cAMP-dependent protein kinase, catalytic subunit-like

Overview
NamecAMP-dependent protein kinase, catalytic subunit-like
Smed IDSMED30009106
Length (bp)1245
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of cAMP-dependent protein kinase, catalytic subunit-like (SMED30009106) t-SNE clustered cells

Violin plots show distribution of expression levels for cAMP-dependent protein kinase, catalytic subunit-like (SMED30009106) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of cAMP-dependent protein kinase, catalytic subunit-like (SMED30009106) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for cAMP-dependent protein kinase, catalytic subunit-like (SMED30009106) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30009106

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30009106SMESG000041798.1 Contig6448GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
parenchymal cellSMED30009106SMESG000041798.1 dd_Smed_v4_3838_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
enteric muscle cellSMED30009106SMESG000041798.1 dd_Smed_v4_3838_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of cAMP-dependent protein kinase, catalytic subunit-like vs. Ensembl Human
Match: PRKX (protein kinase X-linked [Source:HGNC Symbol;Acc:HGNC:9441])

HSP 1 Score: 410.994 bits (1055), Expect = 3.209e-142
Identity = 188/316 (59.49%), Postives = 247/316 (78.16%), Query Frame = 3
Query:  165 FTLKKVELLRTVGTGTFGRVMAVREKETNTYYALKILVIEDVIRMKQVEHVKNEKLILEKVNHPFIVNLFWTRHDVKFLYMLLEYICGGELFTYLRNQGKFNNETGLFFSCEIISALSYLHSLQIVYRDLKPENLLIDQNGHIKITDFGFAKVLRDRTYTMCGTPEYLAPEIIQGKGYNRAVDWWALGVLIYEMLVGNPPFFDDNPMNIYSKILSNKFDFPQNLVEPDARDLIRKLLVSDRTKRLGNMKDGTDDVLNHKWFANISWNDVLERKLKPVIMPQVTHVGDTRCYDKYDEQDWRKIPSCSTAAQEMFAEF 1112
            ++L+  + L TVGTGTFGRV  V+EK    ++ALK++ I DVIR+KQ +HV NEK +L++V+HPF++ LFWT HD +FLYML+EY+ GGELF+YLRN+G+F++ TGLF+S EII A+ YLHS +IVYRDLKPEN+L+D++GHIK+TDFGFAK L DRT+T+CGTPEYLAPE+IQ KG+ RAVDWWALG+LI+EML G PPFFDDNP  IY KIL+ K DFP++L +   +DLI+KLLV DRT+RLGNMK+G +DV +H+WF ++ W  V +RKLKP I+P++   GDT  ++ Y E DW           E+F  F
Sbjct:   44 YSLQDFDTLATVGTGTFGRVHLVKEKTAKHFFALKVMSIPDVIRLKQEQHVHNEKSVLKEVSHPFLIRLFWTWHDERFLYMLMEYVPGGELFSYLRNRGRFSSTTGLFYSAEIICAIEYLHSKEIVYRDLKPENILLDRDGHIKLTDFGFAKKLVDRTWTLCGTPEYLAPEVIQSKGHGRAVDWWALGILIFEMLSGFPPFFDDNPFGIYQKILAGKIDFPRHL-DFHVKDLIKKLLVVDRTRRLGNMKNGANDVKHHRWFRSVDWEAVPQRKLKPPIVPKIAGDGDTSNFETYPENDWDTAAPVPQKDLEIFKNF 358          
BLAST of cAMP-dependent protein kinase, catalytic subunit-like vs. Ensembl Human
Match: PRKACA (protein kinase cAMP-activated catalytic subunit alpha [Source:HGNC Symbol;Acc:HGNC:9380])

HSP 1 Score: 347.436 bits (890), Expect = 2.098e-117
Identity = 163/314 (51.91%), Postives = 224/314 (71.34%), Query Frame = 3
Query:  171 LKKVELLRTVGTGTFGRVMAVREKETNTYYALKILVIEDVIRMKQVEHVKNEKLILEKVNHPFIVNLFWTRHDVKFLYMLLEYICGGELFTYLRNQGKFNNETGLFFSCEIISALSYLHSLQIVYRDLKPENLLIDQNGHIKITDFGFAKVLRDRTYTMCGTPEYLAPEIIQGKGYNRAVDWWALGVLIYEMLVGNPPFFDDNPMNIYSKILSNKFDFPQNLVEPDARDLIRKLLVSDRTKRLGNMKDGTDDVLNHKWFANISWNDVLERKLKPVIMPQVTHVGDTRCYDKYDEQDWRKIPSCSTAAQEMFAEF 1112
            L + E ++T+GTG+FGRVM V+ KET  +YA+KIL  + V+++KQ+EH  NEK IL+ VN PF+V L ++  D   LYM++EY+ GGE+F++LR  G+F+     F++ +I+    YLHSL ++YRDLKPENLLIDQ G+I++TDFGFAK ++ RT+T+CGTPEYLAPEII  KGYN+AVDWWALGVLIYEM  G PPFF D P+ IY KI+S K  FP +    D +DL+R LL  D TKR GN+K+G +D+ NHKWFA   W  + +RK++   +P+    GDT  +D Y+E++ R   S +    + F+EF
Sbjct:   33 LDQFERIKTLGTGSFGRVMLVKHKETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHF-SSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIR--VSINEKCGKEFSEF 343          
BLAST of cAMP-dependent protein kinase, catalytic subunit-like vs. Ensembl Human
Match: PRKACA (protein kinase cAMP-activated catalytic subunit alpha [Source:HGNC Symbol;Acc:HGNC:9380])

HSP 1 Score: 347.436 bits (890), Expect = 2.098e-117
Identity = 163/314 (51.91%), Postives = 224/314 (71.34%), Query Frame = 3
Query:  171 LKKVELLRTVGTGTFGRVMAVREKETNTYYALKILVIEDVIRMKQVEHVKNEKLILEKVNHPFIVNLFWTRHDVKFLYMLLEYICGGELFTYLRNQGKFNNETGLFFSCEIISALSYLHSLQIVYRDLKPENLLIDQNGHIKITDFGFAKVLRDRTYTMCGTPEYLAPEIIQGKGYNRAVDWWALGVLIYEMLVGNPPFFDDNPMNIYSKILSNKFDFPQNLVEPDARDLIRKLLVSDRTKRLGNMKDGTDDVLNHKWFANISWNDVLERKLKPVIMPQVTHVGDTRCYDKYDEQDWRKIPSCSTAAQEMFAEF 1112
            L + E ++T+GTG+FGRVM V+ KET  +YA+KIL  + V+++KQ+EH  NEK IL+ VN PF+V L ++  D   LYM++EY+ GGE+F++LR  G+F+     F++ +I+    YLHSL ++YRDLKPENLLIDQ G+I++TDFGFAK ++ RT+T+CGTPEYLAPEII  KGYN+AVDWWALGVLIYEM  G PPFF D P+ IY KI+S K  FP +    D +DL+R LL  D TKR GN+K+G +D+ NHKWFA   W  + +RK++   +P+    GDT  +D Y+E++ R   S +    + F+EF
Sbjct:   33 LDQFERIKTLGTGSFGRVMLVKHKETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHF-SSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIR--VSINEKCGKEFSEF 343          
BLAST of cAMP-dependent protein kinase, catalytic subunit-like vs. Ensembl Human
Match: PRKACA (protein kinase cAMP-activated catalytic subunit alpha [Source:HGNC Symbol;Acc:HGNC:9380])

HSP 1 Score: 347.436 bits (890), Expect = 2.112e-117
Identity = 163/314 (51.91%), Postives = 224/314 (71.34%), Query Frame = 3
Query:  171 LKKVELLRTVGTGTFGRVMAVREKETNTYYALKILVIEDVIRMKQVEHVKNEKLILEKVNHPFIVNLFWTRHDVKFLYMLLEYICGGELFTYLRNQGKFNNETGLFFSCEIISALSYLHSLQIVYRDLKPENLLIDQNGHIKITDFGFAKVLRDRTYTMCGTPEYLAPEIIQGKGYNRAVDWWALGVLIYEMLVGNPPFFDDNPMNIYSKILSNKFDFPQNLVEPDARDLIRKLLVSDRTKRLGNMKDGTDDVLNHKWFANISWNDVLERKLKPVIMPQVTHVGDTRCYDKYDEQDWRKIPSCSTAAQEMFAEF 1112
            L + E ++T+GTG+FGRVM V+ KET  +YA+KIL  + V+++KQ+EH  NEK IL+ VN PF+V L ++  D   LYM++EY+ GGE+F++LR  G+F+     F++ +I+    YLHSL ++YRDLKPENLLIDQ G+I++TDFGFAK ++ RT+T+CGTPEYLAPEII  KGYN+AVDWWALGVLIYEM  G PPFF D P+ IY KI+S K  FP +    D +DL+R LL  D TKR GN+K+G +D+ NHKWFA   W  + +RK++   +P+    GDT  +D Y+E++ R   S +    + F+EF
Sbjct:   41 LDQFERIKTLGTGSFGRVMLVKHKETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHF-SSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIR--VSINEKCGKEFSEF 351          
BLAST of cAMP-dependent protein kinase, catalytic subunit-like vs. Ensembl Human
Match: PRKACA (protein kinase cAMP-activated catalytic subunit alpha [Source:HGNC Symbol;Acc:HGNC:9380])

HSP 1 Score: 347.436 bits (890), Expect = 2.112e-117
Identity = 163/314 (51.91%), Postives = 224/314 (71.34%), Query Frame = 3
Query:  171 LKKVELLRTVGTGTFGRVMAVREKETNTYYALKILVIEDVIRMKQVEHVKNEKLILEKVNHPFIVNLFWTRHDVKFLYMLLEYICGGELFTYLRNQGKFNNETGLFFSCEIISALSYLHSLQIVYRDLKPENLLIDQNGHIKITDFGFAKVLRDRTYTMCGTPEYLAPEIIQGKGYNRAVDWWALGVLIYEMLVGNPPFFDDNPMNIYSKILSNKFDFPQNLVEPDARDLIRKLLVSDRTKRLGNMKDGTDDVLNHKWFANISWNDVLERKLKPVIMPQVTHVGDTRCYDKYDEQDWRKIPSCSTAAQEMFAEF 1112
            L + E ++T+GTG+FGRVM V+ KET  +YA+KIL  + V+++KQ+EH  NEK IL+ VN PF+V L ++  D   LYM++EY+ GGE+F++LR  G+F+     F++ +I+    YLHSL ++YRDLKPENLLIDQ G+I++TDFGFAK ++ RT+T+CGTPEYLAPEII  KGYN+AVDWWALGVLIYEM  G PPFF D P+ IY KI+S K  FP +    D +DL+R LL  D TKR GN+K+G +D+ NHKWFA   W  + +RK++   +P+    GDT  +D Y+E++ R   S +    + F+EF
Sbjct:   41 LDQFERIKTLGTGSFGRVMLVKHKETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHF-SSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIR--VSINEKCGKEFSEF 351          
BLAST of cAMP-dependent protein kinase, catalytic subunit-like vs. Ensembl Celegans
Match: F47F2.1 (cAMP-dependent protein kinase, catalytic subunit-like [Source:UniProtKB/Swiss-Prot;Acc:Q7JP68])

HSP 1 Score: 351.288 bits (900), Expect = 1.229e-119
Identity = 162/319 (50.78%), Postives = 227/319 (71.16%), Query Frame = 3
Query:  156 RENFTLKKVELLRTVGTGTFGRVMAVREKETNTYYALKILVIEDVIRMKQVEHVKNEKLILEKVNHPFIVNLFWTRHDVKFLYMLLEYICGGELFTYLRNQGKFNNETGLFFSCEIISALSYLHSLQIVYRDLKPENLLIDQNGHIKITDFGFAKVLRDRTYTMCGTPEYLAPEIIQGKGYNRAVDWWALGVLIYEMLVGNPPFFDDNPMNIYSKILSNKFDFPQNLVEPDARDLIRKLLVSDRTKRLGNMKDGTDDVLNHKWFANISWNDVLERKLKPVIMPQVTHVGDTRCYDKYDEQDWRKIPSCSTAAQEMFAEF 1112
            RE+F+L ++E + T+G GTFGRV   R+K T  +YALK+L I  V+ M+Q +HV NEK +L ++ HPFIV ++ +  D   LYM++E++ GGE+F+YLR    F+N    F++ EI+ AL Y+HSL IVYRDLKPENL++ + GHIK+ DFGFAK LRDRTYT+CGTP+YLAPE +   G+N+ VDWWALG+LIYEM+VG PPF       IY  I+ +K  FP++     A+DL++KLL  DRT+R+G MK+GT DV +HKWF  ++W+D L  +++P I+P + H GDT  +D Y E+D    P CS   +++FAE+
Sbjct:    9 RESFSLSQLERIITIGKGTFGRVELARDKITGAHYALKVLNIRRVVDMRQTQHVHNEKRVLLQLKHPFIVKMYASEKDSNHLYMIMEFVPGGEMFSYLRASRSFSNSMARFYASEIVCALEYIHSLGIVYRDLKPENLMLSKEGHIKMADFGFAKELRDRTYTICGTPDYLAPESLARTGHNKGVDWWALGILIYEMMVGKPPFRGKTTSEIYDAIIEHKLKFPRSF-NLAAKDLVKKLLEVDRTQRIGCMKNGTQDVKDHKWFEKVNWDDTLHLRVEPPIVPTLYHPGDTGNFDDY-EEDTTGGPLCSQRDRDLFAEW 325          
BLAST of cAMP-dependent protein kinase, catalytic subunit-like vs. Ensembl Celegans
Match: F47F2.1 (cAMP-dependent protein kinase, catalytic subunit-like [Source:UniProtKB/Swiss-Prot;Acc:Q7JP68])

HSP 1 Score: 351.288 bits (900), Expect = 1.229e-119
Identity = 162/319 (50.78%), Postives = 227/319 (71.16%), Query Frame = 3
Query:  156 RENFTLKKVELLRTVGTGTFGRVMAVREKETNTYYALKILVIEDVIRMKQVEHVKNEKLILEKVNHPFIVNLFWTRHDVKFLYMLLEYICGGELFTYLRNQGKFNNETGLFFSCEIISALSYLHSLQIVYRDLKPENLLIDQNGHIKITDFGFAKVLRDRTYTMCGTPEYLAPEIIQGKGYNRAVDWWALGVLIYEMLVGNPPFFDDNPMNIYSKILSNKFDFPQNLVEPDARDLIRKLLVSDRTKRLGNMKDGTDDVLNHKWFANISWNDVLERKLKPVIMPQVTHVGDTRCYDKYDEQDWRKIPSCSTAAQEMFAEF 1112
            RE+F+L ++E + T+G GTFGRV   R+K T  +YALK+L I  V+ M+Q +HV NEK +L ++ HPFIV ++ +  D   LYM++E++ GGE+F+YLR    F+N    F++ EI+ AL Y+HSL IVYRDLKPENL++ + GHIK+ DFGFAK LRDRTYT+CGTP+YLAPE +   G+N+ VDWWALG+LIYEM+VG PPF       IY  I+ +K  FP++     A+DL++KLL  DRT+R+G MK+GT DV +HKWF  ++W+D L  +++P I+P + H GDT  +D Y E+D    P CS   +++FAE+
Sbjct:    9 RESFSLSQLERIITIGKGTFGRVELARDKITGAHYALKVLNIRRVVDMRQTQHVHNEKRVLLQLKHPFIVKMYASEKDSNHLYMIMEFVPGGEMFSYLRASRSFSNSMARFYASEIVCALEYIHSLGIVYRDLKPENLMLSKEGHIKMADFGFAKELRDRTYTICGTPDYLAPESLARTGHNKGVDWWALGILIYEMMVGKPPFRGKTTSEIYDAIIEHKLKFPRSF-NLAAKDLVKKLLEVDRTQRIGCMKNGTQDVKDHKWFEKVNWDDTLHLRVEPPIVPTLYHPGDTGNFDDY-EEDTTGGPLCSQRDRDLFAEW 325          
BLAST of cAMP-dependent protein kinase, catalytic subunit-like vs. Ensembl Celegans
Match: F47F2.1 (cAMP-dependent protein kinase, catalytic subunit-like [Source:UniProtKB/Swiss-Prot;Acc:Q7JP68])

HSP 1 Score: 351.288 bits (900), Expect = 1.229e-119
Identity = 162/319 (50.78%), Postives = 227/319 (71.16%), Query Frame = 3
Query:  156 RENFTLKKVELLRTVGTGTFGRVMAVREKETNTYYALKILVIEDVIRMKQVEHVKNEKLILEKVNHPFIVNLFWTRHDVKFLYMLLEYICGGELFTYLRNQGKFNNETGLFFSCEIISALSYLHSLQIVYRDLKPENLLIDQNGHIKITDFGFAKVLRDRTYTMCGTPEYLAPEIIQGKGYNRAVDWWALGVLIYEMLVGNPPFFDDNPMNIYSKILSNKFDFPQNLVEPDARDLIRKLLVSDRTKRLGNMKDGTDDVLNHKWFANISWNDVLERKLKPVIMPQVTHVGDTRCYDKYDEQDWRKIPSCSTAAQEMFAEF 1112
            RE+F+L ++E + T+G GTFGRV   R+K T  +YALK+L I  V+ M+Q +HV NEK +L ++ HPFIV ++ +  D   LYM++E++ GGE+F+YLR    F+N    F++ EI+ AL Y+HSL IVYRDLKPENL++ + GHIK+ DFGFAK LRDRTYT+CGTP+YLAPE +   G+N+ VDWWALG+LIYEM+VG PPF       IY  I+ +K  FP++     A+DL++KLL  DRT+R+G MK+GT DV +HKWF  ++W+D L  +++P I+P + H GDT  +D Y E+D    P CS   +++FAE+
Sbjct:    9 RESFSLSQLERIITIGKGTFGRVELARDKITGAHYALKVLNIRRVVDMRQTQHVHNEKRVLLQLKHPFIVKMYASEKDSNHLYMIMEFVPGGEMFSYLRASRSFSNSMARFYASEIVCALEYIHSLGIVYRDLKPENLMLSKEGHIKMADFGFAKELRDRTYTICGTPDYLAPESLARTGHNKGVDWWALGILIYEMMVGKPPFRGKTTSEIYDAIIEHKLKFPRSF-NLAAKDLVKKLLEVDRTQRIGCMKNGTQDVKDHKWFEKVNWDDTLHLRVEPPIVPTLYHPGDTGNFDDY-EEDTTGGPLCSQRDRDLFAEW 325          
BLAST of cAMP-dependent protein kinase, catalytic subunit-like vs. Ensembl Celegans
Match: F47F2.1 (cAMP-dependent protein kinase, catalytic subunit-like [Source:UniProtKB/Swiss-Prot;Acc:Q7JP68])

