSKECLHTSRPEIST 4156
            C  TC+N +      Q    GC C +  VL   +C+   +C C  NN  Y           +C   CIC +      G WVCE ++ C              G C   G+ HY +FD     F G C+Y  +   C   + L  F + + N    GS++ S  K +        F   +G   +V      PP   +  Y      ++ +L T   + V++D    +EI++P +Y  ++CG+CGNF+    +D     G          +SW+V +S          + PP  C +       + + C I+  D  +FK+CH V+  + ++  CV D C  D   D    C A++ Y  +C +  + + WR N  CP  C     +++C   CP +C     N +   GC + C EGC C DG     ++CV  + C C+D      P+    + +G+   R              ECEE   C+  +G   C      +C+ T  P   T
Sbjct:  401 CPATCSNANPPAGCNQQCAEGCVCDDGFVLSGDKCVPTDQCGCLDNNGHYHPIGESWFESQDCSQRCICVNPGNVNCGAWVCEDDETCGVEDGILGCHGSAPGDCVITGDPHYITFDKTTHHFMGECTYTAAIP-CNQSSTLPHFNVETTNEFRGGSTAVSYVKEVHVDVYGHRFTLAKGRRVLVDGLRVTPPVFMSGVYIQLS-GSYVVLETDFNLVVRFDGNHHVEIVVPGEYAGQLCGICGNFNGDGSDDNLKPDGSAAASSNELGNSWRVFNSSDDDCQDGTGEIPP--CDENDKDVYESDSFCGIIIDDEGAFKECHAVLPPQVFFDNCVFDLCATD--GDHGSLCQALQAYADQCAQAGVIVTWRNNTFCPFPCEPGSHYESCAPPCPATC----SNASLPGGCNQQCAEGCVCDDGFVLSGDKCVPVELCGCLDFDNQYHPLGESWFESGNCSRRCTCLGAGDVHCEDWECEEHEVCSVEDGILDCYAREPGDCVITGDPHYIT 901          

HSP 6 Score: 137.887 bits (346), Expect = 1.166e-32
Identity = 118/462 (25.54%), Postives = 187/462 (40.48%), Query Frame = 2
Query: 2783 CQKTCTNLDLVCPKGQCQLPGCFCPENTVLHNGECIKPFECPCYMNNKMYSENDTIVRGPANCQNPCICKDG------KWVCEQNKQCS-------------GICKTWGETHYESFDGKYFEFQGSCSY--VISEDFCGNKLGTFKLISEN-IACGXXXXXCTKSIKFIYLNRVFQFVRGSNPIVSRNTNYPPGGPTAFYWTSDVDTHFILFTMEGIQVKWDKAMSLEIMIPEKYQNKVCGLCGNFDLRIDNDMRARSGEIEKDIVNFADSWKVHSSCP------VPQKPPFMCSKRPDREPWAKAKCEIL--KSDSFKKCHDVVNVEHYYKRCVADACECDRGDDCVCFCTAVEQYVARCNEYEIGLKWRTNENCPHTCTGKRVWKNCGNICPDSCIDIGKNVTDNTGCKKVCIEGCFCPDGLHWQNNECVERKACECVDPITNLKYNTGDKVIRECEECN 4078
            C  TC+N +      Q    GC C +  VL   +C+   +C C  NN  Y           +C   CIC +        WVCE ++ C              G C   G+ HY +FD     F G C+Y   I  +        F + + N    GS++ S  K +        F   +G   +V      PP   +  Y      ++ +L T   + V++D    +EI++P +Y  ++CG+CGNF+    +D     G          +SW+V +S          + PP  C +       +   C I+     +FK+CH V+  + ++  CV D C    G D    C A++ Y  +C +  + + WR N  CP  C     +++C   CP +C     N     GC + C EGC C DG     ++CV    C C+D   N  Y+   +   E ++C+
Sbjct:   14 CPATCSNANPPAGCNQQCAEGCVCDDGFVLSGDKCVPTDQCGCLDNNGHYHPIGESWFESQDCSQRCICVNPGNVNCEAWVCEDDETCGVEDGILGCHGSAPGDCVITGDPHYITFDKTTHHFMGECTYTAAIPCNQSSTLPPHFNVETTNEFRGGSTAVSYVKEVHVDVYGHRFTLAKGRRVLVDGLRVTPPFFMSGVYIQLS-GSYVVLETDFNLVVRFDGNHHVEIVVPGEYAGQLCGICGNFNGDGSDDNLKPDGSAAASSSELGNSWRVFNSSDDDCQDDTGEIPP--CDENDKNLYESDTFCGIITDPEGAFKECHAVLPPQIFFDNCVFDLCA--TGGDHGSLCQALQAYADQCAQAGVIVTWRNNTFCPFPCEPGSHYESCAPPCPATC----SNANPPAGCNQQCAEGCVCDDGFVLSGDKCVPTDQCGCLD--NNGHYHPIGESWFESQDCS 464          

HSP 7 Score: 105.145 bits (261), Expect = 1.091e-22
Identity = 108/464 (23.28%), Postives = 186/464 (40.09%), Query Frame = 2
Query: 2747 CPKSMAWFDCG-ICQKTCTNL--DLVCPKGQCQLPGCFCPENTVLHNGECIKPFECPCYMNNKMYSENDTIVRGPANCQNPCICK-DGKWVCEQN--------------KQCSGI----CKTWGETHYESFDGKYFEFQGSCSYVISEDFCG--NKLGTFKLISENIACGXXXXXCTKSIKFIYLNRVFQFVRGSNPIVSRNTNY--------PPGGPTAFYWTSDVDTHFILFTMEGIQVKWDKAMSLEIMIPEKYQNKVCGLCGNFDLRIDNDMRARSGEIEKDIVNFADSWKVHSSCPVPQKPPFMCSKRPDREP------------WA----KAKCEILK--SDSFKKCHDVVNVEHYYKRCVADACECDRGDDCVCFCTAVEQYVARCNEYEIGL-KWRTNENCPHTCTGKRVWKNCGNICPDSCIDIGKNVTDNTGCKKVCIEGCFCPDGLHWQNNEC 3985
            CP +  +  C   C  TC+++  +  C        GC C +  VL +  C+    C C+ +   Y   +       NC+  C+C   G   CE +              + C  +    C   G+ HY++FD + + F G  +Y + +  CG  N L   +++ +N   G        + +  +L+ V+ +V G     +   ++        PP  P             +L T  G+ V +D+    ++ IP  Y  +VCGLCGN +    ++ +   G +      F +SW+V+      ++  F  SKR   EP            WA    K+ C +    +  F +C     V+ YY  C+ D CE + GD  + FC+++E Y + C +  I    WR    C   C    ++    + CP +C D+      ++ C+   +EGC C  G      +C
Sbjct: 1169 CPPNTHYTPCASPCPATCSDIYAEDGCQSAARCAEGCVCDQGFVLSDDLCVSLEACGCWDDENNYHSFEEAWLS-DNCKRKCVCSVPGNASCEAHSCVEHESCQLNNGKESCQPVSYSTCSISGDPHYQTFDKRLYHFMGRETYTLVQS-CGDNNNLLPIRILGKNKRVG-------HNHRVSFLDAVYIYVYGFKIKFTDRKDFELNGVRTKPPSNPKEGLEIVHTSHKMVLRTDFGLTVIFDRKSHADVTIPSSYAGQVCGLCGNSNGDKSDEFKTPDGSLVTSEDVFGNSWEVND-----RRSLFEQSKRLVEEPRNDLNLSCSDEQWAELENKSSCGVFHDPAGPFVQCWIPAPVDPYYTNCMYDMCE-NIGDKEL-FCSSLEVYTSACQQEGITPNNWRIYTGCAQQCAAHNIYVERMSACPSTCGDLAA----SSNCELPDVEGCQCMPGFVMSGFDC 1612          

HSP 8 Score: 80.1073 bits (196), Expect = 5.180e-15
Identity = 84/332 (25.30%), Postives = 131/332 (39.46%), Query Frame = 2
Query:  446 TYYECSVIYGHHIKTFDGNVFSYPLRGGYTLFMDCLGAAPLFYVYFNASYDCFDQKTQNDCSISMKITVGTQTIILFPKNEFALVKNNKTKIPFNS-EGIIVSSVGSFIKIKGIDDLEILFDRDRNIYVYAPVTAEKKICGLCGYFNGIMSDDYRDFNQVIQKNVKTFVNSWIDRDPSDLNVYRER-EQYPCNALKLKNNDQYQKAL---TLCQDMVKNNLGR--TCQSEVKIDKYLDMCQDEICECLQTQPENSTIENCYSTFCKIEEQYSYACTLKGIAVDWRSATTICKQPQCFNGQEFSECGSNCGKNCGQLGMELECESQCLPGCYC 1420
            +Y  CS+    H +TFD  ++ +  R  YTL   C     L  +             +     ++ I V    I    + +F L    +TK P N  EG+ +      + ++    L ++FDR  +  V  P +   ++CGLCG  NG  SD+++  +  +  +   F NSW   D   L    +R  + P N L L  +D+    L   + C  +  +  G    C     +D Y   C  ++CE +  +            FC   E Y+ AC  +GI  +     T C Q QC     + E  S C   CG L     CE   + GC C
Sbjct: 1283 SYSTCSISGDPHYQTFDKRLYHFMGRETYTLVQSCGDNNNLLPIRILGKNKRVGHNHRVSFLDAVYIYVYGFKIKFTDRKDFEL-NGVRTKPPSNPKEGLEIVHTSHKMVLRTDFGLTVIFDRKSHADVTIPSSYAGQVCGLCGNSNGDKSDEFKTPDGSLVTSEDVFGNSWEVNDRRSLFEQSKRLVEEPRNDLNLSCSDEQWAELENKSSCG-VFHDPAGPFVQCWIPAPVDPYYTNCMYDMCENIGDK----------ELFCSSLEVYTSACQQEGITPNNWRIYTGCAQ-QCAAHNIYVERMSACPSTCGDLAASSNCELPDVEGCQC 1601          
BLAST of von Willebrand factor vs. Ensembl Nematostella
Match: EDO44199 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RWN6])

HSP 1 Score: 361.303 bits (926), Expect = 1.380e-101
Identity = 319/1191 (26.78%), Postives = 511/1191 (42.91%), Query Frame = 2
Query:  479 HIKTFDGNVFSYPLRGGYTLFMDCLGAAPLFYVYFNASYDCFDQKTQNDCSISMKITVGTQTIIL----FPKNEFALVKNNKTKIPFNSEGIIVSSVGSFIKIKGIDDLEILFDRDRNIYVYAP------VTAEKKICGLCGYFNGIMSDDY--RDFNQVIQKNVKTFVNSWIDRDPSDLNVYREREQYPCNALKLKNNDQY---QKALTLCQDMVKNNLGRTCQSEVKIDKYLDMCQDEICECLQTQPENSTIENCYSTFCKIEEQYSYACTL-KGIAVDWRSATTICKQPQCFNGQEFSECGSNCGKNCGQLGMEL-ECESQCLPGCYCPRNRYWDGTMCVPQEKCPCVRDNGESTYQQGYRLKLNCETCICGMHGKWQCIENEECEGRCFISGDPHYITFDRRHFFFDGHCEYTAVMTTSDNVLLSNSTIAPLSITIQNTNCQDNSETGCPRTIGVIIGEDEDQVAINLLSSSEIKVNFVKISLPYQHTGNTKVL-----IDQVSTDILRLKSETGVEILWNGGSRIEIKLSKKYREKVTGMCGNFNGNEMDDSMTFKGVDEKDIDKFVLSWKTNPTCESDR----GIVEYKGACALSRSYSDYANKVCHKLYE-SEEFKKCHSAANADKFFDQCTHDVCTCGMKRNGALDHCECEAFSSYARQCALENINL-SWR-TNELCPKK--CPNENMKYNQCGS-------RCTSTCRLLQ---ESKCKEECIEGCFC-PEGETFDEAAKECVKISDCKCEFHGRFYLPYEIRQDRCNNCTCTNGNWICTSNDCEGKEFCPKSMAWFDCGICQKTCTNLDLVCPKGQCQLPGCFCPENTVLH-NGECIKPFECPCYMNNKMYSENDTIVRGPANCQNPCICKDGKWVCEQNKQCSGI-------CKTWGETHYESFDGKYFEFQG-SCSYVISEDFCGNKLGTFKLISENIAC----------GXXXXXCTKSIKFIYLNRVFQFVRGSNPIVSRNTNYPPGGPTAFYWTSDVDTHFI----LFTMEGI-----------QVKWDKAMSLEIMIPEKYQNKVCGLCGNFDLRIDNDMRARSGEIEKDIVNFADSWKVHSSCPVPQKPPFMCSKRPDREPWAKAKCEILKSD-SFKKCHDVVNVEHYYKRCVADACECDRGDDCVCFCTAVEQYVARCNEYEIGLKWRTNENC 3820
            H  TFD   +S+     Y   +D      +F V  N   +C        C+ S+ + V  + + L      ++ F  V      +P+      +   G ++ ++  D++ I FD    + +  P       +++ ++ GLCG ++G  ++D+   D     + N+  F  S +D DP   N  +     P         D +   Q A  +C  +++++    C+S+V    +   C  ++C C      NST  +     C +   YS AC     I + WRS + +C    C +G E SEC S C ++C  +  +   C S+C+ GC+CP  +  D   CV   +C C        Y  G   K  C +C+C   G W C +   C G C + G+ H+ TFD R +   G C+Y      S++   SN T    +I I+                  I  +   Q+ ++L  ++ + +  V+ S P     N K       ++ +    + + +  G+ ILW G +   I +   ++ +  G+CG FN N+ DD  T  G +E D   F   W+   +  +         +    C+   S   YA   C+ + + +  FK CH        + +C  D C C          C C   ++YA+ CA + I +  WR T  +C  K  CP   +   QC         RC STC  L    ++     C+EGC+C  EGE  +   K CV  + C C +    Y   EIR+DRCNNCTC  G + CT+ DCE      + + + DCGI   TC NL  +    +  + GC+CP+  ++H NG C++  +C C  NNK Y   D     P +C   C   D  W     +Q +GI       C  +G+ HY +FDG  + F+   C Y   E          K++ +N+ C            + +   ++++ + + + F   R          +YPP  P   +  + ++T  I    LF +  I           ++++D+   + +M    Y+  V GLCGNFD +  ND R  +G I   I  FADSW+V S+C +  K    C   PDR+PWA   CE ++++ +F  CHD VN   Y + C  + C    G DC  FC+A+  YV  CN Y I + WR    C
Sbjct:  485 HFTTFDHQEYSFYGTCSYKALIDNSNVKQIFQVVLNNDKNC---DINAPCTKSVDVNVDGKKVHLGQEVASRHGFVKVDGVTENLPYTKSWPNIRQAGKYVIVRTSDEVLIYFDGSEELMIKVPDSYKTVNSSDTRLKGLCGNYDGNNTNDFIGLDGTTYTKDNINDFGVSMLD-DPLCTNPPKP----PSGCYSEVAGDVFSAMQNAEKMCS-VIQSDAFSACRSKVDFRDFKAQCIADVCAC------NSTSRS--DCMCNVLSTYSKACAWNHNITLSWRSPS-LCPV-TCPSGMEHSECSSACPRDCSNMNSDPNACNSKCVDGCFCPEGKIQDRGKCVDPGQCSCYHSG--IPYAHGAIRKSECSSCLCN-GGMWNCTDTP-CSGTCTMVGNSHFTTFDSRSYSMHGQCDYV----LSEHCHFSNDTTKQFTIHIK------------------ISSDGSRQLIVSLAGATPVTLGGVEGS-PTVLNSNGKATSHILSVEHIGVQNVLVHAYAGLTILWTGYNAY-ITVGPDFKSQTCGLCGTFNQNDADDFHTRDGDNEADAYAFAQEWQVVSSVAASNCHRSNWNQLDQPCSTYSSNEGYAKSGCNAIIDLNGPFKACHRYVPPQDMYQKCVKDGCMC--------KDCLCSVAAAYAKACADKGIVIDGWRDTISVCKPKFVCPAGTV-LKQCNRDPLTRKLRCPSTCDDLANVTDTCPSRRCVEGCYCEKEGELMNNEHK-CVDKTQCPCYYGDTMYKYGEIRKDRCNNCTCKGGVFDCTNVDCEAMCL-TRGLVYSDCGI---TCENLHPINGGERPCVSGCYCPDGLIMHDNGTCVQSMQCQCKHNNKYY---DAGAISPTDCSRKCR-GDRYW-----EQLAGIQAQPEYECSAFGKGHYRTFDGMLYNFESEGCGYTFMEH------EDVKVVVKNMKCVNSFELQMCKEVTITLVKENVEVVMMQKSFTLKRNGIDTAYNPGSYPP--PCKPFLNTYMNTLEIFQVGLFMIVRIVDRVNPNHIKFEIRFDQGTRVYVMANTDYKGTVQGLCGNFDGKDSNDKRTSTGSIATSIPEFADSWRVGSAC-LDTKTVSPCVLYPDRKPWADKGCEEIRANPNFTICHDAVNPAPYIEACKYETCMSHMGGDCGAFCSAIAAYVRACNRYGISILWRREGFC 1596          

HSP 2 Score: 161.384 bits (407), Expect = 1.525e-39
Identity = 118/400 (29.50%), Postives = 185/400 (46.25%), Query Frame = 2
Query: 1586 ECEGRCFISGDPHYITFDRRHFFFDGHCEYTAVMTTSDNVLLSNSTIAPLSITIQNTNCQDNSETGCPRTIGVIIGEDEDQVAINLLSSSE---IKVNFVKISLPYQHTGNTKVLIDQVSTDILRLKSETGVEILWNGGSRIEIKLSKKYR------EKVTGMCGNFNGNEMDDSMTFKGV--DEKDIDKFVLSWKTNPTCESDRGIVE--YKGACALSRSYSDYANKVCHKLYESEEFKKCHSAANADKFFDQCTHDVCTCGMKRNGALDHCECEAFSSYARQCAL-ENINLSWRTNELCPKKCPNENMKYNQCGSRCTSTCRLLQE--SKCKEECIEGCFCPEGETFDEAAKECVKISDCKCEFHGRFYLPYEIRQDRCNNCTCTNGNWICTSNDCEG 2737
            E  G C+ISG  H+ TFD + + F G C Y A        L+ NS +  +   + N +   N +   P T  V +  D  +V +    +S    +KV+ V  +LPY  +      I Q    ++ +++   V I ++G   + IK+   Y+       ++ G+CGN++GN  +D +   G    + +I+ F +S   +P C +        Y        S    A K+C  + +S+ F  C S  +   F  QC  DVC C    + +   C C   S+Y++ CA   NI LSWR+  LCP  CP+  M++++C S C   C  +    + C  +C++GCFCPEG+  D    +CV    C C   G  Y    IR+  C++C C  G W CT   C G
Sbjct:  473 EVPGLCYISGRGHFTTFDHQEYSFYGTCSYKA--------LIDNSNVKQIFQVVLNND--KNCDINAPCTKSVDVNVDGKKVHLGQEVASRHGFVKVDGVTENLPYTKSWPN---IRQAGKYVI-VRTSDEVLIYFDGSEELMIKVPDSYKTVNSSDTRLKGLCGNYDGNNTNDFIGLDGTTYTKDNINDFGVSMLDDPLCTNPPKPPSGCYSEVAGDVFSAMQNAEKMC-SVIQSDAFSACRSKVDFRDFKAQCIADVCAC---NSTSRSDCMCNVLSTYSKACAWNHNITLSWRSPSLCPVTCPS-GMEHSECSSACPRDCSNMNSDPNACNSKCVDGCFCPEGKIQDRG--KCVDPGQCSCYHSGIPYAHGAIRKSECSSCLCNGGMWNCTDTPCSG 851          

HSP 3 Score: 144.436 bits (363), Expect = 2.115e-34
Identity = 133/491 (27.09%), Postives = 200/491 (40.73%), Query Frame = 2
Query: 2747 CPKSMAWFDCG-ICQKTCTNL--DLVCPKGQCQLPGCFCPENTVLHNGECIKPFECPCYMNNKMYSENDTIVRGPANCQNPCICKDGKWVCEQNKQCSGICKTWGETHYESFDGKYFEFQGSCSYVISEDFCGNKLGTFKLISENIACGXXXXXCTKSIKFIYLNRVFQFVRGSNPIVSRNTNYPPGGPTAFYWTSDVDTHFI-----------LFTMEGIQVKWDKAMSLEIMIPEKYQNKVCGLCGNFDLRIDNDMRARSGEIEKDIVNFADSWKVHSSCPVPQ-------KPPFMCSKRPDREPWAKAKCEIL--KSDSFKKCHDVVNVEHYYKRCVADACECDRGDDCVCFCTAVEQYVARCNEYEIGLK-WRTNENC---PHTCTGKRVWKNCGN-------ICPDSCIDIGKNVTDNTGCKKVCIEGCFCPDGLHWQNNE--CVERKACECVDPITNLKYNTGDKVIRECEECNCYEGAFRCTKL 4111
            CP  M   +C   C + C+N+  D      +C + GCFCPE  +   G+C+ P +C CY +   Y+     +R  + C + C+C  G W C  +  CSG C   G +H+ +FD + +   G C YV+SE  C     T K  + +I            I      ++   + G+ P+         G PT         +H +           +    G+ + W    +  I +   ++++ CGLCG F+    +D   R G+ E D   FA  W+V SS            +    CS     E +AK+ C  +   +  FK CH  V  +  Y++CV D C C       C C+    Y   C +  I +  WR   +       C    V K C          CP +C D+  NVTD    ++ C+EGC+C       NNE  CV++  C C    T  KY  G+     C  C C  G F CT +
Sbjct:  759 CPSGMEHSECSSACPRDCSNMNSDPNACNSKC-VDGCFCPEGKIQDRGKCVDPGQCSCYHSGIPYAHG--AIR-KSECSS-CLCNGGMWNC-TDTPCSGTCTMVGNSHFTTFDSRSYSMHGQCDYVLSE-HCHFSNDTTKQFTIHI-----------KISSDGSRQLIVSLAGATPVTLGGVE---GSPTVLNSNGKATSHILSVEHIGVQNVLVHAYAGLTILW-TGYNAYITVGPDFKSQTCGLCGTFNQNDADDFHTRDGDNEADAYAFAQEWQVVSSVAASNCHRSNWNQLDQPCSTYSSNEGYAKSGCNAIIDLNGPFKACHRYVPPQDMYQKCVKDGCMCKD-----CLCSVAAAYAKACADKGIVIDGWRDTISVCKPKFVCPAGTVLKQCNRDPLTRKLRCPSTCDDLA-NVTDTCPSRR-CVEGCYCEKEGELMNNEHKCVDKTQCPCYYGDTMYKY--GEIRKDRCNNCTCKGGVFDCTNV 1218          

HSP 4 Score: 133.65 bits (335), Expect = 4.247e-31
Identity = 101/380 (26.58%), Postives = 161/380 (42.37%), Query Frame = 2
Query: 3032 GICKTWGETHYESFDGKYFEFQGSCSYVISEDFCGNKLGTFKLISENIACGXXXXXCTKSI------KFIYLNRVFQFVRGSNPI--VSRNTNYPPGGPTAFYWTSDVDTHFILFTMEGIQVKWDKAMSLEIMIPEKYQN------KVCGLCGNFDLRIDNDMRARSGEI--EKDIVNFADSWKVHSSCPVPQKPPFMCSKRPDREPW-----AKAKCEILKSDSFKKCHDVVNVEHYYKRCVADACECDRGDDCVCFCTAVEQYVARCN-EYEIGLKWRTNENCPHTCTGKRVWKNCGNICPDSCIDIGKNVTDNTGCKKVCIEGCFCPDGLHWQNNECVERKACECVDPITNLKYNTGDKVIRECEECNCYEGAFRCT 4105
            G+C   G  H+ +FD + + F G+CSY    D   N    F+++  N      ++ CTKS+      K ++L +      G   +  V+ N  Y    P           + I+ T + + + +D +  L I +P+ Y+       ++ GLCGN+D    ND     G    + +I +F  S      C  P KPP  C      + +     A+  C +++SD+F  C   V+   +  +C+AD C C+      C C  +  Y   C   + I L WR+   CP TC        C + CP  C ++    +D   C   C++GCFCP+G      +CV+   C C    + + Y  G     EC  C C  G + CT
Sbjct:  476 GLCYISGRGHFTTFDHQEYSFYGTCSYKALIDN-SNVKQIFQVVLNNDKNCDINAPCTKSVDVNVDGKKVHLGQEVASRHGFVKVDGVTENLPYTKSWPN----IRQAGKYVIVRTSDEVLIYFDGSEELMIKVPDSYKTVNSSDTRLKGLCGNYDGNNTNDFIGLDGTTYTKDNINDFGVSMLDDPLCTNPPKPPSGCYSEVAGDVFSAMQNAEKMCSVIQSDAFSACRSKVDFRDFKAQCIADVCACNSTSRSDCMCNVLSTYSKACAWNHNITLSWRSPSLCPVTCPSGMEHSECSSACPRDCSNMN---SDPNACNSKCVDGCFCPEGKIQDRGKCVDPGQCSCYH--SGIPYAHGAIRKSECSSCLCNGGMWNCT 845          

HSP 5 Score: 104.76 bits (260), Expect = 2.376e-22
Identity = 99/392 (25.26%), Postives = 162/392 (41.33%), Query Frame = 2
Query: 1343 SNCGKNCGQLGMELECESQCLPGCYCPRNRYW-DGTMCVPQEKCPCVRDNGESTYQQGYRLKLNCETCICGMHGKWQCIEN--EECEGRCFISGDPHYITFDRRHFFFDGH-CEYTAVMTTSDNVLLSNSTIAPLSITIQNTNCQDNSETGCPRTIGVIIGEDEDQVAINLLSSSEIKVNFVKISLPYQHTGNTKVLIDQVST-DILRL-----KSETGVEILWNGGSRIEIKLSKKYREKVTGMCGNFNGNEMDDSMTFKGVDEKDIDKFVLSWKTNPTCESDRGIVEYKGACALSRSYSDYANKVCHKLYESEEFKKCHSAANADKFFDQCTHDVCTCGMKRN-GALDHCECEAFSSYARQCALENINLSWRTNELCPKKCPNENMKYNQ 2485
            S+CG  C  L      E  C+ GCYCP      D   CV   +C C  +N    Y  G     +C    C     W+ +     + E  C   G  HY TFD   + F+   C YT +      V++ N      S  +Q   C++ + T     + V++ +    +  N + ++    ++     P+ +T    + I QV    I+R+      +    EI ++ G+R+ +  +  Y+  V G+CGNF+G + +D  T  G     I +F  SW+    C   + +      C L      +A+K C ++  +  F  CH A N   + + C ++ C   M  + GA     C A ++Y R C    I++ WR    C KK    NM  N+
Sbjct: 1232 SDCGITCENLHPINGGERPCVSGCYCPDGLIMHDNGTCVQSMQCQCKHNN--KYYDAGAISPTDCSR-KCRGDRYWEQLAGIQAQPEYECSAFGKGHYRTFDGMLYNFESEGCGYTFMEHEDVKVVVKNMKCVN-SFELQM--CKEVTITLVKENVEVVMMQKSFTLKRNGIDTAYNPGSYPPPCKPFLNTYMNTLEIFQVGLFMIVRIVDRVNPNHIKFEIRFDQGTRVYVMANTDYKGTVQGLCGNFDGKDSNDKRTSTGSIATSIPEFADSWRVGSACLDTKTV----SPCVLYPDRKPWADKGCEEIRANPNFTICHDAVNPAPYIEACKYETCMSHMGGDCGAF----CSAIAAYVRACNRYGISILWRREGFCGKKI---NMPMNK 1606          

HSP 6 Score: 67.3958 bits (163), Expect = 6.792e-11
Identity = 119/481 (24.74%), Postives = 182/481 (37.84%), Query Frame = 2
Query:  281 CVGGC-------SNGGKCVAPNQCLCLDNYSG-PNCNTLLIKSSQSDVSNYGAVTRVNNTMYSTYYECSVIYGHHIKTFDGNVFSYPLRGGYTLFMDCLGAAPLFYVYFNASYDCFDQKTQNDCSISMKITV-GTQTII--LFPKNEFALVKNNKTKIPFNSEGIIVSSVGSF-------IKIKGIDDLEILFDRDRNIYVYAPVTAEKKICGLCGYFNGIMSDDYRDFNQVIQKNVKTFVNSW-IDRDPSDLNVYRE---REQYPCNALKLKNNDQYQKALTLCQDMVK-NNLGRTCQSEVKIDKYLDMCQDEICECLQTQPENSTIENCYSTFCKIEEQYSYACTLKGIAVD-WRSATTICKQP-QCFNGQEFSECGSN-------CGKNCGQLGMELE-CES-QCLPGCYCPRNRYW--DGTMCVPQEKCPCVRDNGESTYQQGYRLKLNCETCICGMHGKWQCIENEECEGRCFISG 1615
            CV GC        + GKCV P QC C   +SG P  +  + KS  S     G +    +T  S    C+++   H  TFD   +S   +  Y L   C                 F   T    +I +KI+  G++ +I  L       L     +    NS G   S + S        + +     L IL+    N Y+      + + CGLCG FN   +DD+   +   + +   F   W +    +  N +R    +   PC+     +N+ Y K  + C  ++  N   + C   V        C  + C C          ++C    C +   Y+ AC  KGI +D WR   ++CK    C  G    +C  +       C   C  L    + C S +C+ GCYC +      +   CV + +CPC    G++ Y+ G   K  C  C C   G + C  N +CE  C   G
Sbjct:  790 CVDGCFCPEGKIQDRGKCVDPGQCSCY--HSGIPYAHGAIRKSECSSCLCNGGMWNCTDTPCSG--TCTMVGNSHFTTFDSRSYSMHGQCDYVLSEHCH----------------FSNDTTKQFTIHIKISSDGSRQLIVSLAGATPVTLGGVEGSPTVLNSNGKATSHILSVEHIGVQNVLVHAYAGLTILW-TGYNAYITVGPDFKSQTCGLCGTFNQNDADDFHTRDGDNEADAYAFAQEWQVVSSVAASNCHRSNWNQLDQPCST--YSSNEGYAK--SGCNAIIDLNGPFKACHRYVPPQDMYQKCVKDGCMC----------KDC---LCSVAAAYAKACADKGIVIDGWRDTISVCKPKFVCPAGTVLKQCNRDPLTRKLRCPSTCDDLANVTDTCPSRRCVEGCYCEKEGELMNNEHKCVDKTQCPCYY--GDTMYKYGEIRKDRCNNCTC-KGGVFDCT-NVDCEAMCLTRG 1228          
BLAST of von Willebrand factor vs. Ensembl Nematostella
Match: EDO41877 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S313])

HSP 1 Score: 207.608 bits (527), Expect = 3.097e-59
Identity = 125/333 (37.54%), Postives = 179/333 (53.75%), Query Frame = 2
Query: 2843 GCFCPENTVLHN-GECIKPFECPCYMNNKMYSENDTIVRGPANCQNPCICKDGKWVCEQNKQCSGICKTWGETHYESFDGKYFEFQGSCSYVISEDFC-GNKLG--TFKLISENIACGXXXXXCTKSIKFIYLNRVFQFVRG-SNPIVSRNTNYPPGGPTAFYWTSDVDTHFILFTMEGIQVKWDKAMSLEIMIPEKYQN--KVCGLCGNFDLRIDNDMRARSGEIEKDIVNFADSWKVHSSCPVPQKPPFMCSKRPDREPWAKAKCEILKSDSFKKCHDVVNVEHYYK--RCVADACECDRGDDCVCFCTAVEQYVARCNEYEIGLKWRTNE 3814
            GC CP  +VL + G CI   ECPC+ N K Y  +D I R   +C N C C    W C + K+C   C  +G+ HY++FDG+ + FQG C+YV+S D C G+KL   +F++ +ENI CGS+  +CTKS+     + +   VRG + P V++ ++  P    A Y       + I+    G+ V WD+   L I +    Q+  KVCGLCGNFD  + ND  A++G  E     F D+W+    C    +P   C +   RE  + A C I+KS +FK CH  V+ + YY+  RCV D C CD   DC C C A+  Y   C    + +KWR ++
Sbjct:   13 GCVCPVGSVLDDFGRCILETECPCHHNGKSYKTDDVIRR---DC-NTCTCVRNTWECTK-KRCRATCTAFGDPHYKTFDGRLYSFQGGCNYVMSTDKCPGSKLTLQSFRIDAENIPCGSAGVTCTKSVTVTLHDTIIHMVRGKAVPSVTKVSSLSP--VHARYELVYAGLYVIIKAPFGLNVIWDRGTRLYIELSPDSQHWSKVCGLCGNFDGDMTNDYMAKNGITETSPYPFGDTWRARGDCTKTMEPIHPCKQNKHRESKSHAACAIIKSGTFKPCHISVDPDPYYERCRCVYDTCGCDSVGDCECTCEAIAAYAYECLAAGVVVKWRQDK 338          

HSP 2 Score: 129.028 bits (323), Expect = 3.447e-32
Identity = 100/350 (28.57%), Postives = 163/350 (46.57%), Query Frame = 2
Query: 1400 CLPGCYCPRNRYWDG-TMCVPQEKCPCVRDNGESTYQQGYRLKLNCETCICGMHGKWQCIENEECEGRCFISGDPHYITFDRRHFFFDGHCEYTAVMTTSDNVLLSNSTIAPLSITIQNTNCQDNSETGCPRTIGVIIGEDEDQVAINLLSSSEIKVNFVKISLPYQHTGNTKVLIDQVSTDILRLKSETGVEILWNGGSRIEIKLS--KKYREKVTGMCGNFNGNEMDDSMTFKGVDEKDIDKFVLSWKTNPTCESDRGIVEYKGACALSRSYSDYANKVCHKLYESEEFKKCHSAANADKFFDQCTHDVCTCGMKRNGALDHCECEAFSSYARQCALENINLSWRTNE 2440
            C  GC CP     D    C+ + +CPC   NG+S Y+    ++ +C TC C +   W+C + + C   C   GDPHY TFD R + F G C Y  VM+T D    S  T+    I  +N  C     T C +++ V + +    +       S  KV+    SL   H     V         + +K+  G+ ++W+ G+R+ I+LS   ++  KV G+CGNF+G+  +D M   G+ E     F  +W+    C      +E    C  ++     ++  C  + +S  FK CH + + D ++++C     TCG    G  + C CEA ++YA +C    + + WR ++
Sbjct:   10 CKSGCVCPVGSVLDDFGRCILETECPC-HHNGKS-YKTDDVIRRDCNTCTC-VRNTWECTK-KRCRATCTAFGDPHYKTFDGRLYSFQGGCNY--VMST-DKCPGSKLTLQSFRIDAENIPCGSAGVT-CTKSVTVTLHDTIIHMVRGKAVPSVTKVS----SLSPVHARYELVYAGL----YVIIKAPFGLNVIWDRGTRLYIELSPDSQHWSKVCGLCGNFDGDMTNDYMAKNGITETSPYPFGDTWRARGDCTK---TMEPIHPCKQNKHRESKSHAAC-AIIKSGTFKPCHISVDPDPYYERCRCVYDTCGCDSVGDCE-CTCEAIAAYAYECLAAGVVVKWRQDK 338          