HSP 1 Score: 350.903 bits (899), Expect = 1.770e-118
Identity = 162/319 (50.78%), Postives = 227/319 (71.16%), Query Frame = 3
Query:  156 RENFTLKKVELLRTVGTGTFGRVMAVREKETNTYYALKILVIEDVIRMKQVEHVKNEKLILEKVNHPFIVNLFWTRHDVKFLYMLLEYICGGELFTYLRNQGKFNNETGLFFSCEIISALSYLHSLQIVYRDLKPENLLIDQNGHIKITDFGFAKVLRDRTYTMCGTPEYLAPEIIQGKGYNRAVDWWALGVLIYEMLVGNPPFFDDNPMNIYSKILSNKFDFPQNLVEPDARDLIRKLLVSDRTKRLGNMKDGTDDVLNHKWFANISWNDVLERKLKPVIMPQVTHVGDTRCYDKYDEQDWRKIPSCSTAAQEMFAEF 1112
            RE+F+L ++E + T+G GTFGRV   R+K T  +YALK+L I  V+ M+Q +HV NEK +L ++ HPFIV ++ +  D   LYM++E++ GGE+F+YLR    F+N    F++ EI+ AL Y+HSL IVYRDLKPENL++ + GHIK+ DFGFAK LRDRTYT+CGTP+YLAPE +   G+N+ VDWWALG+LIYEM+VG PPF       IY  I+ +K  FP++     A+DL++KLL  DRT+R+G MK+GT DV +HKWF  ++W+D L  +++P I+P + H GDT  +D Y E+D    P CS   +++FAE+
Sbjct:   82 RESFSLSQLERIITIGKGTFGRVELARDKITGAHYALKVLNIRRVVDMRQTQHVHNEKRVLLQLKHPFIVKMYASEKDSNHLYMIMEFVPGGEMFSYLRASRSFSNSMARFYASEIVCALEYIHSLGIVYRDLKPENLMLSKEGHIKMADFGFAKELRDRTYTICGTPDYLAPESLARTGHNKGVDWWALGILIYEMMVGKPPFRGKTTSEIYDAIIEHKLKFPRSF-NLAAKDLVKKLLEVDRTQRIGCMKNGTQDVKDHKWFEKVNWDDTLHLRVEPPIVPTLYHPGDTGNFDDY-EEDTTGGPLCSQRDRDLFAEW 398          
BLAST of cAMP-dependent protein kinase, catalytic subunit-like vs. Ensembl Celegans
Match: kin-1 (cAMP-dependent protein kinase catalytic subunit [Source:UniProtKB/Swiss-Prot;Acc:P21137])

HSP 1 Score: 339.347 bits (869), Expect = 1.215e-114
Identity = 160/314 (50.96%), Postives = 222/314 (70.70%), Query Frame = 3
Query:  171 LKKVELLRTVGTGTFGRVMAVREKETNTYYALKILVIEDVIRMKQVEHVKNEKLILEKVNHPFIVNLFWTRHDVKFLYMLLEYICGGELFTYLRNQGKFNNETGLFFSCEIISALSYLHSLQIVYRDLKPENLLIDQNGHIKITDFGFAKVLRDRTYTMCGTPEYLAPEIIQGKGYNRAVDWWALGVLIYEMLVGNPPFFDDNPMNIYSKILSNKFDFPQNLVEPDARDLIRKLLVSDRTKRLGNMKDGTDDVLNHKWFANISWNDVLERKLKPVIMPQVTHVGDTRCYDKYDEQDWRKIPSCSTAAQEMFAEF 1112
            L   + ++T+GTG+FGRVM V+ K++  YYA+KIL  + V+++KQVEH  NEK IL+ ++ PF+VN+ ++  D   LYM+LE+I GGE+F++LR  G+F+     F++ +I+ A  YLHSL ++YRDLKPENLLID  G++KITDFGFAK ++ RT+T+CGTPEYLAPEII  KGYN+AVDWWALGVLIYEM  G PPFF D P+ IY KI+S K  FP +    + +DL++ LL  D TKR GN+K+G  D+ NHKWF +  W  + ++K++   +P+    GD   +D Y+E+  R I      A+E FAEF
Sbjct:   39 LDDFDRIKTLGTGSFGRVMLVKHKQSGNYYAMKILDKQKVVKLKQVEHTLNEKRILQAIDFPFLVNMTFSFKDNSNLYMVLEFISGGEMFSHLRRIGRFSEPHSRFYAAQIVLAFEYLHSLDLIYRDLKPENLLIDSTGYLKITDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVKFPSHFSN-ELKDLLKNLLQVDLTKRYGNLKNGVADIKNHKWFGSTDWIAIYQKKIEAPFLPKCRGPGDASNFDDYEEEPLR-ISGTEKCAKE-FAEF 349          
BLAST of cAMP-dependent protein kinase, catalytic subunit-like vs. Ensembl Fly
Match: Pka-C3 (gene:FBgn0000489 transcript:FBtr0075529)

HSP 1 Score: 417.157 bits (1071), Expect = 7.730e-143
Identity = 189/316 (59.81%), Postives = 251/316 (79.43%), Query Frame = 3
Query:  165 FTLKKVELLRTVGTGTFGRVMAVREKETNTYYALKILVIEDVIRMKQVEHVKNEKLILEKVNHPFIVNLFWTRHDVKFLYMLLEYICGGELFTYLRNQGKFNNETGLFFSCEIISALSYLHSLQIVYRDLKPENLLIDQNGHIKITDFGFAKVLRDRTYTMCGTPEYLAPEIIQGKGYNRAVDWWALGVLIYEMLVGNPPFFDDNPMNIYSKILSNKFDFPQNLVEPDARDLIRKLLVSDRTKRLGNMKDGTDDVLNHKWFANISWNDVLERKLKPVIMPQVTHVGDTRCYDKYDEQDWRKIPSCSTAAQEMFAEF 1112
            + L   ++++TVGTGTFGRV   R++ +  Y A+KIL + +VIR+KQ+EHVKNE+ IL ++ HPF+++L W+  D   LYM+ +Y+CGGELFTYLRN GKF ++T  F++ EI+SAL YLHSLQIVYRDLKPENLLI+++GH+KITDFGFAK LRDRT+T+CGTPEY+APEIIQ KG+N+AVDWWALGVLIYEMLVG PPF+D+ P  IY KILS K ++ +++ +P A+DLI+KLLV+DRTKRLGNMK+G DDV  H+WF +++WNDV  +KLKP I+P V H GDT+ +D Y E+DW+   +      + F +F
Sbjct:  186 YHLDDYQIIKTVGTGTFGRVCLCRDRISEKYCAMKILAMTEVIRLKQIEHVKNERNILREIRHPFVISLEWSTKDDSNLYMIFDYVCGGELFTYLRNAGKFTSQTSNFYAAEIVSALEYLHSLQIVYRDLKPENLLINRDGHLKITDFGFAKKLRDRTWTLCGTPEYIAPEIIQSKGHNKAVDWWALGVLIYEMLVGYPPFYDEQPFGIYEKILSGKIEWERHM-DPIAKDLIKKLLVNDRTKRLGNMKNGADDVKRHRWFKHLNWNDVYSKKLKPPILPDVHHDGDTKNFDDYPEKDWKPAKAVDQRDLQYFNDF 500          
BLAST of cAMP-dependent protein kinase, catalytic subunit-like vs. Ensembl Fly
Match: Pka-C3 (gene:FBgn0000489 transcript:FBtr0075528)

HSP 1 Score: 417.157 bits (1071), Expect = 9.253e-142
Identity = 189/316 (59.81%), Postives = 251/316 (79.43%), Query Frame = 3
Query:  165 FTLKKVELLRTVGTGTFGRVMAVREKETNTYYALKILVIEDVIRMKQVEHVKNEKLILEKVNHPFIVNLFWTRHDVKFLYMLLEYICGGELFTYLRNQGKFNNETGLFFSCEIISALSYLHSLQIVYRDLKPENLLIDQNGHIKITDFGFAKVLRDRTYTMCGTPEYLAPEIIQGKGYNRAVDWWALGVLIYEMLVGNPPFFDDNPMNIYSKILSNKFDFPQNLVEPDARDLIRKLLVSDRTKRLGNMKDGTDDVLNHKWFANISWNDVLERKLKPVIMPQVTHVGDTRCYDKYDEQDWRKIPSCSTAAQEMFAEF 1112
            + L   ++++TVGTGTFGRV   R++ +  Y A+KIL + +VIR+KQ+EHVKNE+ IL ++ HPF+++L W+  D   LYM+ +Y+CGGELFTYLRN GKF ++T  F++ EI+SAL YLHSLQIVYRDLKPENLLI+++GH+KITDFGFAK LRDRT+T+CGTPEY+APEIIQ KG+N+AVDWWALGVLIYEMLVG PPF+D+ P  IY KILS K ++ +++ +P A+DLI+KLLV+DRTKRLGNMK+G DDV  H+WF +++WNDV  +KLKP I+P V H GDT+ +D Y E+DW+   +      + F +F
Sbjct:  269 YHLDDYQIIKTVGTGTFGRVCLCRDRISEKYCAMKILAMTEVIRLKQIEHVKNERNILREIRHPFVISLEWSTKDDSNLYMIFDYVCGGELFTYLRNAGKFTSQTSNFYAAEIVSALEYLHSLQIVYRDLKPENLLINRDGHLKITDFGFAKKLRDRTWTLCGTPEYIAPEIIQSKGHNKAVDWWALGVLIYEMLVGYPPFYDEQPFGIYEKILSGKIEWERHM-DPIAKDLIKKLLVNDRTKRLGNMKNGADDVKRHRWFKHLNWNDVYSKKLKPPILPDVHHDGDTKNFDDYPEKDWKPAKAVDQRDLQYFNDF 583          
BLAST of cAMP-dependent protein kinase, catalytic subunit-like vs. Ensembl Fly
Match: Pka-C1 (gene:FBgn0000273 transcript:FBtr0335495)

HSP 1 Score: 339.732 bits (870), Expect = 1.371e-114
Identity = 163/315 (51.75%), Postives = 220/315 (69.84%), Query Frame = 3
Query:  168 TLKKVELLRTVGTGTFGRVMAVREKETNTYYALKILVIEDVIRMKQVEHVKNEKLILEKVNHPFIVNLFWTRHDVKFLYMLLEYICGGELFTYLRNQGKFNNETGLFFSCEIISALSYLHSLQIVYRDLKPENLLIDQNGHIKITDFGFAKVLRDRTYTMCGTPEYLAPEIIQGKGYNRAVDWWALGVLIYEMLVGNPPFFDDNPMNIYSKILSNKFDFPQNLVEPDARDLIRKLLVSDRTKRLGNMKDGTDDVLNHKWFANISWNDVLERKLKPVIMPQVTHVGDTRCYDKYDEQDWRKIPSCSTAAQEMFAEF 1112
             L   E ++T+GTG+FGRVM V+ K T  YYA+KIL  + V+++KQVEH  NEK IL+ +  PF+V+L +   D   LYM+LEY+ GGE+F++LR  G+F+     F++ +I+ A  YLH L ++YRDLKPENLLID  G++K+TDFGFAK ++ RT+T+CGTPEYLAPEII  KGYN+AVDWWALGVL+YEM  G PPFF D P+ IY KI+S K  FP +    D +DL+R LL  D TKR GN+K G +D+ N KWFA+  W  + ++K++   +P+    GDT  +D Y+E+  R I S    A+E FAEF
Sbjct:   42 ALDDFERIKTLGTGSFGRVMIVQHKPTKDYYAMKILDKQKVVKLKQVEHTLNEKRILQAIQFPFLVSLRYHFKDNSNLYMVLEYVPGGEMFSHLRKVGRFSEPHSRFYAAQIVLAFEYLHYLDLIYRDLKPENLLIDSQGYLKVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLVYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFGS-DLKDLLRNLLQVDLTKRYGNLKAGVNDIKNQKWFASTDWIAIFQKKIEAPFIPRCKGPGDTSNFDDYEEEALR-ISSTEKCAKE-FAEF 353          
BLAST of cAMP-dependent protein kinase, catalytic subunit-like vs. Ensembl Fly
Match: Pka-C1 (gene:FBgn0000273 transcript:FBtr0079852)

HSP 1 Score: 339.732 bits (870), Expect = 1.371e-114
Identity = 163/315 (51.75%), Postives = 220/315 (69.84%), Query Frame = 3
Query:  168 TLKKVELLRTVGTGTFGRVMAVREKETNTYYALKILVIEDVIRMKQVEHVKNEKLILEKVNHPFIVNLFWTRHDVKFLYMLLEYICGGELFTYLRNQGKFNNETGLFFSCEIISALSYLHSLQIVYRDLKPENLLIDQNGHIKITDFGFAKVLRDRTYTMCGTPEYLAPEIIQGKGYNRAVDWWALGVLIYEMLVGNPPFFDDNPMNIYSKILSNKFDFPQNLVEPDARDLIRKLLVSDRTKRLGNMKDGTDDVLNHKWFANISWNDVLERKLKPVIMPQVTHVGDTRCYDKYDEQDWRKIPSCSTAAQEMFAEF 1112
             L   E ++T+GTG+FGRVM V+ K T  YYA+KIL  + V+++KQVEH  NEK IL+ +  PF+V+L +   D   LYM+LEY+ GGE+F++LR  G+F+     F++ +I+ A  YLH L ++YRDLKPENLLID  G++K+TDFGFAK ++ RT+T+CGTPEYLAPEII  KGYN+AVDWWALGVL+YEM  G PPFF D P+ IY KI+S K  FP +    D +DL+R LL  D TKR GN+K G +D+ N KWFA+  W  + ++K++   +P+    GDT  +D Y+E+  R I S    A+E FAEF
Sbjct:   42 ALDDFERIKTLGTGSFGRVMIVQHKPTKDYYAMKILDKQKVVKLKQVEHTLNEKRILQAIQFPFLVSLRYHFKDNSNLYMVLEYVPGGEMFSHLRKVGRFSEPHSRFYAAQIVLAFEYLHYLDLIYRDLKPENLLIDSQGYLKVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLVYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFGS-DLKDLLRNLLQVDLTKRYGNLKAGVNDIKNQKWFASTDWIAIFQKKIEAPFIPRCKGPGDTSNFDDYEEEALR-ISSTEKCAKE-FAEF 353          
BLAST of cAMP-dependent protein kinase, catalytic subunit-like vs. Ensembl Fly
Match: Pka-C1 (gene:FBgn0000273 transcript:FBtr0079851)

HSP 1 Score: 339.732 bits (870), Expect = 1.371e-114
Identity = 163/315 (51.75%), Postives = 220/315 (69.84%), Query Frame = 3
Query:  168 TLKKVELLRTVGTGTFGRVMAVREKETNTYYALKILVIEDVIRMKQVEHVKNEKLILEKVNHPFIVNLFWTRHDVKFLYMLLEYICGGELFTYLRNQGKFNNETGLFFSCEIISALSYLHSLQIVYRDLKPENLLIDQNGHIKITDFGFAKVLRDRTYTMCGTPEYLAPEIIQGKGYNRAVDWWALGVLIYEMLVGNPPFFDDNPMNIYSKILSNKFDFPQNLVEPDARDLIRKLLVSDRTKRLGNMKDGTDDVLNHKWFANISWNDVLERKLKPVIMPQVTHVGDTRCYDKYDEQDWRKIPSCSTAAQEMFAEF 1112
             L   E ++T+GTG+FGRVM V+ K T  YYA+KIL  + V+++KQVEH  NEK IL+ +  PF+V+L +   D   LYM+LEY+ GGE+F++LR  G+F+     F++ +I+ A  YLH L ++YRDLKPENLLID  G++K+TDFGFAK ++ RT+T+CGTPEYLAPEII  KGYN+AVDWWALGVL+YEM  G PPFF D P+ IY KI+S K  FP +    D +DL+R LL  D TKR GN+K G +D+ N KWFA+  W  + ++K++   +P+    GDT  +D Y+E+  R I S    A+E FAEF
Sbjct:   42 ALDDFERIKTLGTGSFGRVMIVQHKPTKDYYAMKILDKQKVVKLKQVEHTLNEKRILQAIQFPFLVSLRYHFKDNSNLYMVLEYVPGGEMFSHLRKVGRFSEPHSRFYAAQIVLAFEYLHYLDLIYRDLKPENLLIDSQGYLKVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLVYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFGS-DLKDLLRNLLQVDLTKRYGNLKAGVNDIKNQKWFASTDWIAIFQKKIEAPFIPRCKGPGDTSNFDDYEEEALR-ISSTEKCAKE-FAEF 353          
BLAST of cAMP-dependent protein kinase, catalytic subunit-like vs. Ensembl Zebrafish
Match: prkx (protein kinase X-linked [Source:ZFIN;Acc:ZDB-GENE-090313-408])

HSP 1 Score: 414.075 bits (1063), Expect = 1.275e-143
Identity = 187/316 (59.18%), Postives = 247/316 (78.16%), Query Frame = 3
Query:  165 FTLKKVELLRTVGTGTFGRVMAVREKETNTYYALKILVIEDVIRMKQVEHVKNEKLILEKVNHPFIVNLFWTRHDVKFLYMLLEYICGGELFTYLRNQGKFNNETGLFFSCEIISALSYLHSLQIVYRDLKPENLLIDQNGHIKITDFGFAKVLRDRTYTMCGTPEYLAPEIIQGKGYNRAVDWWALGVLIYEMLVGNPPFFDDNPMNIYSKILSNKFDFPQNLVEPDARDLIRKLLVSDRTKRLGNMKDGTDDVLNHKWFANISWNDVLERKLKPVIMPQVTHVGDTRCYDKYDEQDWRKIPSCSTAAQEMFAEF 1112
            +TL  ++ + TVGTGTFGRV  V++K+T  ++ALK + I DVIR+KQ +HV NEK +L +VNHPF+V LFWT HD +FLYML+EY+ GGELF+YLR++G F+N TG+F+S EI+ A+ YLHS +IVYRDLKPEN+L+D  GHI++TDFGFAK L +RT+T+CGTPEYLAPE+IQ KG+ RAVDWWALGVLI+EML G PPFFDDNP  IY KIL+ K +FP++L +   +DLI+K LV+DR +RLGNMK+G DDV  H+WF +++W  V  RKLKP I+P+V+H GDT  +D Y +++W+K         E+F  F
Sbjct:   43 YTLDDLDTIATVGTGTFGRVFLVKDKKTRGFFALKAMKIPDVIRLKQEQHVHNEKEVLTEVNHPFLVRLFWTHHDDRFLYMLMEYVNGGELFSYLRSRGHFSNSTGMFYSAEIVCAIEYLHSKEIVYRDLKPENILLDSEGHIRLTDFGFAKKLSERTWTLCGTPEYLAPEVIQSKGHGRAVDWWALGVLIFEMLAGYPPFFDDNPFGIYQKILAGKLEFPRHL-DLYVKDLIKKFLVTDRERRLGNMKNGADDVKKHRWFKSVNWESVPCRKLKPPIVPKVSHEGDTSNFDSYPDEEWKKDTPVPAKDLEIFKNF 357          
BLAST of cAMP-dependent protein kinase, catalytic subunit-like vs. Ensembl Zebrafish
Match: prkacbb (protein kinase, cAMP-dependent, catalytic, beta b [Source:ZFIN;Acc:ZDB-GENE-050904-4])