HSP 3 Score: 76.6406 bits (187), Expect = 1.379e-14
Identity = 66/277 (23.83%), Postives = 118/277 (42.60%), Query Frame = 2
Query:  458 CSVIYGHHIKTFDGNVFSYPLRGGYTLFMD-CLGAAPLFYVYFNASYDCFDQKTQNDCSISMKITVGTQTIILFPKNEFALVKNNKTKIPFNSEGIIVSSVGSFIKIKGIDDLEILFDRDRNIYVYAPVTAE--KKICGLCGYFNGIMSDDYRDFNQVIQKNVKTFVNSWIDRDPSDLNVYREREQYPCNALKLKNNDQYQKALTLCQDMVKNNLGRTCQSEVKIDKYLDMCQDEICECLQTQPENSTIENCYSTFCKIEEQYSYACTLKGIAVDWR 1279
            C+     H KTFDG ++S+     Y +  D C G+      +   + +         C+ S+ +T+    I +        V    +  P ++   +V + G ++ IK    L +++DR   +Y+     ++   K+CGLCG F+G M++DY   N + + +   F ++W  R   D     E   +PC     +N  +  K+   C  ++K+   + C   V  D Y      E C C+       ++ +C  T C+    Y+Y C   G+ V WR
Sbjct:   74 CTAFGDPHYKTFDGRLYSFQGGCNYVMSTDKCPGSKLTLQSFRIDAENIPCGSAGVTCTKSVTVTLHDTIIHMVRGKAVPSVTKVSSLSPVHARYELVYA-GLYVIIKAPFGLNVIWDRGTRLYIELSPDSQHWSKVCGLCGNFDGDMTNDYMAKNGITETSPYPFGDTW--RARGDCTKTME-PIHPCK----QNKHRESKSHAACA-IIKSGTFKPCHISVDPDPYY-----ERCRCVYDTCGCDSVGDCECT-CEAIAAYAYECLAAGVVVKWR 335          
BLAST of von Willebrand factor vs. Ensembl Nematostella
Match: EDO41876 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S312])

HSP 1 Score: 188.348 bits (477), Expect = 3.911e-52
Identity = 130/392 (33.16%), Postives = 193/392 (49.23%), Query Frame = 2
Query: 1595 GRCFISGDPHYITFDRRHFFFDGHCEYTAVMTTSDNVLLSNSTIAPLSITIQNTNCQDNSETGCPRTIGVIIGEDEDQV--AINLLSS-SEIKVNFVKISLPYQHTGNTKVLIDQVSTDILRLKSETGVEILWNGGSRIEIKLSKKYREKVTGMCGNFNGNEMDDS-MTFKGVDEKDIDKFVLSW---KTNPTCESDRGIVEYKGACALSRSY-SDYANKVCHKLYESEEFKKCHSAANADKFFDQCTHDVCTCGMKRNGALDHCECEAFSSYARQCALENINLSWRTNELCPKKCPNENMKYNQCGSRCTSTCRL--LQESKCKEECIEGCFCPEGETFDEAAKECVKISDCKCEFHGRFYLPYEIRQDRCNNCTCTNGNWICTSNDCEGK 2740
            G C   G  HY TFD RH  F G C YT      D +  S+      S+ +QN     ++   C R + + IGE   +V   ++L+SS   I+VN  K+S PY+   +T V + +V +  +       + I ++G S I++ +S KYR    G+CGN NG   DD  M         + +F  SW   + N  CES   +   +  C+ + S   D A ++C  L  SE F  CH+  +   F  +C  DVC+C   + G    C+C+A + Y+R CA   I L WR+  LCPK+C    + Y++CG  C  TC    LQ + C E CI+GC CPEG    +    C+ ++ C C+ +G  Y+     +  CN C C  G+W C+ + C GK
Sbjct:    2 GACSTWGQRHYRTFDGRHIDFIGKCSYTLAQ---DCIPGSDQ----FSLHVQNDKTCGSAGMDCERALLLYIGEKTYKVRWLVHLISSHGAIRVNGAKVSAPYK---DTNVEVSKVHSYTIIRSQGDELGIKFDGASSIQVAVSHKYRNNTCGLCGNNNGIPDDDLLMAVTNKPATSVAEFAESWAMPEPNEKCESPLEVT--RDVCSNASSVIRDAAKRICMVLL-SENFSACHTKVDPVPFVKRCEEDVCSC---KFGEHSGCQCQALTEYSRACASREIMLDWRSQHLCPKQCIQPKV-YSECGPACVKTCDADGLQPT-CHETCIDGCHCPEGTV--QTDNRCLPVNQCPCQHNGITYVTGTTIRVGCNTCKCRGGSWTCSKHRCPGK 373          

HSP 2 Score: 166.392 bits (420), Expect = 1.292e-44
Identity = 113/374 (30.21%), Postives = 180/374 (48.13%), Query Frame = 2
Query: 3032 GICKTWGETHYESFDGKYFEFQGSCSYVISEDFCGNKLGTFKL-ISENIACGXXXXXCTKSIKFIYLNRVFQFVRGSNPIVSRNTNYPPGGP--TAFYWTSDVDTH----FILFTMEG--IQVKWDKAMSLEIMIPEKYQNKVCGLCGNFDLRIDNDM-RARSGEIEKDIVNFADSWKV---HSSCPVPQKPPF-MCSKRPDR-EPWAKAKCEILKSDSFKKCHDVVNVEHYYKRCVADACECDRGDDCVCFCTAVEQYVARCNEYEIGLKWRTNENCPHTCTGKRVWKNCGNICPDSCIDIGKNVTDNTGCKKVCIEGCFCPDGLHWQNNECVERKACECVDPITNLKYNTGDKVIRECEECNCYEGAFRCTK 4108
            G C TWG+ HY +FDG++ +F G CSY +++D C      F L +  +  CGS+   C +++  +Y+      VR    ++S +      G   +A Y  ++V+      + +   +G  + +K+D A S+++ +  KY+N  CGLCGN +   D+D+  A + +    +  FA+SW +   +  C  P +    +CS         AK  C +L S++F  CH  V+   + KRC  D C C  G+   C C A+ +Y   C   EI L WR+   CP  C   +V+  CG  C  +C   G   T    C + CI+GC CP+G    +N C+    C C      + Y TG  +   C  C C  G++ C+K
Sbjct:    2 GACSTWGQRHYRTFDGRHIDFIGKCSYTLAQD-CIPGSDQFSLHVQNDKTCGSAGMDCERAL-LLYIGEKTYKVRWLVHLISSHGAIRVNGAKVSAPYKDTNVEVSKVHSYTIIRSQGDELGIKFDGASSIQVAVSHKYRNNTCGLCGNNNGIPDDDLLMAVTNKPATSVAEFAESWAMPEPNEKCESPLEVTRDVCSNASSVIRDAAKRICMVLLSENFSACHTKVDPVPFVKRCEEDVCSCKFGEHSGCQCQALTEYSRACASREIMLDWRSQHLCPKQCIQPKVYSECGPACVKTCDADGLQPT----CHETCIDGCHCPEGTVQTDNRCLPVNQCPCQH--NGITYVTGTTIRVGCNTCKCRGGSWTCSK 367          

HSP 3 Score: 134.42 bits (337), Expect = 1.263e-33
Identity = 111/400 (27.75%), Postives = 171/400 (42.75%), Query Frame = 2
Query:  458 CSVIYGHHIKTFDGNVFSYPLRGGYTLFMDCLGAAPLFYVYFNASYDCFDQKTQNDCSISMKITVGTQT------IILFPKNEFALVKNNKTKIPFNSEGIIVSSVGSFIKIKGI-DDLEILFDRDRNIYVYAPVTAEKKICGLCGYFNGIMSDDYRDFNQVIQK---NVKTFVNSWIDRDP-----SDLNVYREREQYPCNALKLKNNDQYQKALTLCQDMVKNNLGRTCQSEVKIDKYLDMCQDEICECLQTQPENSTIENCYSTFCKIEEQYSYACTLKGIAVDWRSATTICKQPQCFNGQEFSECGSNCGKNCGQLGMELECESQCLPGCYCPRNRYWDGTMCVPQEKCPCVRDNGESTYQQGYRLKLNCETCICGMHGKWQCIENEECEGRCFIS 1612
            CS     H +TFDG    +  +  YTL  DC+  +  F ++      C       DC  ++ + +G +T      + L   +    V   K   P+    + VS V S+  I+   D+L I FD   +I V          CGLCG  NGI  DD      V  K   +V  F  SW   +P     S L V R+      + ++         A  +C  ++  N    C ++V    ++  C++++C C     E+S  +      C+   +YS AC  + I +DWRS   +C + QC   + +SECG  C K C   G++  C   C+ GC+CP         C+P  +CPC + NG  TY  G  +++ C TC C   G W C     C G+  ++
Sbjct:    4 CSTWGQRHYRTFDGRHIDFIGKCSYTLAQDCIPGSDQFSLHVQNDKTCGSAGM--DCERALLLYIGEKTYKVRWLVHLISSHGAIRVNGAKVSAPYKDTNVEVSKVHSYTIIRSQGDELGIKFDGASSIQVAVSHKYRNNTCGLCGNNNGIPDDDL--LMAVTNKPATSVAEFAESWAMPEPNEKCESPLEVTRDVCSNASSVIR-------DAAKRICMVLLSENFS-ACHTKVDPVPFVKRCEEDVCSC--KFGEHSGCQ------CQALTEYSRACASREIMLDWRSQH-LCPK-QCIQPKVYSECGPACVKTCDADGLQPTCHETCIDGCHCPEGTVQTDNRCLPVNQCPC-QHNG-ITYVTGTTIRVGCNTCKC-RGGSWTC-SKHRCPGKPHVT 377          
BLAST of von Willebrand factor vs. Ensembl Nematostella
Match: EDO33061 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7ST99])

HSP 1 Score: 134.42 bits (337), Expect = 3.586e-34
Identity = 95/299 (31.77%), Postives = 140/299 (46.82%), Query Frame = 2
Query: 1571 CIENEECEGRCFISGDPHYITFDRRHFFFDGHCEYTAVMTTSDNVLLSNSTIAPLSITIQNTNCQDNSETGCPRTIGVIIGEDEDQVAINLLSSSEIKVNFVKISLPYQHTGNTKVLIDQVSTDILRLKSETGVEILWNGGSRIEIKLSKKYREKVTGMCGNFNGNEMDDSMTFKGVDEKDIDKFVLSW-----KTNPTCESDRG--IVEYKGACALSRSYSDYANKVCHKLYESEEFKKCHSAANADKFFDQCTHDVCTCGMKRNGALDHCECEAFSSYARQCALENINLSWRTNELC 2446
            CIE  E  G C   GDPHY TFD R F F G+C Y          L+++      S+ +++     N   G  +++ V IG       I+L     +KV+  ++ LPYQ   + +  ID+    ++ L SETGV+I+W+G S IE+ +S +YR    G+CGNFNG   DD M   G   +   +F  SW     +  P  +      I E    C  S  +   A K C  +    +F  CH      K++  C  +VC C +KR      CECE+  +YAR C    +N++W   + C
Sbjct:   47 CIECVEDMGICTSYGDPHYQTFDGRMFNFHGNCRYR---------LVADCRQGNFSVRLRSER-HHNQAVGEAKSLVVHIGS----TVIHLQRGLVVKVDRKEVQLPYQRLPSLQ--IDR-KNFMITLLSETGVKIIWDGESYIEVHVSHRYRGNTCGLCGNFNGVPSDDFMMKNGRYARSDREFGKSWSLGGHRRRPCLQRAPSPPIAEPISKCRRSALHHWRARKRCWPI--KSQFSNCHPVVKPHKYYKACISEVCKCLVKR------CECESLVTYARACRRMGVNVNWGRKKAC 320          

HSP 2 Score: 107.071 bits (266), Expect = 8.248e-25
Identity = 76/276 (27.54%), Postives = 117/276 (42.39%), Query Frame = 2
Query: 3032 GICKTWGETHYESFDGKYFEFQGSCSYVISEDFCGNKLGTFKLISE---NIACGXXXXXCTKSIKFIYLNRVFQFVRGSNPIVSRNTNYPPGGPTAFYWTSDVDTHFILFTMEGIQVKWDKAMSLEIMIPEKYQNKVCGLCGNFDLRIDNDMRARSGEIEKDIVNFADSWKV--HSSCP----VPQKP---PFMCSKRPDREPW-AKAKCEILKSDSFKKCHDVVNVEHYYKRCVADACECDRGDDCVCFCTAVEQYVARCNEYEIGLKWRTNENC 3820
            GIC ++G+ HY++FDG+ F F G+C Y +  D C     + +L SE   N A G       KS+     + V    RG    V R     P            +    L +  G+++ WD    +E+ +  +Y+   CGLCGNF+    +D   ++G   +    F  SW +  H   P     P  P   P    +R     W A+ +C  +KS  F  CH VV    YYK C+++ C+C       C C ++  Y   C    + + W   + C
Sbjct:   55 GICTSYGDPHYQTFDGRMFNFHGNCRYRLVAD-CRQGNFSVRLRSERHHNQAVGE-----AKSLVVHIGSTVIHLQRGLVVKVDRKEVQLPYQRLPSLQIDRKNFMITLLSETGVKIIWDGESYIEVHVSHRYRGNTCGLCGNFNGVPSDDFMMKNGRYARSDREFGKSWSLGGHRRRPCLQRAPSPPIAEPISKCRRSALHHWRARKRCWPIKSQ-FSNCHPVVKPHKYYKACISEVCKCLVKR---CECESLVTYARACRRMGVNVNWGRKKAC 320          

HSP 3 Score: 69.3218 bits (168), Expect = 3.071e-12
Identity = 64/279 (22.94%), Postives = 112/279 (40.14%), Query Frame = 2
Query:  479 HIKTFDGNVFSYPLRGGYTLFMDCLGAAPLFYVYFNASYDCFDQKTQNDC---SISMKITVGTQTIILFPKNEFALVKNNKTKIPFNS-EGIIVSSVGSFIKIKGIDDLEILFDRDRNIYVYAPVTAEKKICGLCGYFNGIMSDDYRDFNQVIQKNVKTFVNSWIDRDPSDLNVYRER---EQYPCNALK------LKNNDQYQKALTLCQDMVKNNLGRTCQSEVKIDKYLDMCQDEICECLQTQPENSTIENCYSTFCKIEEQYSYACTLKGIAVDW 1276
            H +TFDG +F++     Y L  DC           N S     ++  N     + S+ + +G+ T+I   +     V   + ++P+     + +      I +     ++I++D +  I V+         CGLCG FNG+ SDD+   N    ++ + F  SW       L  +R R   ++ P   +        ++   + +A   C   +K+     C   VK  KY   C  E+C+CL  + E           C+    Y+ AC   G+ V+W
Sbjct:   64 HYQTFDGRMFNFHGNCRYRLVADCRQG--------NFSVRLRSERHHNQAVGEAKSLVVHIGS-TVIHLQRGLVVKVDRKEVQLPYQRLPSLQIDRKNFMITLLSETGVKIIWDGESYIEVHVSHRYRGNTCGLCGNFNGVPSDDFMMKNGRYARSDREFGKSW------SLGGHRRRPCLQRAPSPPIAEPISKCRRSALHHWRARKRCWP-IKSQFS-NCHPVVKPHKYYKACISEVCKCLVKRCE-----------CESLVTYARACRRMGVNVNW 314          
BLAST of von Willebrand factor vs. Ensembl Nematostella
Match: EDO49603 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RFH4])

HSP 1 Score: 48.9062 bits (115), Expect = 2.981e-7
Identity = 25/60 (41.67%), Postives = 34/60 (56.67%), Query Frame = 2
Query: 2477 YNQCGSRCTSTC-RLLQESKCKEECIEGCFCPEGETFDEAAKECVKISDCKCEFHGRFYL 2653
            Y+ CG+ C  TC  L  + +C EEC  GCFCP G   D   K CV  + C C++ G+ +L
Sbjct:    6 YSSCGTMCPWTCTNLYDDDECPEECNRGCFCPRGMVVDRNGK-CVLATRCGCKYEGKMFL 64          
BLAST of von Willebrand factor vs. Ensembl Medaka
Match: vwf (von Willebrand factor [Source:NCBI gene;Acc:101162365])

HSP 1 Score: 545.043 bits (1403), Expect = 2.210e-159
Identity = 372/1291 (28.81%), Postives = 580/1291 (44.93%), Query Frame = 2
Query:  455 ECSVIYGHHIKTFDGNVFSYPLRGGYTLFMDCLGAAPLFYVYFNASYDCFDQKTQNDCSISMKITVGTQTIILFPKNEFALVKNNKTKIPFNSEGIIVSSVGSFIKIKGID-DLEILFDRDRNIYVYAPVTAEKKICGLCGYFNGIMSDDYRDFNQVIQKNVKTFVNSWIDRDPSDLNVYREREQYPCNALKLKNNDQYQKALTLCQDMVKNNLGRTCQSEVKIDKYLDMCQDEICECLQTQPENSTIENCYSTFCKIEEQYSYACTLKGIAVDWRSATTICKQPQCFNGQEFSECGSNCGKNCGQLGMELECESQCLPGCYCPRNRYWDGTMCVPQEKCPCVRDNGESTYQQGYRLKLNCETCICGMHGKWQCIENEECEGRCFISGDPHYITFDRRHFFFDGHCEYTAVMTTSDNVLLSNSTIAPLSITIQNTNCQDNSETGCPRTIGVIIGEDEDQVAINLLSSSEIKVNFVKISLPYQHTGNTKVLIDQVSTDILRLKSETGVEILWNGGSRIEIKLSKKYREKVTGMCGNFNGNEMDDSMTFKGVDEKDIDKFVLSWKTNPTCESDRGIVEY-KGACALSRSYSDYANKVCHKLYESEEFKKCHSAANADKFFDQCTHDVCTCGMKRNGALDHCECEAFSSYARQCALENINLSWRTNELCPKKCPNENMKYNQCGSRCTSTCRLLQ--ESKCKEE--CIEGCFCPEGETFDEAAKECVKISDCKCEFHGRFYLPYEIRQDRCNNCTCTNGNWICTSNDCEG------------------KEFCPKSMAWFDCGI------CQKTCTNLDLVCPKGQCQLPGCFCPENTVLHNGECIKPFECPCYMNNKMYSENDTIVRGPANCQNPCICKDGKWVCEQNKQCSGICKTWGETHYESFDGKYFEFQGSCSYVISEDFCGNKLGTFKLISENIACGXXXXXCTKSIKFIYLNRVFQFVRGSNPIVSRNTNYPPGGPTAFYWTSDVDTHFILFTMEGIQVKWDKAMSLEIMIPEKYQNKVCGLCGNFDLRIDNDMRARSGEIEKDIVNFADSWKVHSSCPVPQKPPFMCSKRPDREPWAKAKCEILKSDSFKKCHDVVNVEHYYKRCVADACECDRGDDCVCFCTAVEQYVARCNEYEIGLKWRTNENCPHTC---------TGKRV--WK--NCGNICPDSCIDIGKNVTDNTGCKKVCIEGC--FCPDGLHWQNNECVERKACECVDPI-------TNLKYNTGDKVIRE------CEECNCYEGAFRCTKLFSKECLHTSRPEIS 4153
             CS+   +H+ TFDG ++ +P    Y L  DC   +      F+           N     + + +G    +    + F   +  +  +P+ S  +   S   F K+   +    +  D   NI +        + CGLCG FN + +D+Y     ++ ++   F NSW  +               CN+ K       +  L+ C  +  + +   C   V  + +L +CQ E C C Q       +E+CY   C I  +Y+  C   GI +      + C  P+C  G ++SEC  +C   C  L ++  C+ +C+ GC CP  +  DG  CV   +C C        +  G  +  +C TC+C  HG W+C  NE C G C + G  H+ +FD + F F G C+Y       +N           S+ I+N  C DN +  C R++ + +   E+ + + L     + VN + I  P  H G+  + I +     +RL     + + W+G  R+ +KL+ ++  +  G+CGN+NGN+ DD M+  G+ E     F  +WK N  CES     +Y    CA++     +A + C  +  S+ F  CH   N   F   C +DVC CG   +G  + C C A ++YA  C+ + + ++WR+  LC  +C    + Y  CG+ C  TC  L   E+ C+ E  C EGCFCP G+    +  +CV    C C   G+ Y P ++  D  + C C NG+  C+S++                        CP  +   +CG       C +TC NLDL C    C +PGC CP +TV H  +CI P +CPCY NN+ Y+   TI     +C N C+C++ KW C Q K C G+C++ GE HY +FDG  F F G C YV+ +D C  + G+F+++ EN ACG     C K++   Y   +     G    V+     P         +      + L   + I + WD+   L + I   Y+ +VCGLCGNFD  ++ND  + + ++E D  +F +SWKV  SC    + P  CS    +    +  C ++    FK+C+  V+ E Y + CV  AC C    DC CFC  V  Y   C+E  I + WR+N+ CP +C          G+ +  W+   CG  CP +C        +   C   C+E C  +CP G      + ++  A  CV+P           + + G+KVI        C+ C+C   +  C    S   L T  P  S
Sbjct:   26 RCSLFGRYHVHTFDGVLYEFPGDCSYLLAGDCSHRSFTLLGDFH-----------NGKRTGVTLFLGDAFELHLSVDGFLSQREKRLTLPYASHAVFAGSELGFYKLWSEEFGFTVTIDNAANIALTLSKHHANRTCGLCGNFNAVTADEYTAQEGLLTEDSYDFANSWAVKGADQSCRRVSNPSKSCNSTK-----GTEAILSSCSVLKTSGVFLHCAHLVPPEAFLLLCQAEACHCNQRD-----VEDCY---CPILLEYARTCHAHGILLHGWLEESKC-YPKCPIGMQYSECTKSCSTTCHSLNIQEVCKDECMDGCTCPAGKVLDGNRCVEVSECSCTHMGRH--FPPGSTVSQDCNTCVC-RHGSWECT-NEGCPGECLVVGQSHFKSFDNKFFTFTGDCQYLLAKDCVNN---------EFSVIIENVQCADNQDAVCTRSVTLSLPSLEN-MTVKLKHGGVVSVNNMDIQTPM-HYGH--LHIQRAVQSSVRLVFSDDLRLDWDGQGRVLLKLTARWTGQTCGLCGNYNGNQGDDFMSDSGLVETKPQAFGQAWKINGDCESTH---KYDPDPCAINPKRVRFAEEAC-AVIMSDVFSPCHILVNPSPFQRFCRYDVCACG---DG--EKCLCSALAAYAASCSAKGVLVNWRSALLCELECSGGQV-YEACGTVCDRTCLSLSGAEAGCEGEKVCEEGCFCPVGKYLSPSG-QCVTADLCPCLHDGQLYQPNDVYADHTSICYCENGSMRCSSSEVPSLLSDLFYDEDLGSTRERRSAHCPPPLVRTECGSGKKGLECARTCQNLDLPCVSLSC-IPGCLCPPDTVRHRRDCIAPEQCPCYHNNRPYAAGQTIT---TDC-NTCVCENRKWRCTQ-KLCDGVCRSVGEGHYITFDGLKFSFPGLCQYVLVQDMCLGEEGSFRVLVENEACGIVGRRCAKAVTVFYQGGLIVMQHGE---VTMKKPVPQSSQVEIIRSGQF---YTLLLGKHISLSWDRGTRLLVHISAAYRGRVCGLCGNFDGNVNNDFMSSNNQLEVDSSHFGNSWKVIPSCADVTQIPLPCSDNIMKLVTVEQSCRLMSGPLFKECNTQVDAEPYVEMCVEAACSCPSVGDCACFCDVVAAYAQACSERGISISWRSNDLCPMSCEELNPKISGVGEELCQWRYNTCGPACPITC-----QHPEPLQCSFTCVEACHAYCPPG------QLLDEVAMRCVNPSQCQMCVHNGQRISHGNKVILNHDNPALCKICHCENNSLSCEDCTSLSMLSTPTPTPS 1240          

HSP 2 Score: 135.576 bits (340), Expect = 4.148e-31
Identity = 103/385 (26.75%), Postives = 159/385 (41.30%), Query Frame = 2
Query: 1595 GRCFISGDPHYITFDRRHFFFDGHCEYTAVMTTSDNVLLSNSTIAPLSITIQNTNCQDNSETGCPRTIGVIIGEDEDQVAINLLSSSEIKVNFVKISLPYQHTGNTKVLIDQVSTDILRLKSET-GVEILWNGGSRIEIKLSKKYREKVTGMCGNFNGNEMDDSMTFKGVDEKDIDKFVLSWKTNPTCESDRGIVEYKGACALSRSYSDYANKVCHKLYESEEFKKCHSAANADKFFDQCTHDVCTCGMKRNGALDHCECEAFSSYARQCALENINL-SWRTNELCPKKCPNENMKYNQCGSRCTSTCRLLQ-ESKCKEECIEGCFCPEGETFDEAAKECVKISDCKCEFHGRFYLPYEIRQDRCNNCTCTNGNWICTSNDCEGK 2740
            GRC + G  H  TFD   + F G C Y      S             S T+   +  +   TG    +G       D   ++L     +     +++LPY     +  +         +L SE  G  +  +  + I + LSK +  +  G+CGNFN    D+    +G+  +D   F  SW      +S R +     +C  ++  ++     C  L  S  F  C      + F   C  + C C  +    ++ C C     YAR C    I L  W     C  KCP   M+Y++C   C++TC  L  +  CK+EC++GC CP G+  D     CV++S+C C   GR + P       CN C C +G+W CT+  C G+
Sbjct:   25 GRCSLFGRYHVHTFDGVLYEFPGDCSYLLAGDCSHR-----------SFTLLG-DFHNGKRTGVTLFLG-------DAFELHLSVDGFLSQREKRLTLPYA----SHAVFAGSELGFYKLWSEEFGFTVTIDNAANIALTLSKHHANRTCGLCGNFNAVTADEYTAQEGLLTEDSYDFANSWAVKGADQSCRRVSNPSKSCNSTKG-TEAILSSCSVLKTSGVFLHCAHLVPPEAFLLLCQAEACHCNQRD---VEDCYCPILLEYARTCHAHGILLHGWLEESKCYPKCPI-GMQYSECTKSCSTTCHSLNIQEVCKDECMDGCTCPAGKVLD--GNRCVEVSECSCTHMGRHFPPGSTVSQDCNTCVCRHGSWECTNEGCPGE 379          

HSP 3 Score: 108.227 bits (269), Expect = 7.727e-23
Identity = 113/451 (25.06%), Postives = 187/451 (41.46%), Query Frame = 2
Query:  182 TKSCSPDC----VNGVCKD---GRCSCSLG--WQGNRCSDPICVGGCSNGGKCVAPNQCLCLDNYSGPNCNTLLIKSSQSDVSNYGAVTRVNNTMYSTYYECSVIYGHHIKTFDGNVFSYPLRGGYTLFMDCLGAAPLFYVYFNASYDCFDQKTQNDCSISMKITVGTQTIILFPKNEFALVKNNKTKIPFNSEGI-IVSSVGSFIKIKGIDDLEILFDRDRNIYVYAPVTAEKKICGLCGYFNGIMSDDYRDFNQVIQKNVKTFVNSW-IDRDPSDLNVYREREQYPCNALKLKNNDQYQKALTLCQDMVKNNLGRTCQSEVKIDKYLDMCQDEICECLQTQPENSTIENCYSTFCKIEEQYSYACTLKGIAVDWRSATTICKQPQCFNGQEFSECGSNCGKNCGQL-GMELECESQ--CLPGCYCPRNRYWDGT-MCVPQEKCPCVRDN 1489
            TKSCS  C    +  VCKD     C+C  G    GNRC + +    C++ G+   P   +  D      CNT + +    + +N G              EC V+   H K+FD   F++     Y L  DC+     F V         +Q      S+++ +       +         V N   + P +   + I  +V S +++   DDL + +D    + +        + CGLCG +NG   DD+   + +++   + F  +W I+ D    + Y   +  PC      N  + + A   C  ++ +++   C   V    +   C+ ++C C          E C    C     Y+ +C+ KG+ V+WRSA  +C+  +C  GQ +  CG+ C + C  L G E  CE +  C  GC+CP  +Y   +  CV  + CPC+ D 
Sbjct:  297 TKSCSTTCHSLNIQEVCKDECMDGCTCPAGKVLDGNRCVE-VSECSCTHMGRHFPPGSTVSQD------CNTCVCRHGSWECTNEGCPG-----------ECLVVGQSHFKSFDNKFFTFTGDCQYLLAKDCVNNE--FSVIIENVQCADNQDAVCTRSVTLSLPSLENMTVKLKHGGVVSVNNMDIQTPMHYGHLHIQRAVQSSVRLVFSDDLRLDWDGQGRVLLKLTARWTGQTCGLCGNYNGNQGDDFMSDSGLVETKPQAFGQAWKINGDCESTHKY---DPDPCAI----NPKRVRFAEEACA-VIMSDVFSPCHILVNPSPFQRFCRYDVCAC-------GDGEKC---LCSALAAYAASCSAKGVLVNWRSA-LLCEL-ECSGGQVYEACGTVCDRTCLSLSGAEAGCEGEKVCEEGCFCPVGKYLSPSGQCVTADLCPCLHDG 707          

HSP 4 Score: 97.0561 bits (240), Expect = 1.880e-19
Identity = 112/436 (25.69%), Postives = 180/436 (41.28%), Query Frame = 2
Query:  311 CVAPNQCLCLDNYSGPNCNTLLIKSSQSDVSNYGAVTRVNNTMYSTYYEC-----SVIYGHHIKTFDGNVFSYPLRGGYTLFMD-CLGAAPLFYVYFNASYDCFDQKTQNDCSI-----SMKITVGTQ-TIILFPKNEFALVKNNKTKIPFNSEGIIVSSVGSFIKIKGIDDLEILFDRDRNIYVYAPVTAEKKICGLCGYFNGIMSDDYRDFNQVIQKNVKTFVNSWIDRDPSDLNVYREREQYPCNALKLKNNDQYQKALTLCQD--MVKNNLGRTCQSEVKIDKYLDMCQDEICECLQTQPENSTIENCYSTFCKIEEQYSYACTLKGIAVDWRSATTICKQPQCFN------GQE-----FSECGSNCGKNCGQLGMELECESQCLPGC--YCPRNRYWD--GTMCVPQEKCPCVRDNGESTYQQGYRLKLN 1531
            C+AP QC C  N            + Q+  ++       N     T   C     SV  GH+I TFDG  FS+P    Y L  D CLG    F V                C I     +  +TV  Q  +I+    E  +    K  +P +S+  I+ S G F  +     + + +DR   + V+       ++CGLCG F+G +++D+   N  ++ +   F NSW    PS  +V +         + L  +D   K +T+ Q   ++   L + C ++V  + Y++MC +  C C        ++ +C + FC +   Y+ AC+ +GI++ WRS        +  N      G+E     ++ CG  C   C Q    L+C   C+  C  YCP  +  D     CV   +C     NG+     G ++ LN
Sbjct:  812 CIAPEQCPCYHNNRP-------YAAGQTITTDCNTCVCENRKWRCTQKLCDGVCRSVGEGHYI-TFDGLKFSFPGLCQYVLVQDMCLGEEGSFRVLVE----------NEACGIVGRRCAKAVTVFYQGGLIVMQHGEVTM----KKPVPQSSQVEIIRS-GQFYTLLLGKHISLSWDRGTRLLVHISAAYRGRVCGLCGNFDGNVNNDFMSSNNQLEVDSSHFGNSW-KVIPSCADVTQ---------IPLPCSDNIMKLVTVEQSCRLMSGPLFKECNTQVDAEPYVEMCVEAACSC-------PSVGDC-ACFCDVVAAYAQACSERGISISWRSNDLCPMSCEELNPKISGVGEELCQWRYNTCGPACPITC-QHPEPLQCSFTCVEACHAYCPPGQLLDEVAMRCVNPSQCQMCVHNGQR-ISHGNKVILN 1204          

HSP 5 Score: 76.6406 bits (187), Expect = 2.907e-13
Identity = 112/479 (23.38%), Postives = 179/479 (37.37%), Query Frame = 2
Query: 1586 ECEGRCFISGDPHYITFDRRHFFFDGH--CEYTAVMTTSDNVLLSNSTIAPLSITIQNTNCQDNSETG--CPRTIGVIIGEDEDQVAINLLSSSEIKVNFVKISLPYQHTGNTKVLIDQVSTDILRLKSETGVEILWNGGSRIEIKLS---KKYREKVTGMCGNFNGNEMDDSMTFKGVDEKDIDKFVLSWKTNPTCESDRGI-VEYKGACALSRSYSDYANKVCHKLYESEEFKKCHSAANADKFFDQCTHDVCTCGMKRNGALDHCECEAFSSYARQCALENINLSWRTNELCPKKCPNENMKYNQCGSRCTSTCRLLQE-------SKCKEECI----EGCFCPEGETFDEAAKECVKISDCK--CEFHGRFYLPYE---IRQDRCNNCTCTNGNWI-CTSNDCEGKEFCPKSMAWFDCGICQKT--------CTNLDLVCPKGQCQL---PGCFCPENTVLHN-GECIKPFECPC 2911
            EC   C  S   H + FD      DG   C YT +   SD+   S        + +    CQ+ +     C + + V  G  +    + L       ++  +++LP++  G   +    V   +L+LKS  G  + +   S  E  ++        +  G+CG     +++      G    +   F+  W    T   + G+ +  + +  LS      A   C  L+ SE F  CH+      F  +C    C          +   CE  S+YAR C    + + WR+  LCP KCP+ +M+Y+ C + C   C  +Q        ++  E C+    EGCFC  G         CV    C    + HG  Y   +     ++ C  C C +   I CT+  C         +   +CG C+          C   + VC    C L   P C   +  +L N G+C    EC C
Sbjct: 1963 ECPCMCMGSSTNHVVRFDSLALRLDGEGLCSYTLLTVNSDSGEGSE-------VKLHTGPCQETTSYNQICMKAMEVTHGPHK----LILRDDMRAMIDREELALPWRFYGMELMRYGGV---MLQLKSNQGYMLTFTPQSN-EFTITFQGSTNSAQTAGLCGACGEEKVNILSLRNGSSTTNQPAFISDW----TAAGEDGVCLPKRQSVCLSG-----AAMGCQALH-SEVFLPCHAFIPVQIFLTKCEEQACE---------ESDACEVISAYARLCRQRGVCVDWRSPHLCPLKCPS-SMEYDACRTGCVEDCDSIQALPSDWSVARSNESCMDTPTEGCFCAGGTVLHHG--RCVSPEACGQCVDQHGHTYTHMQSWVPDENPCLICMCLDQQRINCTARPC-------NDVKAPECGACEILRERKGSMCCPEYECVCDLVNCALPEVPQCVDGQTLLLKNPGDCQPIHECVC 2397          

HSP 6 Score: 62.3882 bits (150), Expect = 5.607e-9
Identity = 52/205 (25.37%), Postives = 75/205 (36.59%), Query Frame = 2
Query: 3428 KVCGLCGNFDLRIDNDMRARSGEIEKDIVNFADSWKVHSSCPV--PQKPPFMCSKRPDREPWAKAKCEILKSDSFKKCHDVVNVEHYYKRCVADACECDRGDDCVCFCTAVEQYVARCNEYEIGLKWRTNENCPHTCTGKRVWKNCGNICPDSCIDIGKNVTD------NTGCKKVCIEGCFCPDGLHWQNNECVERKAC-ECVD 4015
            +  GLCG       N +  R+G    +   F   W       V  P++     S        A   C+ L S+ F  CH  + V+ +  +C   ACE          C  +  Y   C +  + + WR+   CP  C     +  C   C + C  I    +D      N  C     EGCFC  G    +  CV  +AC +CVD
Sbjct: 2104 QTAGLCGACGEEKVNILSLRNGSSTTNQPAFISDWTAAGEDGVCLPKRQSVCLSG-------AAMGCQALHSEVFLPCHAFIPVQIFLTKCEEQACEESDA------CEVISAYARLCRQRGVCVDWRSPHLCPLKCPSSMEYDACRTGCVEDCDSIQALPSDWSVARSNESCMDTPTEGCFCAGGTVLHHGRCVSPEACGQCVD 2295          
BLAST of von Willebrand factor vs. Ensembl Medaka
Match: scospondin (SCO-spondin [Source:NCBI gene;Acc:101172449])

HSP 1 Score: 436.802 bits (1122), Expect = 5.486e-124
Identity = 335/1227 (27.30%), Postives = 526/1227 (42.87%), Query Frame = 2
Query:  680 KNEFALVKNNKTKIPFNSEGIIVSSVGSFIKIKGIDDLEILFDRDRNIYVYAPVTAEKKICGLCGYFNGIMSDDYRDFNQVIQKNVKTFVNSWIDRDPSDLNVYREREQYPCNALKLKNNDQYQKALTLCQDMVKNNLGRTCQSEVKIDKYLDMCQDEICECLQTQPENSTIENCYSTFCKIEEQYSYACTLKGIAVDWRSATTICKQPQCFNGQEFSECGSNCGKNC------GQLGMELECESQCLPGCYCPRNRYWDGTMCVPQEKCPCVRDNGESTYQQGYRLKLNCETCICGMHGKWQCIENEECEGRCFISGDPHYITFDRRHFFFDGHCEYTAVMTTSDNVLLSNSTIAPLSITIQNTNCQDNSETGCPRTIGVIIGEDEDQVAINLLSSSEIKVNFVKISLPYQHTGNTKVLIDQVSTDILRLKSETGVEILWN-GGSRIEIKLSKKYREKVTGMCGNFNGNEMDDSMTFKGVDEKDIDKFVLSWKTNPTCESDRGIVEYKGACALSRSYSDYANKVCHKLYESEEFKKCHSAANADKFFDQCTHDVCTCGMKRNGALDHCECEAFSSYARQCALENINLSWRTNELCPKKCPNENMKYNQCGSRCTSTCRLLQESKC---------KEECIEGCFCPEGETFDEAAKECVKISDCKCEFHGRFYLPYEIRQDRCNNCTCTNGNWICTSNDCEGKEFCPKSMAWFDCGICQKTCTNLD---------LVCPKGQCQLPGCFCPENTVLHNGECIKPFECPCYMNNKMYSENDTIVRGPANCQNPCICKDGKWVCEQNKQCSGICKTWGETHYESFDGKYFEFQGSCSYVISEDFCGNKLGTFKLISENIACGXXXXXCTKSIKFIYLNRVFQFVRGSNPIVSRNTNYPPGGPTAFYWTSDVDTHFI-LFTMEGIQVKWDKAMSLEIMIPEKYQNKVCGLCGNFDLRIDNDMRARSGEIEKDIVNFADSWKVHSSCPVPQ----KPPFMCSKRPDREPWAKAKCEILKSDSFKKCHDVVNVEHYYKRCVADACECDRGDDCVCFCTAVEQYVARCNEYEIGLKWRTNENCPHTCTGKRVWKNCGNICPDSCIDIGKNVTDNTGCKKV-CIEGCFCPDGLHWQNNECVERKACECVDPITNLKYNTGDKVIRECEECNCYEGAFRCTKLFSKECLHTSRPEISTKPPHCVNEYEFLCPNNFCARR---CNGIIECRDGEDE 4258
            KN + LV       P     I V  +G F+ ++    + + FD    +Y+           GLCG +N          N   + ++   V SW+ +D SD         + C+ ++  +    ++A ++C  +++N     C   V    Y+D C    C  L T+  +          C     Y+  C  + I + WR+ + +C +  C  GQ FS+C S+C  +C      G      +C  +C+ GC CP   +     C+  E CPC       TYQ G  ++  C TC+C   G+WQC   E C G+C + G     TFD++ +   G            + L     +   ++T+              +T+ V+       +A++  SSS I V                                 G  +LW+  G    I L      KV G+CG    ++ DD  T +G  E  +  F   + + P         +    C+       YA +VC  ++ +  F+KCH     + +F  C  +VC C ++R+     C C   ++YA+ CA E + + WR    CP +C    + + +CG  C  +C   Q             +  C+ GC CP G   D    +CV +S C C    + Y P  I Q+ CN C C +G + CT   C+  + CP S+  +    C  TC++LD         +  P  +  L GC CP+ T  H   C+ P ECPC+ N ++Y  N+TI +   +C N C+C+  +W C +   C G+C   G+ HY +FDG+ + F G C YV++ +      G F + +EN+ CGS+  +CTKS+ F   + +   +RG    V+      P   +    T +    F+ L +  G+ + WD  M + + +    + +V GLCGNFD   +ND     G +E     F +SWKV  SCP  +    + P +    P R  WAK +C +L  D F  CH  V  +HYY  CV D C CD G DC C CTA+  Y   CN   + ++WR+ E CP  C    +++ CG  C  SC  + ++      C+ + C+EGCFCP G     + C+    C C        +  G  + + C+ C+C EG ++C  +    C  +S P +         E EF C    C      C+   +C DG DE
Sbjct:  155 KNTWGLVHKITVLFPL---WISVHWLGDFVFVESGLGVRLKFDLINTVYLTVTAEHLAATRGLCGVYN----------NNPEEASLTETV-SWLQQDCSDA----AELGHSCDIVE--DLTLRRQAESVCHQLLENPFTH-CHFRVDPAAYIDTCLYLYCS-LPTRERDGGA-------CDTLATYARECAQQHIIIMWRTPS-LCGR-VCPRGQVFSDCVSSCPPSCASPHPPGPAATMAQCREECVGGCECPPGLFLHQGTCLKAEDCPCFHR--RLTYQPGDSIQQRCNTCVC-RSGQWQCT-GERCAGQCTLVGALQVTTFDKKKYSLQG-----------GDFLFQ---LLKCTVTVNGVR----------QTLPVV----SSDLAVHRASSSFILVQTF------------------------------GALVLWHLDGPFALIHLQPGLAHKVHGLCGTLTWSQHDDFTTPEGDVEMSVSAFAEKFISQPCTLPKAAPSD---PCSTYTQRISYAERVCSVIH-NPVFQKCHDVVEKEPYFRLCLSEVCACALQRS-----CHCTVLTAYAQHCAQEGVQVHWRNQTFCPVQCSGGQV-FRECGRTCGFSCFDWQHGWLCNDSSGEIGQRVCVPGCQCPTGLVQDHLG-QCVPVSLCPCVQDDKIYSPGTILQNNCNTCVCKHGAFNCTQEHCKSVQQCPGSLV-YSPRSCMLTCSSLDHQGQQQSSSVTKPSCREPLSGCVCPQGTFFHGDRCVLPDECPCHHNGQVYYTNETITK---DC-NTCVCQKRRWHCTR-LVCDGVCVATGDPHYVTFDGRRYSFLGDCQYVLATE----TSGLFSITAENVPCGSTGVTCTKSVTFSLGSTIIHLLRGKAVTVNGMPVTLPKSYSGSGLTLEKVGLFVSLSSRLGVTLMWDGGMRVYVHLAAHLRGQVGGLCGNFDEDTENDFTTHQGSVESTAEVFGNSWKVSPSCPDVENQDLQDPCL---NPHRVTWAKKRCAVLTQDLFSVCHTEVPFQHYYDWCVFDTCGCDSGGDCECLCTAIASYAEECNRRGVYVRWRSQELCPLQCEKGMIYEPCGPACSQSCPSVQQHSYSR--CEVLSCVEGCFCPAGTIHHGDGCILPLDCPCE--WEGSMFPPGTSITQRCQNCSCVEGLWQCEGV---ACPASSPPCL---------EAEFACATGRCIPSQWLCDNEDDCGDGSDE 1248          

HSP 2 Score: 108.997 bits (271), Expect = 4.638e-23
Identity = 106/430 (24.65%), Postives = 173/430 (40.23%), Query Frame = 2
Query:  299 NGGKCVAPNQCLCLDNYSGPNCNTLLIKSSQSDVSNYGAVTRVNNTMYSTYYECSVIYGHHIKTFDGNVFSYPLRGGYTLFMDCLGAAPLFYVYFNASYDCFDQKTQNDCSISMKITVGTQTIILFPKNEFALVKNNKTKIP--FNSEGIIVSSVGSFIKIKGIDDLEILFDRDRNIYVYAPVTAEKKICGLCGYFNGIMSDDYRDFNQVIQKNVKTFVNSWIDRDPSDLNVYREREQYPCNALKLKNNDQYQKALTLCQDMVKNNLGRTCQSEVKIDKYLDMCQDEICECLQTQPENSTIENCYSTFCKIEEQYSYACTLKGIAVDWRSATTICKQPQCFNGQEFSECGSNCGKNCGQLGME--LECES-QCLPGCYCPRNRYWDGTMCVPQEKCPCVRDNGESTYQQGYRLKLNCETCICGMHGKWQC 1573
            +G +CV P++C C  N      N  + K   + V       R + T       C      H  TFDG  +S+     Y L  +  G   LF +    + +     T   C+ S+  ++G+ TII   + +   V      +P  ++  G+ +  VG F+ +     + +++D    +YV+       ++ GLCG F+    +D+      ++   + F NSW    PS  +V  +  Q PC      N  +   A   C  ++  +L   C +EV    Y D C  + C C        +  +C    C     Y+  C  +G+ V WRS   +C   QC  G  +  CG  C ++C  +       CE   C+ GC+CP      G  C+    CPC  +   S +  G  +   C+ C C + G WQC
Sbjct:  806 HGDRCVLPDECPCHHNGQVYYTNETITKDCNTCVCQK---RRWHCTRLVCDGVCVATGDPHYVTFDGRRYSFLGDCQYVLATETSG---LFSI---TAENVPCGSTGVTCTKSVTFSLGS-TIIHLLRGKAVTVNGMPVTLPKSYSGSGLTLEKVGLFVSLSSRLGVTLMWDGGMRVYVHLAAHLRGQVGGLCGNFDEDTENDFTTHQGSVESTAEVFGNSW-KVSPSCPDVENQDLQDPC-----LNPHRVTWAKKRCA-VLTQDLFSVCHTEVPFQHYYDWCVFDTCGC-------DSGGDC-ECLCTAIASYAEECNRRGVYVRWRS-QELCPL-QCEKGMIYEPCGPACSQSCPSVQQHSYSRCEVLSCVEGCFCPAGTIHHGDGCILPLDCPCEWEG--SMFPPGTSITQRCQNCSC-VEGLWQC 1205          

HSP 3 Score: 97.4413 bits (241), Expect = 1.439e-19
Identity = 92/375 (24.53%), Postives = 145/375 (38.67%), Query Frame = 2
Query:  575 VYFNASYDCFDQKTQNDCSISMKITVGTQTIILFPKNEFAL---------------VKNNKTKIPFNSEGIIVS-SVGSFIKIKGIDDLEILFDRDRNIYVYAPVTAEKKICGLCGYFNGIMSDDYRDFNQVIQKNVKTFVNSWIDRD-------PSD-LNVYREREQYPCNALKLKNNDQYQKALTLCQDMVKNNLGRTCQSEVKIDKYLDMCQDEICECLQTQPENSTIENCYSTFCKIEEQYSYACTLKGIAVDWRSATTICKQPQCFNGQEFSECGSNCGKNC-------------GQLGMELECESQCLPGCYCPRNRYWDGT-MCVPQEKCPCVRDNGESTYQQGYRLKLNCETCICGMHGKWQCIENE 1585
            V  +  + C  ++    C++     VG   +  F K +++L               V   +  +P  S  + V  +  SFI ++    L +         ++       K+ GLCG       DD+      ++ +V  F   +I +        PSD  + Y +R  Y      + +N  +QK    C D+V+             + Y  +C  E+C C   +          S  C +   Y+  C  +G+ V WR+ T  C   QC  GQ F ECG  CG +C             G++G  +     C+PGC CP     D    CVP   CPCV+D  +  Y  G  L+ NC TC+C  HG + C +  
Sbjct:  416 VCRSGQWQCTGERCAGQCTL-----VGALQVTTFDKKKYSLQGGDFLFQLLKCTVTVNGVRQTLPVVSSDLAVHRASSSFILVQTFGALVLWHLDGPFALIHLQPGLAHKVHGLCGTLTWSQHDDFTTPEGDVEMSVSAFAEKFISQPCTLPKAAPSDPCSTYTQRISYAERVCSVIHNPVFQK----CHDVVEK------------EPYFRLCLSEVCACALQR----------SCHCTVLTAYAQHCAQEGVQVHWRNQT-FCPV-QCSGGQVFRECGRTCGFSCFDWQHGWLCNDSSGEIGQRV-----CVPGCQCPTGLVQDHLGQCVPVSLCPCVQD--DKIYSPGTILQNNCNTCVC-KHGAFNCTQEH 749          

HSP 4 Score: 58.9214 bits (141), Expect = 7.448e-8
Identity = 65/244 (26.64%), Postives = 100/244 (40.98%), Query Frame = 2
Query: 2441 LCP-KKCPNENMKYNQ-CGSRCTSTCR-LLQESKCKE-ECIEGCFCPEGETFDEAAKECVKISDCKCEF---HGRF-YLPYEIRQDRCNNCTCTNGNWICTSNDC------------------------------EG--------------KEFCPKSMAW---FDC-GICQKTCTNL--DLVCPKGQCQLPGCFCPENTVLHNGECIKPFECPCY-----MNNKMYSENDTIVRGPANCQNPC 2983
            LCP ++C +    Y Q C ++C  +C  L +  +C +  C  GC CPEG+   +    CV +++C+C     +G   + P E     CN C C NG  +CT + C                              EG              ++ CP   +W    DC G C  TC +L  +  C  G C  PGC CP   V + G C+   +CPC      M  + ++E+  +++  A  Q+ C
Sbjct: 3963 LCPGERCEDRERIYQQSCANQCPRSCTDLWEHVQCLQGACHSGCRCPEGQLLQDG--HCVPVAECRCGIPSGNGTLEFSPMEETTVDCNKCVCVNGTLLCTKHPCPVYDSWSSWSSCSVSCGLGRMTRTRTCEDTEGGPSCGETTQTESCRQQPCPDCPSWQVYSDCSGSCPYTCEDLWPNTQCLPGPC-TPGCTCPSGQVFYRGSCLDRADCPCSVLSLPMEFQSWNESSEVLQPGATVQHLC 4203          

HSP 5 Score: 53.1434 bits (126), Expect = 3.511e-6
Identity = 50/160 (31.25%), Postives = 70/160 (43.75%), Query Frame = 2
Query: 2468 NMKYNQCGSRCTSTCRLLQESKCKEECIEGCFCPEGETFDEAAKECVKISDCKC--EFHGRFYLPYEIRQDR--CNNCTCTNGNWICTSNDCEGKEFCPKSMAWFDCG---ICQKTCTNLDLVCPKGQCQLP-----GCFCPENTVLHNGECIKPFECPC 2911
               ++ CG  C  +C  L  + C+ +C  GC+C EG+     A  CV   +C C     G+   P EI + R  CNNCTC +G + CT      +E CP S  W +      C +TC   + V     C  P     G  CP    +HNG  ++    PC
Sbjct: 2698 GTAFSSCGPSCPRSCDDL--AHCEWKCEPGCYCSEGKVLSVNATVCVARENCPCLDLNTGQRLKPGEITRARDGCNNCTCVDGRFNCT------REACPVSGGWCEWSEWTSCSRTC-GAESVSRYRSCSCPEPKAGGDHCPGEQEMHNGVGVQIQRQPC 2848          

HSP 6 Score: 52.373 bits (124), Expect = 6.700e-6
Identity = 33/115 (28.70%), Postives = 60/115 (52.17%), Query Frame = 2
Query: 2450 KKCPNENMKYNQCGSRCTSTCRLLQES-KCK--EECIEGCFCPEGETFDEAAKECVKISDCKC-EFHGRFYLPYEIRQDRCNNCTCTNGNWICTSNDCEGKEFCPKSMAWFDCGI 2782
            K+CP  + +++ C S+C   C  LQ+  +C+   EC  GC CP+G+   +    CV++  C C +  G+ +      Q  CNNC+C++G  +C+++ C+         +W  C +
Sbjct: 3404 KRCP-ASQEFDPCASQCPQRCSDLQQGLQCQGDTECQPGCRCPKGQLQQDGL--CVEVWQCDCVDSAGQIWAAGSWHQVDCNNCSCSDGKLLCSNHSCQSACVWSSWSSWAQCSV 3515          
BLAST of von Willebrand factor vs. Ensembl Medaka
Match: otog (otogelin [Source:NCBI gene;Acc:101158818])

HSP 1 Score: 373.244 bits (957), Expect = 5.073e-104
Identity = 312/1227 (25.43%), Postives = 512/1227 (41.73%), Query Frame = 2
Query:  293 CSNGGKCVAPNQCLC-LDNYSGPNCNTLLIKSSQSDVSNYGAVTRVNNTMYSTYYECSVIYGHHIKTFDGNVFSYPLRGGYTLFMDCLGAAPLFYVYFNASYDCFDQKTQNDCSISMKITVGTQTIILFPKNEFALVKNNKT------KIPFNSEGIIVSSVGSFIKIKGIDDLEILFD-RDRNIYVYAPVTAEKKICGLCGYFNGIMSDDYRDFNQVIQKNVKTFVNSWIDRDPSDLNVYREREQYPCNALKLKNNDQYQKALTLCQDMVKNNLGRTCQSEVKIDKYLDMCQDEICECLQTQPENSTIENCYSTFCKIEEQYSY------------ACTL--KGIAVDWRSATTICKQPQCFNGQEFSECGSNCGKNCGQLGMELECESQCLPGCYCPRNRYWDGTMCVPQEKCPCVRDNGESTYQQGYRLKLNCETCICGMHGKWQCIENEECEGRCFISGDPHYITFDRRHFFFDGHCEYTAVMTTSDNVLLSNSTIAPLSITIQNTNCQDNSETGCPRTIGVIIGEDEDQVAINLLSSSEI-KVNFVKISLPYQHTGNTKVLIDQVSTDILRLKSETGVEILWNGGS-RIEIKLSKKYREKVTGMCGNFNGNEMDDSMTFKGVDEKDIDKFVLSWKTNPTCESDRGIVEYKGACALSRSYSDYANKVCHKLYESEEFKKCHSAANADKFFDQCTHDVCTCGMKRNGALDHCECEAFSSYARQCALENINLSWRTN-ELCPKKCPNENMKYNQCGSRCTSTCRLLQE-SKCKEECIEGCFCPEGETFDEAAKECVKISDCKCEFHGRFY----LPYEIRQDRCNNCTCTNGNWICTSNDCEGKEFCPKSMAWFDCG------------ICQKTCTN--LDLVCPKGQCQLPGCFCPENTVLHNGECIKPFECPCYMNNKMYSENDTIVRGPANCQNPCICKDGKWVCEQNKQCSGICKTWGETHYESFDGKYFEFQGSCSYVISEDFCGNKLGTFKLISENIACGXXXXXCTKSIKF---IYLNRVFQFVRGSNP--IVSRNTNYPPGGPTAFYWTSDVDTHFILFTMEGIQVKWDKAMSLEIMIPEKYQNKVCGLCGNFDLRIDNDMRARSGEIEKDIVNFADSWKVHS--SCPVPQKPPFMCSKRPDREPWAKAKCEILKSDSFKKCHDVVNVEHYYKRCVADACECDRGDDCVCFCTAVEQYVARCNEYEIGLKWRTNENC 3820
            C NGG+CV    C C L + +G  C T++                  N  +     C     ++ +TFDG  + +P R  YTL  D            + S+  F      +CS +      + +I L  + E  L  +N T      ++P +   + +  +  ++ +       + ++ R  ++Y+          CGLCG FN  + DD      ++  +V+ F NSW++ DP          Q  C  +       Y+      Q +                       +E+C  L + P     ++C+     +    SY             C      + +  RS       P C  G ++ EC S C   C      ++    CL GCYCP    +    CV    CPC  ++    Y  G  L+  C  C C + G W C ++  C G C ++GD  + +FD R F F   C+Y         VL+ +      ++TIQN  C  + +  C +++ +++ ED  +  + L    E+      +ISLPY    +    I ++S+  L++++  G+++ ++    R+ ++  +++++   G+CG FNGN  DD ++  G+ E     F  SWK +  C S   +      C   +    YA+ +C  L + + F  CH   +   F  QC  + C CG         C C   + YAR C   ++ + +R++   C   CP   M+Y+ C S C   C  L    +C EEC EGC CP+G  ++     CV  S C C   G  Y    LP ++         C+  ++         +  CP    + +C              C++TC +  L++ C      + GC CP   + H  EC +P  CPC    K Y   D   R  + C   C C+DG + C   + C  +C  +G+ HY +FDG  F++ G+C   + +    +    F + +EN+ C  +   C K +       L  +   +   NP  ++ RN          F W + + T  + F  E I V WD   ++ + +   +Q ++ GLCGNFDL+  N+MR            F +SW      + P  + P   CS  P REP+AK +C +L S+ F+ CH VV+V  +Y+ C+AD C C RG DC CFC++V  Y  RC    + + WR+   C
Sbjct:  124 CLNGGQCVQ-QSCDCSLYHATGLRCQTVV------------------NLGFEREMTCRTWGQYNFETFDGLYYYFPGRCSYTLLKDS-----------HISFFVFKVHNDPECSSAPYTCQRSVSIFLPWEGEIRLHASNVTFKGRRLQLPHHLHHLQLEQISQYVLVTQQQGFTLAWEGRTGSVYIKLSPDFVGGTCGLCGNFNAEVQDDMTTSYGLLTHDVEMFGNSWMEMDP---------HQNTCPPVGSSFPSPYRPFPVSVQRV-----------------------EEVCSMLLSPP----FQSCHDFVSPLPYMASYYWKKDYYRIFFGTCFFCDASLFLPPRSV------PPCPAGLQYRECISCCPATCSLERTCIDSRLACLDGCYCPDGLIFQDGGCVEASDCPC--EHHGVFYPAGQMLQEECNNCTC-VGGVWNCTDHS-CPGECSVTGDMFFQSFDGRIFTFPASCQY---------VLVKSRLSGKFTVTIQNAPCGPDLDGACIQSVSLVVDEDP-RTEMTLSHMGEVFMAGQYRISLPYY---DDVFHIQELSSMFLQVRTAFGLQLQYSWAEFRLYLQAEERWKDDTVGLCGTFNGNIQDDFLSPSGMIESTPQLFGNSWKVSSACSSSLSVSPID-PCDSHQQAVSYASSMCDVLNQ-DLFAACHDYLSPAPFHQQCRANTCRCGTP-------CLCSTLAHYARHCRKFSVIVDFRSHIPDCAVSCP-ATMEYSSCVSSCQRRCSSLAALQRCGEECEEGCACPQGSFYNHRTHTCVHRSQCPCSLFGADYEPGDLPAQLSWSLTGFLKCSGFSFFLP------ERLCPAGQLYQNCSDGDDAFLPGRGVACERTCESHLLNIPCSSHDSCVSGCVCPHGLLKHGDECFEPAACPCLWKGKEYFPGD---RVSSPCYQ-CACQDGTFQCA-FRPCPSMCTAYGDRHYRTFDGLLFDYVGACKVYLVK---SSADAVFSVTAENVDCFDTGVICKKYLLINVGASLLSLDDHMGKPNPSSVIDRNQRL-------FIWQAGLFT-VVHFPEEDITVLWDHKTTVHVQVGPHWQGRLSGLCGNFDLKTVNEMRTPENMDSPTPQEFGNSWTATECVNSPDIRHP---CSLNPLREPYAKHQCAVLLSEVFQTCHPVVDVSWFYENCLADTCACSRGGDCECFCSSVAAYAQRCCHEGVPVDWRSPSLC 1226          

HSP 2 Score: 147.902 bits (372), Expect = 6.054e-35
Identity = 117/463 (25.27%), Postives = 198/463 (42.76%), Query Frame = 2
Query: 2747 CPKSMAWFDCGIC-------QKTCTNLDLVCPKGQCQLPGCFCPENTVLHNGECIKPFECPCYMNNKMYSENDTIVRGPANCQNPCICKDGKWVCEQNKQCSGICKTWGETHYESFDGKYFEFQGSCSYVISEDFCGNKLGTFKLISENIACGXXX-XXCTKSIKFI------------YLNRVFQF--VRGSNPIVSRNTNYPPGGPTAFYWTSDVDTHFI-LFTMEGIQVKWDKA-MSLEIMIPEKYQNKVCGLCGNFDLRIDNDMRARSGEIEKDIVNFADSWKVHSSCPVPQK--PPFMCSKRPDREPWAKAKCEILKSDSFKKCHDVVNVEHYYKRCVADACECDRGDDCVCFCTAVEQYVARCNEYEIGLKWRTN-ENCPHTCTGKRVWKNCGNICPDSCIDIGKNVTDNTGCKKVCIEGCFCPDGLHW--QNNECVERKACECVDPITNLKYNTGD 4048
            CP  + + +C  C       ++TC +  L C      L GC+CP+  +  +G C++  +CPC  +   Y     +      C N C C  G W C  +  C G C   G+  ++SFDG+ F F  SC YV+ +       G F +  +N  CG     +C +S+  +            ++  VF     R S P                +   ++ + F+ + T  G+Q+++  A   L +   E++++   GLCG F+  I +D  + SG IE     F +SWKV S+C       P   C        +A + C++L  D F  CHD ++   ++++C A+ C C       C C+ +  Y   C ++ + + +R++  +C  +C     + +C + C   C  +         C + C EGC CP G  +  + + CV R  C C   +    Y  GD
Sbjct:  413 CPAGLQYRECISCCPATCSLERTCIDSRLAC------LDGCYCPDGLIFQDGGCVEASDCPCEHHGVFYPAGQMLQE---ECNN-CTCVGGVWNCT-DHSCPGECSVTGDMFFQSFDGRIFTFPASCQYVLVKSRLS---GKFTVTIQNAPCGPDLDGACIQSVSLVVDEDPRTEMTLSHMGEVFMAGQYRISLPYYDD-----------VFHIQELSSMFLQVRTAFGLQLQYSWAEFRLYLQAEERWKDDTVGLCGTFNGNIQDDFLSPSGMIESTPQLFGNSWKVSSACSSSLSVSPIDPCDSHQQAVSYASSMCDVLNQDLFAACHDYLSPAPFHQQCRANTCRCGTP----CLCSTLAHYARHCRKFSVIVDFRSHIPDCAVSCPATMEYSSCVSSCQRRCSSLAAL----QRCGEECEEGCACPQGSFYNHRTHTCVHRSQCPCS--LFGADYEPGD 840          

HSP 3 Score: 117.472 bits (293), Expect = 1.136e-25
Identity = 94/378 (24.87%), Postives = 158/378 (41.80%), Query Frame = 2
Query: 3038 CKTWGETHYESFDGKYFEFQGSCSYVISEDFCGNKLGTFKL-ISENIACGXXXXXCTKSIKFIYLNRVFQFVRGSNPIVSRNTNYPPGGPTAFYWTSDVDTHFILFTMEGIQVKWD-KAMSLEIMIPEKYQNKVCGLCGNFDLRIDNDMRARSGEIEKDIVNFADSW-----------KVHSSCPVPQKPPFMCSKRPDREPWAKAKCEILKSDSFKKCHDVVNVEHY---------YKRCVADACECDRGDDCVCFCTAVEQYVARCNEYEIGLKWRTNENCPHTCTGKRVWKNCGNICPDSCIDIGKNVTDNTGCKKVCIEGCFCPDGLHWQNNECVERKACECVDPITNLKYNTGDKVIRECEECNCYEGAFRCT 4105
            C+TWG+ ++E+FDG Y+ F G CSY + +D   + +  F   +  +  C S+  +C +S+  I+L    +    ++ +  +                 +  + ++   +G  + W+ +  S+ I +   +    CGLCGNF+  + +DM    G +  D+  F +SW            V SS P P +P  +  +R       +  C +L S  F+ CHD V+   Y         Y R     C          FC A            + L  R+   CP        ++ C + CP +C  + +   D+   +  C++GC+CPDGL +Q+  CVE   C C      + Y  G  +  EC  C C  G + CT
Sbjct:  161 CRTWGQYNFETFDGLYYYFPGRCSYTLLKD---SHISFFVFKVHNDPECSSAPYTCQRSVS-IFLPWEGEIRLHASNVTFKGRRLQLPHHLHHLQLEQISQYVLVTQQQGFTLAWEGRTGSVYIKLSPDFVGGTCGLCGNFNAEVQDDMTTSYGLLTHDVEMFGNSWMEMDPHQNTCPPVGSSFPSPYRPFPVSVQR------VEEVCSMLLSPPFQSCHDFVSPLPYMASYYWKKDYYRIFFGTC---------FFCDA-----------SLFLPPRSVPPCP----AGLQYRECISCCPATC-SLERTCIDS---RLACLDGCYCPDGLIFQDGGCVEASDCPCEH--HGVFYPAGQMLQEECNNCTCVGGVWNCT 498          

HSP 4 Score: 62.7734 bits (151), Expect = 4.833e-9
Identity = 57/240 (23.75%), Postives = 103/240 (42.92%), Query Frame = 2
Query: 3326 DVDTHFILFTMEGIQVKWDKAMSLEIMIPEKYQNKVCGLCGNFDLRIDNDMRARSGEI---EKDIVNFADSWKVHSSCPVPQKPPFMCSKRPDREPWAKAKCE----ILKSDSFKKCHDVVNVEHYYKRCVADACECDRGDDCVCFCTAVEQYVARCNEYEIGLKWRTNENCPHTCTGKRVWKNCGNICPDSCIDIGKNVTDNTGCKKVCIEGCFCPDG--LHWQNNE-CVERKACECVD 4015
            D    +++ +  G++++W  +  + ++I    +    GLCG  D    +D+   +G +    +D   F DSW+V ++     +     S+R D    + + C     +L++ +F  CH  V    + +  V D+   +        C A+  YVA C+++ I ++WR    CP  C     ++ C   C            D   C  +  EGC CP+G  LH Q +  C+  + C C D
Sbjct: 2218 DTGNMYLIRSPAGLKLQWYHSTGM-MVIETDSKVPTMGLCGVCDGDPTDDLTLPNGSVLGAGEDPALFIDSWQVSNTTSYISQ-----SRRRDLN-CSTSDCSTCLSMLENATFTACHAFVPPSTFCEVWVRDSEYVNNQ------CVALAAYVASCHKFNICIEWRRPNYCPFICAATLRYQACLPACTSQSCPNHDFDADPEQCSGL-TEGCVCPEGTLLHRQYSALCIPPEKCACTD 2443          

HSP 5 Score: 56.6102 bits (135), Expect = 3.850e-7
Identity = 83/374 (22.19%), Postives = 137/374 (36.63%), Query Frame = 2
Query: 1568 QCIENEECEGRCFISGDPHYITFDRRHFFFDGHCEYTAVMTTSDNVLLSNSTIAPLSITIQNTNCQDNSETGCPRT------IGVIIGEDEDQVAINLL------SSSEIKVNFVKISLPYQHTGNTKVLIDQVSTDILRLKSETGVEILWNGGSRIEIKLSKKYREKVTGMCGNFNGNEMDDSMTFKGV---DEKDIDKFVLSWKTNPTCESDRGIVEYKGACALSRSYSDYANKVCHKLYESEEFKKCHSAANADKFFDQCTHDVCTCGMKRNGALDHCECEAFSSYARQCALENINLSWRTNELCPKKCPNENMKYNQCGSRCTS-TCRLLQESKCKEEC---IEGCFCPEGETFD-EAAKECVKISDCKC 2629
            +C    +C  RC +  D + ITFD           Y           L N T+     T+    C  +SE+           + + I    + V IN L      ++   K  F K       TGN           +  ++S  G+++ W   + + + +    +    G+CG  +G+  DD     G      +D   F+ SW+ + T       +       L+ S SD +   C  + E+  F  CH+      F        C   ++ +  +++ +C A ++Y   C   NI + WR    CP  C    ++Y  C   CTS +C         E+C    EGC CPEG     + +  C+    C C
Sbjct: 2108 KCCPKWDCPCRCSMFPDLNVITFDGNSVAIYKAALYIVTQ-------LPNETV-----TVMVQECPADSESLLLWNFTNLCLVSLNITHQSNHVLINRLQRRLYVNTRYAKARFKKYGFEIYDTGN-----------MYLIRSPAGLKLQWYHSTGMMV-IETDSKVPTMGLCGVCDGDPTDDLTLPNGSVLGAGEDPALFIDSWQVSNT----TSYISQSRRRDLNCSTSDCST--CLSMLENATFTACHAFVPPSTF--------CEVWVRDSEYVNN-QCVALAAYVASCHKFNICIEWRRPNYCPFIC-AATLRYQACLPACTSQSCPNHDFDADPEQCSGLTEGCVCPEGTLLHRQYSALCIPPEKCAC 2441          
BLAST of von Willebrand factor vs. Ensembl Medaka
Match: FCGBP (Fc fragment of IgG binding protein [Source:NCBI gene;Acc:101155957])