HSP 1 Score: 342.813 bits (878), Expect = 1.042e-115
Identity = 165/331 (49.85%), Postives = 228/331 (68.88%), Query Frame = 3
Query:  120 SENCENDKPNFDRENFTLKKVELLRTVGTGTFGRVMAVREKETNTYYALKILVIEDVIRMKQVEHVKNEKLILEKVNHPFIVNLFWTRHDVKFLYMLLEYICGGELFTYLRNQGKFNNETGLFFSCEIISALSYLHSLQIVYRDLKPENLLIDQNGHIKITDFGFAKVLRDRTYTMCGTPEYLAPEIIQGKGYNRAVDWWALGVLIYEMLVGNPPFFDDNPMNIYSKILSNKFDFPQNLVEPDARDLIRKLLVSDRTKRLGNMKDGTDDVLNHKWFANISWNDVLERKLKPVIMPQVTHVGDTRCYDKYDEQDWRKIPSCSTAAQEMFAEF 1112
            S  C +D   FDR+          +T+GTG+FGRV+ V+ K ++ YYA+K+L  + V+++KQVEH  NEK IL+ V+ PF+V L +   D   LYM++EY+ GGE+F++LR  G+F+     F++ +I+    YLHSL ++YRDLKPENLLIDQ+G+I++TDFGFAK ++ RT+T+CGTPEYLAPEII  KGYN+AVDWWALGVLIYEM  G PPFF D P+ IY KI+S K  FP +    D +DL+R LL  D TKR GN+++G +D+ NHKWFA   W  + ERK++   +P+    GDT  +D Y+E+D R   S +    + F+EF
Sbjct:   37 STTCLDD---FDRQ----------KTLGTGSFGRVLLVKHKASDQYYAMKVLDKQKVVKLKQVEHTLNEKRILQAVSFPFLVRLEYAFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQHGYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHF-SSDLKDLLRNLLQVDLTKRFGNLRNGVNDIKNHKWFATTDWIAIYERKVEAPFIPKCRGPGDTSNFDDYEEEDIR--VSVTEKCAKEFSEF 351          
BLAST of cAMP-dependent protein kinase, catalytic subunit-like vs. Ensembl Zebrafish
Match: prkacaa (protein kinase, cAMP-dependent, catalytic, alpha, genome duplicate a [Source:ZFIN;Acc:ZDB-GENE-050114-6])

HSP 1 Score: 341.273 bits (874), Expect = 3.719e-115
Identity = 161/315 (51.11%), Postives = 222/315 (70.48%), Query Frame = 3
Query:  168 TLKKVELLRTVGTGTFGRVMAVREKETNTYYALKILVIEDVIRMKQVEHVKNEKLILEKVNHPFIVNLFWTRHDVKFLYMLLEYICGGELFTYLRNQGKFNNETGLFFSCEIISALSYLHSLQIVYRDLKPENLLIDQNGHIKITDFGFAKVLRDRTYTMCGTPEYLAPEIIQGKGYNRAVDWWALGVLIYEMLVGNPPFFDDNPMNIYSKILSNKFDFPQNLVEPDARDLIRKLLVSDRTKRLGNMKDGTDDVLNHKWFANISWNDVLERKLKPVIMPQVTHVGDTRCYDKYDEQDWRKIPSCSTAAQEMFAEF 1112
            +L   E L+T+GTG+FGRVM V+ KE+  ++A+KIL  + V+++KQ+EH  NEK IL+ V+ PF+V L  +  D   LYM++EY+ GGE+F++LR  G+F+     F++ +I+    YLHSL ++YRDLKPENLLIDQ G+I++TDFGFAK ++ RT+T+CGTPEYLAPEII  KGYN+AVDWWALGVLIYEM  G PPFF D P+ IY KI+S K  FP +    D +DL+R LL  D TKR GN+K+G +D+  HKWFA   W  + ++K++   +P+    GDT  +D YDE++ R   S +    + FAEF
Sbjct:   41 SLDHFERLKTLGTGSFGRVMLVKHKESGQHFAMKILDKQKVVKLKQIEHTLNEKRILQAVSFPFLVRLEHSFKDNTNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHF-SSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKGHKWFATTDWIAIYQKKVEAPFIPKCKGPGDTSNFDDYDEEEIR--VSITEKCGKEFAEF 352          
BLAST of cAMP-dependent protein kinase, catalytic subunit-like vs. Ensembl Zebrafish
Match: prkacab (protein kinase, cAMP-dependent, catalytic, alpha, genome duplicate b [Source:ZFIN;Acc:ZDB-GENE-040801-208])

HSP 1 Score: 337.035 bits (863), Expect = 1.548e-113
Identity = 158/314 (50.32%), Postives = 224/314 (71.34%), Query Frame = 3
Query:  171 LKKVELLRTVGTGTFGRVMAVREKETNTYYALKILVIEDVIRMKQVEHVKNEKLILEKVNHPFIVNLFWTRHDVKFLYMLLEYICGGELFTYLRNQGKFNNETGLFFSCEIISALSYLHSLQIVYRDLKPENLLIDQNGHIKITDFGFAKVLRDRTYTMCGTPEYLAPEIIQGKGYNRAVDWWALGVLIYEMLVGNPPFFDDNPMNIYSKILSNKFDFPQNLVEPDARDLIRKLLVSDRTKRLGNMKDGTDDVLNHKWFANISWNDVLERKLKPVIMPQVTHVGDTRCYDKYDEQDWRKIPSCSTAAQEMFAEF 1112
            L+  + L+T+GTG+FGRVM VR +ET  +YA+KIL  + V+++KQ+EH  NEK IL+ V+ PF+V L ++  D   LYM+++Y+ GGE+F++LR  G+F+     F++ +I+    YLH+L ++YRDLKPENLLIDQ G+I++TDFGFAK ++ RT+T+CGTPEYLAPEII  KGYN+AVDWWALGVL+YEM  G PPFF D P+ IY KI+S K  FP +    D +DL+R LL  D TKR GN+K+G +D+  HKWF+   W  + +R+++   +P+    GDT  +D Y+E++ R +      A+E FAEF
Sbjct:   41 LEDFDRLKTLGTGSFGRVMLVRHRETGQHYAMKILNKQKVVKLKQIEHTLNEKRILQAVSFPFLVRLEYSFKDNTNLYMVMQYVQGGEMFSHLRRIGRFSEPHARFYASQIVLTFEYLHALDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLMYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHF-SSDLKDLLRNLLQVDLTKRYGNLKNGVNDIKGHKWFSTTDWIAIYQRRVEAPFVPKCRGPGDTSNFDDYEEEEIR-VSFTEKCAKE-FAEF 351          
BLAST of cAMP-dependent protein kinase, catalytic subunit-like vs. Ensembl Zebrafish
Match: prkacba (protein kinase, cAMP-dependent, catalytic, beta a [Source:ZFIN;Acc:ZDB-GENE-040426-1351])

HSP 1 Score: 333.183 bits (853), Expect = 2.475e-111
Identity = 163/335 (48.66%), Postives = 223/335 (66.57%), Query Frame = 3
Query:  108 CAMSSENCENDKPNFDRENFTLKKVELLRTVGTGTFGRVMAVREKETNTYYALKILVIEDVIRMKQVEHVKNEKLILEKVNHPFIVNLFWTRHDVKFLYMLLEYICGGELFTYLRNQGKFNNETGLFFSCEIISALSYLHSLQIVYRDLKPENLLIDQNGHIKITDFGFAKVLRDRTYTMCGTPEYLAPEIIQGKGYNRAVDWWALGVLIYEMLVGNPPFFDDNPMNIYSKILSNKFDFPQNLVEPDARDLIRKLLVSDRTKRLGNMKDGTDDVLNHKWFANISWNDVLERKLKPVIMPQVTHVGDTRCYDKYDEQDWRKIPSCSTAAQEMFAEF 1112
            C   S  C +D   FD+          L+T+GTG+FGRVM V+ K++  Y+A+KIL    V+++KQ+EH  NEK IL+ V+ PF+V L     D   LYM++ YI GGE+F++LR  G+F+ +   F++ +I+    YLH L ++YRDLKPENLLID  G+I++TDFGFAK ++ RT+T+CGTPEYLAPEII  KGYN+AVDWWALGVLIYEM  G PPFF D P+ IY KI+S K  +P +    D +DL+R LL  D TKR GN+K+G  D+ NH+WFA+  W  + E+K+   I+P+    GDT  +D+YDE+  R   S S    + F +F
Sbjct:   77 CQQKSTACLDD---FDK----------LKTLGTGSFGRVMLVKHKQSEQYFAMKILDKLKVVKLKQIEHTLNEKKILQAVSFPFLVKLECAFKDNSNLYMVMRYIQGGEMFSHLRRIGRFSEQNARFYAAQIVLTFEYLHMLDLIYRDLKPENLLIDHQGYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRYPSHF-SSDLKDLLRNLLQVDLTKRFGNLKNGVSDIKNHRWFASTDWIAIYEKKVDAPIIPKCRGPGDTSNFDEYDEEVIR--VSVSEQCSKEFLDF 395          
BLAST of cAMP-dependent protein kinase, catalytic subunit-like vs. Ensembl Xenopus
Match: ENSXETT00000036207.1 (protein kinase X-linked [Source:NCBI gene;Acc:100494406])

HSP 1 Score: 431.795 bits (1109), Expect = 2.417e-150
Identity = 204/335 (60.90%), Postives = 253/335 (75.52%), Query Frame = 3
Query:  108 CAMSSENCENDKPNFDRENFTLKKVELLRTVGTGTFGRVMAVREKETNTYYALKILVIEDVIRMKQVEHVKNEKLILEKVNHPFIVNLFWTRHDVKFLYMLLEYICGGELFTYLRNQGKFNNETGLFFSCEIISALSYLHSLQIVYRDLKPENLLIDQNGHIKITDFGFAKVLRDRTYTMCGTPEYLAPEIIQGKGYNRAVDWWALGVLIYEMLVGNPPFFDDNPMNIYSKILSNKFDFPQNLVEPDARDLIRKLLVSDRTKRLGNMKDGTDDVLNHKWFANISWNDVLERKLKPVIMPQVTHVGDTRCYDKYDEQDWRKIPSCSTAAQEMFAEF 1112
            C  +S  C    P   ++ + L   + + TVGTGTFGRV  V+EK    Y+ALK++ I DVIR+KQ +HV NEK +L++VNHPF+V LFWT HD +FLYML+EY+ GGELF+YLRN G+FNN TGLF+S EII A+ YLHS +IVYRDLKPEN+L+D+ GHIK+TDFGFAK L DRT+T+CGTPEYLAPE+IQ KG+ RAVDWWALG+LI+EML G PPFFDDNP  IY KIL+ K DFP++L +   +DLI+KLLV DRT+RLGNMK+G DDV  H+WF +I W+ V  RKLKP I+P+VTH GDT  ++ Y E DW K P       EMF  F
Sbjct:   41 CGHTSSPC----PEL-QQQYKLDDFDTVATVGTGTFGRVHLVKEKMGKQYFALKVMSIPDVIRLKQEQHVHNEKSVLKEVNHPFLVKLFWTSHDDRFLYMLMEYVPGGELFSYLRNMGRFNNSTGLFYSTEIICAIEYLHSKEIVYRDLKPENILLDKEGHIKLTDFGFAKKLSDRTWTLCGTPEYLAPEVIQSKGHGRAVDWWALGILIFEMLSGFPPFFDDNPFGIYQKILAGKIDFPRHL-DLYVKDLIKKLLVVDRTRRLGNMKNGADDVKRHRWFRSIDWDTVPPRKLKPPIIPKVTHEGDTSNFEAYPEDDWNKAPPVPPKDLEMFNSF 369          
BLAST of cAMP-dependent protein kinase, catalytic subunit-like vs. Ensembl Xenopus
Match: prkacb (protein kinase cAMP-activated catalytic subunit beta [Source:NCBI gene;Acc:100038053])

HSP 1 Score: 345.51 bits (885), Expect = 1.190e-116
Identity = 163/315 (51.75%), Postives = 222/315 (70.48%), Query Frame = 3
Query:  168 TLKKVELLRTVGTGTFGRVMAVREKETNTYYALKILVIEDVIRMKQVEHVKNEKLILEKVNHPFIVNLFWTRHDVKFLYMLLEYICGGELFTYLRNQGKFNNETGLFFSCEIISALSYLHSLQIVYRDLKPENLLIDQNGHIKITDFGFAKVLRDRTYTMCGTPEYLAPEIIQGKGYNRAVDWWALGVLIYEMLVGNPPFFDDNPMNIYSKILSNKFDFPQNLVEPDARDLIRKLLVSDRTKRLGNMKDGTDDVLNHKWFANISWNDVLERKLKPVIMPQVTHVGDTRCYDKYDEQDWRKIPSCSTAAQEMFAEF 1112
            +L   E ++T+GTG+FGRVM V+ K    YYA+KIL  + V+++KQ+EH  NEK IL+ VN PF+V L ++  D   LYM++EY+ GGE+F++LR  G+F+     F++ +I+    YLHSL ++YRDLKPENLLIDQ G+I++TDFGFAK ++ RT+T+CGTPEYLAPEII  KGYN+AVDWWALGVLIYEM  G PPFF D P+ IY KI+S K  FP +    D +DL+R LL  D TKR GN+K+G +D+ NHKWFA   W  + +RK++   +P+    GDT  +D Y+E+D R   S +    + FA+F
Sbjct:   40 SLDDFERIKTLGTGSFGRVMLVKHKGAEQYYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVRLEYSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHF-SSDLKDLLRNLLQVDLTKRYGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKCRGPGDTSNFDDYEEEDIR--VSLTEKCAKEFADF 351          
BLAST of cAMP-dependent protein kinase, catalytic subunit-like vs. Ensembl Xenopus
Match: prkacb (protein kinase cAMP-activated catalytic subunit beta [Source:NCBI gene;Acc:100038053])

HSP 1 Score: 344.739 bits (883), Expect = 1.749e-116
Identity = 163/315 (51.75%), Postives = 222/315 (70.48%), Query Frame = 3
Query:  168 TLKKVELLRTVGTGTFGRVMAVREKETNTYYALKILVIEDVIRMKQVEHVKNEKLILEKVNHPFIVNLFWTRHDVKFLYMLLEYICGGELFTYLRNQGKFNNETGLFFSCEIISALSYLHSLQIVYRDLKPENLLIDQNGHIKITDFGFAKVLRDRTYTMCGTPEYLAPEIIQGKGYNRAVDWWALGVLIYEMLVGNPPFFDDNPMNIYSKILSNKFDFPQNLVEPDARDLIRKLLVSDRTKRLGNMKDGTDDVLNHKWFANISWNDVLERKLKPVIMPQVTHVGDTRCYDKYDEQDWRKIPSCSTAAQEMFAEF 1112
            +L   E ++T+GTG+FGRVM V+ K    YYA+KIL  + V+++KQ+EH  NEK IL+ VN PF+V L ++  D   LYM++EY+ GGE+F++LR  G+F+     F++ +I+    YLHSL ++YRDLKPENLLIDQ G+I++TDFGFAK ++ RT+T+CGTPEYLAPEII  KGYN+AVDWWALGVLIYEM  G PPFF D P+ IY KI+S K  FP +    D +DL+R LL  D TKR GN+K+G +D+ NHKWFA   W  + +RK++   +P+    GDT  +D Y+E+D R   S +    + FA+F
Sbjct:   31 SLDDFERIKTLGTGSFGRVMLVKHKGAEQYYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVRLEYSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHF-SSDLKDLLRNLLQVDLTKRYGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKCRGPGDTSNFDDYEEEDIRV--SLTEKCAKEFADF 342          
BLAST of cAMP-dependent protein kinase, catalytic subunit-like vs. Ensembl Xenopus
Match: ints8 (integrator complex subunit 8 [Source:Xenbase;Acc:XB-GENE-980129])

HSP 1 Score: 341.273 bits (874), Expect = 4.700e-115
Identity = 158/314 (50.32%), Postives = 223/314 (71.02%), Query Frame = 3
Query:  171 LKKVELLRTVGTGTFGRVMAVREKETNTYYALKILVIEDVIRMKQVEHVKNEKLILEKVNHPFIVNLFWTRHDVKFLYMLLEYICGGELFTYLRNQGKFNNETGLFFSCEIISALSYLHSLQIVYRDLKPENLLIDQNGHIKITDFGFAKVLRDRTYTMCGTPEYLAPEIIQGKGYNRAVDWWALGVLIYEMLVGNPPFFDDNPMNIYSKILSNKFDFPQNLVEPDARDLIRKLLVSDRTKRLGNMKDGTDDVLNHKWFANISWNDVLERKLKPVIMPQVTHVGDTRCYDKYDEQDWRKIPSCSTAAQEMFAEF 1112
            L++ E ++T+GTG+FGRVM VR KE  +++A+KIL  + V+++KQ+EH  NEK IL+ VN PF+V L ++  D   LYM++EY+ GGE+F++LR  G+F+     F++ +I+    YLH+L ++YRDLKPENLLIDQ G+I++TDFGFAK ++ RT+T+CGTPEYLAPEII  KGYN+AVDWWALGVLIYEM  G PPFF D P+ IY KI+S K  FP +    D +DL+R LL  D TKR GN+K+G  D+  HKWF+   W  V ++K++   +P+    GDT  +D Y+E++ R   S +    + F++F
Sbjct:   41 LEQFERIKTLGTGSFGRVMLVRHKENGSHFAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVRLEYSFKDNSNLYMVMEYVAGGEMFSHLRRIGRFSEPHARFYASQIVLTFEYLHALDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHF-SSDLKDLLRNLLQVDLTKRFGNLKNGVTDIKGHKWFSTTDWIAVYQKKVEAPFIPKCKGPGDTSNFDDYEEEEIR--VSITEKCAKEFSDF 351          
BLAST of cAMP-dependent protein kinase, catalytic subunit-like vs. Ensembl Xenopus
Match: ints8 (integrator complex subunit 8 [Source:Xenbase;Acc:XB-GENE-980129])

HSP 1 Score: 340.887 bits (873), Expect = 5.359e-115
Identity = 158/314 (50.32%), Postives = 223/314 (71.02%), Query Frame = 3
Query:  171 LKKVELLRTVGTGTFGRVMAVREKETNTYYALKILVIEDVIRMKQVEHVKNEKLILEKVNHPFIVNLFWTRHDVKFLYMLLEYICGGELFTYLRNQGKFNNETGLFFSCEIISALSYLHSLQIVYRDLKPENLLIDQNGHIKITDFGFAKVLRDRTYTMCGTPEYLAPEIIQGKGYNRAVDWWALGVLIYEMLVGNPPFFDDNPMNIYSKILSNKFDFPQNLVEPDARDLIRKLLVSDRTKRLGNMKDGTDDVLNHKWFANISWNDVLERKLKPVIMPQVTHVGDTRCYDKYDEQDWRKIPSCSTAAQEMFAEF 1112
            L++ E ++T+GTG+FGRVM VR KE  +++A+KIL  + V+++KQ+EH  NEK IL+ VN PF+V L ++  D   LYM++EY+ GGE+F++LR  G+F+     F++ +I+    YLH+L ++YRDLKPENLLIDQ G+I++TDFGFAK ++ RT+T+CGTPEYLAPEII  KGYN+AVDWWALGVLIYEM  G PPFF D P+ IY KI+S K  FP +    D +DL+R LL  D TKR GN+K+G  D+  HKWF+   W  V ++K++   +P+    GDT  +D Y+E++ R   S +    + F++F
Sbjct:   27 LEQFERIKTLGTGSFGRVMLVRHKENGSHFAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVRLEYSFKDNSNLYMVMEYVAGGEMFSHLRRIGRFSEPHARFYASQIVLTFEYLHALDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHF-SSDLKDLLRNLLQVDLTKRFGNLKNGVTDIKGHKWFSTTDWIAVYQKKVEAPFIPKCKGPGDTSNFDDYEEEEIR--VSITEKCAKEFSDF 337          
BLAST of cAMP-dependent protein kinase, catalytic subunit-like vs. Ensembl Mouse
Match: Prkx (protein kinase, X-linked [Source:MGI Symbol;Acc:MGI:1309999])