HSP 1 Score: 270.396 bits (690), Expect = 3.248e-72
Identity = 297/1148 (25.87%), Postives = 470/1148 (40.94%), Query Frame = 2
Query:  740 IIVSSVGSFIKIKGIDDLEILFDRDRNIYVYAPVTAEKKICGLCGYFNGIMSDDYRDFNQVIQKNVKTFVNSW-IDRDPSDLNVYREREQYPCNALKLKNNDQYQKALTLCQDMVKNNLG--RTCQSEVKIDKYLDMCQDEICECLQTQPENSTIENCYSTFCKIEEQYSYACTLKGIAV-DWRSATTICKQPQCFNGQEFSECGSNCGKNCGQLGMELECESQCLPGCYCPRNRYWDGTMCVPQEKCPCVRDNGESTYQQGYRLKLNCET-CICGMHG-----KWQCIENEECE-------------GRCFISGDPHYITFDRRHFFFDGHCEYTAVMTTSDNVLLSNSTIAPLSITIQNTN---CQDNSETGCPRTIGVIIGEDEDQVAINLLSSSE---IKVNFVKISLPYQHTGNTKVLIDQVSTDILRLKSETGVEILWNGGSRIEIKLSKKYREKVTGMCGNFNGNEMDDSMTFKGVDEKDIDKFVLSWKT---NPTCESDRGIVEYKGACA-LSRSYSDYANK--VCHKLYESE-EFKKCHSAANADKFFDQCTHDVCTCGMKRNGALDHCECEAFSSYARQCALENINLS-WRTNELCPKKCPNENMKYNQCGSRCTSTCRLLQES-KCKEECIEGCFCPEGETFDEAAKECVKISDCKCEFHGRFYLPYEIRQDRCNNCTCTNGNWICTSNDCEGKEFCPKSMAWFDCGICQKTCTNLDLVCPKGQCQLPGCFCPENTVLHNGECIKPFECPCYMNNKMYSENDTIVRGPANCQNPCICKDGKWVCEQNKQCSGICKTWGETHYESFDGKYFEFQGSCSYVISEDFCG--NKLGTFKLISENIACGXXXXXCTKSIK-FIY-------LNRVFQFVRGSNPIVSRNTNYPPGGPTAFYWTSDVDTHFILFTMEGIQVKWDKAMSLEIMIPEKYQNKVCGLCGNFDLRIDNDMRARSGEIEKDIVNFADSW------KVHSSCPVPQKPPFMCSKRPDREPWAKAKCEILKSDS---FKKCHDVVNVEHYYKRCVADACECDRGDDCVCFCTAVEQYVARCNEYEIGLK-WRTNENCPHTCTGKRVWKNCGNICPDSCIDIGKNVTDNTGCKKVCIEGCFCPDGLHWQNNECVERKACEC 4009
            + V   G F  +     L++ F+     +V  P      +CGLCG +NG M DD    N         F  SW +   P  +    E  Q  C +  +    QY+K   LC  ++++  G  R C ++V    + + C  ++C            E      C+    Y+ AC   G+ V  WR+ +  C   +C     +  C S C  +C  L     C + C  GC C       G  CVP  +C C+ ++      + +     CE  C C   G     K++C  NE+C+             G C  SGDPHY +FD + F F G C Y      S +  + ++ +   S+ ++N      +   +    R + V +          L+  S+   + VN V  ++P  +  + +V + Q  T+ L + +  G+ + ++    + + +   YR+KV G+CGNFNG+  DD      +  KDI+ F  SWK    N  CE+     E    CA    ++ D  +K   C  L   +  F  CHS  +   +FD C  DVC      NG      C++ ++YA  C +  +N++ WRT   CP KCP  N  Y  C   CT +C  L +  +C E C EGC C  G  +D   + CVK ++C C   G+ Y P E+  +                                DC +         L+C +         CPE+T     + +K     CY  +     N  +       Q  C  + G+ VC    + +  C  WG+ HY +FDG  F+FQG+C Y+IS+  CG  N L  F +   N   G+++ S  + +  FIY        N+V Q       +   N  +  G      + S   +  ++ T  G+ V +D    L I +P  Y + VCGLCGNF+    ++++  SG+    ++ +  SW      K H      +K    C          +A C  L + +   FK C+  ++ + +   CV D C  ++GD  +  C A+  Y  +C +  I +K WR   NCP  C     +++C + C  SC    +  T    C   C+E C C +G       C+  K C C
Sbjct:  525 VSVYKSGWFAVVTTDFGLKVSFNWHSAAFVTLPSNYMGAVCGLCGNYNGNMQDDLTPKNGNTPVKPTDFGTSWRVAEIPGCI----EGCQGVCPSCDITQKVQYEKE-DLC-GIIRDTKGPFRDCHAKVDPAGFFEDCVYDVC----------MYEGRKDVLCQAVTAYTSACQGVGVNVYSWRT-SNFCAV-KCPIHSHYDICASACPASCEGLAPPPGCRAHCEEGCSCDEGYILSGDQCVPFSQCGCLYNDLYYRINEVFYPNGQCEEECKCTQDGEVTCKKFKCGPNEKCKIENGIQKCHPVGKGVCRASGDPHYTSFDGQKFDFQGTCTYV----LSKSCGVEDTHLEAFSVQVENVQWDRMKGKKKVSVTRLVAVEV------FGFTLIMKSKMFGVLVNGVLNNIPL-NLNDGEVQVYQEGTNYL-IATNFGLLVTYDLVYHVTVTVPGNYRDKVCGLCGNFNGDRKDDFQMPDQILAKDINVFGKSWKVAIPNVVCENGCQGNE----CADCDPAHKDVFSKPAYCGILTAPKGPFAVCHSKLDPQSYFDDCVFDVCA----SNGD-GKVLCDSVAAYAYNCHMAGVNVNDWRTPSFCPMKCP-ANSHYEVCAETCTYSCPGLSDMVQCPEACTEGCVCDAGFLYD--GQTCVKETECGCYDRGKTYKPGEVTYEE-------------------------------DCSLACSCNPATGLICEEYS-------CPEDTQCMIKKGVK----ECYNKDPCKDANCRV-------QETCRVEGGEAVCI--PKYTSTCWAWGDPHYHTFDGFDFDFQGTCKYIISKT-CGNLNGLVPFSITERNDNRGNAAVSFVREVDVFIYDYNITIRKNQVGQVTVNGELL---NLPFQLGDNEVSVFQS--GSSAVVETKFGLIVSYDWNWHLVIKLPSSYYSSVCGLCGNFNGDTGDELQNPSGKAVASVIEWGKSWQTPDQDKGHPCWDTCEKNCPTCDDDERELYKTQAFCGGLAAKTNSVFKICNSKLDPQAFMNNCVYDMC-LNKGDKRM-LCQALTSYNKQCRDEGIIIKDWRKEFNCPMNCQRFSHYEHCASPCQPSCPFPEQKQT----CSGACVEACVCDEGYVLSAGVCIPAKTCGC 1567          

HSP 2 Score: 197.978 bits (502), Expect = 3.947e-50
Identity = 201/831 (24.19%), Postives = 323/831 (38.87%), Query Frame = 2
Query:  446 TYYECSVIYGHHIKTFDGNVFSYPLRGGYTLFMDCLGAAPLFYVYFNASYDCFDQKTQN-DCSISMKITVGTQTIILFPKNEFALVKNNKTKIPFNS-EGIIVSSVGSFIKIKGIDDLEILFDRDRNIYVYAPVTAEKKICGLCGYFNGIMSDDYRDFNQVIQKNVKTFVNSWIDRDPSDLNVYREREQYP-CNALKLKNNDQYQKALTLCQDMVKNNLG--RTCQSEVKIDKYLDMCQDEICECLQTQPENSTIENCYSTFCKIEEQYSYACTLKGIAVD-WRSATTICKQPQCFNGQEFSECGSNCGKNCGQLGMELECESQCLPGCYCPRNRYWDGTMCVPQEKCPCVRDNGESTYQQG---YRLKLNCETCICGMHG-----KWQCIENEEC-------------EGRCFISGDPHYITFDRRHFFFDGHCEYTAVMTTSDNVLLSNSTIAPLSITIQNTNCQDNSETGCPRTIGVIIGEDEDQVAINLLSSSEIKVNFVKISLPYQHTGNTKVLIDQVSTDILRLKSETGVEILWNGGSRIEIKLSKKYREKVTGMCGNFNGNEMDDSMTFKGVDEKDIDKFVLSWKTN-------------PTCESDRGIV-EYKGACALSRSYSDYANKVCHKLYESEEFKKCHSAANADKFFDQCTHDVCTCGMKRNGALDHCECEAFSSYARQCALENINLS-WRTNELCPKKCPNENMKYNQCGSRCTSTC-RLLQESKCKEECIEGCFCPEGETFDEAAKECVKISDCKCEFHGRFYLPYEIRQDR--CNNCTCTNGNWI-CTSNDCEGKEFCPKSMAWFDCGICQKTCT 2800
            +Y  C+     H  TFDG  F++     Y L   C     L  V FN + +  ++ ++    + ++  ++   T+ +  +N + L       +P  S + + V   GS   I+    + I +D    + V  P      +CGLCG +NG   DD    N     +      SW     + +       Q P C A        YQ A   C  ++ +  G  R C   V    Y++ C  ++C+              + + CK  E Y  AC  +GI +  WR+    C   +C     ++ C S C   C  +     C   C   C C +     G  CVP   C C   NG+  YQ+G   Y      E CICG +G     K +C   E C             EG+C  SGDPHY +FD + F F G C Y       DN    ++ + P ++T      Q N++ G  +              +++  S  + VN  +++LP         +  +     +R  ++ G+++L++    +E+ +   Y+ K+ G+CGN+N  + D+     G   K++++F  SW  +             P CE    ++ E   +C + ++                 F+ CHS  +   +   C  DVC  G  +        C +  +Y   C    + +  WR++  CP  CP  N  Y  C   C  TC   +Q+  C E C EGC C  G  FD A  +CV + +C C   GR+    ++  D+   + C C     + C    C   E C        C I Q  CT
Sbjct: 1625 SYATCTASGDPHYHTFDGRRFNFQGTCVYQLAGLCSQHPGL--VPFNVTVENENRGSKAVSFTKTVTFSIYGSTLTISKENPYKL-NGQLAALPLKSNDELAVFLSGSQAVIETAAGITITYDWWSTVRVTVPSNYHGAMCGLCGNYNGKALDDMTMQNGKTTPDEAKLGESW---QVASVPGCSSACQGPWCQACSDSQKKVYQ-ASQFC-GIIADETGPFRECHKFVDPAAYVEDCVYDVCQ----------FHGHHGSVCKAVEVYLSACQSQGIPIHPWRT-QAFCPM-ECPANSHYNLCASGCPTTCASINSLTTCHMHCSEACECDQGHLMSGDTCVPVRDCGCSY-NGQ-YYQKGDVFYPEDTCMEKCICGENGAVSCQKEKCRRGETCKLVNGVKGCHPEEEGKCVASGDPHYTSFDGQRFDFQGTCVYVLAKVCDDN----DNQLTPFTVT------QGNAKYGNGK--------------VSVTKSVTVTVNNEELNLPLSLDKGRLTVTREGHNTFVR--TDFGLKVLYDTVYYVEVIVPSTYQGKMCGLCGNYNKKDRDEFRLPGGKGTKNVNEFGKSWVVDLPEHICGGCEEDCPVCEKANAVLYEKLDSCGIMKA-------------PDGPFQACHSKIDPAAYVSDCVFDVCAAGGSK-----EILCNSVQAYVLACQNAGVQIQPWRSSSFCPASCP-PNSHYEVCADTCRGTCASFIQQLTCSESCFEGCECDAGFVFDGA--QCVPLENCGCVHDGRYLTVNQVVVDKDCQSRCVCEASGLVKCQRLSCSSTEVCDVRGGVRSCHIKQAHCT 2386          

HSP 3 Score: 195.667 bits (496), Expect = 2.172e-49
Identity = 203/799 (25.41%), Postives = 308/799 (38.55%), Query Frame = 2
Query:  479 HIKTFDGNVFSYPLRGGYTLFMDCLGAAPLFYVYF-----NASYDCFDQKTQNDCSISMKITVGTQTIILFPKNEFALVKNNKTKIPFN-SEG-IIVSSVGSFIKIKGIDDLEILFDRDRNIYVYAPVTAEKKICGLCGYFNGIMSDDYRDFNQVIQKNVKTFVNSWIDRDPSDLNVYRER--EQYPCNALKLKNNDQYQKALTLCQDMVKNNLGRTCQSEVKIDKYLDMCQDEICECLQTQPENSTIENCYSTFCKIEEQYSYACTLKGIAV-DWRSATTICKQPQCFNGQEFSECGSNCGKNCGQLGMELECESQCLPGCYCPRNRYWDGTMCVPQEKCPC-----VRDNGESTYQQGYRLKLNCETCICGMHGKWQCIENEEC----------------------------EG-----------RCFISGDPHYITFDRRHFFFDGHCEYTAVMTTSDNVLLSNSTIAPLSITIQNTNCQDNSETGCPRTIGVIIGEDEDQVAINLLSSSEIKVNFVKISLPYQHTGNTKVLIDQVSTDILRLKSETGVEILWNGGSRIEIKLSKKYREKVTGMCGNFNGNEMDDSMTFKGVDEKDIDKFVLSWKTN----------------PTCESD-RGIVEYKGACALSRSYSDYANKVCHKLYESEEFKKCHSAANADKFFDQCTHDVCTCGMKRNGALDHCECEAFSSYARQCALENINLS-WRTNELCPKKCPNENMKYNQCGSRCTSTCRLL-QESKCKEECIEGCFCPEGETFDEAAKECVKISDCKCEFHGRFYLP 2656
            H  +FDG  F +     Y L   C G        F     N  +D    K +   +  + + V   T+I+  K    LV      IP N ++G + V   G+   I     L + +D   ++ V  P     K+CGLCG FNG   DD++  +Q++ K++  F  SW    P   NV  E   +   C      + D + K                C S++    Y D C  ++C        N   +      C     Y+Y C + G+ V DWR+ +  C   +C     +  C   C  +C  L   ++C   C  GC C     +DG  CV + +C C         GE TY++   L  +C      +  ++ C E+ +C                            EG            C+  GDPHY TFD   F F G C+Y  +  T  N+    + + P SIT +N N + N+     R + V I +    +  N +   ++ VN   ++LP+Q   N   +    S+ ++  K    V   WN    + IKL   Y   V G+CGNFNG+  D+     G     + ++  SW+T                 PTC+ D R + + +  C      +   N V         FK C+S  +   F + C +D+C      N       C+A +SY +QC  E I +  WR    CP  C      Y  C S C  +C    Q+  C   C+E C C EG     +A  C+    C C + GR+Y P
Sbjct:  824 HYTSFDGQKFDFQGTCTYVLSKSC-GVEDTHLEAFSVQVENVQWDRMKGKKKVSVTRLVAVEVFGFTLIMKSKMFGVLVNGVLNNIPLNLNDGEVQVYQEGTNYLIATNFGLLVTYDLVYHVTVTVPGNYRDKVCGLCGNFNGDRKDDFQMPDQILAKDINVFGKSWKVAIP---NVVCENGCQGNECADCDPAHKDVFSKPAYCGILTAPKGPFAVCHSKLDPQSYFDDCVFDVCA------SNGDGK----VLCDSVAAYAYNCHMAGVNVNDWRTPS-FCPM-KCPANSHYEVCAETCTYSCPGLSDMVQCPEACTEGCVCDAGFLYDGQTCVKETECGCYDRGKTYKPGEVTYEEDCSLACSCNPATGLICEEYSCPEDTQCMIKKGVKECYNKDPCKDANCRVQETCRVEGGEAVCIPKYTSTCWAWGDPHYHTFDGFDFDFQGTCKYI-ISKTCGNL----NGLVPFSITERNDN-RGNAAVSFVREVDVFIYDYNITIRKNQVG--QVTVNGELLNLPFQLGDNEVSVFQSGSSAVVETKFGLIVSYDWNW--HLVIKLPSSYYSSVCGLCGNFNGDTGDELQNPSGKAVASVIEWGKSWQTPDQDKGHPCWDTCEKNCPTCDDDERELYKTQAFCG---GLAAKTNSV---------FKICNSKLDPQAFMNNCVYDMCL-----NKGDKRMLCQALTSYNKQCRDEGIIIKDWRKEFNCPMNC-QRFSHYEHCASPCQPSCPFPEQKQTCSGACVEACVCDEGYVL--SAGVCIPAKTCGCSYQGRYYTP 1576          

HSP 4 Score: 186.037 bits (471), Expect = 1.467e-46
Identity = 189/785 (24.08%), Postives = 318/785 (40.51%), Query Frame = 2
Query:  458 CSVIYGHHIKTFDGNVFSYPLRGGYTLFMDCLGAAPLFYVYFNASYDCFDQKTQNDCSISMKIT-VGTQTIILFPKNEFAL--------VKNNKTKIP--FNSEGIIVSSVGSFIKIKGIDDLEILFDRDRNIYVYAPVTAEKKICGLCGYFNGIMSDDYRDFNQVIQKNVKTFVNSW----IDRDPSDLNVYREREQYPCNALKLKNNDQYQKALTLCQDMVKNNLG--RTCQSEVKIDKYLDMCQDEICECLQTQPENSTIENCYSTFCKIEEQYSYACTLKGIAV-DWRSATTICKQPQCFNGQEFSECGSNCGKNCGQLGMELECESQCLPGCYCPRNRYWDGTMCVPQEKCPCVRDNGESTYQQGYRLKLNCET---CI------------CGMHGKWQCIEN-EECEG----RCFISGDPHYITFDRRHFFFDGHCEYTAVMTTSDNVLLSNSTIAPLSITIQNTNCQDNSETGCPRTIGVIIGEDEDQV---AINLLSSS--EIKVNFVKISLPYQHTGNTKVLIDQVSTDILRLKSETGVEILWNGGSRIEIKLSKKYREKVTGMCGNFNGNEMDDSMTFKGVDEKDIDKFVLSWKTN--PTC-ESDRGIVEYKGACALSRSYSDYANKVCHKLYESE-EFKKCHSAANADKFFDQCTHDVCTCGMKRNGALDHCECEAFSSYARQCALENINL-SWRTNELCPKKCPNENMKYNQCGSRCTSTCR-LLQESKCKEECIEGCFCPEGETFDEAAKECVKISDCKCEFHGRFYLPYEI 2665
            C  +   H +TFDG  F +     Y +  +C   + L           F+   QN+   S +++ VG  T+ ++     A+        V N+   +P   N+  + +   G  + I+    L + +D   N+ V  P T   K CGLCG FNG   DD+   +         F +SW    +  DP      R      C +      +++   L+ C  + +   G  + C + +    YL+ C+ ++C            +      C   E Y+ AC   G+ + DWR        P+C    ++  CGS C   C       +C+  C+  C C       G+ CVP  KC C  D       Q +    NC+    C+            CG+  + + ++   +C+      C  +GDPHY+TFD + + F G C Y      S +  L+     P  + +QN +          R   V+      Q+   ++N+L+     + V+ V+  +    +G   V    V+TD        G+++ +N  S   + L   Y   V G+CGN+NGN  DD     G        F  SW+    P C E  +G+     +C +++        +C  + +++  F+ CH+  +   FF+ C +DVC    +++       C+A ++Y   C    +N+ SWRT+  C  KCP  +  Y+ C S C ++C  L     C+  C EGC C EG     +  +CV  S C C ++  +Y   E+
Sbjct:   47 CWAMGDPHYRTFDGQRFDFMGTCTYVIAKNCGEDSRL---------TAFEVHAQNENRGSHRVSYVGLVTVQVYDTTITAVRSETGRVRVDNSLWSLPIILNNGKLKIFQSGRSVVIEADFGLMVRYDWTHNLVVTLPDTYSGKTCGLCGNFNGNPKDDFTTPSGTQASGAVAFGSSWKVPGLVADPQ----CRNDCVGGCGSCTESQLNKWDSDLS-CGIITRKENGPFKNCHAIIDPKAYLENCKYDLC----------MGKGLRQFLCNALETYAEACQAAGVQIGDWRGLAKC--SPRCPANSKYELCGSACPATCSDPDAPSKCQRPCVETCTCKEGFVLSGSECVPATKCGCTYDGRYIPAGQTFWADQNCKQLCKCVAGTRQVACQDKGCGVGQQCKVVDGIRKCQALSYSTCKATGDPHYVTFDNKKYDFQGTCVYQLAALCSKDTELT-----PFEVLVQNEH----------RGRNVVSYTKLVQIKVYSLNILNDQLVNLPVSLVEGKVSVYKSGWFAV----VTTDF-------GLKVSFNWHSAAFVTLPSNYMGAVCGLCGNYNGNMQDDLTPKNGNTPVKPTDFGTSWRVAEIPGCIEGCQGVCP---SCDITQKVQYEKEDLCGIIRDTKGPFRDCHAKVDPAGFFEDCVYDVCMYEGRKD-----VLCQAVTAYTSACQGVGVNVYSWRTSNFCAVKCPIHS-HYDICASACPASCEGLAPPPGCRAHCEEGCSCDEGYIL--SGDQCVPFSQCGCLYNDLYYRINEV 768          

HSP 5 Score: 144.821 bits (364), Expect = 6.340e-34
Identity = 124/437 (28.38%), Postives = 184/437 (42.11%), Query Frame = 2
Query: 2843 GCFCPENTVLHNGECIKPFECPCYMNNKMYSENDTIVRGPANCQNPCIC-KDG-----KWVCEQNKQCS-------------GICKTWGETHYESFDGKYFEFQGSCSYVISEDFCG---NKLGTFKLISENIACGXXXXXCTKSIKFIYLNRVFQFV-----RGSNPIVSRNTNYPP----GGPTAFYWTSDVDTHFILFTMEGIQVKWDKAMSLEIMIPEKYQNKVCGLCGNFDLRIDNDMRARSGEIEKDIVNFADSWKVHSSCPVPQKPPFMCSKR------PDREPWAK------AKCEILKS--DSFKKCHDVVNVEHYYKRCVADACECDRGDDCVCFCTAVEQYVARCNEYEIGLK-WRTNENCPHTCTGKRVWKNCGNICPDSCIDIGKNVTDNTGCKKVCIEGCFCPDGLHWQNNECVERKACECVD 4015
            GC C E  +L   +C+   +C C  N+  Y  N+        C+  C C +DG     K+ C  N++C              G+C+  G+ HY SFDG+ F+FQG+C+YV+S+  CG     L  F +  EN+           S+  +    VF F      +    +V+   N  P     G    Y      T++++ T  G+ V +D    + + +P  Y++KVCGLCGNF+    +D +     + KDI  F  SWKV         P  +C          D +P  K      A C IL +    F  CH  ++ + Y+  CV D C    GD  V  C +V  Y   C+   + +  WRT   CP  C     ++ C   C  SC      ++D   C + C EGC C  G  +    CV+   C C D
Sbjct:  734 GCSCDEGYILSGDQCVPFSQCGCLYNDLYYRINEVFYPN-GQCEEECKCTQDGEVTCKKFKCGPNEKCKIENGIQKCHPVGKGVCRASGDPHYTSFDGQKFDFQGTCTYVLSKS-CGVEDTHLEAFSVQVENVQWDRMKGKKKVSVTRLVAVEVFGFTLIMKSKMFGVLVNGVLNNIPLNLNDGEVQVYQEG---TNYLIATNFGLLVTYDLVYHVTVTVPGNYRDKVCGLCGNFNGDRKDDFQMPDQILAKDINVFGKSWKV-------AIPNVVCENGCQGNECADCDPAHKDVFSKPAYCGILTAPKGPFAVCHSKLDPQSYFDDCVFDVCA-SNGDGKV-LCDSVAAYAYNCHMAGVNVNDWRTPSFCPMKCPANSHYEVCAETCTYSC----PGLSDMVQCPEACTEGCVCDAGFLYDGQTCVKETECGCYD 1152          

HSP 6 Score: 142.895 bits (359), Expect = 2.420e-33
Identity = 121/465 (26.02%), Postives = 199/465 (42.80%), Query Frame = 2
Query: 2843 GCFCPENTVLHNGECIKPFECPCYMNNKMYSENDTIVRGPANCQNPCICKDGKWVCEQNKQC-------------------SGICKTWGETHYESFDGKYFEFQGSCSYVISE--DFCGNKLGTFKLISENIACGXXXXXCTKSIKFIY----LNRVFQFVRGSNPIVSRNTNYPPGGPTAFYWTSDVDTHFILFTMEGIQVKWDKAMSLEIMIPEKYQNKVCGLCGNFDLRIDNDMRARSGEIEKDIVNFADSWKV----------HSSCPVPQKPPFMCSKRPDREPWAKAKCEILKS--DSFKKCHDVVNVEHYYKRCVADACECDRGDDCVCFCTAVEQYVARCNEYEIGLK-WRTNENCPHTCTGKRVWKNCGNICPDSCIDIGKNVTDNTGCKKVCIEGCFCPDGLHWQNNECVERKACECVDPITNLKYNTGDKVI--RECE-ECNC-YEGAFRCTKL 4111
             C C +  ++    C+   +C C  N + Y + D +      C   CIC +   V  Q ++C                    G C   G+ HY SFDG+ F+FQG+C YV+++  D   N+L  F +   N   G+   S TKS+        LN      +G   +     N            + V T F      G++V +D    +E+++P  YQ K+CGLCGN++ +  ++ R   G+  K++  F  SW V             CPV +K   +  ++ D        C I+K+    F+ CH  ++   Y   CV D C    G      C +V+ YV  C    + ++ WR++  CP +C     ++ C + C  +C    + +T    C + C EGC C  G  +   +CV  + C CV    + +Y T ++V+  ++C+  C C   G  +C +L
Sbjct: 1932 ACECDQGHLMSGDTCVPVRDCGCSYNGQYYQKGD-VFYPEDTCMEKCICGENGAVSCQKEKCRRGETCKLVNGVKGCHPEEEGKCVASGDPHYTSFDGQRFDFQGTCVYVLAKVCDDNDNQLTPFTVTQGNAKYGNGKVSVTKSVTVTVNNEELNLPLSLDKGRLTVTREGHN------------TFVRTDF------GLKVLYDTVYYVEVIVPSTYQGKMCGLCGNYNKKDRDEFRLPGGKGTKNVNEFGKSWVVDLPEHICGGCEEDCPVCEKANAVLYEKLD-------SCGIMKAPDGPFQACHSKIDPAAYVSDCVFDVCA--AGGSKEILCNSVQAYVLACQNAGVQIQPWRSSSFCPASCPPNSHYEVCADTCRGTCASFIQQLT----CSESCFEGCECDAGFVFDGAQCVPLENCGCVH---DGRYLTVNQVVVDKDCQSRCVCEASGLVKCQRL 2361          

HSP 7 Score: 142.895 bits (359), Expect = 2.461e-33
Identity = 128/466 (27.47%), Postives = 188/466 (40.34%), Query Frame = 2
Query: 2837 LPGCFCPENTVLHNGECIKPFECPCYMNNKMYSENDTI--------------VRGPANCQNP-------CICKDGKWVCEQNKQCSGICKTWGETHYESFDGKYFEFQGSCSYVISEDFCGNKLGT--FKLISENIACGXXXXXCTKSIKFIYLNRVFQFVRGSNPIVSRNTNYPPGGPTAFYWTSDVD--------THFILFTMEGIQVKWDKAMSLEIMIPEKYQNKVCGLCGNFDLRIDNDMRARSGEIEKDIVNFADSWKVHS--SCPVPQKPPF--MCSKRPDREPWAKAKCEILKSDS--FKKCHDVVNVEHYYKRCVADACECDRGDDCVCFCTAVEQYVARCNEYEIGLK-WRTNENCPHTCTGKRVWKNCGNICPDSCIDIGKNVTDNTGCKKVCIEGCFCPDGLHWQNNECVERKACECVDPITNLKYNTGDKVIRE---CEECNCYE-GAFRCTK 4108
            +  C C E  VL  G CI    C C    + Y+                     G   C+         CI +DG+ VC+     +  C   G+ HY +FDG+ F FQG+C Y ++   C    G   F +  EN   GS + S TK++ F         + GS   +S+   Y   G  A       D        +  ++ T  GI + +D   ++ + +P  Y   +CGLCGN++ +  +DM  ++G+   D     +SW+V S   C    + P+   CS    +   A   C I+  ++  F++CH  V+   Y + CV D C+       V  C AVE Y++ C    I +  WRT   CP  C     +  C + CP +C  I    T    C   C E C C  G     + CV  + C C        Y  GD    E    E+C C E GA  C K
Sbjct: 1543 VEACVCDEGYVLSAGVCIPAKTCGCSYQGRYYTPGQQFWADEACSRLCVCDTTLGMVTCREASCSVNEKCIIQDGERVCQPISYAT--CTASGDPHYHTFDGRRFNFQGTCVYQLA-GLCSQHPGLVPFNVTVENENRGSKAVSFTKTVTFS--------IYGSTLTISKENPYKLNGQLAALPLKSNDELAVFLSGSQAVIETAAGITITYDWWSTVRVTVPSNYHGAMCGLCGNYNGKALDDMTMQNGKTTPDEAKLGESWQVASVPGCSSACQGPWCQACSDSQKKVYQASQFCGIIADETGPFRECHKFVDPAAYVEDCVYDVCQFHGHHGSV--CKAVEVYLSACQSQGIPIHPWRTQAFCPMECPANSHYNLCASGCPTTCASINSLTT----CHMHCSEACECDQGHLMSGDTCVPVRDCGC--SYNGQYYQKGDVFYPEDTCMEKCICGENGAVSCQK 1989          

HSP 8 Score: 126.331 bits (316), Expect = 2.565e-28
Identity = 129/501 (25.75%), Postives = 211/501 (42.12%), Query Frame = 2
Query: 2747 CPKSMAWFDCG-ICQKTCTNLDLVCPKGQCQLP---GCFCPENTVLHNGECIKPFECPCYMNNKMYSENDTIVRGPANCQNPCICKDG-KWVCEQNKQCS---------GI----------CKTWGETHYESFDGKYFEFQGSCSYVISEDFCG--NKLGTFKLISENIACGXXXXXCTKSIKFIYLNRVFQFVRGSNPIVSRNTNYPPGGPTAFY--WTSDVDTHFILFTMEGIQVKWDKAMSLEIMIPEKYQNKVCGLCGNFDLRIDNDMRARSGEIEKDIVNFADSWKVHS-------------SCPVPQKPPFMCSKRPDREPWAKAKCEILK--SDSFKKCHDVVNVEHYYKRCVADACECDRGDDCVCFCTAVEQYVARCNEYEIGL-KWRTNENCPHTCTGKRVWKNCGNICPDSCIDIGKNVTDNTGCKKVCIEGCFCPDGLHWQNNECVERKACECVDPITNLKYNTGDKVIREC-EECNCYE-GAFRCTKL 4111
            CP +  +  CG  C  TC++ D      +CQ P    C C E  VL   EC+   +C C  + +      T      NC+  C C  G + V  Q+K C          GI          CK  G+ HY +FD K ++FQG+C Y ++   C    +L  F+++ +N   G +  S TK ++     +V+     ++ +V+   +   G  + +   W + V T F      G++V ++   +  + +P  Y   VCGLCGN++  + +D+  ++G       +F  SW+V               SC + QK  +   ++ D        C I++     F+ CH  V+   +++ CV D C  +   D +  C AV  Y + C    + +  WRT+  C   C     +  C + CP SC    + +    GC+  C EGC C +G     ++CV    C C+      + N       +C EEC C + G   C K 
Sbjct:  323 CPANSKYELCGSACPATCSDPDA---PSKCQRPCVETCTCKEGFVLSGSECVPATKCGCTYDGRYIPAGQTF-WADQNCKQLCKCVAGTRQVACQDKGCGVGQQCKVVDGIRKCQALSYSTCKATGDPHYVTFDNKKYDFQGTCVYQLAA-LCSKDTELTPFEVLVQNEHRGRNVVSYTKLVQI----KVYSLNILNDQLVNLPVSLVEGKVSVYKSGWFAVVTTDF------GLKVSFNWHSAAFVTLPSNYMGAVCGLCGNYNGNMQDDLTPKNGNTPVKPTDFGTSWRVAEIPGCIEGCQGVCPSCDITQKVQY---EKEDL-------CGIIRDTKGPFRDCHAKVDPAGFFEDCVYDVCMYEGRKDVL--CQAVTAYTSACQGVGVNVYSWRTSNFCAVKCPIHSHYDICASACPASC----EGLAPPPGCRAHCEEGCSCDEGYILSGDQCVPFSQCGCLYNDLYYRINEVFYPNGQCEEECKCTQDGEVTCKKF 792          

HSP 9 Score: 117.472 bits (293), Expect = 1.119e-25
Identity = 133/573 (23.21%), Postives = 202/573 (35.25%), Query Frame = 2
Query:  479 HIKTFDGNVFSYPLRGGYTLFMDCLG----AAPLFYVYFNASYDCFDQKTQNDCSISMKITVGTQTIILFPKNEFALVKNNKTKIPFNSEG--IIVSSVGSFIKIKGIDDLEILFDRDRNIYVYAPVTAEKKICGLCGYFNGIMSDDYRDFNQVIQKNVKTFVNSWIDRDPSDLNVYREREQYPCNALKLKNNDQYQKALTLCQDM-VKNNLGRTCQSEVKIDKYLDMCQDEICECLQTQPENSTIENCYSTFCKIEEQYSYACTLKGIAVD-WRSATTICKQPQCFNGQEFSECGSNCGKNCGQLGMELECESQCLPGCYCPRNRYWDGTMCVPQEKCPCVRDNGESTYQQGYRLKLNCETCICGMHG-----KWQCIENEECEGR-----CFISGDPHYITFDRRHFFFDGHCEYTAVMTTSDNVLLSNSTIAPLSITIQNTNCQDNSETGCPRTIGVIIGEDEDQVAINLLSSSEIKVNFVKISLPYQHTGNTKVLIDQVSTDILRLKSETGVEILWNGGSRIEIKLSKKYREKVTGMCGNFNGNEMDDSMTFKGVDEKDIDKFVLSWKT 2143
            H  +FDG  F +     Y L   C        P      NA Y           S++  +TV               V N +  +P + +   + V+  G    ++    L++L+D    + V  P T + K+CGLCG +N    D++R       KNV  F  SW+   P  +    E +   C   +  N   Y+K L  C  M   +   + C S++    Y+  C  ++C    ++             C   + Y  AC   G+ +  WRS ++ C    C     +  C   C   C     +L C   C  GC C     +DG  CVP E C CV D    T  Q    K     C+C   G     +  C   E C+ R     C I      I+   +   FDG           +   L + T       + +           P T+ V   E      + + S   I VN  K+S P   T    V +   S  I R   ++ V + ++    + + +      KV G CGN+N    DD  T  G    D+   + SW  
Sbjct: 2022 HYTSFDGQRFDFQGTCVYVLAKVCDDNDNQLTPFTVTQGNAKYG------NGKVSVTKSVTV--------------TVNNEELNLPLSLDKGRLTVTREGHNTFVRTDFGLKVLYDTVYYVEVIVPSTYQGKMCGLCGNYNKKDRDEFRLPGGKGTKNVNEFGKSWVVDLPEHICGGCEED---CPVCEKANAVLYEK-LDSCGIMKAPDGPFQACHSKIDPAAYVSDCVFDVCAAGGSK----------EILCNSVQAYVLACQNAGVQIQPWRS-SSFCPA-SCPPNSHYEVCADTCRGTCASFIQQLTCSESCFEGCECDAGFVFDGAQCVPLENCGCVHDGRYLTVNQVVVDKDCQSRCVCEASGLVKCQRLSCSSTEVCDVRGGVRSCHIKQAHCTISHAGQLSSFDGMTAAVEAQGAVEVASLCDETSENWFRVVVDVRVCHKKSAFAPATVHVFFNE----ATVTVNSQHGIWVNGKKVSPPNNLTNQLSVQVLDRSVVIQR---KSAVRVTYSVSQEVTVTVDNSLASKVCGACGNYNSESEDDLKTADGKVTTDMSVVIGSWSA 2551          

HSP 10 Score: 116.316 bits (290), Expect = 2.308e-25
Identity = 98/368 (26.63%), Postives = 157/368 (42.66%), Query Frame = 2
Query: 2981 CICKDGKWVCEQNKQCSGICKTWGETHYESFDGKYFEFQGSCSYVISEDFCG--NKLGTFKLISENIACGXXXXXCTKSIKFIYLNRVFQFVRG------------SNPIVSRNTNYPPGGPTAFYWTSDVDTHFILFTMEGIQVKWDKAMSLEIMIPEKYQNKVCGLCGNFDLRIDNDMRARSGEIEKDIVNFADSWKVHSSCPVPQ------KPPFMCSKRPDREPWAKAKCEIL---KSDSFKKCHDVVNVEHYYKRCVADACECDRGDDCVCF-CTAVEQYVARCNEYEIGL-KWRTNENCPHTCTGKRVWKNCGNICPDSCIDIGKNVTDNTGCKKVCIEGCFCPDGLHWQNNECVERKACEC 4009
            C  K+G  +C    +  G C   G+ HY +FDG+ F+F G+C+YVI+++ CG  ++L  F++ ++N   GS   S    +     +     VR             S PI+  N      G    + +       ++    G+ V++D   +L + +P+ Y  K CGLCGNF+    +D    SG      V F  SWKV      PQ           C++    +  +   C I+   ++  FK CH +++ + Y + C  D C    G     F C A+E Y   C    + +  WR    C   C     ++ CG+ CP +C D        + C++ C+E C C +G     +ECV    C C
Sbjct:   29 CEMKNGSPLCVPQSK-MGTCWAMGDPHYRTFDGQRFDFMGTCTYVIAKN-CGEDSRLTAFEVHAQNENRGSHRVSYVGLVTVQVYDTTITAVRSETGRVRVDNSLWSLPIILNN------GKLKIFQSG---RSVVIEADFGLMVRYDWTHNLVVTLPDTYSGKTCGLCGNFNGNPKDDFTTPSGTQASGAVAFGSSWKVPGLVADPQCRNDCVGGCGSCTESQLNKWDSDLSCGIITRKENGPFKNCHAIIDPKAYLENCKYDLC---MGKGLRQFLCNALETYAEACQAAGVQIGDWRGLAKCSPRCPANSKYELCGSACPATCSDPDA----PSKCQRPCVETCTCKEGFVLSGSECVPATKCGC 378          

HSP 11 Score: 54.299 bits (129), Expect = 1.656e-6
Identity = 53/284 (18.66%), Postives = 104/284 (36.62%), Query Frame = 2
Query: 2747 CPKSMAWFDCG-ICQKTCTNLDLVCPKGQCQLPGCFCPENTVLHNGECIKPFECPCYMNNKMYSENDTIVRGPANCQNPCICKDGKWVCEQNKQCSG--ICKTWGET----------------HYESFDGKYFEFQGSCSYVISEDFCGNKLGTFKLISENIACGXXXXXCTKSIKFIYLNRVFQFVRGSNPI-VSRNTNYPPGGPTAFYWTSDVDTHFILFTMEGIQVKWDKAMSLEIMIPEKYQNKVCGLCGNFDLRIDNDMRARSGEIEKDIVNFADSWKV 3538
            CP +  +  C   C+ TC +        +    GC C    V    +C+    C C  + +  + N  +V    +CQ+ C+C+    V  Q   CS   +C   G                     SFDG     +   +  ++          F+++ +   C   S+    ++  ++ N     V   + I V+     PP   T       +D   ++     ++V +  +  + + +     +KVCG CGN++   ++D++   G++  D+     SW  
Sbjct: 2271 CPPNSHYEVCADTCRGTCASFIQQLTCSESCFEGCECDAGFVFDGAQCVPLENCGCVHDGRYLTVNQVVVD--KDCQSRCVCEASGLVKCQRLSCSSTEVCDVRGGVRSCHIKQAHCTISHAGQLSSFDGMTAAVEAQGAVEVASLCDETSENWFRVVVDVRVCHKKSAFAPATVH-VFFNEATVTVNSQHGIWVNGKKVSPPNNLTNQLSVQVLDRSVVIQRKSAVRVTYSVSQEVTVTVDNSLASKVCGACGNYNSESEDDLKTADGKVTTDMSVVIGSWSA 2551          
BLAST of von Willebrand factor vs. Ensembl Medaka
Match: zanl (zonadhesin [Source:NCBI gene;Acc:101162078])

HSP 1 Score: 265.003 bits (676), Expect = 1.934e-70
Identity = 282/1229 (22.95%), Postives = 484/1229 (39.38%), Query Frame = 2
Query:  479 HIKTFDGNVFSYPLRGGYTLFMDCLGAA-PLFYVYFNASYDCFDQKTQNDCSISMKITVGT---QTIILFPKNEFALVKNNKTKIPFN-SEGIIVSSVGSFIKIKGIDDLEILFDRDRNIYVYAPVTAEKKICGLCGYFNGIMSDDYRDFNQVIQKNVKTFVNSWIDRDPSDLNVYREREQYPCNALKLKNNDQYQKALTLCQDMVKNNLGRTCQSEVKIDKYLDMCQDEICECLQTQPENSTIENCYSTFCKIEEQYSYACTLKGIAVD-WRSATTICKQPQCFNGQEFSECGSNCGKNCGQLGMELECESQCLPGCYCPRNRYWDGTMCVPQEKCPCVRDNGESTYQQGY-------RLKLNCE----TCICG----MH------GKWQCIENEECEGRCFISGDPHYITFDRRHFFFDGHCEYTAVMTTSDNVLLSNSTIAPLSITIQNTNCQDNSETGCPRTIGVIIGEDEDQVAINLLSSSEIKVNFVKISLPYQHTGNTKVLIDQVSTDILRLKSETGVEILWNGGSRIEIKLSKKYREKVTGMCGNFNGNEMDDSMTFKGVDEKDIDKFVLSWKTNPTCESDRGIVEYKGACALSRSYSDYANKVCHKLYESEEFKKCHSAANADKFFDQCTHDVCTCGMKRNGALDHCECEAFSSYARQCALENINLS-WRTNELCPKKCPNENMKYNQCGSRCTSTCR-LLQESKCKEECIEGCFCPEGETFDEAAKECVKISDCKC-EFHGRFYLPYEIRQDRCNNCTCTNGNWICTSNDCEGKEFCPKSMAWFDCG-ICQKTCTNLDLVCPKGQCQLPGCFCPENTVLHNGECIKPFECPCYMNNKMYSENDTIVRGPANCQNPCICKDGKWV------CEQNKQC------------SGICKTWGETHYESFDGKYFEFQGSCSYVISEDFCGNKLGTFKLISENIACGXXXXXCTKSIKFIYLNRV-FQFVRGSNPIVSRNTNYPPGGPTAFYWTSDVDTHFILFTMEGIQVKWDKAMSLEIMIPEKYQNKVCGLCGNFDLRIDNDMRARSGEIEKDIVNFADSWKVHSSCPVPQKPPFMCSKRPDREPWAKAKCEIL--KSDSFKKCHDVVNVEHYYKRCVADACECDRGDDCVCFCTAVEQYVARCNEYEIGLKWRTNENCPHTCTGKRVWKNCGNICPDSCIDIGKNVTDNTGCKKVCIEGCFCPDGLHWQNNECVERKACEC 4009
            H  TFD   +++     Y +   C   + P F V+ +      ++   N  +IS    V        I   K     V      +P N +  + V   G    +     + + +D +  + +   +  + K+CGLCG +NG   DD++  +  +  +   F +SW + DP +     ++        +    + Y+    +  D  KN+    C  +V  + Y   C  ++CE          +E      C+  E Y   C  +G+ +  WR+ T   K   C +   +  C   C   C   G    C   C  GC C          CV  + C C   NG+   Q G        +LK  C+    TC+      MH      G+  C  + +    C +SGDPHY TFD++ + F G C YT   T  ++        +P   +++  N ++   +G      + +  ++  + + L+ S    VN  +++ P+  +    ++   +S   + L++  G+ + W+G    +I +   Y +++ G+CG+++GN  +D     G    +++ F  SW+T    +           C             C K+ +     +C    + + FF  C +D+C    + NG L H  C+   +Y   C      +  WR  + C   CP  N  Y+ C S C  TC  ++    C++ C+EGC C  G  F  +  +CV + DC C +  G ++ P                              CP +  + +CG  C  TC      C  G C + GCFC    V     C+   +C C   +  Y E   +V G   C   C C     +      C+ +++C            +  C   G+ HY +FD   ++F G+CSYV+S       L  F++ ++N    +S +        +Y++ V    ++G    V+      P  P           H+ +    G+ V++D    ++I +  KYQ+K+CGLCG+++    +D +   G +  D   F  SW        P      C   P  +   +  C IL  K+  F  CH  VN  +Y++ C+ D CE +     +  C A+E YV  C +  + +    NE     C     ++ C + C D+C   GK     + C   C EGC C  G      +CV+R++C C
Sbjct: 1422 HYTTFDKRKYNFMGNCSYVMSGICNATSLPFFEVHAD------NENRYNSPTISYLKAVHVYVHMVKISILKGGVVQVNGTNVNLPVNPTPEVSVFQSGKHYTVSMTFGVTVRYDGNHFMDIKV-IKYQDKLCGLCGDYNGNSKDDFQKPDGTMTNDANEFGHSW-NTDPCN-----KQPNATIPGCEPGEQELYEGYCGILLD--KNSPFAVCHGKVNPNNYFQDCLFDLCE----------LEGAKPILCEAIEAYVNECQDRGVDIGPWRNETFCLK---CPSNSHYEPCADPCQDTCS--GKPSSCGGACSEGCVCDPGYVLSAGKCVKSDSCGCKHTNGQYYEQPGEEFYVEDCKLKCRCDSPFVTCVASDCPPMHECKLQDGELGCYPSIQ---DCIVSGDPHYNTFDKKFYSFMGTCTYTLARTCRND--------SPW-FSVEGKN-EERGASGVSYLKKLYVTVND--ITVTLMKSKRTLVNGKRVAFPHNPS---PLMSLSLSGQYVILQTTFGLRVRWDGNHHAQISV-PSYHDQMCGLCGDYDGNAGNDFTKPDGTPAGNVNDFGNSWQTEEDEDECSPGTTPDLDCDPELEAEVIKPDKCGKIEDPSGPFECIGVVDPEPFFQSCVYDMC----QFNGEL-HVLCDQLQAYTDACQSAGATVHHWRAPDFC-LDCP-ANSSYSLCVSSCPETCLGVIGSPGCEDVCVEGCECDPG--FILSDDKCVPLKDCGCVDTSGTYHPP------------------------------CPPNAEYIECGPACIPTCQEPSTNC-SGSC-ISGCFCKPGFVFKGPRCVPIEKCGCLDEDGNYYEPGEVVLG-DGCSKLCRCAGNYTLECTDNSCDPSEECREVNGIPSCYPKTSTCIASGDPHYTTFDKHRYDFMGNCSYVMSGICNTTSLPFFEVHADNENRYNSPTISYLKAVHVYVHMVKISILKGGVVQVNGTNVNLPLNPAPEVSVFQSGKHYTVSMTFGVTVRYDGNHFMDIKV-IKYQDKLCGLCGDYNGNSKDDFQKPDGTMTNDANEFGHSWNTDPCNKQPNATIPGC--EPGEQELYEGYCGILLDKNGPFAVCHGKVNPNNYFQDCLFDLCELEGAKPIL--CEAIEAYVNECQDRGVDIGPWRNETFCLKCPPNSHYEPCADPCQDTC--SGK----PSSCGGACSEGCVCDPGYVLSAGKCVKRESCGC 2548          

HSP 2 Score: 177.948 bits (450), Expect = 5.620e-44
Identity = 176/690 (25.51%), Postives = 285/690 (41.30%), Query Frame = 2
Query:  710 KTKIPFNSEGIIVSSVGSFIKIKGIDDLEILFDRDRNIYVYAPVTAEKKICGLCGYFNGIMSDDYRDFNQVIQKNVKTFVNSWIDRDPSDLNVYREREQYPCNALKLKNNDQYQKALTLCQDMVKNNLGRTCQSEVKIDKYLDMCQDEICECLQTQPENSTIENCYSTFCKIEEQYSYACTLKGIAVDWRSATTICKQPQCFNGQEFSECGSNCGKNCGQLGMELECE---SQCLPGCYCPRNRYWDGTMCVPQEKCPCVRDNGESTYQQGYRLKLNCETCICGMHGKWQCIENEECEGRCFISGDPHYITFDRRHFFFDGHCEYTAVMTTSDNVLLSNSTIAPLSITIQNTNCQDNSETGCPRTIGVIIGEDEDQVAINLLSSSEIKVNFVKISLPYQHTGNTKVLIDQVSTDILRLKSETGVEILWNGGSRIEIKLSKKYREKVTGMCGNFNGNEMDDSMTFKGVDEKDIDKFVLSWKTNPTCESDRGIVEYKGACALSRSYSDYANKV-CHKLYESE-EFKKCHSAANADKFFDQCTHDVCTCGMKRNGALDHCECEAFSSYARQCALENINL-SWRTNELCPKKCPNENMKYNQCGSRCTSTCR-LLQESKC-KEECIEGCFCPEGETFDEAAKECVKISDCKCEFHGRFYLPYE--IRQDRCNNCTCTNGNWICTSNDCEGKEFC 2749
            +T +  ++ G  V + GS+  +     L++ FD   ++ +  P     K+CG+CG +N   +DD    ++   K+V    NSW     SD      R     N       ++ ++    C+ ++ ++  R C S V  D +L  C  ++CE    Q          +T C   E Y+ AC   G+ + WR++T     P       +S+C + C   C  L   + C    + C+ GC C          CV  +KC CV  +GE  Y                               RC +SGDPHY TFD     + G   YT V+T   N+     ++ PL +  +N     N        + V +      V +  L    + VN  +++ P       + L   +++  ++L ++ G+ + ++G SR  I L + Y   V G+CGN++G   ++ M   G   +D+++F  SW+ +   E+D         C+ S    DY +   C  L + E  F  CH AA   + +  C  D+C      +G+ +   C ++ +YA  C    + L SWR    C   CP  N  Y  C S C S+C  L   S+C    C+EGC C  G    E A  CV   +C C F  R+Y   E  + +D   +C  T+   +C    C+    C
Sbjct: 3291 RTPLTIDTIGAKVITSGSYSLLDTNFGLQVKFDGVHHLEITVPGEYFNKLCGMCGNYNHDSTDDNLKPDKQPAKDVIELGNSWKSEGDSDPCQPDNRPDVHPNCTA----EEEEQFKAQCEQVILSSSFRPCHSVVSPDAFLGNCIYDMCEYNGMQ----------ATLCDNVEAYAQACQSAGVTITWRNSTFCLPCPP---NSHYSDCTAPCPPTCSDL-FPIFCHLPPTACVEGCECNAGYVLSDGKCVSLDKCGCVGSDGE--YHD---------------------------FDRCTVSGDPHYRTFDGFTHHYQG--PYTYVLTQDHNL---QGSLKPLMVRGKNLRRGGNKRVSFLDEMYVNV----YGVDVRFLQKKTVLVNGERVTPPLSPV---RGLTITMNSKQMQLTTDFGLTVRFDGKSRGVI-LPRTYSNSVRGLCGNYDGITRNEYMKPDGTVVRDLNEFGDSWRVSRDTETDPDSGFETSDCSQSE-LDDYTSVTKCGALSDPEGPFSACH-AALPPQIYQDCVFDLCA----EDGS-EELRCASYEAYATICQEAGVKLGSWRQQLGC-LPCP-ANSTYTACMSPCPSSCADLAAPSECDATACVEGCQCAAGFVMSEGA--CVPYPECGCTFLDRYYPLNENFVTEDCSQSCVSTSIGAVCQPKTCQAGYVC 3909          

HSP 3 Score: 162.925 bits (411), Expect = 1.840e-39
Identity = 179/809 (22.13%), Postives = 317/809 (39.18%), Query Frame = 2
Query:  479 HIKTFDGNVFSYPLRGGYTLFMDC-LGAAPLFYVYFNASYDCFDQKTQNDCSISMKITVGT---QTIILFPKNEFALVKNNKTKIPFN-SEGIIVSSVGSFIKIKGIDDLEILFDRDRNIYVYAPVTAEKKICGLCGYFNGIMSDDYRDFNQVIQKNVKTFVNSWIDRDPSDLNVYREREQYPCNALKLKNNDQYQKALTLCQDMVKNNLGRTCQSEVKIDKYLDMCQDEICECLQTQPENSTIENCYSTFCKIEEQYSYACTLKGIAVD-WRSATTICKQPQCFNGQEFSECGSNCGKNCGQLGMELECESQCLPGCYCPRNRYWDGTMCVPQEKCPCVRDNG------ESTYQQGYRLKLNCE----TCICG----MH------GKWQCIENEECEGRCFISGDPHYITFDRRHFFFDGHCEYTAVMTTSDNVLLSNSTIAPLSITIQNTNCQDNSETGCPRTIGVIIGEDEDQVAINLLSSSEIKVNFVKISLPYQHTGNTKVLIDQVSTDILRLKSETGVEILWNGGSRIEIKLSKKYREKVTGMCGNFNGNEMDDSMTFKGVDEKDIDKFVLSWKTNPTCESDRGIVEYKGACALSRSYSDYANKVCHKLYESEEFKKCHSAANADKFFDQCTHDVCTCGMKRNGALDHCECEAFSSYARQCALENINL-SWRTNELCPKKCPNENMKYNQCGSRCTSTCR-LLQESKCKEECIEGCFCPEGETFDEAAKECVKISDCKCEFHGRFYLPYEIRQDRC-----NNCTCTNGNWI-CTSNDCEG-KEFCPKSMAWFDCGICQKTCT 2800
            H  TFD + + +     Y +   C   + P F V+ +      ++   N  +IS    V        I   K     V      +P N +  + V   G    +     + + +D +  + +   +  + K+CGLCG +NG   DD++  +  +  +   F +SW + DP +     ++        +    + Y+    +  D  KN     C  +V  + Y   C  ++CE          +E      C+  E Y   C  +G+ +  WR+ T   K P       +  C   C   C   G    C   C  GC C          CV +E C C   NG      E  Y +  +LK  C+    TC+      MH      G+  C  + +    C +SGDPHY TFD++++ F G C YT   T  ++        +P   +++  N ++   +G      + +  ++  + + L+ S    VN  +++ P+     + ++   +S   + L++  G+ + W+G    +I +   Y +++ G+CG+++GN  +D     G    +++ F  SW+T    +           C             C K+ +     +C    + + FF  C +D+C    + NG L H  C+   +Y   C      +  WR  + C   CP  N  Y+ C S C  TC  ++    C++ C+EGC C  G  F  +  +CV + DC C      Y P+++  +        +C C +G  I C +  C    E C      ++C      C+
Sbjct: 2240 HYTTFDKHRYDFMGNCSYVMSGICNTTSLPFFEVHAD------NENRYNSPTISYLKAVHVYVHMVKISILKGGVVQVNGTNVNLPLNPAPEVSVFQSGKHYTVSMTFGVTVRYDGNHFMDIKV-IKYQDKLCGLCGDYNGNSKDDFQKPDGTMTNDANEFGHSW-NTDPCN-----KQPNATIPGCEPGEQELYEGYCGILLD--KNGPFAVCHGKVNPNNYFQDCLFDLCE----------LEGAKPILCEAIEAYVNECQDRGVDIGPWRNETFCLKCPP---NSHYEPCADPCQDTCS--GKPSSCGGACSEGCVCDPGYVLSAGKCVKRESCGCKHTNGQYYEPGEEFYVEDCKLKCRCDSPFVTCVASDCPPMHECKLQDGELGCYPSSQ---DCIVSGDPHYNTFDKKYYSFMGTCTYTLARTCRND--------SPW-FSVEGKN-EERGASGVSYLKKLYVTVND--ITVTLMKSKRTLVNGKRVAFPHNP---SPLMSLSLSGQYVILQTTFGLRVRWDGNHHAQISV-PSYHDQMCGLCGDYDGNAGNDFTKPDGTPAGNVNDFGNSWQTEEDEDECSPGTTPDLDCDPELEAEVTKPDKCGKIEDLSGPFECIGVVDPEPFFQSCVYDMC----QFNGEL-HVLCDQLQAYTDACQSAGATVHHWRAPDFC-LDCP-ANSSYSLCVSSCPETCLGVVGSPGCEDVCVEGCECDPG--FILSDDKCVSLKDCGCVDTSGTYHPFQVDDEWLLEGCEQSCECLSGGQIQCHNTSCNPVTEVCQLQDGLYECSPLNGICS 2990          

HSP 4 Score: 159.458 bits (402), Expect = 2.563e-38
Identity = 170/754 (22.55%), Postives = 296/754 (39.26%), Query Frame = 2
Query:  479 HIKTFDGNVFSYPLRGGYTLFMDCLGAA-PLFYVYFNASYDCFDQKTQNDCSISMKITVGT---QTIILFPKNEFALVKNNKTKIPFN-SEGIIVSSVGSFIKIKGIDDLEILFDRDRNIYVYAPVTAEKKICGLCGYFNGIMSDDYRDFNQVIQKNVKTFVNSWIDRDPSDLNVYREREQYPCNALKLKNNDQYQKALTLCQDMVKNNLGRTCQSEVKIDKYLDMCQDEICECLQTQPENSTIENCYSTFCKIEEQYSYACTLKGIAVD-WRSATTICKQPQCFNGQEFSECGSNCGKNCGQLGMELECESQCLPGCYCPRNRYWDGTMCVPQEKCPCVRDNG------ESTYQQGYRLKLNCE----TCICG----MH------GKWQCIENEECEGRCFISGDPHYITFDRRHFFFDGHCEYTAVMTTSDNVLLSNSTIAPLSITIQNTNCQDNSETGCPRTIGVIIGEDEDQVAINLLSSSEIKVNFVKISLPYQHTGNTKVLIDQVSTDILRLKSETGVEILWNGGSRIEIKLSKKYREKVTGMCGNFNGNEMDDSMTFKGVDEKDIDKFVLSWKTNPTCESDRGIVEYKGACALSRSYSDYANKVCHKLYESEEFKKCHSAANADKFFDQCTHDVCTCGMKRNGALDHCECEAFSSYARQCALENINL-SWRTNELCPKKCPNENMKYNQCGSRCTSTCR-LLQESKCKEECIEGCFCPEGETFDEAAKECVKISDCKCEFHGRFYLP 2656
            H  TFD + + +     Y +   C   + P F V+ +      ++   N  +IS    V        I   K     V      +P N +  + V   G    +     + + +D +  + +   +  + K+CGLCG +NG   DD++  +  +  +   F +SW + DP +     ++        +    + Y+    +  D  KN     C  +V  + Y   C  ++CE          +E      C+  E Y   C  +G+ +  WR+ T   K P       +  C   C   C   G    C   C  GC C          CV +E C C   NG      E  Y +  +LK  C+    TC+      MH      GK  C  + +    C +SGDPHY TFD+ ++ F G C YT   T  ++        +P   +++  N ++   +G      + +    + + + L+ S    VN  +++ P+     + ++   +S   + L++  G+ + W+G    +I +   Y +++ G+CG+++GN  +D     G    +++ F  SW+T    +           C             C K+ +     +C    + + FF  C +D+C    + NG L H  C+   +Y   C    + +  WR  + C   CP  N  Y+ C S C  TC  ++    C++ C+EGC C  G  F  +  +CV + DC C      Y P
Sbjct:  442 HYTTFDKHRYDFMGNCSYLMSGICNATSLPFFEVHAD------NENRYNSPTISYLKAVHVYVHMVKISILKGGVVQVNGTNVNLPLNPAPEVSVFQSGKHYTVSMTFGVTVRYDGNHFMDIKV-IKYQDKLCGLCGDYNGNSKDDFQKPDGTMTNDANEFGHSW-NTDPCN-----KQPNATIPGCEPGEQELYEGYCGILLD--KNGPFAVCHGKVNPNNYFQDCLFDLCE----------LEGAKPILCEAIEAYVNECQDRGVDIGPWRNETFCLKCPP---NSHYEPCADPCQDTCS--GKPSSCGGACSEGCVCDPGYVLSAGKCVKRESCGCKHTNGQYYEPGEEFYVEDCKLKCRCDSPFVTCVASDCPPMHECKMQDGKLGCYPSFQ---DCIVSGDPHYNTFDKNYYTFMGTCTYTLARTCRND--------SPW-FSVEGKN-EERGVSGVSYLKKLYV--TVNNITVTLMKSRTTLVNGKRVAFPHNP---SPLMSLSLSGQYVILQTTFGLRVRWDGNHHAQISV-PSYHDQMCGLCGDYDGNAGNDFTKPDGTPAGNVNDFGNSWQTEEDEDECSPGTTPDLDCDPELEAEVTKPDKCGKIEDPSGPFECIGVVDPEPFFQSCVYDMC----QFNGEL-HVLCDQLQAYTDACQSAGVTVHHWRAPDFC-LDCP-ANSSYSLCVSSCPETCLGVVGSPGCEDVCVEGCECDPG--FILSDDKCVPLKDCGCVDTSGTYHP 1137          

HSP 5 Score: 157.147 bits (396), Expect = 1.002e-37
Identity = 141/515 (27.38%), Postives = 213/515 (41.36%), Query Frame = 2
Query: 1301 QPQCFNGQEFSECGSNCGKNCGQLGMELECESQCLPGCYCPRNRYWDGTMCVPQEKCPCVRDNGESTYQQGYRLKLNC-ETCICGMHGKWQCIEN-----EECE------------GRCFISGDPHYITFDRRHFFFDGHCEYTAVMTTSDNVLLSNSTIAPL-SITIQNTNCQDNSETGCPRTIGVIIGEDEDQVAINLLSSSEIKVNFVKISLPYQHTGNTKVLIDQVSTDILRLKSETGVEILWNGGSRIEIKLSKKYREKVTGMCGNFNGNEMDDSMTFKGVDEKDIDKFVLSWKTNPTCESDRGIVE---------YKGACALSRSYSDYANKVCHKLYESEEFKKCHSAANADKFFDQCTHDVCTCGMKRNGALDHCECEAFSSYARQCALENINLS-WRTNELCPKKCPNENMKYNQCGSRCTSTCRLLQESKCKEECIEGCFCPEGETFDEAAKECVKISDCKCEF-HGRFYLPYE--IRQDRCNNCTCTNGNWICTSNDCEGKEFC 2749
             P C    E+ ECG  C   C +      C   C+ GC+C     + G  CVP EKC C+ ++G         L   C + C C  +   +C +N     EEC               C  SGDPHY TFD+  + F G+C Y  VM+      + N+T  P   +   N N  ++      + + V +      V I++L    ++VN   ++LP        V     S     +    GV + ++G   ++IK+  KY++K+ G+CG++NGN  DD     G    D ++F  SW T+P  +     +          Y+G C +              L ++  F  CH   N + +F  C  D+C    +  GA     CEA  +Y  +C    +++  WR    C  KCP  N  Y  C   C  TC   + S C   C EGC C  G     +A +CVK   C C+  +G++Y P E    +D    C C +    C ++DC     C
Sbjct: 2117 HPPCPPNAEYIECGPACIPTCQE--PSTNCSGSCISGCFCKPGFVFKGPRCVPIEKCGCLDEDGNYYEPGEVVLGDGCSKLCRCAGNYTLECTDNSCDPSEECREVNGIPSCYPKTSTCIASGDPHYTTFDKHRYDFMGNCSY--VMSG-----ICNTTSLPFFEVHADNENRYNSPTISYLKAVHVYV----HMVKISILKGGVVQVNGTNVNLPLNPAPEVSVF---QSGKHYTVSMTFGVTVRYDGNHFMDIKV-IKYQDKLCGLCGDYNGNSKDDFQKPDGTMTNDANEFGHSWNTDPCNKQPNATIPGCEPGEQELYEGYCGI-------------LLDKNGPFAVCHGKVNPNNYFQDCLFDLC----ELEGA-KPILCEAIEAYVNECQDRGVDIGPWRNETFC-LKCP-PNSHYEPCADPCQDTCS-GKPSSCGGACSEGCVCDPGYVL--SAGKCVKRESCGCKHTNGQYYEPGEEFYVEDCKLKCRCDSPFVTCVASDCPPMHEC 2591          

HSP 6 Score: 155.221 bits (391), Expect = 4.480e-37
Identity = 160/701 (22.82%), Postives = 266/701 (37.95%), Query Frame = 2
Query:  440 YSTYYECSVIYGHHIKTFDGNVFSYPLRGGYTLFMDCLGAAPLFYVYFNASYDCFDQKTQNDCSISMK--ITVGTQTIILFPKNEFALVKNNKTKIPFNSEGIIVSSV-GSFIKIKGIDDLEILFDRDRNIYVYAPVTAEKKICGLCGYFNGIMSDDYRDFNQVIQKNVKTFVNSWIDRDPSDLNVYREREQYPCNALKLKNNDQYQKALTL---CQDMVKNNLGRTCQSEVKIDKYLDMCQDEICECLQTQPENSTIENCYSTFCKIEEQYSYACTLKGIAVDWRSATTICKQPQCFNGQEFSECGSNCGKNCGQLGMELECESQCLPGCYCPRNRYWDGTMCVPQEKCPCVRDNGESTYQ----QGYRLKLNCE-TCICGMHGKWQCIENEECE-------------------GRCFISGDPHYITFDRRHFFFDGHCEYTAVMTTSDNVLLSNSTIAPLSITIQNTNCQDNSETGCPRTIGVIIGEDEDQVAINLLSSSEIKVNFVKISLPYQHTGNTKVLIDQVSTDILRLKSETGVEILWNGGSRIEIKLSKKYREKVTGMCGNFNGNEMDDSMTFKGVDEKDIDKFVLSWKTNPTCESDRGIVEYKGACALSRSYSDYANK--VCHKLYESEEFKKCHSAANADKFFDQCTHDVCTCGMKRNGALDHCECEAFSSYARQCALENINLSWRTNELC 2446
            Y +  +C V    H  TFD   +S+     YTL   C   +P F V         +++  +  S   K  +TV   T+ L  K++  LV   +   P N   ++  S+ G ++ ++    L + +D + +  +  P +   ++CGLCG ++G   +D+   +     NV  F NSW   +        E E  P     L  + + +  +T    C  +   +    C   V  + +   C  ++C+                  C   + Y+ AC   G  V    A   C    C     +S C S+C + C  +     CE  C+ GC C          CV  + C CV  +G  TY         L   CE +C C   G+ QC  N  C                    G C +SGDPHY TFD+R   + G C YT        +  S+S +   ++  QN +   N++    R + + +      + +       ++VN   +  P       K+     S   + L++  G+ + ++G    ++ L   Y   + GMC NFN N  DD++        + ++   SW         R      G         + A K   C  + +   FK CH+    + +F+ C +D+C  G +         C+A  SYA  CA   +N+ WR +  C
Sbjct: 2601 YPSSQDCIVSGDPHYNTFDKKYYSFMGTCTYTLARTCRNDSPWFSVEGKN-----EERGASGVSYLKKLYVTVNDITVTLM-KSKRTLVNGKRVAFPHNPSPLMSLSLSGQYVILQTTFGLRVRWDGNHHAQISVP-SYHDQMCGLCGDYDGNAGNDFTKPDGTPAGNVNDFGNSWQTEE-------DEDECSPGTTPDLDCDPELEAEVTKPDKCGKIEDLSGPFECIGVVDPEPFFQSCVYDMCQ----------FNGELHVLCDQLQAYTDACQSAGATVHHWRAPDFCLD--CPANSSYSLCVSSCPETCLGVVGSPGCEDVCVEGCECDPGFILSDDKCVSLKDCGCVDTSG--TYHPFQVDDEWLLEGCEQSCECLSGGQIQC-HNTSCNPVTEVCQLQDGLYECSPLNGICSVSGDPHYTTFDKRTHHYMGACSYTLT-----KLCNSSSDLPHFTVDTQNEHRGSNTKVSYVRAVVINV----YGMTVVFGKGRSVQVNGTVVVPPVSSISGVKIYF---SGKFVVLEASFGLRVRFDGNHHADVTLPSSYSGLLCGMC-NFNDNPTDDNLKPDNTPAANSNELGDSWAV----PDPRPCTNGGGQEECDEKVEEEAQKPTSCGMITDPNIFKPCHAVVPPEPYFENCVYDMCATGGQTVAL-----CQALESYADICAAAGVNIPWRNSTFC 3250          