HSP 1 Score: 398.667 bits (1023), Expect = 1.408e-137
Identity = 186/333 (55.86%), Postives = 248/333 (74.47%), Query Frame = 3
Query:  120 SENCENDKP--NFDRENFTLKKVELLRTVGTGTFGRVMAVREKETNTYYALKILVIEDVIRMKQVEHVKNEKLILEKVNHPFIVNLFWTRHDVKFLYMLLEYICGGELFTYLRNQGKFNNETGLFFSCEIISALSYLHSLQIVYRDLKPENLLIDQNGHIKITDFGFAKVLRDRTYTMCGTPEYLAPEIIQGKGYNRAVDWWALGVLIYEMLVGNPPFFDDNPMNIYSKILSNKFDFPQNLVEPDARDLIRKLLVSDRTKRLGNMKDGTDDVLNHKWFANISWNDVLERKLKPVIMPQVTHVGDTRCYDKYDEQDWRKIPSCSTAAQEMFAEF 1112
            S    + KP  +  +   +L+  + + TVGTGTFGRV  V+EK    Y ALKI+ I DVIR+KQ +HV+NEK +L+++NHPF++ L WT HD +FLYML+E++ GGELFTYLRN+G+F++   +F++ EI+ A+ YLHS +IVYRDLKPEN+L+D+ GHIK+TDFGFAK L DRT+T+CGTPEYLAPE+IQ KG+ RAVDWWALG+LI+EML G PPFFDDNP  IY KIL+ K DFP+ L +  ++DLI+KLLV DRT+RLGNMK+G +D+  H+WF  + W  V +RKLKP I+P+++  GD   ++ Y E +  K PS S    E F  F
Sbjct:   24 SAPAADPKPRTSSQKAGHSLQDWDTIATVGTGTFGRVNLVKEKTGRQYCALKIMSIPDVIRLKQEQHVQNEKAVLKEINHPFLIKLLWTGHDNRFLYMLMEFVPGGELFTYLRNRGRFSSVASVFYATEIVCAIEYLHSKEIVYRDLKPENILLDREGHIKLTDFGFAKKLVDRTWTLCGTPEYLAPEVIQSKGHGRAVDWWALGILIFEMLSGFPPFFDDNPFGIYQKILACKIDFPRQL-DFTSKDLIKKLLVVDRTRRLGNMKNGAEDIKRHRWFRGVEWESVPQRKLKPPIVPKLSGDGDISNFETYPESELDKTPSVSDKDLETFKNF 355          
BLAST of cAMP-dependent protein kinase, catalytic subunit-like vs. Ensembl Mouse
Match: Prkaca (protein kinase, cAMP dependent, catalytic, alpha [Source:MGI Symbol;Acc:MGI:97592])

HSP 1 Score: 345.895 bits (886), Expect = 5.647e-117
Identity = 161/314 (51.27%), Postives = 223/314 (71.02%), Query Frame = 3
Query:  171 LKKVELLRTVGTGTFGRVMAVREKETNTYYALKILVIEDVIRMKQVEHVKNEKLILEKVNHPFIVNLFWTRHDVKFLYMLLEYICGGELFTYLRNQGKFNNETGLFFSCEIISALSYLHSLQIVYRDLKPENLLIDQNGHIKITDFGFAKVLRDRTYTMCGTPEYLAPEIIQGKGYNRAVDWWALGVLIYEMLVGNPPFFDDNPMNIYSKILSNKFDFPQNLVEPDARDLIRKLLVSDRTKRLGNMKDGTDDVLNHKWFANISWNDVLERKLKPVIMPQVTHVGDTRCYDKYDEQDWRKIPSCSTAAQEMFAEF 1112
            L + + ++T+GTG+FGRVM V+ KE+  +YA+KIL  + V+++KQ+EH  NEK IL+ VN PF+V L ++  D   LYM++EY+ GGE+F++LR  G+F+     F++ +I+    YLHSL ++YRDLKPENLLIDQ G+I++TDFGFAK ++ RT+T+CGTPEYLAPEII  KGYN+AVDWWALGVLIYEM  G PPFF D P+ IY KI+S K  FP +    D +DL+R LL  D TKR GN+K+G +D+ NHKWFA   W  + +RK++   +P+    GDT  +D Y+E++ R   S +    + F EF
Sbjct:   41 LDQFDRIKTLGTGSFGRVMLVKHKESGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVAGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHF-SSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIR--VSINEKCGKEFTEF 351          
BLAST of cAMP-dependent protein kinase, catalytic subunit-like vs. Ensembl Mouse
Match: Prkaca (protein kinase, cAMP dependent, catalytic, alpha [Source:MGI Symbol;Acc:MGI:97592])

HSP 1 Score: 345.125 bits (884), Expect = 9.057e-117
Identity = 161/314 (51.27%), Postives = 223/314 (71.02%), Query Frame = 3
Query:  171 LKKVELLRTVGTGTFGRVMAVREKETNTYYALKILVIEDVIRMKQVEHVKNEKLILEKVNHPFIVNLFWTRHDVKFLYMLLEYICGGELFTYLRNQGKFNNETGLFFSCEIISALSYLHSLQIVYRDLKPENLLIDQNGHIKITDFGFAKVLRDRTYTMCGTPEYLAPEIIQGKGYNRAVDWWALGVLIYEMLVGNPPFFDDNPMNIYSKILSNKFDFPQNLVEPDARDLIRKLLVSDRTKRLGNMKDGTDDVLNHKWFANISWNDVLERKLKPVIMPQVTHVGDTRCYDKYDEQDWRKIPSCSTAAQEMFAEF 1112
            L + + ++T+GTG+FGRVM V+ KE+  +YA+KIL  + V+++KQ+EH  NEK IL+ VN PF+V L ++  D   LYM++EY+ GGE+F++LR  G+F+     F++ +I+    YLHSL ++YRDLKPENLLIDQ G+I++TDFGFAK ++ RT+T+CGTPEYLAPEII  KGYN+AVDWWALGVLIYEM  G PPFF D P+ IY KI+S K  FP +    D +DL+R LL  D TKR GN+K+G +D+ NHKWFA   W  + +RK++   +P+    GDT  +D Y+E++ R   S +    + F EF
Sbjct:   33 LDQFDRIKTLGTGSFGRVMLVKHKESGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVAGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHF-SSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIR--VSINEKCGKEFTEF 343          
BLAST of cAMP-dependent protein kinase, catalytic subunit-like vs. Ensembl Mouse
Match: Prkacb (protein kinase, cAMP dependent, catalytic, beta [Source:MGI Symbol;Acc:MGI:97594])

HSP 1 Score: 339.732 bits (870), Expect = 1.495e-114
Identity = 164/327 (50.15%), Postives = 222/327 (67.89%), Query Frame = 3
Query:  132 ENDKPNFDRENFTLKKVELLRTVGTGTFGRVMAVREKETNTYYALKILVIEDVIRMKQVEHVKNEKLILEKVNHPFIVNLFWTRHDVKFLYMLLEYICGGELFTYLRNQGKFNNETGLFFSCEIISALSYLHSLQIVYRDLKPENLLIDQNGHIKITDFGFAKVLRDRTYTMCGTPEYLAPEIIQGKGYNRAVDWWALGVLIYEMLVGNPPFFDDNPMNIYSKILSNKFDFPQNLVEPDARDLIRKLLVSDRTKRLGNMKDGTDDVLNHKWFANISWNDVLERKLKPVIMPQVTHVGDTRCYDKYDEQDWRKIPSCSTAAQEMFAEF 1112
            EN  P+    N  L+  E  +T+GTG+FGRVM V+ K T  YYA+KIL  + V+++KQ+EH  NEK IL+ V  PF+V L ++  D   LYM++EY+ GGE+F++LR  G+F+     F++ +I+    YLHSL ++YRDLKPENLLID  G+I++TDFGFAK ++ RT+T+CGTPEYLAPEII  KGYN+AVDWWALGVLIYEM  G PPFF D P+ IY KI+S K  FP +    D +DL+R LL  D TKR GN+K+G  D+  HKWFA   W  + +RK++   +P+    GDT  +D Y+E++ R   S +    + F EF
Sbjct:   32 ENPPPS----NAGLEDFERKKTLGTGSFGRVMLVKHKATEQYYAMKILDKQKVVKLKQIEHTLNEKRILQAVEFPFLVRLEYSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDHQGYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHF-SSDLKDLLRNLLQVDLTKRFGNLKNGVSDIKTHKWFATTDWIAIYQRKVEAPFIPKFRGSGDTSNFDDYEEEEIR--VSITEKCGKEFCEF 351          
BLAST of cAMP-dependent protein kinase, catalytic subunit-like vs. Ensembl Mouse
Match: Prkacb (protein kinase, cAMP dependent, catalytic, beta [Source:MGI Symbol;Acc:MGI:97594])

HSP 1 Score: 339.347 bits (869), Expect = 1.745e-114
Identity = 164/327 (50.15%), Postives = 222/327 (67.89%), Query Frame = 3
Query:  132 ENDKPNFDRENFTLKKVELLRTVGTGTFGRVMAVREKETNTYYALKILVIEDVIRMKQVEHVKNEKLILEKVNHPFIVNLFWTRHDVKFLYMLLEYICGGELFTYLRNQGKFNNETGLFFSCEIISALSYLHSLQIVYRDLKPENLLIDQNGHIKITDFGFAKVLRDRTYTMCGTPEYLAPEIIQGKGYNRAVDWWALGVLIYEMLVGNPPFFDDNPMNIYSKILSNKFDFPQNLVEPDARDLIRKLLVSDRTKRLGNMKDGTDDVLNHKWFANISWNDVLERKLKPVIMPQVTHVGDTRCYDKYDEQDWRKIPSCSTAAQEMFAEF 1112
            EN  P+    N  L+  E  +T+GTG+FGRVM V+ K T  YYA+KIL  + V+++KQ+EH  NEK IL+ V  PF+V L ++  D   LYM++EY+ GGE+F++LR  G+F+     F++ +I+    YLHSL ++YRDLKPENLLID  G+I++TDFGFAK ++ RT+T+CGTPEYLAPEII  KGYN+AVDWWALGVLIYEM  G PPFF D P+ IY KI+S K  FP +    D +DL+R LL  D TKR GN+K+G  D+  HKWFA   W  + +RK++   +P+    GDT  +D Y+E++ R   S +    + F EF
Sbjct:   19 ENPPPS----NAGLEDFERKKTLGTGSFGRVMLVKHKATEQYYAMKILDKQKVVKLKQIEHTLNEKRILQAVEFPFLVRLEYSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDHQGYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHF-SSDLKDLLRNLLQVDLTKRFGNLKNGVSDIKTHKWFATTDWIAIYQRKVEAPFIPKFRGSGDTSNFDDYEEEEIR--VSITEKCGKEFCEF 338          
BLAST of cAMP-dependent protein kinase, catalytic subunit-like vs. UniProt/SwissProt
Match: sp|P51817|PRKX_HUMAN (cAMP-dependent protein kinase catalytic subunit PRKX OS=Homo sapiens OX=9606 GN=PRKX PE=1 SV=1)

HSP 1 Score: 410.994 bits (1055), Expect = 1.541e-141
Identity = 188/316 (59.49%), Postives = 247/316 (78.16%), Query Frame = 3
Query:  165 FTLKKVELLRTVGTGTFGRVMAVREKETNTYYALKILVIEDVIRMKQVEHVKNEKLILEKVNHPFIVNLFWTRHDVKFLYMLLEYICGGELFTYLRNQGKFNNETGLFFSCEIISALSYLHSLQIVYRDLKPENLLIDQNGHIKITDFGFAKVLRDRTYTMCGTPEYLAPEIIQGKGYNRAVDWWALGVLIYEMLVGNPPFFDDNPMNIYSKILSNKFDFPQNLVEPDARDLIRKLLVSDRTKRLGNMKDGTDDVLNHKWFANISWNDVLERKLKPVIMPQVTHVGDTRCYDKYDEQDWRKIPSCSTAAQEMFAEF 1112
            ++L+  + L TVGTGTFGRV  V+EK    ++ALK++ I DVIR+KQ +HV NEK +L++V+HPF++ LFWT HD +FLYML+EY+ GGELF+YLRN+G+F++ TGLF+S EII A+ YLHS +IVYRDLKPEN+L+D++GHIK+TDFGFAK L DRT+T+CGTPEYLAPE+IQ KG+ RAVDWWALG+LI+EML G PPFFDDNP  IY KIL+ K DFP++L +   +DLI+KLLV DRT+RLGNMK+G +DV +H+WF ++ W  V +RKLKP I+P++   GDT  ++ Y E DW           E+F  F
Sbjct:   44 YSLQDFDTLATVGTGTFGRVHLVKEKTAKHFFALKVMSIPDVIRLKQEQHVHNEKSVLKEVSHPFLIRLFWTWHDERFLYMLMEYVPGGELFSYLRNRGRFSSTTGLFYSAEIICAIEYLHSKEIVYRDLKPENILLDRDGHIKLTDFGFAKKLVDRTWTLCGTPEYLAPEVIQSKGHGRAVDWWALGILIFEMLSGFPPFFDDNPFGIYQKILAGKIDFPRHL-DFHVKDLIKKLLVVDRTRRLGNMKNGANDVKHHRWFRSVDWEAVPQRKLKPPIVPKIAGDGDTSNFETYPENDWDTAAPVPQKDLEIFKNF 358          
BLAST of cAMP-dependent protein kinase, catalytic subunit-like vs. UniProt/SwissProt
Match: sp|P16912|KAPC3_DROME (cAMP-dependent protein kinase catalytic subunit 3 OS=Drosophila melanogaster OX=7227 GN=Pka-C3 PE=2 SV=2)

HSP 1 Score: 417.157 bits (1071), Expect = 9.276e-141
Identity = 189/316 (59.81%), Postives = 251/316 (79.43%), Query Frame = 3
Query:  165 FTLKKVELLRTVGTGTFGRVMAVREKETNTYYALKILVIEDVIRMKQVEHVKNEKLILEKVNHPFIVNLFWTRHDVKFLYMLLEYICGGELFTYLRNQGKFNNETGLFFSCEIISALSYLHSLQIVYRDLKPENLLIDQNGHIKITDFGFAKVLRDRTYTMCGTPEYLAPEIIQGKGYNRAVDWWALGVLIYEMLVGNPPFFDDNPMNIYSKILSNKFDFPQNLVEPDARDLIRKLLVSDRTKRLGNMKDGTDDVLNHKWFANISWNDVLERKLKPVIMPQVTHVGDTRCYDKYDEQDWRKIPSCSTAAQEMFAEF 1112
            + L   ++++TVGTGTFGRV   R++ +  Y A+KIL + +VIR+KQ+EHVKNE+ IL ++ HPF+++L W+  D   LYM+ +Y+CGGELFTYLRN GKF ++T  F++ EI+SAL YLHSLQIVYRDLKPENLLI+++GH+KITDFGFAK LRDRT+T+CGTPEY+APEIIQ KG+N+AVDWWALGVLIYEMLVG PPF+D+ P  IY KILS K ++ +++ +P A+DLI+KLLV+DRTKRLGNMK+G DDV  H+WF +++WNDV  +KLKP I+P V H GDT+ +D Y E+DW+   +      + F +F
Sbjct:  269 YHLDDYQIIKTVGTGTFGRVCLCRDRISEKYCAMKILAMTEVIRLKQIEHVKNERNILREIRHPFVISLEWSTKDDSNLYMIFDYVCGGELFTYLRNAGKFTSQTSNFYAAEIVSALEYLHSLQIVYRDLKPENLLINRDGHLKITDFGFAKKLRDRTWTLCGTPEYIAPEIIQSKGHNKAVDWWALGVLIYEMLVGYPPFYDEQPFGIYEKILSGKIEWERHM-DPIAKDLIKKLLVNDRTKRLGNMKNGADDVKRHRWFKHLNWNDVYSKKLKPPILPDVHHDGDTKNFDDYPEKDWKPAKAVDQRDLQYFNDF 583          
BLAST of cAMP-dependent protein kinase, catalytic subunit-like vs. UniProt/SwissProt
Match: sp|Q922R0|PRKX_MOUSE (cAMP-dependent protein kinase catalytic subunit PRKX OS=Mus musculus OX=10090 GN=Prkx PE=1 SV=1)

HSP 1 Score: 398.667 bits (1023), Expect = 9.850e-137
Identity = 186/333 (55.86%), Postives = 248/333 (74.47%), Query Frame = 3
Query:  120 SENCENDKP--NFDRENFTLKKVELLRTVGTGTFGRVMAVREKETNTYYALKILVIEDVIRMKQVEHVKNEKLILEKVNHPFIVNLFWTRHDVKFLYMLLEYICGGELFTYLRNQGKFNNETGLFFSCEIISALSYLHSLQIVYRDLKPENLLIDQNGHIKITDFGFAKVLRDRTYTMCGTPEYLAPEIIQGKGYNRAVDWWALGVLIYEMLVGNPPFFDDNPMNIYSKILSNKFDFPQNLVEPDARDLIRKLLVSDRTKRLGNMKDGTDDVLNHKWFANISWNDVLERKLKPVIMPQVTHVGDTRCYDKYDEQDWRKIPSCSTAAQEMFAEF 1112
            S    + KP  +  +   +L+  + + TVGTGTFGRV  V+EK    Y ALKI+ I DVIR+KQ +HV+NEK +L+++NHPF++ L WT HD +FLYML+E++ GGELFTYLRN+G+F++   +F++ EI+ A+ YLHS +IVYRDLKPEN+L+D+ GHIK+TDFGFAK L DRT+T+CGTPEYLAPE+IQ KG+ RAVDWWALG+LI+EML G PPFFDDNP  IY KIL+ K DFP+ L +  ++DLI+KLLV DRT+RLGNMK+G +D+  H+WF  + W  V +RKLKP I+P+++  GD   ++ Y E +  K PS S    E F  F
Sbjct:   24 SAPAADPKPRTSSQKAGHSLQDWDTIATVGTGTFGRVNLVKEKTGRQYCALKIMSIPDVIRLKQEQHVQNEKAVLKEINHPFLIKLLWTGHDNRFLYMLMEFVPGGELFTYLRNRGRFSSVASVFYATEIVCAIEYLHSKEIVYRDLKPENILLDREGHIKLTDFGFAKKLVDRTWTLCGTPEYLAPEVIQSKGHGRAVDWWALGILIFEMLSGFPPFFDDNPFGIYQKILACKIDFPRQL-DFTSKDLIKKLLVVDRTRRLGNMKNGAEDIKRHRWFRGVEWESVPQRKLKPPIVPKLSGDGDISNFETYPESELDKTPSVSDKDLETFKNF 355          
BLAST of cAMP-dependent protein kinase, catalytic subunit-like vs. UniProt/SwissProt
Match: sp|Q7JP68|KAPC2_CAEEL (cAMP-dependent protein kinase, catalytic subunit-like OS=Caenorhabditis elegans OX=6239 GN=F47F2.1 PE=1 SV=1)