HSP 7 Score: 154.451 bits (389), Expect = 6.998e-37
Identity = 140/508 (27.56%), Postives = 213/508 (41.93%), Query Frame = 2
Query: 1325 EFSECGSNCGKNCGQLGMELECESQCLPGCYCPRNRYWDGTMCVPQEKCPCVRDNGESTYQQGYRLKLNC-ETCICGMHGKWQCIEN-----EECE------------GRCFISGDPHYITFDRRHFFFDGHCEYTAVMTTSDNVLLSNSTIAPL-SITIQNTNCQDNSETGCPRTIGVIIGEDEDQVAINLLSSSEIKVNFVKISLPYQHTGNTKVLIDQVSTDILRLKSETGVEILWNGGSRIEIKLSKKYREKVTGMCGNFNGNEMDDSMTFKGVDEKDIDKFVLSWKTNPTCESDRGIVE---------YKGACALSRSYSDYANKVCHKLYESEEFKKCHSAANADKFFDQCTHDVCTCGMKRNGALDHCECEAFSSYARQCALENINLS-WRTNELCPKKCPNENMKYNQCGSRCTSTCRLLQESKCKEECIEGCFCPEGETFDEAAKECVKISDCKCEF-HGRFY--LPYEIRQDRCN-NCTCTNGNWICTSNDCEGKEFC 2749
            E+ ECG  C   C +      C   C+ GC+C     + G  CVP EKC C+ ++G         L   C + C C  +   +C +N     EEC               C  SGDPHY TFD+R + F G+C Y  VM+      + N+T  P   +   N N  ++      + + V +      V I++L    ++VN   ++LP   T    V     S     +    GV + ++G   ++IK+  KY++K+ G+CG++NGN  DD     G    D ++F  SW T+P  +     +          Y+G C +              L ++  F  CH   N + +F  C  D+C    +  GA     CEA  +Y  +C    +++  WR    C  KCP+ N  Y  C   C  TC   + S C   C EGC C  G     +A +CVK   C C+  +G++Y     E   + C   C C +    C ++DC     C
Sbjct: 1307 EYIECGPACIPTCQE--PSTNCSGSCISGCFCKPGFVFKGPRCVPIEKCGCLDEDGNYYEPGEVVLGDGCSKLCRCAGNYTLECTDNSCDPSEECREVNGIPGCYPKTSTCIASGDPHYTTFDKRKYNFMGNCSY--VMSG-----ICNATSLPFFEVHADNENRYNSPTISYLKAVHVYV----HMVKISILKGGVVQVNGTNVNLPVNPTPEVSVF---QSGKHYTVSMTFGVTVRYDGNHFMDIKV-IKYQDKLCGLCGDYNGNSKDDFQKPDGTMTNDANEFGHSWNTDPCNKQPNATIPGCEPGEQELYEGYCGI-------------LLDKNSPFAVCHGKVNPNNYFQDCLFDLC----ELEGA-KPILCEAIEAYVNECQDRGVDIGPWRNETFC-LKCPS-NSHYEPCADPCQDTCS-GKPSSCGGACSEGCVCDPGYVL--SAGKCVKSDSCGCKHTNGQYYEQPGEEFYVEDCKLKCRCDSPFVTCVASDCPPMHEC 1774          

HSP 8 Score: 154.066 bits (388), Expect = 8.857e-37
Identity = 146/528 (27.65%), Postives = 220/528 (41.67%), Query Frame = 2
Query: 1262 IAVDWRSATTICKQPQCFNGQEFSECGSNCGKNCGQLGMELECESQCLPGCYCPRNRYWDGTMCVPQEKCPCVRDNGESTYQQGYRLKLNC-ETCICGMHGKWQCIEN-----EECE------------GRCFISGDPHYITFDRRHFFFDGHCEYTAVMTTSDNVLLSNSTIAPL-SITIQNTNCQDNSETGCPRTIGVIIGEDEDQVAINLLSSSEIKVNFVKISLPYQHTGNTKVLIDQVSTDILRLKSETGVEILWNGGSRIEIKLSKKYREKVTGMCGNFNGNEMDDSMTFKGVDEKDIDKFVLSWKTNPTCESDRGIVE---------YKGACALSRSYSDYANKVCHKLYESEEFKKCHSAANADKFFDQCTHDVCTCGMKRNGALDHCECEAFSSYARQCALENINLS-WRTNELCPKKCPNENMKYNQCGSRCTSTCRLLQESKCKEECIEGCFCPEGETFDEAAKECVKISDCKCEF-HGRFYLPYE--IRQDRCNNCTCTNGNWICTSNDCEGKEFC 2749
            IA+D    TT CK   C    E+ ECG  C   C +      C   C+ GC+C     + G  CVP EKC C+ ++G         L   C + C C  +   +C +N     EEC               C  SGDPHY TFD+  + F G+C Y  +M+      + N+T  P   +   N N  ++      + + V +      V I++L    ++VN   ++LP        V     S     +    GV + ++G   ++IK+  KY++K+ G+CG++NGN  DD     G    D ++F  SW T+P  +     +          Y+G C +              L ++  F  CH   N + +F  C  D+C    +  GA     CEA  +Y  +C    +++  WR    C  KCP  N  Y  C   C  TC   + S C   C EGC C  G     +A +CVK   C C+  +G++Y P E    +D    C C +    C ++DC     C
Sbjct:  309 IAIDAVCITT-CKP--CPPNAEYIECGPACIPTCQE--PSTNCSGSCISGCFCKPGFVFKGPRCVPIEKCGCLDEDGNYYEPGEVVLGDGCSKLCRCVGNYTLECTDNSCDPSEECREVNGVPGCYPKTSTCIASGDPHYTTFDKHRYDFMGNCSY--LMSG-----ICNATSLPFFEVHADNENRYNSPTISYLKAVHVYV----HMVKISILKGGVVQVNGTNVNLPLNPAPEVSVF---QSGKHYTVSMTFGVTVRYDGNHFMDIKV-IKYQDKLCGLCGDYNGNSKDDFQKPDGTMTNDANEFGHSWNTDPCNKQPNATIPGCEPGEQELYEGYCGI-------------LLDKNGPFAVCHGKVNPNNYFQDCLFDLC----ELEGA-KPILCEAIEAYVNECQDRGVDIGPWRNETFC-LKCP-PNSHYEPCADPCQDTCS-GKPSSCGGACSEGCVCDPGYVL--SAGKCVKRESCGCKHTNGQYYEPGEEFYVEDCKLKCRCDSPFVTCVASDCPPMHEC 793          

HSP 9 Score: 141.739 bits (356), Expect = 6.073e-33
Identity = 120/448 (26.79%), Postives = 186/448 (41.52%), Query Frame = 2
Query: 2747 CPKSMAWFDCG-ICQKTCTNLDLVCPKGQCQLPGCFCPENTVLHNGECIKPFECPCYMNNKMYSEND-------------------TIVRGPANCQNPCICKDGKWVCEQNKQCSGICKTWGETHYESFDGKYFEFQGSCSYVISEDFCGNKLGTFKLISENIACGXXXXXCTKSIKFIYLNRVFQFVRGSNPIVSRNTNYPPGGPTAFYWTSDVDTHFILFTMEGIQVKWDKAMSLEIMIPEKYQNKVCGLCGNFDLRIDNDMRARSGEIEKDIVNFADSWKVHS---SCPVPQKPPFMCSKRPDREPWAKAKCEILKSDSFK-KCHDVVNVEHYYKRCVADACECDRGDDCVCFCTAVEQYVARCNEYEIGLK-WRTNENCPHTCTGKRVWKNCGNICPDSCIDIGKNVTDNTGCKKVCIEGCFCPDGLHWQNNECVERKACECVD 4015
            CP +  +  C   CQ TC+     C  G C   GC C    VL  G+C+K   C C   N  Y E                     T V       + C  +DGK  C  + Q    C   G+ HY +FD  Y+ F G+C+Y ++   C N    F +  +N   G S  S  K +     N     ++    +V+      P  P+     S    + IL T  G++V+WD     +I +P  Y +++CGLCG++D    ND     G    ++ +F +SW+       C     P   C    + E     KC  ++  S   +C  VV+ E +++ CV D C+ +   +    C  ++ Y   C    + +  WR  + C   C     +  C + CP++C+     V  + GC+ VC+EGC C  G    +++CV  K C CVD
Sbjct:  697 CPPNSHYEPCADPCQDTCSGKPSSC-GGACS-EGCVCDPGYVLSAGKCVKRESCGCKHTNGQYYEPGEEFYVEDCKLKCRCDSPFVTCVASDCPPMHECKMQDGKLGCYPSFQ---DCIVSGDPHYNTFDKNYYTFMGTCTYTLART-CRNDSPWFSVEGKNEERGVSGVSYLKKLYVTVNNITVTLMKSRTTLVNGKRVAFPHNPSPLMSLSLSGQYVILQTTFGLRVRWDGNHHAQISVP-SYHDQMCGLCGDYDGNAGNDFTKPDGTPAGNVNDFGNSWQTEEDEDECSPGTTPDLDCDPELEAEVTKPDKCGKIEDPSGPFECIGVVDPEPFFQSCVYDMCQFN--GELHVLCDQLQAYTDACQSAGVTVHHWRAPDFC-LDCPANSSYSLCVSSCPETCL----GVVGSPGCEDVCVEGCECDPGFILSDDKCVPLKDCGCVD 1130          

HSP 10 Score: 140.584 bits (353), Expect = 1.085e-32
Identity = 127/477 (26.62%), Postives = 199/477 (41.72%), Query Frame = 2
Query: 2747 CPKSMAWFDCG-ICQKTCTNLDLVCPKGQCQLPGCFCPENTVLHNGECIKPFECPCYMNNKMYSEND-------------------TIVRGPANCQNPCICKDGKWVCEQNKQCSGICKTWGETHYESFDGKYFEFQGSCSYVISEDFCGNKLGTFKLISENIACGXXXXXCTKSIKFIYLNRVFQFVRGSNPIVSRNTNYPPGGPTAFYWTSDVDTHFILFTMEGIQVKWDKAMSLEIMIPEKYQNKVCGLCGNFDLRIDNDMRARSGEIEKDIVNFADSWKVHS---SCPVPQKPPFMCSKRPDREPWAKAKCEILKSDSFK-KCHDVVNVEHYYKRCVADACECDRGDDCVCFCTAVEQYVARCNEYEIGLK-WRTNENCPHTCTGKRVWKNCGNICPDSCIDIGKNVTDNTGCKKVCIEGCFCPDGLHWQNNECVERKACECVDPI-TNLKYNTGDKVIRE-CEE-CNCYEGA 4093
            CP +  +  C   CQ TC+     C  G C   GC C    VL  G+C+K   C C   N  Y E                     T V       + C  +DG+  C  + Q    C   G+ HY +FD KY+ F G+C+Y ++   C N    F +  +N   G+S  S  K +     +     ++    +V+      P  P+     S    + IL T  G++V+WD     +I +P  Y +++CGLCG++D    ND     G    ++ +F +SW+       C     P   C    + E     KC  ++  S   +C  VV+ E +++ CV D C+ +   +    C  ++ Y   C      +  WR  + C   C     +  C + CP++C+     V  + GC+ VC+EGC C  G    +++CV  K C CVD   T   +   D+ + E CE+ C C  G 
Sbjct: 2495 CPPNSHYEPCADPCQDTCSGKPSSC-GGACS-EGCVCDPGYVLSAGKCVKRESCGCKHTNGQYYEPGEEFYVEDCKLKCRCDSPFVTCVASDCPPMHECKLQDGELGCYPSSQ---DCIVSGDPHYNTFDKKYYSFMGTCTYTLART-CRNDSPWFSVEGKNEERGASGVSYLKKLYVTVNDITVTLMKSKRTLVNGKRVAFPHNPSPLMSLSLSGQYVILQTTFGLRVRWDGNHHAQISVP-SYHDQMCGLCGDYDGNAGNDFTKPDGTPAGNVNDFGNSWQTEEDEDECSPGTTPDLDCDPELEAEVTKPDKCGKIEDLSGPFECIGVVDPEPFFQSCVYDMCQFN--GELHVLCDQLQAYTDACQSAGATVHHWRAPDFC-LDCPANSSYSLCVSSCPETCL----GVVGSPGCEDVCVEGCECDPGFILSDDKCVSLKDCGCVDTSGTYHPFQVDDEWLLEGCEQSCECLSGG 2957          

HSP 11 Score: 139.043 bits (349), Expect = 3.929e-32
Identity = 118/449 (26.28%), Postives = 188/449 (41.87%), Query Frame = 2
Query: 2747 CPKSMAWFDCG-ICQKTCTNLDLVCPKGQCQLPGCFCPENTVLHNGECIKPFECPCYMNNKMYSENDTIVRGPANCQNPCIC--------------------KDGKWVCEQNKQCSGICKTWGETHYESFDGKYFEFQGSCSYVISEDFCGNKLGTFKLISENIACGXXXXXCTKSIKFIYLNRVFQFVRGSNPIVSRNTNYPPGGPTAFYWTSDVDTHFILFTMEGIQVKWDKAMSLEIMIPEKYQNKVCGLCGNFDLRIDNDMRARSGEIEKDIVNFADSWKVHS---SCPVPQKPPFMCSKRPDREPWAKAKCEILKSDSFK-KCHDVVNVEHYYKRCVADACECDRGDDCVCFCTAVEQYVARCNEYEIGLK-WRTNENCPHTCTGKRVWKNCGNICPDSCIDIGKNVTDNTGCKKVCIEGCFCPDGLHWQNNECVERKACECVD 4015
            CP +  +  C   CQ TC+     C  G C   GC C    VL  G+C+K   C C   N  Y E         +C+  C C                    +DG+  C  + Q    C   G+ HY +FD K++ F G+C+Y ++   C N    F +  +N   G+S  S  K +     +     ++    +V+      P  P+     S    + IL T  G++V+WD     +I +P  Y +++CGLCG++D    ND     G    ++ +F +SW+       C     P   C    + E     KC  ++  S   +C  VV+ E +++ CV D C+ +   +    C  ++ Y   C      +  WR  + C   C     +  C + CP++C+     V  + GC+ VC+EGC C  G    +++CV  K C CVD
Sbjct: 1677 CPSNSHYEPCADPCQDTCSGKPSSC-GGACS-EGCVCDPGYVLSAGKCVKSDSCGCKHTNGQYYEQPGEEFYVEDCKLKCRCDSPFVTCVASDCPPMHECKLQDGELGCYPSIQ---DCIVSGDPHYNTFDKKFYSFMGTCTYTLART-CRNDSPWFSVEGKNEERGASGVSYLKKLYVTVNDITVTLMKSKRTLVNGKRVAFPHNPSPLMSLSLSGQYVILQTTFGLRVRWDGNHHAQISVP-SYHDQMCGLCGDYDGNAGNDFTKPDGTPAGNVNDFGNSWQTEEDEDECSPGTTPDLDCDPELEAEVIKPDKCGKIEDPSGPFECIGVVDPEPFFQSCVYDMCQFN--GELHVLCDQLQAYTDACQSAGATVHHWRAPDFC-LDCPANSSYSLCVSSCPETCL----GVIGSPGCEDVCVEGCECDPGFILSDDKCVPLKDCGCVD 2111          

HSP 12 Score: 126.716 bits (317), Expect = 1.950e-28
Identity = 113/443 (25.51%), Postives = 184/443 (41.53%), Query Frame = 2
Query: 2747 CPKSMAWFDCG-ICQKTCTNLDLVCPKGQCQLPGCFCPENTVLHNGECIKPFECPCYMNNKMYSENDTIVRGPANCQNPCICKDGKWV------CEQNKQC------------SGICKTWGETHYESFDGKYFEFQGSCSYVISEDFCGNKLGTFKLISENIACGXXXXXCTKSIKFIYLNRV-FQFVRGSNPIVSRNTNYPPGGPTAFYWTSDVDTHFILFTMEGIQVKWDKAMSLEIMIPEKYQNKVCGLCGNFDLRIDNDMRARSGEIEKDIVNFADSWKVHSSCPVPQKPPFMCSKRPDREPWAKAKCEIL--KSDSFKKCHDVVNVEHYYKRCVADACECDRGDDCVCFCTAVEQYVARCNEYEIGLKWRTNENCPHTCTGKRVWKNCGNICPDSCIDIGKNVTDNTGCKKVCIEGCFCPDGLHWQNNECVERKACEC 4009
            CP +  + +CG  C  TC      C  G C + GCFC    V     C+   +C C   +  Y E   +V G   C   C C     +      C+ +++C            +  C   G+ HY +FD   ++F G+CSY++S       L  F++ ++N    +S +        +Y++ V    ++G    V+      P  P           H+ +    G+ V++D    ++I +  KYQ+K+CGLCG+++    +D +   G +  D   F  SW        P      C   P  +   +  C IL  K+  F  CH  VN  +Y++ C+ D CE +     +  C A+E YV  C +  + +    NE     C     ++ C + C D+C   GK     + C   C EGC C  G      +CV+R++C C
Sbjct:  322 CPPNAEYIECGPACIPTCQEPSTNC-SGSC-ISGCFCKPGFVFKGPRCVPIEKCGCLDEDGNYYEPGEVVLG-DGCSKLCRCVGNYTLECTDNSCDPSEECREVNGVPGCYPKTSTCIASGDPHYTTFDKHRYDFMGNCSYLMSGICNATSLPFFEVHADNENRYNSPTISYLKAVHVYVHMVKISILKGGVVQVNGTNVNLPLNPAPEVSVFQSGKHYTVSMTFGVTVRYDGNHFMDIKV-IKYQDKLCGLCGDYNGNSKDDFQKPDGTMTNDANEFGHSWNTDPCNKQPNATIPGC--EPGEQELYEGYCGILLDKNGPFAVCHGKVNPNNYFQDCLFDLCELEGAKPIL--CEAIEAYVNECQDRGVDIGPWRNETFCLKCPPNSHYEPCADPCQDTC--SGK----PSSCGGACSEGCVCDPGYVLSAGKCVKRESCGC 750          

HSP 13 Score: 123.25 bits (308), Expect = 2.470e-27
Identity = 112/437 (25.63%), Postives = 180/437 (41.19%), Query Frame = 2
Query: 2765 WFDCG-ICQKTCTNLDLVCPKGQCQLPGCFCPENTVLHNGECIKPFECPCYMNNKMYSENDTIVRGPANCQNPCICKDGKWV------CEQNKQC------------SGICKTWGETHYESFDGKYFEFQGSCSYVISEDFCGNKLGTFKLISENIACGXXXXXCTKSIKFIYLNRV-FQFVRGSNPIVSRNTNYPPGGPTAFYWTSDVDTHFILFTMEGIQVKWDKAMSLEIMIPEKYQNKVCGLCGNFDLRIDNDMRARSGEIEKDIVNFADSWKVHSSCPVPQKPPFMCSKRPDREPWAKAKCEIL--KSDSFKKCHDVVNVEHYYKRCVADACECDRGDDCVCFCTAVEQYVARCNEYEIGLKWRTNENCPHTCTGKRVWKNCGNICPDSCIDIGKNVTDNTGCKKVCIEGCFCPDGLHWQNNECVERKACEC 4009
            + +CG  C  TC      C  G C + GCFC    V     C+   +C C   +  Y E   +V G   C   C C     +      C+ +++C            +  C   G+ HY +FD + + F G+CSYV+S       L  F++ ++N    +S +        +Y++ V    ++G    V+      P  PT          H+ +    G+ V++D    ++I +  KYQ+K+CGLCG+++    +D +   G +  D   F  SW        P      C   P  +   +  C IL  K+  F  CH  VN  +Y++ C+ D CE +     +  C A+E YV  C +  + +    NE     C     ++ C + C D+C   GK     + C   C EGC C  G      +CV+  +C C
Sbjct: 1308 YIECGPACIPTCQEPSTNC-SGSC-ISGCFCKPGFVFKGPRCVPIEKCGCLDEDGNYYEPGEVVLG-DGCSKLCRCAGNYTLECTDNSCDPSEECREVNGIPGCYPKTSTCIASGDPHYTTFDKRKYNFMGNCSYVMSGICNATSLPFFEVHADNENRYNSPTISYLKAVHVYVHMVKISILKGGVVQVNGTNVNLPVNPTPEVSVFQSGKHYTVSMTFGVTVRYDGNHFMDIKV-IKYQDKLCGLCGDYNGNSKDDFQKPDGTMTNDANEFGHSWNTDPCNKQPNATIPGC--EPGEQELYEGYCGILLDKNSPFAVCHGKVNPNNYFQDCLFDLCELEGAKPIL--CEAIEAYVNECQDRGVDIGPWRNETFCLKCPSNSHYEPCADPCQDTC--SGK----PSSCGGACSEGCVCDPGYVLSAGKCVKSDSCGC 1730          

HSP 14 Score: 113.235 bits (282), Expect = 2.275e-24
Identity = 113/444 (25.45%), Postives = 172/444 (38.74%), Query Frame = 2
Query: 2747 CPKSMAWFDC-GICQKTCTNLDLVCPKGQCQLP------GCFCPENTVLHNGECIKPFECPCYMNNKMYSENDTIVRGPANCQNPCICKDGKWVCEQNKQCSGICKTWGETHYESFDGKYFEFQGSCSYVISEDFCGNKLGTFKLI---SENIACGXXXXXCTKSIKFI---YLNRV---FQFVRGSNPIVSRNTNYPPGGPTAFYWTSDVDTHFILFTMEGIQVKWDKAMSLEIMIPEKYQNKVCGLCGNFDLRIDNDMRARSGEIEKDIVNFADSWKVHSSCPVPQKPPFM---CSKRPDREPWAKAKCEILK--SDSFKKCHDVVNVEHYYKRCVADACECDRGDDCVCFCTAVEQYVARCNEYEIGL-KWRTNENCPHTCTGKRVWKNCGNICPDSCIDIGKNVTDNTGCKKVCIEGCFCPDGLHWQNNECVERKACECV 4012
            CP +  + DC   C  TC++L  +     C LP      GC C    VL +G+C+   +C C  ++  Y + D                               C   G+ HY +FDG    +QG  +YV+++D   N  G+ K +    +N+  G       K + F+   Y+N      +F++    +V+     PP  P      +       L T  G+ V++D   S  +++P  Y N V GLCGN+D    N+     G + +D+  F DSW+V           F    CS+    +  +  KC  L      F  CH  +  +  Y+ CV D C  D  ++    C + E Y   C E  + L  WR    C   C     +  C + CP SC D+      +      C+EGC C  G       CV    C C 
Sbjct: 3474 CPPNSHYSDCTAPCPPTCSDLFPI----FCHLPPTACVEGCECNAGYVLSDGKCVSLDKCGCVGSDGEYHDFDR------------------------------CTVSGDPHYRTFDGFTHHYQGPYTYVLTQDH--NLQGSLKPLMVRGKNLRRGG-----NKRVSFLDEMYVNVYGVDVRFLQKKTVLVNGERVTPPLSPVRGLTITMNSKQMQLTTDFGLTVRFD-GKSRGVILPRTYSNSVRGLCGNYDGITRNEYMKPDGTVVRDLNEFGDSWRVSRDTETDPDSGFETSDCSQSELDDYTSVTKCGALSDPEGPFSACHAALPPQ-IYQDCVFDLCAEDGSEELR--CASYEAYATICQEAGVKLGSWRQQLGC-LPCPANSTYTACMSPCPSSCADLAAPSECDA---TACVEGCQCAAGFVMSEGACVPYPECGCT 3868          

HSP 15 Score: 107.071 bits (266), Expect = 1.559e-22
Identity = 81/296 (27.36%), Postives = 124/296 (41.89%), Query Frame = 2
Query: 3152 FKLISENIACGXXXXXCTKSIKFIYLNRVFQFVRGSNPIVSRNTNYPPGGPTAFYWTSDVDTHFILFTMEGIQVKWDKAMSLEIMIPEKYQNKVCGLCGNFDLRIDNDMRARSGEIEKDIVNFADSWKVHSSCPVPQKPPFMCSKRPDREP--------WAKAKCE-ILKSDSFKKCHDVVNVEHYYKRCVADACECDRGDDCVCFCTAVEQYVARCNEYEIGLKWRTNENCPHTCTGKRVWKNCGNICPDSCIDIGKNVTDNTGCKKVCIEGCFCPDGLHWQNNECVERKACECV 4012
            F+++++N   G   +S  +S+K   LN              R    P    T         ++ +L T  G+QVK+D    LEI +P +Y NK+CG+CGN++    +D      +  KD++   +SWK           P     RPD  P          KA+CE ++ S SF+ CH VV+ + +   C+ D CE +        C  VE Y   C    + + WR +  C   C     + +C   CP +C D+             C+EGC C  G    + +CV    C CV
Sbjct: 3260 FRVVAKNEERGQPEASYVRSVKVFLLN-------------GRRVRTPLTIDTIGAKVITSGSYSLLDTNFGLQVKFDGVHHLEITVPGEYFNKLCGMCGNYNHDSTDDNLKPDKQPAKDVIELGNSWKSEG-----DSDPCQPDNRPDVHPNCTAEEEEQFKAQCEQVILSSSFRPCHSVVSPDAFLGNCIYDMCEYNGMQ--ATLCDNVEAYAQACQSAGVTITWRNSTFC-LPCPPNSHYSDCTAPCPPTCSDLFPIFCHLP--PTACVEGCECNAGYVLSDGKCVSLDKCGCV 3532          

HSP 16 Score: 95.1301 bits (235), Expect = 7.132e-19
Identity = 72/275 (26.18%), Postives = 120/275 (43.64%), Query Frame = 2
Query: 1865 VNFVKISLPYQHTGNTKVLIDQVSTDILR------LKSETGVEILWNGGSRIEIKLSKKYREKVTGMCGNFNGNEMDDSMTFKGVDEKDIDKFVLSWKT---NPTCESDRGIVEYKGACALSRSYSDYANKVCHKLYESEEFKKCHSAANADKFFDQCTHDVCTCGMKRNGALDHCECEAFSSYARQCALENINLSWRTNELCPKKCPNENMKYNQCGSRCTSTCRLLQESKC---KEECIEGCFCPEGETFDEAAKECVKISDCKC-----EFH 2638
            V  VK+ L       T + ID +   ++       L +  G+++ ++G   +EI +  +Y  K+ GMCGN+N +  DD++       KD+ +   SWK+   +  C+ D     +    A      +     C ++  S  F+ CHS  + D F   C +D+C    + NG +    C+   +YA+ C    + ++WR +  C   CP  N  Y+ C + C  TC  L    C      C+EGC C  G    +   +CV +  C C     E+H
Sbjct: 3277 VRSVKVFLLNGRRVRTPLTIDTIGAKVITSGSYSLLDTNFGLQVKFDGVHHLEITVPGEYFNKLCGMCGNYNHDSTDDNLKPDKQPAKDVIELGNSWKSEGDSDPCQPDNRPDVHPNCTAEEE---EQFKAQCEQVILSSSFRPCHSVVSPDAFLGNCIYDMC----EYNG-MQATLCDNVEAYAQACQSAGVTITWRNSTFC-LPCP-PNSHYSDCTAPCPPTCSDLFPIFCHLPPTACVEGCECNAGYVLSDG--KCVSLDKCGCVGSDGEYH 3539          

HSP 17 Score: 87.8113 bits (216), Expect = 1.251e-16
Identity = 104/450 (23.11%), Postives = 175/450 (38.89%), Query Frame = 2
Query: 2627 CEFHGRFYL---PYEIRQDRCNNCTCTNGNWICTSNDCEGKEFCPKSMAWFDCGICQKTC--TNLDLVCPKGQCQ---LPGCFCPENTVLHNGECIKPFECPCYMNNKMYS----ENDTIVRGPANCQNPCICKDGKWVCEQNKQCS-------------------GICKTWGETHYESFDGKYFEFQGSCSYVISEDFCGNK--LGTFKLISENIACGXXXXXCTKSIKFIYLNRVFQFVRGSNPIVSRNTNYPPGGPTAFYWTSDVDTHFILFTME--------GIQVKWDKAMSLEIMIPEKYQNKVCGLCGNF-------DLRIDNDMRARSGEIEKDIVNFADSWKVHSSCPVP----QKPPFMCSKRPDREPWAKAKCEILKSDSFKKCHDVVNVEHYYKRCVADACECDRGDDCVCFCTAVEQYVARCNEYEIGLKWRTNENC 3820
            C+F+G  ++     +   D C +   T  +W          +FC    A     +C  +C  T L +V   G C+   + GC C    +L + +C+   +C C   +  Y     +++ ++ G   C+  C C  G  +   N  C+                   GIC   G+ HY +FD +   + G+CSY +++  C +   L  F + ++N   G        + K  Y+  V   V G   +  +  +    G       S +    I F+ +        G++V++D     ++ +P  Y   +CG+C NF       +L+ DN   A S E+        DSW V    P      Q+      +   ++P +     I   + FK CH VV  E Y++ CV D C    G   V  C A+E Y   C    + + WR +  C
Sbjct: 2832 CQFNGELHVLCDQLQAYTDACQSAGATVHHW-------RAPDFCLDCPANSSYSLCVSSCPETCLGVVGSPG-CEDVCVEGCECDPGFILSDDKCVSLKDCGCVDTSGTYHPFQVDDEWLLEG---CEQSCECLSGGQIQCHNTSCNPVTEVCQLQDGLYECSPLNGICSVSGDPHYTTFDKRTHHYMGACSYTLTK-LCNSSSDLPHFTVDTQNEHRG-------SNTKVSYVRAVVINVYGMTVVFGKGRSVQVNGTVVVPPVSSISGVKIYFSGKFVVLEASFGLRVRFDGNHHADVTLPSSYSGLLCGMC-NFNDNPTDDNLKPDNTPAANSNEL-------GDSWAVPDPRPCTNGGGQEECDEKVEEEAQKPTSCGM--ITDPNIFKPCHAVVPPEPYFENCVYDMCA--TGGQTVALCQALESYADICAAAGVNIPWRNSTFC 3250          

HSP 18 Score: 80.1073 bits (196), Expect = 2.819e-14
Identity = 81/357 (22.69%), Postives = 138/357 (38.66%), Query Frame = 2
Query:  440 YSTYYECSVIYGHHIKTFDGNVFSYPLRGGYTLFMDCLGAAPLFYVYFNASYDCFDQKTQNDCSISMK--ITVGTQTIILFPKNEFALVKNNKTKIPFNSEGIIVSSV-GSFIKIKGIDDLEILFDRDRNIYVYAPVTAEKKICGLCGYFNGIMSDDYRDFNQVIQKNVKTFVNSWIDRDPSDLNVYREREQYPCNALKLKNNDQYQKALTL---CQDMVKNNLGRTCQSEVKIDKYLDMCQDEICECLQTQPENSTIENCYSTFCKIEEQYSYACTLKGIAVDWRSATTICKQPQCFNGQEFSECGSNCGKNCGQLGMELECESQCLPGCYCPRNRYWDGTMCVPQEKCPCVRDNG 1492
            Y ++ +C V    H  TFD N +++     YTL   C   +P F V         +++  +  S   K  +TV   T+ L  K+   LV   +   P N   ++  S+ G ++ ++    L + +D + +  +  P +   ++CGLCG ++G   +D+   +     NV  F NSW   +        E E  P     L  + + +  +T    C  +   +    C   V  + +   C  ++C+                  C   + Y+ AC   G+ V    A   C    C     +S C S+C + C  +     CE  C+ GC C          CVP + C CV  +G
Sbjct:  803 YPSFQDCIVSGDPHYNTFDKNYYTFMGTCTYTLARTCRNDSPWFSVEGKN-----EERGVSGVSYLKKLYVTVNNITVTLM-KSRTTLVNGKRVAFPHNPSPLMSLSLSGQYVILQTTFGLRVRWDGNHHAQISVP-SYHDQMCGLCGDYDGNAGNDFTKPDGTPAGNVNDFGNSWQTEE-------DEDECSPGTTPDLDCDPELEAEVTKPDKCGKIEDPSGPFECIGVVDPEPFFQSCVYDMCQ----------FNGELHVLCDQLQAYTDACQSAGVTVHHWRAPDFCLD--CPANSSYSLCVSSCPETCLGVVGSPGCEDVCVEGCECDPGFILSDDKCVPLKDCGCVDTSG 1133          
BLAST of von Willebrand factor vs. Planmine SMEST
Match: SMESG000025547.1 (SMESG000025547.1)