HSP 1 Score: 350.903 bits (899), Expect = 2.252e-117
Identity = 162/319 (50.78%), Postives = 227/319 (71.16%), Query Frame = 3
Query:  156 RENFTLKKVELLRTVGTGTFGRVMAVREKETNTYYALKILVIEDVIRMKQVEHVKNEKLILEKVNHPFIVNLFWTRHDVKFLYMLLEYICGGELFTYLRNQGKFNNETGLFFSCEIISALSYLHSLQIVYRDLKPENLLIDQNGHIKITDFGFAKVLRDRTYTMCGTPEYLAPEIIQGKGYNRAVDWWALGVLIYEMLVGNPPFFDDNPMNIYSKILSNKFDFPQNLVEPDARDLIRKLLVSDRTKRLGNMKDGTDDVLNHKWFANISWNDVLERKLKPVIMPQVTHVGDTRCYDKYDEQDWRKIPSCSTAAQEMFAEF 1112
            RE+F+L ++E + T+G GTFGRV   R+K T  +YALK+L I  V+ M+Q +HV NEK +L ++ HPFIV ++ +  D   LYM++E++ GGE+F+YLR    F+N    F++ EI+ AL Y+HSL IVYRDLKPENL++ + GHIK+ DFGFAK LRDRTYT+CGTP+YLAPE +   G+N+ VDWWALG+LIYEM+VG PPF       IY  I+ +K  FP++     A+DL++KLL  DRT+R+G MK+GT DV +HKWF  ++W+D L  +++P I+P + H GDT  +D Y E+D    P CS   +++FAE+
Sbjct:   82 RESFSLSQLERIITIGKGTFGRVELARDKITGAHYALKVLNIRRVVDMRQTQHVHNEKRVLLQLKHPFIVKMYASEKDSNHLYMIMEFVPGGEMFSYLRASRSFSNSMARFYASEIVCALEYIHSLGIVYRDLKPENLMLSKEGHIKMADFGFAKELRDRTYTICGTPDYLAPESLARTGHNKGVDWWALGILIYEMMVGKPPFRGKTTSEIYDAIIEHKLKFPRSF-NLAAKDLVKKLLEVDRTQRIGCMKNGTQDVKDHKWFEKVNWDDTLHLRVEPPIVPTLYHPGDTGNFDDY-EEDTTGGPLCSQRDRDLFAEW 398          
BLAST of cAMP-dependent protein kinase, catalytic subunit-like vs. UniProt/SwissProt
Match: sp|P17612|KAPCA_HUMAN (cAMP-dependent protein kinase catalytic subunit alpha OS=Homo sapiens OX=9606 GN=PRKACA PE=1 SV=2)

HSP 1 Score: 347.436 bits (890), Expect = 1.014e-116
Identity = 163/314 (51.91%), Postives = 224/314 (71.34%), Query Frame = 3
Query:  171 LKKVELLRTVGTGTFGRVMAVREKETNTYYALKILVIEDVIRMKQVEHVKNEKLILEKVNHPFIVNLFWTRHDVKFLYMLLEYICGGELFTYLRNQGKFNNETGLFFSCEIISALSYLHSLQIVYRDLKPENLLIDQNGHIKITDFGFAKVLRDRTYTMCGTPEYLAPEIIQGKGYNRAVDWWALGVLIYEMLVGNPPFFDDNPMNIYSKILSNKFDFPQNLVEPDARDLIRKLLVSDRTKRLGNMKDGTDDVLNHKWFANISWNDVLERKLKPVIMPQVTHVGDTRCYDKYDEQDWRKIPSCSTAAQEMFAEF 1112
            L + E ++T+GTG+FGRVM V+ KET  +YA+KIL  + V+++KQ+EH  NEK IL+ VN PF+V L ++  D   LYM++EY+ GGE+F++LR  G+F+     F++ +I+    YLHSL ++YRDLKPENLLIDQ G+I++TDFGFAK ++ RT+T+CGTPEYLAPEII  KGYN+AVDWWALGVLIYEM  G PPFF D P+ IY KI+S K  FP +    D +DL+R LL  D TKR GN+K+G +D+ NHKWFA   W  + +RK++   +P+    GDT  +D Y+E++ R   S +    + F+EF
Sbjct:   41 LDQFERIKTLGTGSFGRVMLVKHKETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHF-SSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIR--VSINEKCGKEFSEF 351          
BLAST of cAMP-dependent protein kinase, catalytic subunit-like vs. TrEMBL
Match: A0A267DYK9 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig021253g2 PE=3 SV=1)

HSP 1 Score: 504.212 bits (1297), Expect = 7.354e-176
Identity = 228/321 (71.03%), Postives = 272/321 (84.74%), Query Frame = 3
Query:  153 DRENFTLKKVELLRTVGTGTFGRVMAVREKETNTYYALKILVIEDVIRMKQVEHVKNEKLILEKVNHPFIVNLFWTRHDVKFLYMLLEYICGGELFTYLRNQGKFNNETGLFFSCEIISALSYLHSLQIVYRDLKPENLLIDQNGHIKITDFGFAKVLRDRTYTMCGTPEYLAPEIIQGKGYNRAVDWWALGVLIYEMLVGNPPFFDDNPMNIYSKILSNKFDFPQNL-VEPDARDLIRKLLVSDRTKRLGNMKDGTDDVLNHKWFANISWNDVLERKLKPVIMPQVTHVGDTRCYDKYDEQDWRKIPSCSTAAQEMFAEF 1112
            D + F+L++ ELLRTVGTGTFGRVM +REK +  Y+ALKIL+IEDV+R+KQVEHVKNEK IL+ VNHPF+V+LFWT HDVKFLYM+ +++CGGE+F+YLR  G F+N +  F+S EI++A+ YLH L +VYRDLKPENLL+D  GH+KITDFGFAKVL+DRTYTMCGTPEYLAPEIIQGKGYNRAVD+WALGVLIYEMLVG PPF+DDNPM IY KILS KFDFP++  V+P ARD++RKLLV DRTKRLGNMK G DDV NH+WF  ++W DV  RK+ P I+PQV H GDTRCYD YDEQDW+K+PS S A QE F +F
Sbjct:   39 DWQKFSLRQAELLRTVGTGTFGRVMVIREKTSGEYFALKILIIEDVMRLKQVEHVKNEKSILKMVNHPFLVSLFWTNHDVKFLYMIFDFVCGGEIFSYLRTAGTFSNSSAQFYSAEILTAVIYLHDLSVVYRDLKPENLLLDTQGHLKITDFGFAKVLKDRTYTMCGTPEYLAPEIIQGKGYNRAVDYWALGVLIYEMLVGTPPFYDDNPMQIYQKILSGKFDFPRDSPVDPVARDIVRKLLVQDRTKRLGNMKSGPDDVRNHRWFKGVNWLDVELRKMAPPIVPQVQHPGDTRCYDVYDEQDWKKVPSASAAGQEHFRDF 359          
BLAST of cAMP-dependent protein kinase, catalytic subunit-like vs. TrEMBL
Match: A0A267E1A0 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig000304g3 PE=3 SV=1)

HSP 1 Score: 491.115 bits (1263), Expect = 8.831e-171
Identity = 220/333 (66.07%), Postives = 271/333 (81.38%), Query Frame = 3
Query:  120 SENCENDKPNF-DRENFTLKKVELLRTVGTGTFGRVMAVREKETNTYYALKILVIEDVIRMKQVEHVKNEKLILEKVNHPFIVNLFWTRHDVKFLYMLLEYICGGELFTYLRNQGKFNNETGLFFSCEIISALSYLHSLQIVYRDLKPENLLIDQNGHIKITDFGFAKVLRDRTYTMCGTPEYLAPEIIQGKGYNRAVDWWALGVLIYEMLVGNPPFFDDNPMNIYSKILSNKFDFPQNL-VEPDARDLIRKLLVSDRTKRLGNMKDGTDDVLNHKWFANISWNDVLERKLKPVIMPQVTHVGDTRCYDKYDEQDWRKIPSCSTAAQEMFAEF 1112
            +E+   D+P+  D   F+L+  ELLRTVGTGTFGRVM +REK T+ Y+ALKILVI+DV+R+KQVEHVKNEK IL  V+HPF+V L+WT HD+KFLYM+ E++CGGE+F+YLR  G F+N   LF++ EI+SA+ YLH + +VYRDLKPENLL+D  GH+KITDFGFAKVL+DRTYTMCGTPEYLAPEII GKGYNRAVD+WALGVLIYEMLVG PPF+DD+PM IY KIL+ +F+FP +   +P ARDL+RKLLV DRTKRLGNMK G +DV +H+WF  + W+ V  RKL P I+PQV H GDT CYDKY+EQDW+++PS S   QE F +F
Sbjct:   18 AEDAPLDQPSLVDWSKFSLRNAELLRTVGTGTFGRVMVIREKNTDEYFALKILVIDDVMRLKQVEHVKNEKAILNTVSHPFLVKLYWTNHDIKFLYMVFEFVCGGEIFSYLRTSGTFSNAATLFYAAEILSAIMYLHDMSVVYRDLKPENLLLDARGHLKITDFGFAKVLKDRTYTMCGTPEYLAPEIIMGKGYNRAVDYWALGVLIYEMLVGTPPFYDDSPMQIYQKILNGRFEFPVSAQTDPQARDLVRKLLVQDRTKRLGNMKSGAEDVRSHRWFRGLDWDQVYSRKLAPPIVPQVQHPGDTSCYDKYEEQDWKRVPSSSAIGQEYFRDF 350          
BLAST of cAMP-dependent protein kinase, catalytic subunit-like vs. TrEMBL
Match: A0A267E122 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig000304g4 PE=3 SV=1)

HSP 1 Score: 490.345 bits (1261), Expect = 1.858e-170
Identity = 220/332 (66.27%), Postives = 270/332 (81.33%), Query Frame = 3
Query:  123 ENCENDKPNF-DRENFTLKKVELLRTVGTGTFGRVMAVREKETNTYYALKILVIEDVIRMKQVEHVKNEKLILEKVNHPFIVNLFWTRHDVKFLYMLLEYICGGELFTYLRNQGKFNNETGLFFSCEIISALSYLHSLQIVYRDLKPENLLIDQNGHIKITDFGFAKVLRDRTYTMCGTPEYLAPEIIQGKGYNRAVDWWALGVLIYEMLVGNPPFFDDNPMNIYSKILSNKFDFPQNL-VEPDARDLIRKLLVSDRTKRLGNMKDGTDDVLNHKWFANISWNDVLERKLKPVIMPQVTHVGDTRCYDKYDEQDWRKIPSCSTAAQEMFAEF 1112
            E+   D+P+  D   F+L+  ELLRTVGTGTFGRVM +REK T+ Y+ALKILVI+DV+R+KQVEHVKNEK IL  V+HPF+V L+WT HD+KFLYM+ E++CGGE+F+YLR  G F+N   LF++ EI+SA+ YLH + +VYRDLKPENLL+D  GH+KITDFGFAKVL+DRTYTMCGTPEYLAPEII GKGYNRAVD+WALGVLIYEMLVG PPF+DD+PM IY KIL+ +F+FP +   +P ARDL+RKLLV DRTKRLGNMK G +DV +H+WF  + W+ V  RKL P I+PQV H GDT CYDKY+EQDW+++PS S   QE F +F
Sbjct:   19 EDAPLDQPSLVDWSKFSLRNAELLRTVGTGTFGRVMVIREKNTDEYFALKILVIDDVMRLKQVEHVKNEKAILNTVSHPFLVKLYWTNHDIKFLYMVFEFVCGGEIFSYLRTSGTFSNAATLFYAAEILSAIMYLHDMSVVYRDLKPENLLLDARGHLKITDFGFAKVLKDRTYTMCGTPEYLAPEIIMGKGYNRAVDYWALGVLIYEMLVGTPPFYDDSPMQIYQKILNGRFEFPVSAQADPQARDLVRKLLVQDRTKRLGNMKSGAEDVRSHRWFRGLDWDQVYSRKLAPPIVPQVQHPGDTSCYDKYEEQDWKRVPSSSAIGQEYFRDF 350          
BLAST of cAMP-dependent protein kinase, catalytic subunit-like vs. TrEMBL
Match: A0A267GL64 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig000304g2 PE=3 SV=1)

HSP 1 Score: 490.345 bits (1261), Expect = 1.962e-170
Identity = 220/332 (66.27%), Postives = 270/332 (81.33%), Query Frame = 3
Query:  123 ENCENDKPNF-DRENFTLKKVELLRTVGTGTFGRVMAVREKETNTYYALKILVIEDVIRMKQVEHVKNEKLILEKVNHPFIVNLFWTRHDVKFLYMLLEYICGGELFTYLRNQGKFNNETGLFFSCEIISALSYLHSLQIVYRDLKPENLLIDQNGHIKITDFGFAKVLRDRTYTMCGTPEYLAPEIIQGKGYNRAVDWWALGVLIYEMLVGNPPFFDDNPMNIYSKILSNKFDFPQNL-VEPDARDLIRKLLVSDRTKRLGNMKDGTDDVLNHKWFANISWNDVLERKLKPVIMPQVTHVGDTRCYDKYDEQDWRKIPSCSTAAQEMFAEF 1112
            E+   D+P+  D   F+L+  ELLRTVGTGTFGRVM +REK T+ Y+ALKILVI+DV+R+KQVEHVKNEK IL  V+HPF+V L+WT HD+KFLYM+ E++CGGE+F+YLR  G F+N   LF++ EI+SA+ YLH + +VYRDLKPENLL+D  GH+KITDFGFAKVL+DRTYTMCGTPEYLAPEII GKGYNRAVD+WALGVLIYEMLVG PPF+DD+PM IY KIL+ +F+FP +   +P ARDL+RKLLV DRTKRLGNMK G +DV +H+WF  + W+ V  RKL P I+PQV H GDT CYDKY+EQDW+++PS S   QE F +F
Sbjct:   19 EDAPLDQPSLVDWSKFSLRNAELLRTVGTGTFGRVMVIREKNTDEYFALKILVIDDVMRLKQVEHVKNEKAILNTVSHPFLVKLYWTNHDIKFLYMVFEFVCGGEIFSYLRTSGTFSNAATLFYAAEILSAIMYLHDMSVVYRDLKPENLLLDARGHLKITDFGFAKVLKDRTYTMCGTPEYLAPEIIMGKGYNRAVDYWALGVLIYEMLVGTPPFYDDSPMQIYQKILNGRFEFPVSAQADPQARDLVRKLLVQDRTKRLGNMKSGAEDVRSHRWFRGLDWDQVYSRKLAPPIVPQVQHPGDTSCYDKYEEQDWKRVPSSSAIGQEYFRDF 350          
BLAST of cAMP-dependent protein kinase, catalytic subunit-like vs. TrEMBL
Match: A0A267DLZ8 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig000437g3 PE=3 SV=1)

HSP 1 Score: 479.945 bits (1234), Expect = 2.613e-166
Identity = 215/323 (66.56%), Postives = 270/323 (83.59%), Query Frame = 3
Query:  147 NFDRENFTLKKVELLRTVGTGTFGRVMAVREKETNTYYALKILVIEDVIRMKQVEHVKNEKLILEKVNHPFIVNLFWTRHDVKFLYMLLEYICGGELFTYLRNQGKFNNETGLFFSCEIISALSYLHSLQIVYRDLKPENLLIDQNGHIKITDFGFAKVLRDRTYTMCGTPEYLAPEIIQGKGYNRAVDWWALGVLIYEMLVGNPPFFDDNPMNIYSKILSNKFDFP-QNLVEPDARDLIRKLLVSDRTKRLGNMKDGTDDVLNHKWFANISWNDVLERKLKPVIMPQVTHVGDTRCYDKYDEQDWRKIPSCSTAAQEMFAEF 1112
            + D   FTL++ ELLRTVGTGTFGRV+ +RE+ T  ++ALKIL+I+DV+R+KQ  HVKNEK IL  V HPF+V L+WT HD KFLYM++EYICGGE+F+YLR  G F N   LF++ EI+SA+ YLHSL I+YRDLKPENLL+D NGH+KITDFGFAKV+RDRT+TMCGTPEYLAPEII+G+GYN++VD+WALG+LIYEMLVG+PPF+DDNP NIY KIL  KFDFP ++ ++P A+DLIR+LL  D+TKRLGNMK+G +D+ +H+WF +I+W DV  R+LKP I+PQV+H GDTRCYD YDEQDW+K+P  S A QE F +F
Sbjct:   30 SIDWSKFTLRQAELLRTVGTGTFGRVLVIRERSTAQHFALKILLIDDVVRLKQEAHVKNEKAILMNVKHPFLVRLYWTNHDAKFLYMIMEYICGGEVFSYLRAAGIFANSAALFYAAEILSAIGYLHSLCIMYRDLKPENLLLDVNGHLKITDFGFAKVVRDRTFTMCGTPEYLAPEIIRGQGYNKSVDFWALGILIYEMLVGSPPFYDDNPANIYQKILPGKFDFPRESNIDPLAKDLIRRLLTVDQTKRLGNMKNGVEDIRSHRWFKSINWPDVELRQLKPPIVPQVSHAGDTRCYDMYDEQDWKKVPVASPAGQEHFKDF 352          
BLAST of cAMP-dependent protein kinase, catalytic subunit-like vs. Ensembl Cavefish
Match: prkx (protein kinase X-linked [Source:NCBI gene;Acc:103026199])

HSP 1 Score: 414.461 bits (1064), Expect = 6.508e-144
Identity = 188/323 (58.20%), Postives = 247/323 (76.47%), Query Frame = 3
Query:  144 PNFDRENFTLKKVELLRTVGTGTFGRVMAVREKETNTYYALKILVIEDVIRMKQVEHVKNEKLILEKVNHPFIVNLFWTRHDVKFLYMLLEYICGGELFTYLRNQGKFNNETGLFFSCEIISALSYLHSLQIVYRDLKPENLLIDQNGHIKITDFGFAKVLRDRTYTMCGTPEYLAPEIIQGKGYNRAVDWWALGVLIYEMLVGNPPFFDDNPMNIYSKILSNKFDFPQNLVEPDARDLIRKLLVSDRTKRLGNMKDGTDDVLNHKWFANISWNDVLERKLKPVIMPQVTHVGDTRCYDKYDEQDWRKIPSCSTAAQEMFAEF 1112
            P  +   ++L+  + + TVGTGTFGRV  V++K+T  ++ALK + I DVIR+KQ +HV NEK +L +VNHPF++ LFWT HD +FLYML++Y+ GGELF+YLR++G+F+N TGLF+S EI+ A+ YLHS +IVYRDLKPEN+L+D  GHI++TDFGFAK L DRT+T+CGTPEYLAPE+IQ KG+ RAVDWWALGVLI+EML G PPFFDDNP  IY KIL+ K +FP++L +   +DLI+K LV DR +RLGNMK+G DDV  H+WF +I W  V  R+LKP I+P+V+H GDT  +D Y E +W+K         E+F  F
Sbjct:   39 PGANSRTYSLEDFDTVATVGTGTFGRVFLVKDKKTRGFFALKAMKIPDVIRLKQEQHVHNEKEVLTEVNHPFLITLFWTHHDERFLYMLMDYVPGGELFSYLRSRGRFSNNTGLFYSAEIVCAIEYLHSKEIVYRDLKPENILLDGEGHIRLTDFGFAKKLSDRTWTLCGTPEYLAPEVIQSKGHGRAVDWWALGVLIFEMLAGYPPFFDDNPFGIYQKILAGKLEFPRHL-DFYVKDLIKKFLVIDRARRLGNMKNGADDVKKHRWFKSIDWETVPNRRLKPPIVPKVSHEGDTSNFDAYPEDEWKKETPVPQKDLELFKNF 360          
BLAST of cAMP-dependent protein kinase, catalytic subunit-like vs. Ensembl Cavefish
Match: ENSAMXT00000001472.2 (cAMP-dependent protein kinase catalytic subunit PRKX-like [Source:NCBI gene;Acc:103040942])

HSP 1 Score: 397.127 bits (1019), Expect = 8.710e-137
Identity = 186/334 (55.69%), Postives = 252/334 (75.45%), Query Frame = 3
Query:  111 AMSSENCENDKPNFDRENFTLKKVELLRTVGTGTFGRVMAVREKETNTYYALKILVIEDVIRMKQVEHVKNEKLILEKVNHPFIVNLFWTRHDVKFLYMLLEYICGGELFTYLRNQGKFNNETGLFFSCEIISALSYLHSLQIVYRDLKPENLLIDQNGHIKITDFGFAKVLRDRTYTMCGTPEYLAPEIIQGKGYNRAVDWWALGVLIYEMLVGNPPFFDDNPMNIYSKILSNKFDFPQNLVEPDARDLIRKLLVSDRTKRLGNMKDGTDDVLNHKWFANISWNDVLERKLKPVIMPQVTHVGDTRCYDKYDEQDWRKIPSCSTAAQEMFAEF 1112
            A S    +  +P     +F+   ++ + TVGTGTFGRV+ V+++ +  ++ALK + I D+IR+KQ +HV NEK +L +VNHPFIV L+WT HD + L+ML+E++ GGELFTYLR++GKF N+T +FFS EII AL YLHS  IVYRDLKPEN+L+D+ GH+K+TDFGFAK + DRT T+CGTPEYLAPEIIQGKG+  AVDWWALGVLI+EML G PPFFDDNP  IY K+L+ K +FP++L +   +DLI+KLLV D+TKRLGN++ G DDV  H+WF ++ W+ V +R+LKP I+P+V+H GD+  +D Y ++  +K P+ S    E+F  F
Sbjct:   47 ARSPAGAQCMQPQPGCSDFSPGILDSVATVGTGTFGRVVLVQDRRSKGFFALKSMRIVDLIRLKQQQHVHNEKEVLMEVNHPFIVKLYWTWHDERCLFMLMEFVPGGELFTYLRSRGKFGNDTSMFFSAEIICALEYLHSKDIVYRDLKPENILLDREGHVKLTDFGFAKKVIDRTCTLCGTPEYLAPEIIQGKGHGLAVDWWALGVLIFEMLSGYPPFFDDNPFGIYQKVLAAKLNFPRHL-DFYVKDLIKKLLVVDKTKRLGNLRGGADDVKKHRWFRSVDWDVVPQRRLKPSIVPKVSHEGDSSNFDTYPDEKRKKEPAVSPKDVEIFKNF 379          
BLAST of cAMP-dependent protein kinase, catalytic subunit-like vs. Ensembl Cavefish
Match: ENSAMXT00000045721.1 (protein kinase cAMP-activated catalytic subunit beta [Source:NCBI gene;Acc:103029308])

HSP 1 Score: 347.821 bits (891), Expect = 4.788e-118
Identity = 167/314 (53.18%), Postives = 223/314 (71.02%), Query Frame = 3
Query:  171 LKKVELLRTVGTGTFGRVMAVREKETNTYYALKILVIEDVIRMKQVEHVKNEKLILEKVNHPFIVNLFWTRHDVKFLYMLLEYICGGELFTYLRNQGKFNNETGLFFSCEIISALSYLHSLQIVYRDLKPENLLIDQNGHIKITDFGFAKVLRDRTYTMCGTPEYLAPEIIQGKGYNRAVDWWALGVLIYEMLVGNPPFFDDNPMNIYSKILSNKFDFPQNLVEPDARDLIRKLLVSDRTKRLGNMKDGTDDVLNHKWFANISWNDVLERKLKPVIMPQVTHVGDTRCYDKYDEQDWRKIPSCSTAAQEMFAEF 1112
            L   E L+T+GTG+FGRVM V+ K T  YYA+KIL  + V+++KQ+EH  NEK IL+ V+ PF+V L +   D   LYM++EY+ GGE+F++LR  G+F+     F++ +I+    YLHSL ++YRDLKPENLLIDQ+G+I++TDFGFAK ++ RT+T+CGTPEYLAPEII  KGYN+AVDWWALGVLIYEM  G PPFF D P+ IY KI+S K  FP +    D +DL+R LL  D TKR GN+K+G +D+ NHKWFA   W  + ERK++  I+P+    GDT  +D Y+E++ R I      A+E F EF
Sbjct:   22 LDDFERLKTLGTGSFGRVMLVKHKATEQYYAMKILDKQKVVKLKQIEHTLNEKRILQAVSFPFLVRLEYAFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEHHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQHGYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHF-SSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYERKVEAPIIPKCRGPGDTSNFDDYEEEEIR-ISDTEKCAKE-FLEF 332          
BLAST of cAMP-dependent protein kinase, catalytic subunit-like vs. Ensembl Cavefish
Match: ENSAMXT00000050353.1 (protein kinase cAMP-activated catalytic subunit beta [Source:NCBI gene;Acc:103029308])

HSP 1 Score: 348.206 bits (892), Expect = 7.449e-118
Identity = 167/314 (53.18%), Postives = 223/314 (71.02%), Query Frame = 3
Query:  171 LKKVELLRTVGTGTFGRVMAVREKETNTYYALKILVIEDVIRMKQVEHVKNEKLILEKVNHPFIVNLFWTRHDVKFLYMLLEYICGGELFTYLRNQGKFNNETGLFFSCEIISALSYLHSLQIVYRDLKPENLLIDQNGHIKITDFGFAKVLRDRTYTMCGTPEYLAPEIIQGKGYNRAVDWWALGVLIYEMLVGNPPFFDDNPMNIYSKILSNKFDFPQNLVEPDARDLIRKLLVSDRTKRLGNMKDGTDDVLNHKWFANISWNDVLERKLKPVIMPQVTHVGDTRCYDKYDEQDWRKIPSCSTAAQEMFAEF 1112
            L   E L+T+GTG+FGRVM V+ K T  YYA+KIL  + V+++KQ+EH  NEK IL+ V+ PF+V L +   D   LYM++EY+ GGE+F++LR  G+F+     F++ +I+    YLHSL ++YRDLKPENLLIDQ+G+I++TDFGFAK ++ RT+T+CGTPEYLAPEII  KGYN+AVDWWALGVLIYEM  G PPFF D P+ IY KI+S K  FP +    D +DL+R LL  D TKR GN+K+G +D+ NHKWFA   W  + ERK++  I+P+    GDT  +D Y+E++ R I      A+E F EF
Sbjct:   41 LDDFERLKTLGTGSFGRVMLVKHKATEQYYAMKILDKQKVVKLKQIEHTLNEKRILQAVSFPFLVRLEYAFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEHHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQHGYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHF-SSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYERKVEAPIIPKCRGPGDTSNFDDYEEEEIR-ISDTEKCAKE-FLEF 351          
BLAST of cAMP-dependent protein kinase, catalytic subunit-like vs. Ensembl Cavefish
Match: ENSAMXT00000056663.1 (protein kinase cAMP-activated catalytic subunit beta [Source:NCBI gene;Acc:103029308])

HSP 1 Score: 347.821 bits (891), Expect = 3.661e-117
Identity = 167/314 (53.18%), Postives = 223/314 (71.02%), Query Frame = 3
Query:  171 LKKVELLRTVGTGTFGRVMAVREKETNTYYALKILVIEDVIRMKQVEHVKNEKLILEKVNHPFIVNLFWTRHDVKFLYMLLEYICGGELFTYLRNQGKFNNETGLFFSCEIISALSYLHSLQIVYRDLKPENLLIDQNGHIKITDFGFAKVLRDRTYTMCGTPEYLAPEIIQGKGYNRAVDWWALGVLIYEMLVGNPPFFDDNPMNIYSKILSNKFDFPQNLVEPDARDLIRKLLVSDRTKRLGNMKDGTDDVLNHKWFANISWNDVLERKLKPVIMPQVTHVGDTRCYDKYDEQDWRKIPSCSTAAQEMFAEF 1112
            L   E L+T+GTG+FGRVM V+ K T  YYA+KIL  + V+++KQ+EH  NEK IL+ V+ PF+V L +   D   LYM++EY+ GGE+F++LR  G+F+     F++ +I+    YLHSL ++YRDLKPENLLIDQ+G+I++TDFGFAK ++ RT+T+CGTPEYLAPEII  KGYN+AVDWWALGVLIYEM  G PPFF D P+ IY KI+S K  FP +    D +DL+R LL  D TKR GN+K+G +D+ NHKWFA   W  + ERK++  I+P+    GDT  +D Y+E++ R I      A+E F EF
Sbjct:   85 LDDFERLKTLGTGSFGRVMLVKHKATEQYYAMKILDKQKVVKLKQIEHTLNEKRILQAVSFPFLVRLEYAFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEHHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQHGYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHF-SSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYERKVEAPIIPKCRGPGDTSNFDDYEEEEIR-ISDTEKCAKE-FLEF 395          
BLAST of cAMP-dependent protein kinase, catalytic subunit-like vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001814.1 (pep scaffold:Pmarinus_7.0:GL481074:830:17391:1 gene:ENSPMAG00000001637.1 transcript:ENSPMAT00000001814.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 309.301 bits (791), Expect = 2.916e-104
Identity = 147/291 (50.52%), Postives = 203/291 (69.76%), Query Frame = 3
Query:  240 KETNTYYALKILVIEDVIRMKQVEHVKNEKLILEKVNHPFIVNLFWTRHDVKFLYMLLEYICGGELFTYLRNQGKFNNETGLFFSCEIISALSYLHSLQIVYRDLKPENLLIDQNGHIKITDFGFAKVLRDRTYTMCGTPEYLAPEIIQGKGYNRAVDWWALGVLIYEMLVGNPPFFDDNPMNIYSKILSNKFDFPQNLVEPDARDLIRKLLVSDRTKRLGNMKDGTDDVLNHKWFANISWNDVLERKLKPVIMPQVTHVGDTRCYDKYDEQDWRKIPSCSTAAQEMFAEF 1112
            ++   + +LK      V+++KQVEH  NEK IL+ ++ PF+V L ++  D   LYM+LEY+ GGE+F++LR  G+F+     F++ +I+ A  YLHSL ++YRDLKPENLLIDQ G+I++TDFGFAK ++ RT+T+CGTPEYLAPEII  KGYN+AVDWWALGVLIYEM  G PPFF D P+ IY KI+S K  FP +    D +DL+R LL  D TKR GN+K+G +D+ NHKWF+   W  + +RK++   +P+    GD   +D Y+E++ R I S    A+E FA+F
Sbjct:    1 EQVGQHVSLKATKRTKVVKLKQVEHTLNEKRILQAISFPFLVRLEYSFKDNSNLYMVLEYVPGGEMFSHLRRIGRFSEPHSRFYAAQIVLAFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHF-SSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFSTTDWIAIYQRKVEAPFIPKCKGPGDASNFDDYEEEEIR-ISSTEKCAKE-FADF 288          
BLAST of cAMP-dependent protein kinase, catalytic subunit-like vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002200.1 (pep scaffold:Pmarinus_7.0:GL479132:31244:36905:-1 gene:ENSPMAG00000001993.1 transcript:ENSPMAT00000002200.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 249.21 bits (635), Expect = 4.253e-80
Identity = 126/295 (42.71%), Postives = 185/295 (62.71%), Query Frame = 3
Query:  180 VELLRTVGTGTFGRVMAVREKETNTYYALKILVIEDVIRMKQVEHVKNEKLILEKVNHPFIVNLFWTRHDVKFLYMLLEYICGGELFTYLRNQGKFNNETGLFFSCEIISALSYLHSLQIVYRDLKPENLLIDQNGHIKITDFGFAKVLR--DRTYTMCGTPEYLAPEIIQGKGYNRAVDWWALGVLIYEMLVGNPPFFDDNPMNIYSKIL--SNKFDFPQNLVEPDARDLIRKLLVSDRTKRLGNMKDGTDDVLNHKWFANISWNDVLERKLKPVIMPQVTHVGDTRCYDKYDE 1052
            ++++ T+G G FGRV  V+ K+++  +ALK L  + V+  +Q EHV +EK IL++ + PFIV  + T  D KF+++L+E   GGEL++ LR+ G F   +  F    ++ AL+YLH+  I+YRDLKPENLL+D  G+IK+ DFGFAK L    + +T CGTPEY+ PE+I  +G++R  D WALGVL+YE+L G PPF   +PM  Y+ IL    +  FP N V   A D+IR+L   + ++RLGN K G  DV  HKWF    W  +   +L   +  +V+   D + +D + E
Sbjct:   34 MDVIATLGVGGFGRVQLVKLKDSDVTFALKCLKKKFVVESRQQEHVYSEKRILQECSCPFIVRFYRTFRDQKFVFLLMEACLGGELWSVLRDSGGFQEVSARFCVACVVEALAYLHARGILYRDLKPENLLLDARGYIKMADFGFAKKLACGRKAWTFCGTPEYVCPEMIVNRGHDRGADCWALGVLVYELLAGVPPFSGTDPMKTYNAILWGMERVHFP-NEVGKRAEDIIRRLCRQNPSERLGNQKHGVGDVRKHKWFQGFDWESLRSNQLASPLKREVSGPTDFKNFDWFPE 327          
BLAST of cAMP-dependent protein kinase, catalytic subunit-like vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008480.1 (pep scaffold:Pmarinus_7.0:GL482122:191709:206473:1 gene:ENSPMAG00000007654.1 transcript:ENSPMAT00000008480.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 247.669 bits (631), Expect = 8.827e-78
Identity = 127/300 (42.33%), Postives = 181/300 (60.33%), Query Frame = 3
Query:  156 RENFTLKKVELLRTVGTGTFGRVMAVREKETNTYYALKILVIEDVIRMKQVEHVKNEKLILEKVNHPFIVNLFWTRHDVKFLYMLLEYICGGELFTYLRNQGKFNNETGLFFSCEIISALSYLHSLQ-IVYRDLKPENLLIDQNGHIKITDFGFAKVLRDRTYTM---CGTPEYLAPEIIQGKGYNRAVDWWALGVLIYEMLVGNPPFFDDNPMNIYSKILSNKFDFPQNLVEPDARDLIRKLLVSDRTKRLGNMKDGTDDVLNHKWFANISWNDVLERKLKPVIMPQVTHVGDTRCYDK 1043
            +   T+   + L+ +G GTFG+V+ VREK T  YYA+KIL  E ++   +V H   E  +L+   HPF+  L ++      L  ++EY+ GGELF +L  +  F+ +   F+  EI+SAL YLH+ + +VYRDLK ENL++D++GHIKI DFG  K       TM   CGTPEYLAPE+++   Y RAVDWW LGV++YEM+ G  PF++ +   ++  IL     FP+ L   DAR L+  LL  D  +RLG   D   +++ H +FA I W DV +RK+ P   PQV    DTR +D+
Sbjct:  142 KSKVTMNNFDYLKLLGKGTFGKVILVREKATGQYYAMKILKKEVIVAKDEVAHTLTENRVLQTTKHPFLTLLKYSFQTHDRLCFVMEYVNGGELFFHLSRERVFSEDRTRFYGAEIVSALDYLHTEKNVVYRDLKLENLMLDKDGHIKIADFGLCKEGITDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELILMEDIRFPRTLSN-DARALLSGLLKKDPKQRLGGGVDDAKEIMRHSFFAGIIWQDVYDRKMTPPFKPQVASETDTRYFDE 440          
BLAST of cAMP-dependent protein kinase, catalytic subunit-like vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004761.1 (pep scaffold:Pmarinus_7.0:GL481731:9563:15328:1 gene:ENSPMAG00000004332.1 transcript:ENSPMAT00000004761.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 226.098 bits (575), Expect = 4.356e-73
Identity = 110/187 (58.82%), Postives = 139/187 (74.33%), Query Frame = 3
Query:  198 VGTGTFGRVMAVREKETNTYYALKILVIEDVIRMKQVEHVKNEKLILEKVN-HPFIVNLFWTRHDVKFLYMLLEYICGGELFTYLRNQGKFNNETGLFFSCEIISALSYLHSLQIVYRDLKPENLLIDQNGHIKITDFGFAKVLRDRTYTMCGTPEYLAPEIIQGKGYNRAVDWWALGVLIYEMLVG 755
             GTGTFGRV+ VR + +  +YALK++ I DV+R+KQ  HV++EK IL  V  HPFI+ LFWT HD +FLYML+E++ GGELFTYLR  G+F      FF+ EI  AL+YLHS  +VYRDLK E L +  +  + ITD+  +K ++ RT+TMCGTPEYLAPEIIQ KGY + VDWWALGVLI+EML G
Sbjct:    5 AGTGTFGRVLLVRHRHSAAFYALKVMSIADVLRLKQERHVQSEKDILRDVQPHPFIIQLFWTHHDERFLYMLMEFVSGGELFTYLRTDGRFAASRAAFFAAEITCALAYLHSRTVVYRDLKAETLYMFTSLRLDITDWHVSKEIKARTWTMCGTPEYLAPEIIQSKGYGKGVDWWALGVLIFEMLCG 191          
BLAST of cAMP-dependent protein kinase, catalytic subunit-like vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006766.1 (pep scaffold:Pmarinus_7.0:GL478342:9725:27922:-1 gene:ENSPMAG00000006086.1 transcript:ENSPMAT00000006766.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 224.172 bits (570), Expect = 2.598e-69
Identity = 117/293 (39.93%), Postives = 172/293 (58.70%), Query Frame = 3
Query:  183 ELLRTVGTGTFGRVMAVREKETNTYYALKILVIEDVIRMKQVEHVKNEKLILEK-VNHPFIVNLFWTRHDVKFLYMLLEYICGGELFTYLRNQGKFNNETGLFFSCEIISALSYLHSLQIVYRDLKPENLLIDQNGHIKITDFGFAKVLRD---RTYTMCGTPEYLAPEIIQGKGYNRAVDWWALGVLIYEMLVGNPPFFDDNPMNIYSKILSNKFDFPQNLVEPDARDLIRKLLVSDRTKRLGNMKDGTDDVL---NHKWFANISWNDVLERKLKPVIMPQVTHVGDTRCYD 1040
            + L  +G G+FG+V+  + K    +YA+K++    +++ K+ +H+  E+ +L K V HPF+V L ++      LY +++Y+ GGELF +L+ QG F      F++ EI SA+ YLHSL IVYRDLKPEN+L+D  GHI +TDFG  K   D    T T CGTPEYLAPE+++   Y+R VDWW LG ++YEML G PPF+  N   +Y  IL       +      A  ++  LL  D  +RLG     T D+L   NH +F+ I+WND+  +++     P V+   D   +D
Sbjct:   93 DFLTVLGKGSFGKVLLAKHKSDGIFYAVKVMKKSIILQKKEEKHIMAERNVLVKNVRHPFLVGLHYSFQSADKLYFVMDYVNGGELFFHLQRQGSFPESRAQFYAAEIGSAIGYLHSLNIVYRDLKPENILLDYQGHIVLTDFGLCKEGIDPHSTTCTFCGTPEYLAPEVLKKHPYDRTVDWWCLGCVLYEMLYGLPPFYSKNLKQMYESILHQPLQL-RPCTTNAAISVLEGLLHKDPHQRLG----ATSDILEIKNHVFFSTINWNDLDAKRIPSPYNPGVSGPCDLHNFD 380          
BLAST of cAMP-dependent protein kinase, catalytic subunit-like vs. Ensembl Yeast
Match: TPK1 (cAMP-dependent protein kinase catalytic subunit; promotes vegetative growth in response to nutrients via the Ras-cAMP signaling pathway; inhibited by regulatory subunit Bcy1p in the absence of cAMP; phosphorylates and inhibits Whi3p to promote G1/S phase passage; partially redundant with Tpk2p and Tpk3p; phosphorylates pre-Tom40p, which impairs its import into mitochondria under non-respiratory conditions; TPK1 has a paralog, TPK3, that arose from the whole genome duplication [Source:SGD;Acc:S000003700])