HSP 1 Score: 1011.52 bits (2614), Expect = 0.000e+0
Identity = 594/1622 (36.62%), Postives = 868/1622 (53.51%), Query Frame = 2
Query:  185 KSCSPDCVNGVCKDGRCSCSLGWQGNRCSDPICVGGCSNGGKCVAPNQCLCLDNYSGPNCNTLLIKSSQSDVSNYGAVTRVNNTMYSTYYECSVIYGHHIKTFDGNVFSYPLRGGYTLFMDCLGAAPLFYVYFNASYDCFDQKTQNDCSISMKITVGTQTIILFPKNEFALVKNNKTKIPFNSEGIIVSSVGSFIKIKGIDDLEILFDRDRNIYVYAPVTAEKKICGLCGYFNG--IMSDDYRDFNQVIQKNVKTFVNSWIDRDPSDLNVYREREQYPCNALKLKNNDQYQKALTLCQDMVKNNLGRTCQSEVKIDKYLDMCQDEICECLQTQPENSTIENCYSTFCKIEEQYSYACTLKGIAVDWRSATTICKQPQCFNGQEFSECGSNCGKNCGQLGMELECESQCLPGCYCPRNRYWDGTMCVPQEKCPCVRDNGES--TYQQGYRLKLNCETCICGMHGKWQCIENEECEGRCFISGDPHYITFDRRHFFFDGHCEYTAVMTTSDNVLLSNSTIAPLSITIQNTNCQDNSETGCPRTIGVIIGEDEDQVAINLLSSSEIKVNFVKISLPYQHTGNTKVLIDQVSTDILRLKSETGVEILWNGGSRIEIKLSKKYREKVTGMCGNFNGNEMDDSMTFKGVDEKDIDKFVLSWKTNPTCESDRGIVEYKGACALSRSYSDYANKVCHKLYESEEFKKCHSAANADKFFDQCTHDVCTCGMKRNGALDHCECEAFSSYARQCALENINLSWRTNELCPKKCPNENMKYNQCGSRCTSTCRLLQESKCKEECIEGCFCPEGETFDEAAKECVKISDCKCEFHGRFYLPYEIRQDRCNNCTCTNGNWICTSNDCEGKEFCPKSMAWFDCGICQKTCTNLDLVCPKGQCQLPGCFCPENTVLHNGECIKPFECPCYMNNKMYSENDTIVRGPANCQNPCICKDGKWVCEQNKQCSGICKTWGETHYESFDGKYFEFQGSCSYVISEDFCGNKLGTFKLISENIACGXXXXXCTKSIKFIYLNRVFQFVRGSNPIVSRNTNYPPGGPTAFYWTSDVDTHFILFTMEGIQVKWDKAMSLEIMIPEKYQNKVCGLCGNFDLRIDNDMRARSGEIEKDIVNFADSWKVHSSCPVPQKPPFMCSKRPDREPWAKAKCEILKSDSFKKCHDVVNVEHYYKRCVADACECDRGDDCVCFCTAVEQYVARCNEYEIGLKWRTNENCPHTCTGKRVWKNCGNICPDSCIDIGKNVTDNTGCKKVCIEGCFCPDGL--HWQNNECVERKACECVDPITNLKYNTGDKVIRECEECNCYEGAFRCTKLFSKECLHTSRPE---ISTKPPHCVNEYEFLCPNNFCARRCNGIIECRDGEDEDLC-SXXXXXXXXXXXXNYCITDQNEIMKSGETKIVDQCIKYICDDGNIVTKTKFCNITCDEHSEILKQHVDSDKCCECVSIRTTTLMVSATTTRLVTCEMYTLTVEKNFNILYKLKSDSIGNSIENVIYDSDK-----------SWTVVSNNAVLIVEFLPKQPXXXXXXXXXXXXXXXXXXXXXDIVEKDDTWKDADSYTLAKSSTKDGNLFSYTFTSATKDGIPGRFVRFSFILSNQITEVIVIRKLMIKIC 4987
            K C   C+ G CK+G C C  G++G RC    C  GC  G  CV PN C C +N+ G NC T   + + S++     ++ V NT Y  Y  CS++ G ++ TFDG     PLRG   L +DCL   P + ++FN+SY+C  +   N C  S+ I   ++++         L  ++          I   ++G F +IKGI +LEIL+D  RN++++AP+T +K +CGLCGYF+G   +S ++++ N    +NV  F+  W + DP D N Y    +  C  L   N D    A  +CQD+   +L +   + + +  Y  +C+ E+C CL        I  C +  C +    SY CTL G  ++WRS   +C   +C   +E+SECGS+C +NC  L  +  C+S C  GC+CP++R+W+GT CVP+ +CPC+R NG S   Y QG   K +CE C C   G + C +   C G C ISGDPHY TFD+RH + +G C YT V T     +  N     L I +QNT+C  +++  C +++ +  G+ ++   I L+++  I VN +   LP Q     ++ I +V+ D + ++S  G+ ILW+  ++IEI L + Y+++V G+CGN+NGN  DD+    G    + ++  +SW T   C+S   +  Y G CA S  Y  +A + C +L   E F  CH + + + F  QC HD+C CG       D+C CE+ +SY R C    + L WR++ LC  KCPN  M+Y +C + C+ +C  L ++ C  ECI+GC C     +D A  +CV IS C+C     +Y     R+++CN+C CTNG W CT NDC    FCP    W +CG C +TC N D  C +  C+  GCFCP+  +L N  C+   +CPC  ++K Y     I  GP NC + C C +GKW CEQ ++C G CK+WG+ HY++FDGKYF+F   CSYV+ +  CG  +G FKL++ENI CG+  +SCTKSI F Y N+V Q +RG  P V  N NYP           D+ +  I++T   I + WDK +S+EI +P +YQN+VCGLCGNFD  ++ND ++++G  E +I+ F DSWK   +CP  +  P MC    +R+ WA   C  +K+  F  C  VV+ E YY++C++D C CDRG DC C CTA+  + + C +Y I   WR+NE CP  C  ++ +K C N CP  C     N T    C K C+EGC CP        +N+CV+   C C  P ++ KYN G+     C  C C E  F+C            RP+   I++   +C+      C N  CAR CNGI EC DG DE  C ST    + TT T  +CI  +  IM+ GE   ++ C+   C D  IV   + C+ TC + + +LK +   DKCCEC  I +TT  VS TTT    CE              KL SDS    I NV   ++            SW V ++NA   +   P+   E+ ++     I +    V+    E +    + + YT+     K G LF     + +KDG    FV+F+  + +Q  E + IR  ++ IC
Sbjct:  117 KPCIQGCIRGKCKNGDCLCDSGYEGERCDRAFCQYGCGTG-ICVEPNVCQCPENFRGRNCETFFREPNTSNL----KISDVINTKYKDYQLCSIMGGSYVTTFDGISIENPLRGSNILVIDCLSRKPSYRIFFNSSYNCPTKDFVN-CDTSLMIETASESVTFL-----GLSNSSTNSNRNYISSIQHKNIGDFNQIKGIGELEILYDGKRNVFIFAPLTMKKSVCGLCGYFDGNSSLSSEFKNINGESIENVTEFMKYWKNPDPIDPNTYYTTGRDLCTGL---NKDLVTTANNMCQDVFGGDLSQC--TILPVIPYQSICRSELCHCLNA---GQNISVCANIACSMGSFKSYQCTLNGKLINWRSQ--LCAPRECPANKEYSECGSSCSQNCEDLITDENCKSFCTAGCFCPKDRFWNGTYCVPKPQCPCIRKNGNSMVVYHQGMSFKRDCEICECSKGGVFNCAKIRGCSGTCVISGDPHYTTFDKRHIYVEGSCFYTMVATKPS--ITGNQV---LKIWVQNTHCMKSNDAYCTKSLSLQFGDTDNSTFIQLVTTKNILVNKIPNRLPLQINDPLRLTIQEVAHDTVLIESYNGIRILWHQKTQIEITLPEFYQDQVQGLCGNYNGNSEDDATKSSGELTTNDNELAVSWAT-AECKSTLSL-SYLGVCAKSYEYEKFAKEFCQRLL-YEPFNSCHMSVDPNPFIQQCEHDICLCGGNEK---DNCACESMASYGRACMKNGLTLKWRSSSLCDPKCPN-GMEYMECKNLCSVSCFSLTQTNCSTECIDGCQCKSNMVYDTAVNQCVNISQCQCSHENAYYPSGSTRKEKCNDCNCTNGVWSCTKNDCSNVTFCPPGKEWKECGHCDQTCENQDGFCLEKGCK-SGCFCPDGYLLSNKTCVPKHKCPCLWSDKSYLNQSVIYTGPTNCLSKCTCNEGKWGCEQEQKCVGSCKSWGDAHYKTFDGKYFDFVSKCSYVMVDSDCGKGIGFFKLVTENIECGNKGTSCTKSIFFYYRNQVVQLIRGVRPKVMENENYPKDRVKGRISFRDLVSQLIIYTDSDIILYWDKGLSIEIALPPQYQNQVCGLCGNFDQNLNNDFKSKAGNYENNILAFVDSWKSRVNCPAAKDVPDMCKSNHERQAWADKMCGTMKNVKFADCQKVVDTELYYQKCLSDTCSCDRGGDCECLCTALSAFYSACKKYGIDYSWRSNELCPVMCPPEKTFKTCINDCPKKCFKSNLNNTVLENCAKNCVEGCSCPTEYIEAEGSNKCVKENECFCKLPNSDKKYNPGEIFTENCLICVCNENNFKC------------RPDPKCITSTTSYCIGSKLTKCENGVCARICNGIPECSDGSDEANCTSTQTKTLPTTTTQPHCIY-EGRIMQIGEVIKLESCLSVTCTDRRIVETRQNCDKTC-QPNYVLKLY--PDKCCECQLITSTTWTVSHTTTVFEKCEKRPA----------KLTSDSTSVKILNVRGGTEADVANTFTRNADSWIVRNSNASFTLSLPPQAGTELIIVGFQMDITKPFKVVVSFGNEVNKV--ELNPYTVIGQG-KAGKLFQ----TISKDGESFPFVKFT--IESQNNEELEIRNFVLWIC 1669          
BLAST of von Willebrand factor vs. Planmine SMEST
Match: SMESG000041532.1 (SMESG000041532.1)

HSP 1 Score: 903.279 bits (2333), Expect = 0.000e+0
Identity = 482/1311 (36.77%), Postives = 730/1311 (55.68%), Query Frame = 2
Query:  236 SCSLGWQGNRCSDPICVGGCSNGGKCVAPNQCLCLD-NYSGPNCNTLLIKSSQSDVSNYGA-VTRVN-NTMYSTYYECSVIYGHHIKTFDG-NVFSYPLRGGYTLFMDCLGAAPLFYVYFNASYDCFDQKTQNDCSISMKITVGTQTIILFPKNEFALVKNNKTKIPFNSEGIIVSSVGSFIKIKGIDDLEILFDRDRNIYVYAPVTAEKKICGLCGYFNGIMSDDYRDFNQVIQKNVKT---FVNSWIDRDPSDLNVYREREQYPCNALKLKNNDQYQKALTLCQDMVKNNLGRTCQSEVKI--DKYLDMCQDEICECLQTQPENSTIENCYSTFCKIEEQYSYACTLKGIAVDWRSATTICKQPQCFNGQEFSECGSNCGKNCGQLGMELECESQCLPGCYCPRNRYWDGTMCVPQEKCPC-VRDNGES--TYQQGYRLKLNCETCICGMHGKWQCIENEECEGRCFISGDPHYITFDRRHFFFDGHCEYTAVMTTSDNVLLSNSTIAPLSITIQNTNCQDNSETGCPRTIGVIIGEDEDQVAINLLSSSEIKVNFVKISLPYQHTGNTKVLIDQVSTDILRLKSETGVEILWNGGSRIEIKLSKKYREKVTGMCGNFNGNEMDDSMTFKGVDEKDIDKFVLSWKTNPTCESDRGIVEYKGACALSRSYSDYANKVCHKLYESEEFKKCHSAANADKFFDQCTHDVCTCGMKRNGALDHCECEAFSSYARQCALENINLSWRTNELCPKKCPNENMKYNQCGSRCTSTCRLLQESKCKEECIEGCFCPEGETFDEAAKECVKISDCKCEFHGRFYLPYEIRQDRCNNCTCTNGNWICTSNDCEGKEFCPKSMAWFDCGICQKTCTNLDLVCPKGQCQLPGCFCPENTVLHNGECIKPFECPCYMNNKMYSENDTIVRGPANCQNPCICKDGKWVCEQNKQCSGICKTWGETHYESFDGKYFEFQGSCSYVISEDFCGNKLGTFKLISENIACGXXXXXCTKSIKFIYLNRVFQFVRGSNPIVSRNTNYPPGGPTAFYWTSDVDTHFILFTMEGIQVKWDKAMSLEIMIPEKYQNKVCGLCGNFDLRIDNDMRARSGEIEKDIVNFADSWKVHSSCPVPQKPPFMCSKRPDREPWAKAKCEILKSDSFKKCHDVVNVEHYYKRCVADACECDRGDDCVCFCTAVEQYVARCNEYEIGLKWRTNENCPHTCTGKRVWKNCGNICPDSCIDIGKNVTDNTGCKKVCIEGCFCPDGLHWQNNECV-ERKACECVDPITNLKYNTGDKVIRECEECNCYEGAFRCTKLFSKECL 4129
            +C LGW G +C++P+C  GC   GKC+ PN C C + N  G  C              +GA V  V+ N   +   +C+ + G   KTFD          G   L  DC+   P + +       C + K+ +DC I++K          +  ++   V N     P++     +S  G ++ +KGI DL I +++  +I+V+APVT +K++CGLCG ++G   D +   +  +   ++T   F+  W       L+V RE    P  A+++ N D  + A              TC   V I   K+ ++C  E C+ ++ Q +NS         C++    ++  +   I  DWR     C++P C N   +S+CG+NC   CG    +++C   C PGCYC ++ +W    C   ++CPC  R + +   +Y+ G ++K  C+ C+C   G W+C  +++C  RC I+GDPH++TFD +H F +G C+Y AVM          S +  LSI ++N  C ++ +  C + I ++ GE  +Q  I + S +E+ +N   +++P +     ++ + +V++D L++++     +     SRIE+ LS KY  KVTG+CGNFNG+  DD++   G   KD  +    ++   TC  +     Y G C  S  +   AN+VC K  + + FK C +   +DKF  QC HDVC CG+ RN +  +CEC A+S+YAR C+++ I   WRT E CP  CP +NM Y +CGS C++TCRL Q   C  +CI+GC CP+    +E    CVK+ DCKCE+ GR Y   E R+DRCN CTC NG W CT+ DC  + +CP    W DCG CQ+TC +++L+C    C+ PGC+C    V  N +CI   ECPC+  N+ ++E+  I RGP  CQ  C C+ GKW C + + C G+CK WGE+HY SFDGK+F+F G CSYV+ ED+C  K GTFK++ EN+ CGS  +SCTKSI+F Y + +   +RG+ PI+ RN  + P   T  +   D  +  ++ T E ++++WD+ +S+++ +  +Y+N VCGLCGNFD  +DND+R R+G I+ D+  FADSWK+ +SCP P+     C     RE WA  +C ILKS++F+ CH+ V  + YY +CV D+C CDRGDDC+C CTA+ QYV  CN Y I ++WR  ENCP  C   R +K C  +CP++CI     ++D       C+EGC+C +  + +++ECV E+  C C D  +  +Y  G  VI+ C +C C    F C K     CL
Sbjct:   34 ACCLGWSGKKCNEPVCEKGC-GPGKCIEPNICDCRETNRFGQQCE------------RFGAEVASVSQNIELTDQAQCTYLNGRSYKTFDRVKTVQTNFTGNMVLVQDCMSRPPTYQIIVIPQESCVN-KSSDDCEITIKFLFKDSIEATYLSSQGVKVGNISYSFPYSKAEFQISDRGHYVYVKGIKDLNIFYNKKGSIFVFAPVTMKKQVCGLCGLYDGNGDDKFETVDASMNP-IETDLDFIKIW-------LSVSRENRMKPDPAIQMVNCDLNEMA--------------TCAKVVSIFGSKFEEICYAEFCQ-MKNQ-KNS---------CELMRDIAFLSSPDNIVSDWRYKLD-CEEPNCPNKMIWSDCGNNCNNRCGFNNDDVDCSKVCTPGCYCRKDFFWYKNQCKRADECPCEYRASAKQIDSYKFGDKMKKGCQNCLCESRGLWKCDTHDQCSSRCIITGDPHFVTFDNQHIFVEGQCQYIAVMPKE-----IESDMPQLSIIVENKFCFNSEDITCAKGIKILFGEGLNQTEIEIKSKTEVIINSKLVTIPSKINKGVEISVFKVTSDGLKIEAGDLFSVFRKDDSRIELVLSAKYARKVTGLCGNFNGDPEDDNIMPDGAPAKDDSELAARYRLTQTCHGEVLRQSYLGLCETSIEWGKIANEVCGKFGQGQ-FKDCEALVPSDKFVTQCKHDVCNCGLLRNASTINCECSAYSAYARICSIKGIQFQWRTPEFCPVICP-KNMVYKECGSSCSATCRLRQRPNCDNDCIDGCQCPDDMVIEEKTGNCVKVEDCKCEYMGRDYNANEERKDRCNTCTCINGLWNCTTKDCSSQSYCPNGKVWKDCGGCQRTCRDMNLICDPNSCE-PGCYCESGEVYDNNKCIPKGECPCFWQNQSFNESAVITRGPFECQLSCTCRSGKWECPK-RDCEGLCKAWGESHYMSFDGKFFDFHGDCSYVLLEDYCNKKSGTFKIVIENVECGSKGTSCTKSIRFYYKDHIIHLIRGAAPIIGRNPTWSPYLGTGIFSKHDYVSSIVIITKE-LKIQWDRQLSVDVFLTPEYKNNVCGLCGNFDDNVDNDLRNRAGIIDADVNAFADSWKLKTSCPYPEISKNPCDINKFRESWAIKRCSILKSETFEPCHNTVRYQLYYDKCVQDSCACDRGDDCLCVCTAISQYVHECNRYNIKIQWRNYENCPIMCPPDREYKPCEKVCPETCIGTKSCISD-------CMEGCYCKNNTYLKDDECVSEKPLCTCKDE-SGKEYPLGTTVIKNCHKCTCQINGFECEKELIHNCL 1278          
BLAST of von Willebrand factor vs. Planmine SMEST
Match: SMESG000041532.1 (SMESG000041532.1)

HSP 1 Score: 903.279 bits (2333), Expect = 0.000e+0
Identity = 482/1311 (36.77%), Postives = 730/1311 (55.68%), Query Frame = 2
Query:  236 SCSLGWQGNRCSDPICVGGCSNGGKCVAPNQCLCLD-NYSGPNCNTLLIKSSQSDVSNYGA-VTRVN-NTMYSTYYECSVIYGHHIKTFDG-NVFSYPLRGGYTLFMDCLGAAPLFYVYFNASYDCFDQKTQNDCSISMKITVGTQTIILFPKNEFALVKNNKTKIPFNSEGIIVSSVGSFIKIKGIDDLEILFDRDRNIYVYAPVTAEKKICGLCGYFNGIMSDDYRDFNQVIQKNVKT---FVNSWIDRDPSDLNVYREREQYPCNALKLKNNDQYQKALTLCQDMVKNNLGRTCQSEVKI--DKYLDMCQDEICECLQTQPENSTIENCYSTFCKIEEQYSYACTLKGIAVDWRSATTICKQPQCFNGQEFSECGSNCGKNCGQLGMELECESQCLPGCYCPRNRYWDGTMCVPQEKCPC-VRDNGES--TYQQGYRLKLNCETCICGMHGKWQCIENEECEGRCFISGDPHYITFDRRHFFFDGHCEYTAVMTTSDNVLLSNSTIAPLSITIQNTNCQDNSETGCPRTIGVIIGEDEDQVAINLLSSSEIKVNFVKISLPYQHTGNTKVLIDQVSTDILRLKSETGVEILWNGGSRIEIKLSKKYREKVTGMCGNFNGNEMDDSMTFKGVDEKDIDKFVLSWKTNPTCESDRGIVEYKGACALSRSYSDYANKVCHKLYESEEFKKCHSAANADKFFDQCTHDVCTCGMKRNGALDHCECEAFSSYARQCALENINLSWRTNELCPKKCPNENMKYNQCGSRCTSTCRLLQESKCKEECIEGCFCPEGETFDEAAKECVKISDCKCEFHGRFYLPYEIRQDRCNNCTCTNGNWICTSNDCEGKEFCPKSMAWFDCGICQKTCTNLDLVCPKGQCQLPGCFCPENTVLHNGECIKPFECPCYMNNKMYSENDTIVRGPANCQNPCICKDGKWVCEQNKQCSGICKTWGETHYESFDGKYFEFQGSCSYVISEDFCGNKLGTFKLISENIACGXXXXXCTKSIKFIYLNRVFQFVRGSNPIVSRNTNYPPGGPTAFYWTSDVDTHFILFTMEGIQVKWDKAMSLEIMIPEKYQNKVCGLCGNFDLRIDNDMRARSGEIEKDIVNFADSWKVHSSCPVPQKPPFMCSKRPDREPWAKAKCEILKSDSFKKCHDVVNVEHYYKRCVADACECDRGDDCVCFCTAVEQYVARCNEYEIGLKWRTNENCPHTCTGKRVWKNCGNICPDSCIDIGKNVTDNTGCKKVCIEGCFCPDGLHWQNNECV-ERKACECVDPITNLKYNTGDKVIRECEECNCYEGAFRCTKLFSKECL 4129
            +C LGW G +C++P+C  GC   GKC+ PN C C + N  G  C              +GA V  V+ N   +   +C+ + G   KTFD          G   L  DC+   P + +       C + K+ +DC I++K          +  ++   V N     P++     +S  G ++ +KGI DL I +++  +I+V+APVT +K++CGLCG ++G   D +   +  +   ++T   F+  W       L+V RE    P  A+++ N D  + A              TC   V I   K+ ++C  E C+ ++ Q +NS         C++    ++  +   I  DWR     C++P C N   +S+CG+NC   CG    +++C   C PGCYC ++ +W    C   ++CPC  R + +   +Y+ G ++K  C+ C+C   G W+C  +++C  RC I+GDPH++TFD +H F +G C+Y AVM          S +  LSI ++N  C ++ +  C + I ++ GE  +Q  I + S +E+ +N   +++P +     ++ + +V++D L++++     +     SRIE+ LS KY  KVTG+CGNFNG+  DD++   G   KD  +    ++   TC  +     Y G C  S  +   AN+VC K  + + FK C +   +DKF  QC HDVC CG+ RN +  +CEC A+S+YAR C+++ I   WRT E CP  CP +NM Y +CGS C++TCRL Q   C  +CI+GC CP+    +E    CVK+ DCKCE+ GR Y   E R+DRCN CTC NG W CT+ DC  + +CP    W DCG CQ+TC +++L+C    C+ PGC+C    V  N +CI   ECPC+  N+ ++E+  I RGP  CQ  C C+ GKW C + + C G+CK WGE+HY SFDGK+F+F G CSYV+ ED+C  K GTFK++ EN+ CGS  +SCTKSI+F Y + +   +RG+ PI+ RN  + P   T  +   D  +  ++ T E ++++WD+ +S+++ +  +Y+N VCGLCGNFD  +DND+R R+G I+ D+  FADSWK+ +SCP P+     C     RE WA  +C ILKS++F+ CH+ V  + YY +CV D+C CDRGDDC+C CTA+ QYV  CN Y I ++WR  ENCP  C   R +K C  +CP++CI     ++D       C+EGC+C +  + +++ECV E+  C C D  +  +Y  G  VI+ C +C C    F C K     CL
Sbjct:   34 ACCLGWSGKKCNEPVCEKGC-GPGKCIEPNICDCRETNRFGQQCE------------RFGAEVASVSQNIELTDQAQCTYLNGRSYKTFDRVKTVQTNFTGNMVLVQDCMSRPPTYQIIVIPQESCVN-KSSDDCEITIKFLFKDSIEATYLSSQGVKVGNISYSFPYSKAEFQISDRGHYVYVKGIKDLNIFYNKKGSIFVFAPVTMKKQVCGLCGLYDGNGDDKFETVDASMNP-IETDLDFIKIW-------LSVSRENRMKPDPAIQMVNCDLNEMA--------------TCAKVVSIFGSKFEEICYAEFCQ-MKNQ-KNS---------CELMRDIAFLSSPDNIVSDWRYKLD-CEEPNCPNKMIWSDCGNNCNNRCGFNNDDVDCSKVCTPGCYCRKDFFWYKNQCKRADECPCEYRASAKQIDSYKFGDKMKKGCQNCLCESRGLWKCDTHDQCSSRCIITGDPHFVTFDNQHIFVEGQCQYIAVMPKE-----IESDMPQLSIIVENKFCFNSEDITCAKGIKILFGEGLNQTEIEIKSKTEVIINSKLVTIPSKINKGVEISVFKVTSDGLKIEAGDLFSVFRKDDSRIELVLSAKYARKVTGLCGNFNGDPEDDNIMPDGAPAKDDSELAARYRLTQTCHGEVLRQSYLGLCETSIEWGKIANEVCGKFGQGQ-FKDCEALVPSDKFVTQCKHDVCNCGLLRNASTINCECSAYSAYARICSIKGIQFQWRTPEFCPVICP-KNMVYKECGSSCSATCRLRQRPNCDNDCIDGCQCPDDMVIEEKTGNCVKVEDCKCEYMGRDYNANEERKDRCNTCTCINGLWNCTTKDCSSQSYCPNGKVWKDCGGCQRTCRDMNLICDPNSCE-PGCYCESGEVYDNNKCIPKGECPCFWQNQSFNESAVITRGPFECQLSCTCRSGKWECPK-RDCEGLCKAWGESHYMSFDGKFFDFHGDCSYVLLEDYCNKKSGTFKIVIENVECGSKGTSCTKSIRFYYKDHIIHLIRGAAPIIGRNPTWSPYLGTGIFSKHDYVSSIVIITKE-LKIQWDRQLSVDVFLTPEYKNNVCGLCGNFDDNVDNDLRNRAGIIDADVNAFADSWKLKTSCPYPEISKNPCDINKFRESWAIKRCSILKSETFEPCHNTVRYQLYYDKCVQDSCACDRGDDCLCVCTAISQYVHECNRYNIKIQWRNYENCPIMCPPDREYKPCEKVCPETCIGTKSCISD-------CMEGCYCKNNTYLKDDECVSEKPLCTCKDE-SGKEYPLGTTVIKNCHKCTCQINGFECEKELIHNCL 1278          
BLAST of von Willebrand factor vs. Planmine SMEST
Match: SMESG000041532.1 (SMESG000041532.1)

HSP 1 Score: 902.894 bits (2332), Expect = 0.000e+0
Identity = 482/1311 (36.77%), Postives = 730/1311 (55.68%), Query Frame = 2
Query:  236 SCSLGWQGNRCSDPICVGGCSNGGKCVAPNQCLCLD-NYSGPNCNTLLIKSSQSDVSNYGA-VTRVN-NTMYSTYYECSVIYGHHIKTFDG-NVFSYPLRGGYTLFMDCLGAAPLFYVYFNASYDCFDQKTQNDCSISMKITVGTQTIILFPKNEFALVKNNKTKIPFNSEGIIVSSVGSFIKIKGIDDLEILFDRDRNIYVYAPVTAEKKICGLCGYFNGIMSDDYRDFNQVIQKNVKT---FVNSWIDRDPSDLNVYREREQYPCNALKLKNNDQYQKALTLCQDMVKNNLGRTCQSEVKI--DKYLDMCQDEICECLQTQPENSTIENCYSTFCKIEEQYSYACTLKGIAVDWRSATTICKQPQCFNGQEFSECGSNCGKNCGQLGMELECESQCLPGCYCPRNRYWDGTMCVPQEKCPC-VRDNGES--TYQQGYRLKLNCETCICGMHGKWQCIENEECEGRCFISGDPHYITFDRRHFFFDGHCEYTAVMTTSDNVLLSNSTIAPLSITIQNTNCQDNSETGCPRTIGVIIGEDEDQVAINLLSSSEIKVNFVKISLPYQHTGNTKVLIDQVSTDILRLKSETGVEILWNGGSRIEIKLSKKYREKVTGMCGNFNGNEMDDSMTFKGVDEKDIDKFVLSWKTNPTCESDRGIVEYKGACALSRSYSDYANKVCHKLYESEEFKKCHSAANADKFFDQCTHDVCTCGMKRNGALDHCECEAFSSYARQCALENINLSWRTNELCPKKCPNENMKYNQCGSRCTSTCRLLQESKCKEECIEGCFCPEGETFDEAAKECVKISDCKCEFHGRFYLPYEIRQDRCNNCTCTNGNWICTSNDCEGKEFCPKSMAWFDCGICQKTCTNLDLVCPKGQCQLPGCFCPENTVLHNGECIKPFECPCYMNNKMYSENDTIVRGPANCQNPCICKDGKWVCEQNKQCSGICKTWGETHYESFDGKYFEFQGSCSYVISEDFCGNKLGTFKLISENIACGXXXXXCTKSIKFIYLNRVFQFVRGSNPIVSRNTNYPPGGPTAFYWTSDVDTHFILFTMEGIQVKWDKAMSLEIMIPEKYQNKVCGLCGNFDLRIDNDMRARSGEIEKDIVNFADSWKVHSSCPVPQKPPFMCSKRPDREPWAKAKCEILKSDSFKKCHDVVNVEHYYKRCVADACECDRGDDCVCFCTAVEQYVARCNEYEIGLKWRTNENCPHTCTGKRVWKNCGNICPDSCIDIGKNVTDNTGCKKVCIEGCFCPDGLHWQNNECV-ERKACECVDPITNLKYNTGDKVIRECEECNCYEGAFRCTKLFSKECL 4129
            +C LGW G +C++P+C  GC   GKC+ PN C C + N  G  C              +GA V  V+ N   +   +C+ + G   KTFD          G   L  DC+   P + +       C + K+ +DC I++K          +  ++   V N     P++     +S  G ++ +KGI DL I +++  +I+V+APVT +K++CGLCG ++G   D +   +  +   ++T   F+  W       L+V RE    P  A+++ N D  + A              TC   V I   K+ ++C  E C+ ++ Q +NS         C++    ++  +   I  DWR     C++P C N   +S+CG+NC   CG    +++C   C PGCYC ++ +W    C   ++CPC  R + +   +Y+ G ++K  C+ C+C   G W+C  +++C  RC I+GDPH++TFD +H F +G C+Y AVM          S +  LSI ++N  C ++ +  C + I ++ GE  +Q  I + S +E+ +N   +++P +     ++ + +V++D L++++     +     SRIE+ LS KY  KVTG+CGNFNG+  DD++   G   KD  +    ++   TC  +     Y G C  S  +   AN+VC K  + + FK C +   +DKF  QC HDVC CG+ RN +  +CEC A+S+YAR C+++ I   WRT E CP  CP +NM Y +CGS C++TCRL Q   C  +CI+GC CP+    +E    CVK+ DCKCE+ GR Y   E R+DRCN CTC NG W CT+ DC  + +CP    W DCG CQ+TC +++L+C    C+ PGC+C    V  N +CI   ECPC+  N+ ++E+  I RGP  CQ  C C+ GKW C + + C G+CK WGE+HY SFDGK+F+F G CSYV+ ED+C  K GTFK++ EN+ CGS  +SCTKSI+F Y + +   +RG+ PI+ RN  + P   T  +   D  +  ++ T E ++++WD+ +S+++ +  +Y+N VCGLCGNFD  +DND+R R+G I+ D+  FADSWK+ +SCP P+     C     RE WA  +C ILKS++F+ CH+ V  + YY +CV D+C CDRGDDC+C CTA+ QYV  CN Y I ++WR  ENCP  C   R +K C  +CP++CI     ++D       C+EGC+C +  + +++ECV E+  C C D  +  +Y  G  VI+ C +C C    F C K     CL
Sbjct:   34 ACCLGWSGKKCNEPVCEKGC-GPGKCIEPNICDCRETNRFGQQCE------------RFGAEVASVSQNIELTDQAQCTYLNGRSYKTFDRVKTVQTNFTGNMVLVQDCMSRPPTYQIIVIPQESCVN-KSSDDCEITIKFLFKDSIEATYLSSQGVKVGNISYSFPYSKAEFQISDRGHYVYVKGIKDLNIFYNKKGSIFVFAPVTMKKQVCGLCGLYDGNGDDKFETVDASMNP-IETDLDFIKIW-------LSVSRENRMKPDPAIQMVNCDLNEMA--------------TCAKVVSIFGSKFEEICYAEFCQ-MKNQ-KNS---------CELMRDIAFLSSPDNIVSDWRYKLD-CEEPNCPNKMIWSDCGNNCNNRCGFNNDDVDCSKVCTPGCYCRKDFFWYKNQCKRADECPCEYRASAKQIDSYKFGDKMKKGCQNCLCESRGLWKCDTHDQCSSRCIITGDPHFVTFDNQHIFVEGQCQYIAVMPKE-----IESDMPQLSIIVENKFCFNSEDITCAKGIKILFGEGLNQTEIEIKSKTEVIINSKLVTIPSKINKGVEISVFKVTSDGLKIEAGDLFSVFRKDDSRIELVLSAKYARKVTGLCGNFNGDPEDDNIMPDGAPAKDDSELAARYRLTQTCHGEVLRQSYLGLCETSIEWGKIANEVCGKFGQGQ-FKDCEALVPSDKFVTQCKHDVCNCGLLRNASTINCECSAYSAYARICSIKGIQFQWRTPEFCPVICP-KNMVYKECGSSCSATCRLRQRPNCDNDCIDGCQCPDDMVIEEKTGNCVKVEDCKCEYMGRDYNANEERKDRCNTCTCINGLWNCTTKDCSSQSYCPNGKVWKDCGGCQRTCRDMNLICDPNSCE-PGCYCESGEVYDNNKCIPKGECPCFWQNQSFNESAVITRGPFECQLSCTCRSGKWECPK-RDCEGLCKAWGESHYMSFDGKFFDFHGDCSYVLLEDYCNKKSGTFKIVIENVECGSKGTSCTKSIRFYYKDHIIHLIRGAAPIIGRNPTWSPYLGTGIFSKHDYVSSIVIITKE-LKIQWDRQLSVDVFLTPEYKNNVCGLCGNFDDNVDNDLRNRAGIIDADVNAFADSWKLKTSCPYPEISKNPCDINKFRESWAIKRCSILKSETFEPCHNTVRYQLYYDKCVQDSCACDRGDDCLCVCTAISQYVHECNRYNIKIQWRNYENCPIMCPPDREYKPCEKVCPETCIGTKSCISD-------CMEGCYCKNNTYLKDDECVSEKPLCTCKDE-SGKEYPLGTTVIKNCHKCTCQINGFECEKELIHNCL 1278          
BLAST of von Willebrand factor vs. Planmine SMEST
Match: SMESG000042718.1 (SMESG000042718.1)