HSP 1 Score: 325.094 bits (832), Expect = 3.575e-109
Identity = 146/299 (48.83%), Postives = 211/299 (70.57%), Query Frame = 3
Query:  165 FTLKKVELLRTVGTGTFGRVMAVREKETNTYYALKILVIEDVIRMKQVEHVKNEKLILEKVNHPFIVNLFWTRHDVKFLYMLLEYICGGELFTYLRNQGKFNNETGLFFSCEIISALSYLHSLQIVYRDLKPENLLIDQNGHIKITDFGFAKVLRDRTYTMCGTPEYLAPEIIQGKGYNRAVDWWALGVLIYEMLVGNPPFFDDNPMNIYSKILSNKFDFPQNLVEPDARDLIRKLLVSDRTKRLGNMKDGTDDVLNHKWFANISWNDVLERKLKPVIMPQVTH-VGDTRCYDKYDEQD 1058
            ++L+  ++LRT+GTG+FGRV  +R +    YYA+K+L  E V+R+KQVEH  +E+L+L  V HPFI+ ++ T  D + ++M+++YI GGELF+ LR   +F N    F++ E+  AL YLHS  I+YRDLKPEN+L+D+NGHIKITDFGFAK + D TYT+CGTP+Y+APE++  K YN+++DWW+ G+LIYEML G  PF+D N M  Y KIL+ +  FP    E D +DL+ +L+  D ++RLGN+++GT+DV NH WF  + W  +L R ++    P +    GDT  +DKY E+D
Sbjct:   82 YSLQDFQILRTLGTGSFGRVHLIRSRHNGRYYAMKVLKKEIVVRLKQVEHTNDERLMLSIVTHPFIIRMWGTFQDAQQIFMIMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVCLALEYLHSKDIIYRDLKPENILLDKNGHIKITDFGFAKYVPDVTYTLCGTPDYIAPEVVSTKPYNKSIDWWSFGILIYEMLAGYTPFYDSNTMKTYEKILNAELRFPPFFNE-DVKDLLSRLITRDLSQRLGNLQNGTEDVKNHPWFKEVVWEKLLSRNIETPYEPPIQQGQGDTSQFDKYPEED 379          
BLAST of cAMP-dependent protein kinase, catalytic subunit-like vs. Ensembl Yeast
Match: TPK2 (cAMP-dependent protein kinase catalytic subunit; promotes vegetative growth in response to nutrients via the Ras-cAMP signaling pathway; partially redundant with Tpk1p and Tpk3p; localizes to P-bodies during stationary phase; relocalizes to the cytosol in response to hypoxia [Source:SGD;Acc:S000006124])

HSP 1 Score: 317.005 bits (811), Expect = 3.695e-106
Identity = 142/302 (47.02%), Postives = 210/302 (69.54%), Query Frame = 3
Query:  153 DRENFTLKKVELLRTVGTGTFGRVMAVREKETNTYYALKILVIEDVIRMKQVEHVKNEKLILEKVNHPFIVNLFWTRHDVKFLYMLLEYICGGELFTYLRNQGKFNNETGLFFSCEIISALSYLHSLQIVYRDLKPENLLIDQNGHIKITDFGFAKVLRDRTYTMCGTPEYLAPEIIQGKGYNRAVDWWALGVLIYEMLVGNPPFFDDNPMNIYSKILSNKFDFPQNLVEPDARDLIRKLLVSDRTKRLGNMKDGTDDVLNHKWFANISWNDVLERKLKPVIMPQVTH-VGDTRCYDKYDEQ 1055
             +  +TL   +++RT+GTG+FGRV  VR      YYA+K+L  + V++MKQVEH  +E+ +L+ V HPF++ ++ T  D + ++M+++YI GGELF+ LR   +F N    F++ E+I AL YLH+  I+YRDLKPEN+L+D+NGHIKITDFGFAK ++  T+T+CGTP+Y+APE+I  K YN++VDWW+LGVLIYEML G  PF+D  PM  Y KIL  K  +P     PD  DL+ KL+ +D T+R+GN++ G+ D+  H WF+ + W  +L + ++    P +T  +GDT  +D+Y E+
Sbjct:   61 SKGKYTLHDFQIMRTLGTGSFGRVHLVRSVHNGRYYAIKVLKKQQVVKMKQVEHTNDERRMLKLVEHPFLIRMWGTFQDARNIFMVMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVILALEYLHAHNIIYRDLKPENILLDRNGHIKITDFGFAKEVQTVTWTLCGTPDYIAPEVITTKPYNKSVDWWSLGVLIYEMLAGYTPFYDTTPMKTYEKILQGKVVYPPYF-HPDVVDLLSKLITADLTRRIGNLQSGSRDIKAHPWFSEVVWERLLAKDIETPYEPPITSGIGDTSLFDQYPEE 361          
BLAST of cAMP-dependent protein kinase, catalytic subunit-like vs. Ensembl Yeast
Match: TPK3 (cAMP-dependent protein kinase catalytic subunit; promotes vegetative growth in response to nutrients via the Ras-cAMP signaling pathway; partially redundant with Tpk1p and Tpk2p; localizes to P-bodies during stationary phase; TPK3 has a paralog, TPK1, that arose from the whole genome duplication [Source:SGD;Acc:S000001649])

HSP 1 Score: 313.153 bits (801), Expect = 1.706e-104
Identity = 141/300 (47.00%), Postives = 209/300 (69.67%), Query Frame = 3
Query:  165 FTLKKVELLRTVGTGTFGRVMAVREKETNTYYALKILVIEDVIRMKQVEHVKNEKLILEKVNHPFIVNLFWTRHDVKFLYMLLEYICGGELFTYLRNQGKFNNETGLFFSCEIISALSYLHSLQIVYRDLKPENLLIDQNGHIKITDFGFAKVLRDRTYTMCGTPEYLAPEIIQGKGYNRAVDWWALGVLIYEMLVGNPPFFDDNPMNIYSKILSNKFDFPQNLVEPDARDLIRKLLVSDRTKRLGNMKDGTDDVLNHKWFANISWNDVLERKLKPVIMPQVTH-VGDTRCYDKYDEQDW 1061
            ++L   ++LRT+GTG+FGRV  +R      +YALK L    ++++KQVEH  +E+ +L  V+HPFI+ ++ T  D + ++M+++YI GGELF+ LR   +F N    F++ E+  AL YLHS  I+YRDLKPEN+L+D+NGHIKITDFGFAK + D TYT+CGTP+Y+APE++  K YN++VDWW+ GVLIYEML G  PF++ N M  Y  IL+ +  FP     PDA+DL++KL+  D ++RLGN+++G++DV NH WF  + W  +L R ++    P +    GDT  +D+Y E+++
Sbjct:   83 YSLSDFQILRTLGTGSFGRVHLIRSNHNGRFYALKTLKKHTIVKLKQVEHTNDERRMLSIVSHPFIIRMWGTFQDSQQVFMVMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVCLALEYLHSKDIIYRDLKPENILLDKNGHIKITDFGFAKYVPDVTYTLCGTPDYIAPEVVSTKPYNKSVDWWSFGVLIYEMLAGYTPFYNSNTMKTYENILNAELKFPP-FFHPDAQDLLKKLITRDLSERLGNLQNGSEDVKNHPWFNEVIWEKLLARYIETPYEPPIQQGQGDTSQFDRYPEEEF 381          
BLAST of cAMP-dependent protein kinase, catalytic subunit-like vs. Ensembl Yeast
Match: YPK1 (S/T protein kinase; phosphorylates, downregulates flippase activator Fpk1p; inactivates Orm1p and Orm2p by phosphorylation in response to compromised sphingolipid synthesis; involved in the TORC-dependent phosphorylation of ribosomal proteins Rps6a/b (S6); mutations affect receptor-mediated endocytosis and sphingolipid-mediated and cell integrity signaling pathways; human homolog SGK1 can complement a null mutant; human homolog SGK2 can complement a ypk1 ypk2 double mutant [Source:SGD;Acc:S000001609])

HSP 1 Score: 256.914 bits (655), Expect = 1.805e-79
Identity = 129/304 (42.43%), Postives = 194/304 (63.82%), Query Frame = 3
Query:  141 KPNFDRENFTLKKVELLRTVGTGTFGRVMAVREKETNTYYALKILVIEDVIRMKQVEHVKNEKLILEKVNHPFIVNLFWTRHDVKFLYMLLEYICGGELFTYLRNQGKFNNETGLFFSCEIISALSYLHSLQIVYRDLKPENLLIDQNGHIKITDFGFAKVLR---DRTYTMCGTPEYLAPEIIQGKGYNRAVDWWALGVLIYEMLVGNPPFFDDNPMNIYSKILSNKFDFPQNLVEPDARDLIRKLLVSDRTKRLGNMKDGTDDVLNHKWFANISWNDVLERKLKPVIMPQVTHVGDTRCYDK 1043
            KP+ ++   ++   +LL+ +G G+FG+VM VR+K+T   YALK +    ++   +V H   E+ +L +V+ PFIV L ++    + LY +L +I GGELF +L+ +G+F+     F++ E++ AL  LH L +VYRDLKPEN+L+D  GHI + DFG  K+     D+T T CGTPEYLAPE++ G GY +AVDWW LGVL+YEML G PP++D++   +Y KIL     FP    + DA+DL+  LL  D T+RLG   +G D++ NH +F+ +SW  +L +   P   P V++  DT  +D+
Sbjct:  335 KPSRNKP-LSIDDFDLLKVIGKGSFGKVMQVRKKDTQKVYALKAIRKSYIVSKSEVTHTLAERTVLARVDCPFIVPLKFSFQSPEKLYFVLAFINGGELFYHLQKEGRFDLSRARFYTAELLCALDNLHKLDVVYRDLKPENILLDYQGHIALCDFGLCKLNMKDDDKTDTFCGTPEYLAPELLLGLGYTKAVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQEPLVFPDGF-DRDAKDLLIGLLSRDPTRRLG--YNGADEIRNHPFFSQLSWKRLLMKGYIPPYKPAVSNSMDTSNFDE 634          
BLAST of cAMP-dependent protein kinase, catalytic subunit-like vs. Ensembl Yeast
Match: YPK2 (Protein kinase similar to S/T protein kinase Ypk1p; functionally redundant with YPK1 at the genetic level; participates in a signaling pathway required for optimal cell wall integrity; involved in the TORC-dependent phosphorylation of ribosomal proteins Rps6a/b (S6); human homolog SGK2 can complement a ypk1 ypk2 double mutant [Source:SGD;Acc:S000004710])

HSP 1 Score: 254.218 bits (648), Expect = 1.498e-78
Identity = 129/304 (42.43%), Postives = 194/304 (63.82%), Query Frame = 3
Query:  141 KPNFDRENFTLKKVELLRTVGTGTFGRVMAVREKETNTYYALKILVIEDVIRMKQVEHVKNEKLILEKVNHPFIVNLFWTRHDVKFLYMLLEYICGGELFTYLRNQGKFNNETGLFFSCEIISALSYLHSLQIVYRDLKPENLLIDQNGHIKITDFGFAKVL---RDRTYTMCGTPEYLAPEIIQGKGYNRAVDWWALGVLIYEMLVGNPPFFDDNPMNIYSKILSNKFDFPQNLVEPDARDLIRKLLVSDRTKRLGNMKDGTDDVLNHKWFANISWNDVLERKLKPVIMPQVTHVGDTRCYDK 1043
            KP+ ++   ++   +LL+ +G G+FG+VM VR+K+T   YALK L    ++   +V H   E+ +L +V+ PFIV L ++    + LY++L +I GGELF +L+++G+F+     F+  E++ AL  LH L ++YRDLKPEN+L+D  GHI + DFG  K+     D+T T CGTPEYLAPEI+ G+GY + VDWW LG+L+YEM+ G PP++D+N   +Y KIL     FP    +P A+DL+  LL  D ++RLG   +GTD++ NH +F +ISW  +L +   P   P V    DT  +D+
Sbjct:  332 KPSKNKP-LSIDDFDLLKVIGKGSFGKVMQVRKKDTQKIYALKALRKAYIVSKCEVTHTLAERTVLARVDCPFIVPLKFSFQSPEKLYLVLAFINGGELFYHLQHEGRFSLARSRFYIAELLCALDSLHKLDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDNDKTDTFCGTPEYLAPEILLGQGYTKTVDWWTLGILLYEMMTGLPPYYDENVPVMYKKILQQPLLFPDGF-DPAAKDLLIGLLSRDPSRRLG--VNGTDEIRNHPFFKDISWKKLLLKGYIPPYKPIVKSEIDTANFDQ 631          
BLAST of cAMP-dependent protein kinase, catalytic subunit-like vs. Ensembl Nematostella
Match: EDO35228 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SM62])

HSP 1 Score: 443.736 bits (1140), Expect = 2.885e-156
Identity = 203/315 (64.44%), Postives = 252/315 (80.00%), Query Frame = 3
Query:  168 TLKKVELLRTVGTGTFGRVMAVREKETNTYYALKILVIEDVIRMKQVEHVKNEKLILEKVNHPFIVNLFWTRHDVKFLYMLLEYICGGELFTYLRNQGKFNNETGLFFSCEIISALSYLHSLQIVYRDLKPENLLIDQNGHIKITDFGFAKVLRDRTYTMCGTPEYLAPEIIQGKGYNRAVDWWALGVLIYEMLVGNPPFFDDNPMNIYSKILSNKFDFPQNLVEPDARDLIRKLLVSDRTKRLGNMKDGTDDVLNHKWFANISWNDVLERKLKPVIMPQVTHVGDTRCYDKYDEQDWRKIPSCSTAAQEMFAEF 1112
            TL+  EL +T+GTGTFGRV+  R++    +YALKI+ I +VIR+KQVEHV+NEK IL  + HPFIVNL WT+HD  FLYMLLEY CGGELFTYLR  G+FNN TGLFF  EI+SA+ YLH   IVYRDLKPEN+L+D++GH+K+TDFGFAK + D+T+T+CGTPEYLAPEIIQ KG+N+AVDWWALG+LIYEMLVG PPFFDDNP  IY KILS K ++P+++    A+DLI+KLLV DRT+RLG+MK+G++DV NHKWF  I WN VL+RKLKP I P+++H GDTR +D Y E+DWR  P  +    E F +F
Sbjct:   14 TLQDFELSKTLGTGTFGRVLLARDRRGGEFYALKIMNISEVIRLKQVEHVQNEKNILMSIEHPFIVNLLWTQHDQTFLYMLLEYACGGELFTYLRTAGRFNNGTGLFFGSEIVSAMDYLHGHSIVYRDLKPENILLDRDGHVKLTDFGFAKEVHDKTWTLCGTPEYLAPEIIQSKGHNKAVDWWALGILIYEMLVGYPPFFDDNPFGIYEKILSGKVEWPKHMDNTSAKDLIKKLLVHDRTRRLGSMKNGSEDVKNHKWFKVIDWNLVLQRKLKPPINPKISHPGDTRNFDDYPEEDWRGAPPLNAKHLEPFKDF 328          
BLAST of cAMP-dependent protein kinase, catalytic subunit-like vs. Ensembl Nematostella
Match: EDO38407 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SCZ7])

HSP 1 Score: 253.447 bits (646), Expect = 6.859e-78
Identity = 128/287 (44.60%), Postives = 185/287 (64.46%), Query Frame = 3
Query:  162 NFTLKKVELLRTVGTGTFGRVMAVREKETNTYYALKILVIEDVIRMKQVEHVKNEKLILEKVNHPFIVNLFWTRHDVKFLYMLLEYICGGELFTYLRNQGKFNNETGLFFSCEIISALSYLHSLQIVYRDLKPENLLIDQNGHIKITDFGFAKVL--RDRTYTMCGTPEYLAPEIIQGKGYNRAVDWWALGVLIYEMLVGNPPFFDDNPMNIYSKILS--NKFDFPQNLVEPDARDLIRKLLVSDRTKRLGNMKDGTDDVLNHKWFANISWNDVLERKLKPVIMPQV 1010
            N  L+ + +++T+G G FGRV  V+       +ALK L    ++  +Q +H+ +EK I+ + N PFIV L  T  D K+LYMLLE   GGEL+T LR++G F++ T  F+   +I A  YLHS  IVYRDLKPENLL+D +G+ K+ DFGFAK +    +T+T CGTPEY+APEII  KG++ + D+W+LG+L+YE+L G+PPF   +PM  Y+ IL   +  DFP+ +   +A  LI+KL   +  +RLG  K G  D++ HKWF   +W+ +  RKL   I P++
Sbjct:  346 NVRLEDLTVVKTLGIGGFGRVELVQVAGDKRTFALKTLKKHHIVETRQQDHIMSEKKIMMESNSPFIVRLHKTFKDKKYLYMLLEVCLGGELWTILRDRGSFDDSTTRFYVGCVIEAFQYLHSKGIVYRDLKPENLLLDGHGYCKLVDFGFAKKIGFGRKTWTFCGTPEYVAPEIILNKGHDLSADYWSLGILMYELLTGSPPFSGTDPMKTYNIILKGIDMIDFPRKITR-NAHALIKKLCRDNPVERLGYQKGGLKDIMKHKWFDGFNWDGLRSRKLNSPIAPKI 631          
BLAST of cAMP-dependent protein kinase, catalytic subunit-like vs. Ensembl Nematostella
Match: EDO41166 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S521])

HSP 1 Score: 245.358 bits (625), Expect = 2.318e-77
Identity = 136/333 (40.84%), Postives = 187/333 (56.16%), Query Frame = 3
Query:  147 NFDRENFTLKKVELLRTVGTGTFGRVMAVREKETNT---YYALKILVIEDVIR-MKQVEHVKNEKLILEKVNHPFIVNLFWTRHDVKFLYMLLEYICGGELFTYLRNQGKFNNETGLFFSCEIISALSYLHSLQIVYRDLKPENLLIDQNGHIKITDFGFAK---VLRDRTYTMCGTPEYLAPEIIQGKGYNRAVDWWALGVLIYEMLVGNPPFFDDNPMNIYSKILSNKFDFPQNLVEPDARDLIRKLLVSDRTKRLGNMKDGTDDVLNHKWFANISWNDVLERKLKPVIMPQVTHVGDTRCYD-KYDEQDWRKIPS---CSTAAQEMFAEF 1112
            N   E    +  ELL+ +G G +G+V  V++   ++    +A+K+L    +IR  K   H K E+ ILE V HPFIV+L +       LY++LEY+ GGELF  L  +G F  +T  F+  EI  AL +LH   IVYRDLKPEN+L+D NGH+K+TDFG  K        T+T CGT EY+APEI+   G+ +AVDWW+LG L+Y+ML G PPF  DN      KIL  K   P  L  P+A+D IRKLL      RLG M    + +  H +F +I W D+L +K++P   P ++   D   +D K+  Q     P     S +A  +F  F
Sbjct:   54 NPKDEKVGPESFELLKVLGKGGYGKVFLVKKNHGHSKEKIFAMKVLKKAAIIRSQKDTAHTKAERNILECVKHPFIVDLIYAFQTGGKLYLILEYLSGGELFMQLEREGIFLEDTACFYLSEISMALEHLHKQGIVYRDLKPENILLDANGHVKLTDFGLCKESIFENSLTHTFCGTIEYMAPEILTRSGHGKAVDWWSLGALMYDMLTGTPPFCADNRKKTIDKILKGKLIIPPYLT-PEAKDFIRKLLKRHPQARLGGMAGDANPIKAHSFFRHICWEDLLAKKVEPPFRPSISGEEDVSQFDSKFTRQTPVDSPDDSMLSESASNIFQGF 385          
BLAST of cAMP-dependent protein kinase, catalytic subunit-like vs. Ensembl Nematostella
Match: EDO37800 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SEW2])