HSP 1 Score: 369.007 bits (946), Expect = 1.355e-102
Identity = 384/1457 (26.36%), Postives = 597/1457 (40.97%), Query Frame = 2
Query:  287 GGCSNGGKCVAPNQCLCLDNYSGPNC---NTLLIKSS--------QSDV--------------------------------------SNYGAVTRVNNTMYSTYYECSVIYG-HHIKTFDGNVFSYPLRGGYTLFMDCLGAA---PLFYVYFNASYDCFDQKTQNDCSISMKITVGTQTI------ILF------PKNEFALVKNNKTKIPFNSEGIIVSSVGSFIKIK-GIDDLEILFDRDRNIYVYAPVTA-EKKICGLCGYFNGIMSDDYRDFNQVIQKNVKTFVNSWIDRDPSDLNVYREREQYPCNALKLKNNDQYQKALTLCQDMVKNNLGRTCQSEVKIDKYLDMCQDEICECLQTQPENSTIENCYSTFCKIEEQYSYACTLKGIAVDWRSATTICKQPQCFNGQEFSECGSNCGKNCGQLGMELE--CESQCLPGCYCPRNRYWDGTMCVPQEKCPCVRDNGESTYQQGYRLKLNCETCICGMHGKWQCIENEECEGRCFISGDPHYITFDRRHFFF-DGHCEYTAVMTTSDNVLLSNSTIAPLSITIQNTNCQDNSETGCPRTIGVIIGEDEDQVAINLLSSSEIKVN----FVKISLPYQHTGNTKVLID--------------------QVSTDILRLKSETGVEILWNGGSRIEIKLSKKYREKVTGMCGNFNGNEMDDSMTFKGVDEKDIDKFVLSWKTNPTCESDRGIVEYKGACALSRSYSDYANKVCHKLYESEEFKKCHSAANADKFFDQCTHDVCTCGMKRNGALDHCE-CEAFSSYARQCALENIN--LSWRTNEL--CPKKCPNENMKYNQCGSRCTSTCRLLQE---SKCKEECIEGCFCPEGETFDEAAKECVKISDCKCEFHGRFYLPYEIRQD-----RCNNCTCTNGNWICTSNDCEGKEFCPKSMAWFDCGICQKTCTNLDLVCPKGQCQLPGCFCPENTVLH-NGECIKPFECPCYMNNKMYSENDTIVRGPANCQNPCICKDGKW--VCEQNKQCSGICKTWGETHYESFDGKYFEFQGSCSYVISEDF--CGNKLGTFKLISENIACGXXXXXCTKSIKFIYLNRVFQFVRGSNPIVSRNTNYPPGGPTAFYWTSDVDTHFILFTMEGIQVKWDKAMSLEIMIPEKYQNKVCGLCGNFDLRIDNDMRARSGEIEKDIVNFADSWKVHSS-CP---------VPQKPPFMCSKRPDREPWAKAKCEILKSDS--FKKCHDVV--NVEHYYKRCVADACECDRGDDCVCFCTAVEQYVARCNEYEIGLKWRTNENCPHTCTGKRVWKNCGNICPDSCIDIGKNVTDNTGCKKVCIEGCFCPDGLHWQNNECVERKACECVDPITNLKYNTGDKVIRE-CEECNCYEGAFRCTKLFSKECLHTSRPEISTKPPHCVNEYEFLCPNNFC---ARRCNGIIECRDGEDEDLC 4267
            GGC NGG C++PNQC C +NY+G  C   N ++I+S         QSD                                       +N+     VNN  ++T +     YG  + +TFD  +++Y  R  Y L      +A    +  VY N + D         C   + I  G   +      IL+      P    + V N  + +      + V    +FI +     ++++ +D + NI++    +     + GLCG  +   S+D+ +F+     NV +F NS+      D+           N L     D    A   C  +     G  C   V  D Y  MC   IC   Q       I +     C     YS +C+ KG  + WRS T +C+  QC   + +S+C S C   C  L       C++  +  C C       G  C+  E CPC+ D  E  +  G   + +C TC C     W C E + C   C I G   + TFD   F F D  C+Y AV  + +N        A + + IQ+     N+E+        ++G + +   IN      +KVN     +K + P      T V ID                    +++     +K  +  ++ ++G   I IK+S   +  + G+CG F+GN  +D         + I     S+ T     + + IV+               N +C  +    EF  C +++  DK F   T+    C  +++   D    C A  + A  C    I   + + +N L  C   C      +  C   C STCR L E   SKC ++C  GC CP    +     +CV  S+C C    R   P EI         C  C C NG   C + D      CPK+  + D      +CTN D  C         C CP +TV   +G C++P +CPC   N+ Y+ ND I    A      IC +  W  + E+   C  +C  +G+ HY++ DG+ F FQGSC Y + +      N +    +   NIACG S ++C K ++ I   + +   RG+N  +     Y        ++T  V          G++V WD++  + + +   +Q  V GLCGN+D  + N+    + + E D + FA+S+  ++  CP          P K   MC+  PDR+ WA+  C ++K  +  F  C + +  +V  YY  C+ DAC C+RG DC C CT++  +  +C    I +KWRT   CP  C G + +  C + CP +C  IG N   +      C+EGC CP+G+   N ECV    C C        Y  G  +  E C++C C +  F CT+ +S +C+ T  P             +F C +  C   ++ C+ + +C + EDE  C
Sbjct:  151 GGCYNGGICMSPNQCKCQENYAGMQCDEDNPIIIQSQHPSQLYCYQSDQCFAFKKSDFLGKAVSYDECCADKTGSWGSQSGSCVSCKANFAGGNDVNNENFTTCHS----YGLDYYRTFDNQLYTYQGRCSYILTAPSDVSAVTWSINIVYENCTSDT-------GCVKVIVIEAGDVVVKSSGNGILYTTDSNNPLTPLS-VTNTDSALIIPGTPMYVLRQDNFILLSLEAGNIKLKWDNNNNIFISIHNSIYNGDVTGLCGNADNNPSNDFSNFD-----NVASFGNSFKGFGCPDI----------ANTLSTCKPDDQILANQQCSKIRLKFPG--CADLVNSDTYFSMCVQNICTKSQNSNTTLDIPSISDVLCTHLSAYSDSCSDKGSCIQWRSDT-LCET-QCPGNKIWSDCASECPVTCRNLFQTPSAYCQNSKVGRCICGSGEVEYGYTCIKPESCPCLYDGQE--HPPGTVRQFDCNTCTCN-SSLWHCTE-KICPSTCGIMGT-QFDTFDGAKFAFNDVGCQYVAVEPSVNNT----DDRANVFVIIQS-----NTES--------MLGTEGNSAYINEPKIVTVKVNGSDIILKATSPQLGDSQTNVFIDGEDHTTKLPFTIPDKNIHVRKLTNIYTEVKVSSHFKLYFDGSKSIYIKVSDALKNNLIGLCGKFDGNSENDFTEKDNSIRESIVNIAKSYITGSCDNTPQSIVDPPAG----------DNDICSTILNGPEFSGCMNSSKVDKEF-YATY----CRREQSSNKDQLSYCSAILNAAIACRRFGIQYEVPFTSNILQACIPLCQAGGTVFQICSRTCQSTCRELNEATASKCDDDCFPGCECPPNY-YKTGTGQCVSESECTCWNPSRPKDP-EIPAGTNITINCQTCVCINGRLNCKTKDNCTNPVCPKNQVYMDSVSGCNSCTNYD-TCTDTSSIANSCGCPNDTVSKIDGTCVQPSDCPCIYMNREYAPNDVITIKCAKY----ICSNRMWNLLSEETANCEAVCIAYGDPHYKTLDGQMFSFQGSCMYTLMDTPGDSSNNIPPITISVANIACGFSLATCAKFVQIIIGGQTYLLSRGNNDTIPLFPKYDIVIEQLTFFTQLVSDSI------GLRVLWDRSTRVYLFLKPSFQGNVQGLCGNYDGDLQNEYMHGTMKYE-DAIQFAESFIANADICPYEISPENNVAPSKEQDMCNANPDRKSWAEQMCGVMKDTNGVFASCIEAMHQDVNRYYSNCLYDACGCNRGGDCECLCTSLATFATQCAFLGIPVKWRTQNLCPIMCEGGKHYDACASPCPQTCDTIGSNAPSHCSTTH-CVEGCSCPNGMIDLNGECVPPTTCPCF--YNGQSYVNGAIIKMENCKKCQCVQAKFNCTEDYS-DCITTCTPS------------QFRCDDGKCIESSKICDKVTDCSNSEDEKNC 1509          
The following BLAST results are available for this feature:
BLAST of von Willebrand factor vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
VWF3.751e-14427.93von Willebrand factor [Source:HGNC Symbol;Acc:HGNC... [more]
MUC5AC5.554e-14128.67mucin 5AC, oligomeric mucus/gel-forming [Source:HG... [more]
MUC5AC5.554e-14128.67mucin 5AC, oligomeric mucus/gel-forming [Source:HG... [more]
MUC5B1.838e-13528.19mucin 5B, oligomeric mucus/gel-forming [Source:HGN... [more]
MUC24.033e-13129.21mucin 2, oligomeric mucus/gel-forming [Source:HGNC... [more]
back to top
BLAST of von Willebrand factor vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
T01D3.64.291e-1423.02pep chromosome:WBcel235:V:13716824:13720402:1 gene... [more]
T01D3.65.481e-1422.82pep chromosome:WBcel235:V:13716849:13720402:1 gene... [more]
apx-14.046e-1157.14Anterior pharynx in excess protein 1 [Source:UniP... [more]
ten-19.759e-1045.45Teneurin-1 [Source:UniProtKB/Swiss-Prot;Acc:G5EGQ... [more]
ten-19.786e-1045.45Teneurin-1 [Source:UniProtKB/Swiss-Prot;Acc:G5EGQ... [more]
back to top
BLAST of von Willebrand factor vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Hml8.255e-13028.30gene:FBgn0029167 transcript:FBtr0333020[more]
Hml1.032e-12928.30gene:FBgn0029167 transcript:FBtr0075753[more]
cv-22.967e-2925.89gene:FBgn0000395 transcript:FBtr0071610[more]
Ten-a1.107e-931.19gene:FBgn0267001 transcript:FBtr0300201[more]
Ten-a1.120e-931.19gene:FBgn0267001 transcript:FBtr0308221[more]
back to top
BLAST of von Willebrand factor vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
vwf5.020e-15428.45von Willebrand factor [Source:ZFIN;Acc:ZDB-GENE-07... [more]
vwf1.848e-15328.28von Willebrand factor [Source:ZFIN;Acc:ZDB-GENE-07... [more]
scospondin6.860e-14528.27subcommissural organ spondin [Source:ZFIN;Acc:ZDB-... [more]
CABZ01080550.12.517e-13328.46pep chromosome:GRCz11:25:8269956:8292650:1 gene:EN... [more]
otog2.203e-12427.51otogelin [Source:ZFIN;Acc:ZDB-GENE-120228-1][more]
back to top
BLAST of von Willebrand factor vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ndufs81.328e-16630.51NADH:ubiquinone oxidoreductase core subunit S8 [So... [more]
ndufs87.695e-16630.38NADH:ubiquinone oxidoreductase core subunit S8 [So... [more]
ndufs81.830e-16530.47NADH:ubiquinone oxidoreductase core subunit S8 [So... [more]
ndufs83.925e-16530.46NADH:ubiquinone oxidoreductase core subunit S8 [So... [more]
ndufs87.892e-16430.52NADH:ubiquinone oxidoreductase core subunit S8 [So... [more]
back to top
BLAST of von Willebrand factor vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Vwf4.312e-14928.24Von Willebrand factor [Source:MGI Symbol;Acc:MGI:9... [more]
Muc5ac4.530e-14129.04mucin 5, subtypes A and C, tracheobronchial/gastri... [more]
Muc5ac6.431e-14028.96mucin 5, subtypes A and C, tracheobronchial/gastri... [more]
Muc5ac6.431e-14028.96mucin 5, subtypes A and C, tracheobronchial/gastri... [more]
Muc5b1.047e-13328.14mucin 5, subtype B, tracheobronchial [Source:MGI S... [more]
back to top
BLAST of von Willebrand factor vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q28295|VWF_CANLF5.327e-14528.32von Willebrand factor OS=Canis lupus familiaris OX... [more]
sp|Q8CIZ8|VWF_MOUSE5.376e-14528.09von Willebrand factor OS=Mus musculus OX=10090 GN=... [more]
sp|P04275|VWF_HUMAN1.801e-14327.93von Willebrand factor OS=Homo sapiens OX=9606 GN=V... [more]
sp|P98088|MUC5A_HUMAN2.667e-14028.67Mucin-5AC OS=Homo sapiens OX=9606 GN=MUC5AC PE=1 S... [more]
sp|Q9HC84|MUC5B_HUMAN8.826e-13528.19Mucin-5B OS=Homo sapiens OX=9606 GN=MUC5B PE=1 SV=... [more]
back to top
BLAST of von Willebrand factor vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267GUZ71.260e-1441.47Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267DLR61.096e-1541.47Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
A0A1I8GY388.566e-1641.03Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8G0U96.542e-1540.94Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A0L8GSF52.210e-3737.74Uncharacterized protein OS=Octopus bimaculoides OX... [more]
back to top
BLAST of von Willebrand factor vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
vwf1.842e-15728.39von Willebrand factor [Source:NCBI gene;Acc:103041... [more]
scospondin2.548e-14228.33subcommissural organ spondin [Source:ZFIN;Acc:ZDB-... [more]
ENSAMXT00000041370.15.292e-13128.93pep primary_assembly:Astyanax_mexicanus-2.0:5:1809... [more]
ENSAMXT00000019204.21.852e-12828.78pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
otog1.995e-12627.10otogelin [Source:ZFIN;Acc:ZDB-GENE-120228-1][more]
back to top
BLAST of von Willebrand factor vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000008773.17.375e-13829.21pep scaffold:Pmarinus_7.0:GL476328:703641:749596:1... [more]
ENSPMAT00000010519.12.120e-12128.37pep scaffold:Pmarinus_7.0:GL477612:23664:47127:1 g... [more]
ENSPMAT00000008716.14.961e-10827.87pep scaffold:Pmarinus_7.0:GL476328:595486:663084:-... [more]
ENSPMAT00000008652.15.213e-10133.38pep scaffold:Pmarinus_7.0:GL477625:577100:586386:1... [more]
ENSPMAT00000005510.11.795e-8123.82pep scaffold:Pmarinus_7.0:GL476588:620363:669144:-... [more]
back to top
BLAST of von Willebrand factor vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of von Willebrand factor vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO441991.380e-10126.78Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO418773.097e-5937.54Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO418763.911e-5233.16Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO330613.586e-3431.77Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO496032.981e-741.67Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of von Willebrand factor vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
vwf2.210e-15928.81von Willebrand factor [Source:NCBI gene;Acc:101162... [more]
scospondin5.486e-12427.30SCO-spondin [Source:NCBI gene;Acc:101172449][more]
otog5.073e-10425.43otogelin [Source:NCBI gene;Acc:101158818][more]
FCGBP3.248e-7225.87Fc fragment of IgG binding protein [Source:NCBI ge... [more]
zanl1.934e-7022.95zonadhesin [Source:NCBI gene;Acc:101162078][more]
back to top
BLAST of von Willebrand factor vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000025547.10.000e+036.62SMESG000025547.1[more]
SMESG000041532.10.000e+036.77SMESG000041532.1[more]
SMESG000041532.10.000e+036.77SMESG000041532.1[more]
SMESG000041532.10.000e+036.77SMESG000041532.1[more]
SMESG000042718.11.355e-10226.36SMESG000042718.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30009111 ID=SMED30009111|Name=von Willebrand factor|organism=Schmidtea mediterranea sexual|type=transcript|length=5530bp
GCTCTTCATTGCTGAACGAGTAAAATTTTTATTTTCTCTTCGATAATTAA
ACATTTTTATCTTATCAATTACCAATAAATTCACTTACAAAATGGGTGTC
TACTTTGGGCCCCAAGTACTTGTTGTTATCATTGGATTCTGTTTGACGAC
GAATTTCCAAGTCTCTAAAGGATTCTTATTTACTAAATCTTGTTCACCGG
ACTGTGTCAATGGTGTATGTAAGGATGGAAGGTGCTCCTGCAGCCTAGGG
TGGCAAGGAAACAGATGCTCAGATCCTATTTGCGTTGGAGGATGTTCAAA
TGGAGGGAAATGCGTAGCTCCAAATCAATGTCTGTGCCTGGACAACTATT
CGGGTCCAAATTGTAATACCCTGTTGATAAAATCATCACAATCTGATGTC
AGCAACTATGGAGCTGTTACAAGGGTCAACAACACAATGTACAGTACCTA
CTATGAATGCAGCGTAATTTACGGACATCACATCAAAACCTTTGACGGAA
ACGTATTCAGTTATCCTTTGAGGGGAGGATATACATTATTTATGGACTGT
TTGGGAGCTGCACCACTTTTCTATGTATATTTCAATGCCAGTTATGACTG
CTTCGATCAAAAGACGCAGAATGATTGTTCAATATCTATGAAAATCACAG
TTGGGACTCAGACAATTATTCTATTCCCAAAAAATGAATTCGCACTTGTC
AAGAACAACAAAACCAAAATCCCTTTCAACTCTGAAGGAATCATAGTAAG
CTCTGTGGGGTCCTTCATTAAAATCAAAGGAATCGACGATTTGGAAATAC
TTTTTGATAGAGATCGAAATATTTATGTCTATGCACCAGTTACGGCTGAG
AAAAAGATTTGTGGACTTTGTGGATATTTTAATGGGATAATGAGTGACGA
TTACCGAGATTTCAATCAGGTCATTCAAAAAAATGTTAAAACCTTTGTCA
ACTCCTGGATTGATAGAGATCCCTCAGATCTAAACGTTTACCGTGAAAGA
GAACAGTATCCGTGTAACGCTCTTAAATTGAAAAATAATGACCAATATCA
AAAGGCTTTAACTCTGTGTCAAGACATGGTGAAAAACAATTTAGGACGGA
CTTGTCAAAGTGAAGTGAAAATAGATAAATATCTCGATATGTGCCAAGAT
GAAATATGTGAATGTTTACAAACTCAACCTGAAAATTCAACGATAGAAAA
CTGTTATTCAACCTTCTGTAAAATTGAGGAACAATATTCATACGCATGTA
CTCTTAAAGGCATTGCAGTCGACTGGAGATCCGCCACCACAATATGCAAA
CAGCCACAGTGTTTCAATGGACAAGAATTCTCTGAATGCGGATCTAATTG
CGGAAAGAATTGTGGACAATTAGGCATGGAATTGGAATGTGAAAGTCAAT
GCTTGCCAGGATGTTACTGTCCAAGAAACCGATATTGGGATGGGACTATG
TGCGTTCCCCAAGAGAAATGTCCATGCGTTAGAGATAATGGAGAGAGTAC
TTATCAACAAGGATACAGACTAAAGTTAAACTGTGAAACTTGCATTTGTG
GGATGCATGGGAAATGGCAGTGCATAGAAAATGAAGAATGCGAAGGTCGA
TGTTTCATTTCAGGAGATCCTCATTACATTACATTCGATAGAAGACATTT
CTTTTTTGACGGTCACTGCGAATATACGGCTGTCATGACAACCTCTGATA
ACGTTCTCCTGTCAAACTCGACAATTGCACCTTTATCAATAACGATCCAA
AATACAAATTGTCAAGACAATAGTGAGACAGGCTGCCCAAGAACAATTGG
TGTAATTATAGGAGAGGATGAAGATCAAGTTGCCATAAATTTATTAAGTT
CTTCCGAAATCAAAGTAAATTTTGTGAAAATTTCCTTACCTTATCAGCAT
ACTGGAAATACTAAAGTGCTTATCGACCAAGTTTCTACCGATATTTTAAG
ATTGAAATCCGAAACCGGTGTTGAAATTCTTTGGAATGGAGGATCGAGGA
TCGAAATCAAGCTTAGCAAAAAATATCGAGAAAAAGTCACTGGAATGTGT
GGTAACTTCAACGGAAACGAAATGGACGACAGTATGACCTTTAAAGGAGT
AGATGAAAAAGATATTGATAAATTCGTTCTGTCATGGAAAACTAATCCGA
CTTGTGAAAGCGATCGTGGAATAGTTGAATATAAAGGAGCTTGTGCTCTT
AGCCGAAGTTATTCTGATTACGCAAATAAAGTTTGTCATAAGCTTTACGA
AAGCGAAGAATTCAAGAAATGCCACTCTGCAGCGAATGCAGATAAATTTT
TTGATCAGTGTACTCATGATGTATGCACTTGTGGAATGAAAAGAAATGGG
GCCCTTGATCATTGTGAATGTGAAGCTTTTTCTAGCTATGCCAGACAATG
TGCTCTTGAAAATATCAATCTAAGTTGGAGAACGAACGAACTATGCCCGA
AAAAATGTCCAAATGAAAACATGAAGTACAACCAATGTGGATCTAGATGC
ACCTCGACTTGTAGATTGTTACAGGAATCAAAATGTAAAGAAGAATGCAT
TGAAGGTTGTTTCTGTCCGGAAGGAGAGACATTTGATGAAGCTGCCAAGG
AATGTGTAAAAATATCAGATTGCAAGTGTGAGTTTCATGGCCGATTTTAC
TTACCCTATGAGATCCGACAAGACCGTTGCAACAATTGTACATGCACAAA
CGGCAATTGGATTTGTACATCAAACGATTGTGAAGGAAAGGAGTTCTGTC
CAAAAAGCATGGCTTGGTTTGATTGTGGAATATGTCAGAAGACCTGTACA
AATCTTGATCTGGTATGTCCGAAAGGTCAATGTCAGCTCCCTGGATGTTT
CTGTCCTGAAAATACAGTTCTACATAATGGAGAATGCATTAAGCCATTTG
AATGCCCATGTTACATGAACAATAAAATGTACAGTGAAAATGACACAATA
GTAAGAGGACCTGCCAATTGTCAAAACCCATGTATTTGCAAGGACGGGAA
ATGGGTATGTGAGCAAAACAAACAGTGCAGTGGAATATGCAAAACATGGG
GAGAAACTCACTACGAATCATTTGATGGGAAATACTTTGAATTTCAAGGA
TCCTGTAGTTACGTAATTTCTGAGGATTTCTGTGGAAATAAACTCGGAAC
ATTCAAGCTGATTTCAGAAAATATTGCATGCGGCTCAAGTAGTAGTTCAT
GTACGAAATCAATCAAATTTATTTACTTGAATCGGGTTTTTCAATTCGTC
CGAGGGTCAAATCCAATAGTGTCGAGAAATACCAATTATCCGCCAGGAGG
ACCAACTGCGTTTTATTGGACGAGTGATGTTGATACTCATTTCATTTTGT
TTACCATGGAAGGAATTCAAGTCAAATGGGACAAAGCTATGTCACTAGAA
ATCATGATTCCAGAGAAATATCAAAATAAGGTTTGTGGACTTTGTGGAAA
CTTTGACTTAAGAATCGACAACGATATGAGAGCTCGATCCGGTGAGATTG
AGAAAGATATAGTAAATTTTGCTGACAGCTGGAAAGTTCACTCTTCTTGT
CCCGTGCCTCAGAAACCGCCGTTTATGTGTTCCAAACGACCCGATAGAGA
ACCATGGGCAAAGGCAAAATGTGAAATTCTAAAGTCAGATAGCTTCAAAA
AGTGTCATGATGTGGTAAATGTCGAACATTATTACAAAAGGTGCGTTGCA
GACGCTTGTGAGTGCGACAGAGGAGACGACTGTGTATGTTTCTGTACCGC
AGTCGAACAATACGTAGCAAGATGCAATGAGTATGAAATCGGCCTTAAAT
GGAGAACAAATGAAAATTGCCCCCATACTTGCACCGGAAAGAGAGTTTGG
AAGAATTGTGGAAACATATGCCCGGATAGCTGCATTGATATAGGAAAAAA
TGTCACGGACAATACAGGATGTAAAAAGGTTTGCATTGAAGGCTGTTTCT
GTCCCGATGGACTTCATTGGCAAAACAATGAATGCGTAGAGAGAAAAGCT
TGTGAATGCGTTGATCCGATCACCAATTTGAAGTACAATACGGGAGATAA
AGTTATTCGAGAATGCGAGGAATGCAATTGTTATGAAGGAGCATTTAGAT
GTACCAAACTTTTTTCCAAAGAATGTCTTCACACGTCAAGGCCCGAAATT
TCAACGAAACCACCACATTGTGTAAATGAATACGAATTTTTGTGTCCAAA
TAATTTTTGCGCTCGCCGATGTAACGGAATAATAGAATGTCGGGATGGAG
AAGATGAAGATCTATGCAGCACCACTCCAGTTCACATAACTACAACCAAA
ACTACAAATTACTGCATCACAGATCAAAATGAGATTATGAAGTCTGGAGA
AACGAAAATTGTTGATCAATGTATAAAATACATCTGCGACGACGGAAACA
TTGTAACGAAAACGAAGTTCTGTAACATAACTTGTGATGAGCATTCAGAG
ATACTCAAGCAACATGTAGATTCAGACAAATGCTGTGAATGTGTCTCAAT
AAGAACTACAACACTGATGGTCTCAGCGACAACCACTAGACTAGTGACAT
GCGAAATGTATACTTTAACTGTTGAAAAGAATTTCAACATTCTTTACAAA
CTAAAATCAGATTCAATTGGCAATTCAATAGAAAATGTTATTTACGACTC
TGATAAATCATGGACGGTCGTCTCAAATAATGCTGTCTTAATCGTTGAAT
TTCTTCCCAAGCAGCCAAATGAGATCAACTTAATTGCTGAAATTTCAATT
ATAGCAGAAAGTGTTTCGAATGTCATTATCGATATAGTAGAAAAAGATGA
TACTTGGAAAGACGCTGATTCTTATACACTAGCAAAGTCTTCAACAAAAG
ATGGAAACTTATTTTCATACACATTTACTAGTGCAACAAAAGACGGAATT
CCCGGTCGCTTTGTGCGATTTTCATTCATACTATCGAATCAAATCACAGA
GGTAATAGTCATTCGAAAATTAATGATAAAGATATGTGGAAGTCAAAAAA
CAACAGAAATCCAGCCGAGTTCGACATCTGGCATGGTCAGCTGTCCACCG
AAAGGTACGACAATTAGACAAAACGAATGCTTGATCACGATGTGTATCGA
CGGGGAATGGATAACGAAAATGAATTGTCCGATTTCTTGTTTGCCGGGGG
AAATCAAAGTGACTTATGACGACGAAAGATGCTGCCAATGCGTGAATGCG
AATCAAACGACAATTTCAATGCCTGTTATATCTTCAACAAAACTCGTATC
TACAAAGGGTCCGTGCAAACCCCCTCTGATTCACAAATGCATCGACGATT
GTGAAGGAATTTGCCACTATTTACAAGAGAATCAATGCCACAATTTACTA
ACATCAACGAATCGAATCTGCAAGGATGCTTGTGTCTGTCCGCAACAGAG
CCTGGAACGGAACCGCGTGCGTCGATACCAGGCAATGCGAATGCGTAGAT
AATGACGGGAAAATACGAAAGCCGAACGAAACGTGGACAGATCGATGCAA
TCAATACCGGTGTGTGGATAACCAGGTTGT
back to top

protein sequence of SMED30009111-orf-1

>SMED30009111-orf-1 ID=SMED30009111-orf-1|Name=SMED30009111-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1787bp
MGVYFGPQVLVVIIGFCLTTNFQVSKGFLFTKSCSPDCVNGVCKDGRCSC
SLGWQGNRCSDPICVGGCSNGGKCVAPNQCLCLDNYSGPNCNTLLIKSSQ
SDVSNYGAVTRVNNTMYSTYYECSVIYGHHIKTFDGNVFSYPLRGGYTLF
MDCLGAAPLFYVYFNASYDCFDQKTQNDCSISMKITVGTQTIILFPKNEF
ALVKNNKTKIPFNSEGIIVSSVGSFIKIKGIDDLEILFDRDRNIYVYAPV
TAEKKICGLCGYFNGIMSDDYRDFNQVIQKNVKTFVNSWIDRDPSDLNVY
REREQYPCNALKLKNNDQYQKALTLCQDMVKNNLGRTCQSEVKIDKYLDM
CQDEICECLQTQPENSTIENCYSTFCKIEEQYSYACTLKGIAVDWRSATT
ICKQPQCFNGQEFSECGSNCGKNCGQLGMELECESQCLPGCYCPRNRYWD
GTMCVPQEKCPCVRDNGESTYQQGYRLKLNCETCICGMHGKWQCIENEEC
EGRCFISGDPHYITFDRRHFFFDGHCEYTAVMTTSDNVLLSNSTIAPLSI
TIQNTNCQDNSETGCPRTIGVIIGEDEDQVAINLLSSSEIKVNFVKISLP
YQHTGNTKVLIDQVSTDILRLKSETGVEILWNGGSRIEIKLSKKYREKVT
GMCGNFNGNEMDDSMTFKGVDEKDIDKFVLSWKTNPTCESDRGIVEYKGA
CALSRSYSDYANKVCHKLYESEEFKKCHSAANADKFFDQCTHDVCTCGMK
RNGALDHCECEAFSSYARQCALENINLSWRTNELCPKKCPNENMKYNQCG
SRCTSTCRLLQESKCKEECIEGCFCPEGETFDEAAKECVKISDCKCEFHG
RFYLPYEIRQDRCNNCTCTNGNWICTSNDCEGKEFCPKSMAWFDCGICQK
TCTNLDLVCPKGQCQLPGCFCPENTVLHNGECIKPFECPCYMNNKMYSEN
DTIVRGPANCQNPCICKDGKWVCEQNKQCSGICKTWGETHYESFDGKYFE
FQGSCSYVISEDFCGNKLGTFKLISENIACGSSSSSCTKSIKFIYLNRVF
QFVRGSNPIVSRNTNYPPGGPTAFYWTSDVDTHFILFTMEGIQVKWDKAM
SLEIMIPEKYQNKVCGLCGNFDLRIDNDMRARSGEIEKDIVNFADSWKVH
SSCPVPQKPPFMCSKRPDREPWAKAKCEILKSDSFKKCHDVVNVEHYYKR
CVADACECDRGDDCVCFCTAVEQYVARCNEYEIGLKWRTNENCPHTCTGK
RVWKNCGNICPDSCIDIGKNVTDNTGCKKVCIEGCFCPDGLHWQNNECVE
RKACECVDPITNLKYNTGDKVIRECEECNCYEGAFRCTKLFSKECLHTSR
PEISTKPPHCVNEYEFLCPNNFCARRCNGIIECRDGEDEDLCSTTPVHIT
TTKTTNYCITDQNEIMKSGETKIVDQCIKYICDDGNIVTKTKFCNITCDE
HSEILKQHVDSDKCCECVSIRTTTLMVSATTTRLVTCEMYTLTVEKNFNI
LYKLKSDSIGNSIENVIYDSDKSWTVVSNNAVLIVEFLPKQPNEINLIAE
ISIIAESVSNVIIDIVEKDDTWKDADSYTLAKSSTKDGNLFSYTFTSATK
DGIPGRFVRFSFILSNQITEVIVIRKLMIKICGSQKTTEIQPSSTSGMVS
CPPKGTTIRQNECLITMCIDGEWITKMNCPISCLPGEIKVTYDDERCCQC
VNANQTTISMPVISSTKLVSTKGPCKPPLIHKCIDDCEGICHYLQENQCH
NLLTSTNRICKDACVCPQQSLERNRVRRYQAMRMRR*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0007599hemostasis
GO:0007155cell adhesion
GO:0007596blood coagulation
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
PLANA:0000420parapharyngeal region
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR036084Ser_inhib-like_sf
IPR000742EGF-like_dom
IPR002172LDrepeatLR_classA_rpt
IPR014853Unchr_dom_Cys-rich
IPR001846VWF_type-D
IPR002919TIL_dom
IPR013032EGF-like_CS
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
Vocabulary: cellular component
TermDefinition
GO:0005576extracellular region
GO:0005578proteinaceous extracellular matrix
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001846von Willebrand factor, type D domainSMARTSM00216VWD_2coord: 492..669
e-value: 4.3E-25
score: 99.4
coord: 972..1134
e-value: 3.9E-33
score: 126.1
coord: 112..276
e-value: 1.4E-9
score: 47.9
IPR001846von Willebrand factor, type D domainPFAMPF00094VWDcoord: 504..669
e-value: 2.3E-27
score: 96.2
coord: 983..1134
e-value: 5.5E-24
score: 85.2
coord: 123..272
e-value: 2.3E-18
score: 67.0
IPR001846von Willebrand factor, type D domainPROSITEPS51233VWFDcoord: 122..329
score: 25.98
IPR001846von Willebrand factor, type D domainPROSITEPS51233VWFDcoord: 982..1191
score: 39.576
IPR001846von Willebrand factor, type D domainPROSITEPS51233VWFDcoord: 503..730
score: 35.228
IPR014853Uncharacterised domain, cysteine-richSMARTSM00832c8_acoord: 1170..1244
e-value: 4.8E-25
score: 99.2
coord: 708..786
e-value: 8.8E-12
score: 55.1
IPR014853Uncharacterised domain, cysteine-richPFAMPF08742C8coord: 1176..1243
e-value: 2.3E-15
score: 56.8
coord: 715..785
e-value: 3.5E-14
score: 53.0
coord: 334..400
e-value: 1.9E-5
score: 25.0
IPR002172Low-density lipoprotein (LDL) receptor class A repeatSMARTSM00192LDLa_2coord: 1359..1394
e-value: 0.0093
score: 22.4
IPR000742EGF-like domainSMARTSM00181egf_5coord: 63..92
e-value: 0.87
score: 18.6
coord: 33..60
e-value: 0.17
score: 21.0
coord: 901..933
e-value: 200.0
score: 1.2
IPR000742EGF-like domainPROSITEPS50026EGF_3coord: 60..92
score: 12.059
NoneNo IPR availableGENE3DG3DSA:2.10.25.10coord: 777..881
e-value: 5.2E-20
score: 73.7
coord: 1234..1345
e-value: 9.5E-15
score: 56.8
coord: 395..501
e-value: 2.2E-13
score: 52.4
coord: 883..979
e-value: 5.2E-14
score: 54.4
NoneNo IPR availableGENE3DG3DSA:2.10.25.10coord: 17..94
e-value: 2.3E-17
score: 64.8
NoneNo IPR availablePANTHERPTHR11339:SF379coord: 34..486
NoneNo IPR availablePANTHERPTHR11339EXTRACELLULAR MATRIX GLYCOPROTEIN RELATEDcoord: 34..486
NoneNo IPR availablePANTHERPTHR11339:SF379coord: 898..1462
NoneNo IPR availablePANTHERPTHR11339EXTRACELLULAR MATRIX GLYCOPROTEIN RELATEDcoord: 898..1462
NoneNo IPR availablePANTHERPTHR11339:SF379coord: 469..1248
NoneNo IPR availablePANTHERPTHR11339EXTRACELLULAR MATRIX GLYCOPROTEIN RELATEDcoord: 469..1248
IPR002919Trypsin Inhibitor-like, cysteine rich domainPFAMPF01826TILcoord: 789..844
e-value: 4.7E-9
score: 36.4
coord: 407..460
e-value: 8.2E-8
score: 32.4
coord: 1247..1304
e-value: 3.8E-8
score: 33.5
IPR013032EGF-like, conserved sitePROSITEPS00022EGF_1coord: 80..91
IPR036084Serine protease inhibitor-like superfamilySUPERFAMILYSSF57567Serine protease inhibitorscoord: 885..940
IPR036084Serine protease inhibitor-like superfamilySUPERFAMILYSSF57567Serine protease inhibitorscoord: 406..460
IPR036084Serine protease inhibitor-like superfamilySUPERFAMILYSSF57567Serine protease inhibitorscoord: 792..844
IPR036084Serine protease inhibitor-like superfamilySUPERFAMILYSSF57567Serine protease inhibitorscoord: 1243..1306