HSP 1 Score: 237.654 bits (605), Expect = 1.900e-74
Identity = 113/289 (39.10%), Postives = 179/289 (61.94%), Query Frame = 3
Query:  186 LLRTVGTGTFGRVMAVREKETNTYYALKILVIEDVIRMKQVEHVKNEKLIL-EKVNHPFIVNLFWTRHDVKFLYMLLEYICGGELFTYLRNQGKFNNETGLFFSCEIISALSYLHSLQIVYRDLKPENLLIDQNGHIKITDFGFAKVLRDR---TYTMCGTPEYLAPEIIQGKGYNRAVDWWALGVLIYEMLVGNPPFFDDNPMNIYSKILSNKFDFPQNLVEPDARDLIRKLLVSDRTKRLGNMKDGTDDVLNHKWFANISWNDVLERKLKPVIMPQVTHVGDTRCYD 1040
             L+ +G G+FG+V   + K+ + +YA+K+L    + +  + +H+  E+ +L + V HPF+V L ++      LY +L+Y+ GGELF +L+ +  F      F++ EI SA+ YLH LQI+YRDLKPEN+L+D  GHI +TDFG  K   DR   T T CGTPEYLAPE+++ + Y+++VDWW LG ++YEM+ G PPF+  +   +Y  IL        N+ +  AR ++  LL  D+TKRLG+ +   +D+  H +F +I+W  ++ R ++P   P V+   D + +D
Sbjct:   76 FLKVIGKGSFGKVFLSKNKQEDKFYAIKVLNKSAIRKRNEAKHIMAERNVLVQNVTHPFLVGLHYSFQTKDKLYFVLDYVNGGELFFHLQRERYFPESRARFYAAEIASAIGYLHGLQIIYRDLKPENILLDSKGHIVLTDFGLCKEGIDRSGTTSTFCGTPEYLAPEVLRKQDYDKSVDWWCLGAVLYEMMYGLPPFYSRDTAEMYDNILHKPLRLRTNISQ-SARHILEGLLQKDKTKRLGSGEGDFEDIRTHSFFRSINWQQLVARGIEPPYNPNVSGQLDLKHFD 363          
BLAST of cAMP-dependent protein kinase, catalytic subunit-like vs. Ensembl Nematostella
Match: EDO38399 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SCY8])

HSP 1 Score: 231.491 bits (589), Expect = 1.031e-69
Identity = 119/265 (44.91%), Postives = 173/265 (65.28%), Query Frame = 3
Query:  162 NFTLKKVELLRTVGTGTFGRVMAVREKETNTYYALKILVIEDVIRMKQVEHVKNEKLILEKVNHPFIVNLFWTRHDVKFLYMLLEYICGGELFTYLRNQGKFNNETGLFFSCEIISALSYLHSLQIVYRDLKPENLLIDQNGHIKITDFGFAKVLRD--RTYTMCGTPEYLAPEIIQGKGYNRAVDWWALGVLIYEMLVGNPPFFDDNPMNIYSKILS--NKFDFPQNLVEPDARDLIRKLLVSDRTKRLGNMKDGTDDVLNHKW 944
            + TL+ +E++ T+GTG FGRV  V        YALK L  + ++  +Q EHV +EK IL + N PFI  ++ T  D K++YMLLE   GGEL+T LR++G F + T  F    ++    YLHS  IVYRDLKPENLL+D  G++K+ DFGFAK +    +T+T CGTPEY+APEII  KG++ + D+W+LG+LI+E+L G+PPF   +PM  Y+ IL   +  +FP+ +   + ++LI++L   +  +RLG  KDG  D+  HK+
Sbjct:  325 DLTLEDLEVVATLGTGGFGRVELV-------TYALKCLKKKHILDTRQQEHVYSEKRILMETNSPFICKIYRTFKDRKYVYMLLEACLGGELWTILRDRGTFEDATARFCIACVVEGFEYLHSKGIVYRDLKPENLLLDAKGYVKLVDFGFAKKIGSGRKTWTFCGTPEYVAPEIILNKGHDLSSDYWSLGILIFELLTGSPPFSSSDPMKTYNIILRGLDMVEFPKRIGR-NPQNLIKRLCKDNPVERLGYQKDGLSDIKKHKY 581          
BLAST of cAMP-dependent protein kinase, catalytic subunit-like vs. Ensembl Medaka
Match: prkx (protein kinase X-linked [Source:NCBI gene;Acc:101168847])

HSP 1 Score: 416.387 bits (1069), Expect = 1.228e-144
Identity = 187/317 (58.99%), Postives = 246/317 (77.60%), Query Frame = 3
Query:  162 NFTLKKVELLRTVGTGTFGRVMAVREKETNTYYALKILVIEDVIRMKQVEHVKNEKLILEKVNHPFIVNLFWTRHDVKFLYMLLEYICGGELFTYLRNQGKFNNETGLFFSCEIISALSYLHSLQIVYRDLKPENLLIDQNGHIKITDFGFAKVLRDRTYTMCGTPEYLAPEIIQGKGYNRAVDWWALGVLIYEMLVGNPPFFDDNPMNIYSKILSNKFDFPQNLVEPDARDLIRKLLVSDRTKRLGNMKDGTDDVLNHKWFANISWNDVLERKLKPVIMPQVTHVGDTRCYDKYDEQDWRKIPSCSTAAQEMFAEF 1112
            +++L++++ + TVGTGTFGRV  VRE+++  +YALK + I DVIR+KQ +HV NEK +L +VNHPF++ L WT HD +FLYML++++ GGELF+YLR++G+F+N  GLF++ EI+ A+ YLHS  IVYRDLKPEN+L+D  GHI++TDFGFAK L DRT+T+CGTPEYLAPE+IQ KG+ RAVDWWALG+L++EML G PPFFDDNP  IY KILS K DFP++L +   +DLI+KLLV DR +RLGNMK+G DDV  H+WF  + W  V  RKLKP I P+V+H GDT  +D Y E DW+K P+      E+F  F
Sbjct:   38 SYSLEELDTVATVGTGTFGRVFLVREQKSKAFYALKQMKIADVIRLKQEQHVHNEKEVLSEVNHPFLIRLLWTHHDERFLYMLMDFVAGGELFSYLRSRGRFSNAAGLFYTSEIVCAIEYLHSKLIVYRDLKPENILLDAEGHIRLTDFGFAKKLSDRTWTLCGTPEYLAPEVIQSKGHGRAVDWWALGILVFEMLAGYPPFFDDNPFGIYQKILSGKLDFPRHL-DFYVKDLIKKLLVIDRARRLGNMKNGADDVKKHRWFKTVDWEAVPLRKLKPPINPKVSHEGDTSNFDVYPEDDWKKDPAVPPKELEIFKNF 353          
BLAST of cAMP-dependent protein kinase, catalytic subunit-like vs. Ensembl Medaka
Match: prkx (protein kinase X-linked [Source:NCBI gene;Acc:101168847])

HSP 1 Score: 372.859 bits (956), Expect = 1.391e-127
Identity = 177/319 (55.49%), Postives = 236/319 (73.98%), Query Frame = 3
Query:  162 NFTLKKVELLRTVGTGTFGRVMAVREKETNTYYALKILVIEDVIRMKQVEHVKNEKLILEKVNHPFIVNLFWTRHDVKFLYMLLEYICGGELFTYLRNQGKFNNETGLFFSCEIISALSYLHSLQIVYRDLKPENLLIDQNGHIKITDFGFAKVLRDRTYTMCGTPEYLAPEIIQGKGYNRAVDWWALGVLIYEMLVGNPPFFDDNPMNIYSKILSNKFDFPQNLVEPDARDLIRKLLVSDRTKRLGNMKDGTDDVLNHKWFANISWNDVLERKL--KPVIMPQVTHVGDTRCYDKYDEQDWRKIPSCSTAAQEMFAEF 1112
            +++L++++ + TVGTGTFGRV  VRE+++  +YALK + I DVIR+KQ +HV NEK +L +VNHPF++ L WT HD +FLYML++++ GGELF+YLR++G+F+N  GLF++ EI+ A+ YLHS  IVYRDLKPEN+L+D  GHI++TDFGFAK L DRT+T+CGTPEYLAPE+IQ KG+ RAVDWWALG+L++EML G PPFFDDNP  IY KILS K DFP++L +   +DLI+KLLV DR +RLGNMK     V  +           L  +L  +P I P+V+H GDT  +D Y E DW+K P+      E+F  F
Sbjct:   46 SYSLEELDTVATVGTGTFGRVFLVREQKSKAFYALKQMKIADVIRLKQEQHVHNEKEVLSEVNHPFLIRLLWTHHDERFLYMLMDFVAGGELFSYLRSRGRFSNAAGLFYTSEIVCAIEYLHSKLIVYRDLKPENILLDAEGHIRLTDFGFAKKLSDRTWTLCGTPEYLAPEVIQSKGHGRAVDWWALGILVFEMLAGYPPFFDDNPFGIYQKILSGKLDFPRHL-DFYVKDLIKKLLVIDRARRLGNMK-----VSRYHGPTGDGVMVPLTVRLCPQPPINPKVSHEGDTSNFDVYPEDDWKKDPAVPPKELEIFKNF 358          
BLAST of cAMP-dependent protein kinase, catalytic subunit-like vs. Ensembl Medaka
Match: ENSORLT00000007944.2 (protein kinase cAMP-activated catalytic subunit beta [Source:NCBI gene;Acc:101160305])

HSP 1 Score: 346.665 bits (888), Expect = 2.221e-117
Identity = 158/297 (53.20%), Postives = 215/297 (72.39%), Query Frame = 3
Query:  168 TLKKVELLRTVGTGTFGRVMAVREKETNTYYALKILVIEDVIRMKQVEHVKNEKLILEKVNHPFIVNLFWTRHDVKFLYMLLEYICGGELFTYLRNQGKFNNETGLFFSCEIISALSYLHSLQIVYRDLKPENLLIDQNGHIKITDFGFAKVLRDRTYTMCGTPEYLAPEIIQGKGYNRAVDWWALGVLIYEMLVGNPPFFDDNPMNIYSKILSNKFDFPQNLVEPDARDLIRKLLVSDRTKRLGNMKDGTDDVLNHKWFANISWNDVLERKLKPVIMPQVTHVGDTRCYDKYDEQD 1058
            +L   E  +T+GTG+FGRVM V+ K TN +YA+KIL  + V+++KQ+EH  NEK IL+ V+ PF+V L +   D   LYM++EY+ GGE+F++LR  G+F+     F++ +I+    YLHSL ++YRDLKPENLLIDQ+G+I++TDFGFAK ++ RT+T+CGTPEYLAPEII  KGYN+AVDWWALGVLIYEM  G PPFF D P+ IY KI+S K  FP +    D +DL+R LL  D TKR GN+K+G +D+ NHKWF+   W  + ERK++   +P+    GDT  +D Y+E+D
Sbjct:   40 SLDDFERFKTLGTGSFGRVMLVKHKATNQFYAMKILDKQKVVKLKQIEHTLNEKRILQAVSFPFLVRLVYAFKDNSNLYMVMEYVPGGEMFSHLRRTGRFSEHHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQHGYIQVTDFGFAKKVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHF-SSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFSTTDWIAIYERKIEAPFLPKCRGPGDTSNFDDYEEED 335          
BLAST of cAMP-dependent protein kinase, catalytic subunit-like vs. Ensembl Medaka
Match: ENSORLT00000028912.1 (protein kinase cAMP-activated catalytic subunit beta [Source:NCBI gene;Acc:101160305])

HSP 1 Score: 347.051 bits (889), Expect = 4.980e-117
Identity = 158/297 (53.20%), Postives = 215/297 (72.39%), Query Frame = 3
Query:  168 TLKKVELLRTVGTGTFGRVMAVREKETNTYYALKILVIEDVIRMKQVEHVKNEKLILEKVNHPFIVNLFWTRHDVKFLYMLLEYICGGELFTYLRNQGKFNNETGLFFSCEIISALSYLHSLQIVYRDLKPENLLIDQNGHIKITDFGFAKVLRDRTYTMCGTPEYLAPEIIQGKGYNRAVDWWALGVLIYEMLVGNPPFFDDNPMNIYSKILSNKFDFPQNLVEPDARDLIRKLLVSDRTKRLGNMKDGTDDVLNHKWFANISWNDVLERKLKPVIMPQVTHVGDTRCYDKYDEQD 1058
            +L   E  +T+GTG+FGRVM V+ K TN +YA+KIL  + V+++KQ+EH  NEK IL+ V+ PF+V L +   D   LYM++EY+ GGE+F++LR  G+F+     F++ +I+    YLHSL ++YRDLKPENLLIDQ+G+I++TDFGFAK ++ RT+T+CGTPEYLAPEII  KGYN+AVDWWALGVLIYEM  G PPFF D P+ IY KI+S K  FP +    D +DL+R LL  D TKR GN+K+G +D+ NHKWF+   W  + ERK++   +P+    GDT  +D Y+E+D
Sbjct:   69 SLDDFERFKTLGTGSFGRVMLVKHKATNQFYAMKILDKQKVVKLKQIEHTLNEKRILQAVSFPFLVRLVYAFKDNSNLYMVMEYVPGGEMFSHLRRTGRFSEHHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQHGYIQVTDFGFAKKVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHF-SSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFSTTDWIAIYERKIEAPFLPKCRGPGDTSNFDDYEEED 364          
BLAST of cAMP-dependent protein kinase, catalytic subunit-like vs. Ensembl Medaka
Match: prkacaa (cAMP-dependent protein kinase catalytic subunit alpha [Source:NCBI gene;Acc:101163742])

HSP 1 Score: 344.739 bits (883), Expect = 1.322e-116
Identity = 163/322 (50.62%), Postives = 224/322 (69.57%), Query Frame = 3
Query:  147 NFDRENFTLKKVELLRTVGTGTFGRVMAVREKETNTYYALKILVIEDVIRMKQVEHVKNEKLILEKVNHPFIVNLFWTRHDVKFLYMLLEYICGGELFTYLRNQGKFNNETGLFFSCEIISALSYLHSLQIVYRDLKPENLLIDQNGHIKITDFGFAKVLRDRTYTMCGTPEYLAPEIIQGKGYNRAVDWWALGVLIYEMLVGNPPFFDDNPMNIYSKILSNKFDFPQNLVEPDARDLIRKLLVSDRTKRLGNMKDGTDDVLNHKWFANISWNDVLERKLKPVIMPQVTHVGDTRCYDKYDEQDWRKIPSCSTAAQEMFAEF 1112
            N  ++   L   E L+T+GTG+FGRVM V+ KET  ++A+KIL  + V+++KQ+EH  NEK IL+ V+ PF+V L  +  D   LYM++EY+ GGE+F++LR  G+F+     F++ +I+    YLHSL ++YRDLKPENLLIDQ G+I++TDFGFAK ++ RT+T+CGTPEYLAPEII  KGYN+AVDWWALGVLIYEM  G PPFF D P+ IY KI+S K  FP +    D +DL+R LL  D TKR GN+++G +D+  HKWFA   W  + +RK++   +P+    GDT  +D Y+E++ R   S S    + FAEF
Sbjct:   33 NPAQQTAALDHFERLKTLGTGSFGRVMLVKHKETGQHFAMKILDKQKVVKLKQIEHTLNEKRILQAVSFPFLVQLEHSFKDTSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHF-SSDLKDLLRNLLQVDLTKRFGNLRNGVNDIKGHKWFATTDWIAIYQRKVEAPFIPKCKGPGDTSNFDDYEEEEIR--VSFSEKCAKEFAEF 351          
BLAST of cAMP-dependent protein kinase, catalytic subunit-like vs. Planmine SMEST
Match: SMESG000041798.1 (SMESG000041798.1)

HSP 1 Score: 692.96 bits (1787), Expect = 0.000e+0
Identity = 332/333 (99.70%), Postives = 332/333 (99.70%), Query Frame = 3
Query:  114 MSSENCENDKPNFDRENFTLKKVELLRTVGTGTFGRVMAVREKETNTYYALKILVIEDVIRMKQVEHVKNEKLILEKVNHPFIVNLFWTRHDVKFLYMLLEYICGGELFTYLRNQGKFNNETGLFFSCEIISALSYLHSLQIVYRDLKPENLLIDQNGHIKITDFGFAKVLRDRTYTMCGTPEYLAPEIIQGKGYNRAVDWWALGVLIYEMLVGNPPFFDDNPMNIYSKILSNKFDFPQNLVEPDARDLIRKLLVSDRTKRLGNMKDGTDDVLNHKWFANISWNDVLERKLKPVIMPQVTHVGDTRCYDKYDEQDWRKIPSCSTAAQEMFAEF 1112
            MSSENCENDKPNFDRENFTLKKVELLRTVGTGTFGRVMAVREKETNTYYALKILVIEDVIRMKQVEHVKNEK ILEKVNHPFIVNLFWTRHDVKFLYMLLEYICGGELFTYLRNQGKFNNETGLFFSCEIISALSYLHSLQIVYRDLKPENLLIDQNGHIKITDFGFAKVLRDRTYTMCGTPEYLAPEIIQGKGYNRAVDWWALGVLIYEMLVGNPPFFDDNPMNIYSKILSNKFDFPQNLVEPDARDLIRKLLVSDRTKRLGNMKDGTDDVLNHKWFANISWNDVLERKLKPVIMPQVTHVGDTRCYDKYDEQDWRKIPSCSTAAQEMFAEF
Sbjct:    1 MSSENCENDKPNFDRENFTLKKVELLRTVGTGTFGRVMAVREKETNTYYALKILVIEDVIRMKQVEHVKNEKFILEKVNHPFIVNLFWTRHDVKFLYMLLEYICGGELFTYLRNQGKFNNETGLFFSCEIISALSYLHSLQIVYRDLKPENLLIDQNGHIKITDFGFAKVLRDRTYTMCGTPEYLAPEIIQGKGYNRAVDWWALGVLIYEMLVGNPPFFDDNPMNIYSKILSNKFDFPQNLVEPDARDLIRKLLVSDRTKRLGNMKDGTDDVLNHKWFANISWNDVLERKLKPVIMPQVTHVGDTRCYDKYDEQDWRKIPSCSTAAQEMFAEF 333          
BLAST of cAMP-dependent protein kinase, catalytic subunit-like vs. Planmine SMEST
Match: SMESG000077752.1 (SMESG000077752.1)

HSP 1 Score: 518.85 bits (1335), Expect = 0.000e+0
Identity = 233/324 (71.91%), Postives = 283/324 (87.35%), Query Frame = 3
Query:  141 KPNFDRENFTLKKVELLRTVGTGTFGRVMAVREKETNTYYALKILVIEDVIRMKQVEHVKNEKLILEKVNHPFIVNLFWTRHDVKFLYMLLEYICGGELFTYLRNQGKFNNETGLFFSCEIISALSYLHSLQIVYRDLKPENLLIDQNGHIKITDFGFAKVLRDRTYTMCGTPEYLAPEIIQGKGYNRAVDWWALGVLIYEMLVGNPPFFDDNPMNIYSKILSNKFDFPQNLVEPDARDLIRKLLVSDRTKRLGNMKDGTDDVLNHKWFANISWNDVLERKLKPVIMPQVTHVGDTRCYDKYDEQDWRKIPSCSTAAQEMFAEF 1112
            K  F RE+F+LKKVELLRTVGTGTFGRVM VREKET +YYALKI++IED+++MKQVEHV +EK ILE+++HPFIV+L+WT+ D+KFLYMLLEY CGGELFTYLRN  KF + T +F+S EI+SA+SYLH L+IVYRDLKPENLL+DQ GHIKITDFGFAK L DRTYTMCGTPEYLAPEIIQGKGYN+AVDWWALG+LIYEML GNPPF DDNPM IY KIL++KF+FP+  ++  A+DLI+KLL+SDR +RLGNMK G++DV+ H+WF +I WN++L+RK++P I+P +THVGDTRCYD YDEQDWRKI   +T +QE+F  F
Sbjct:   35 KKIFKREDFSLKKVELLRTVGTGTFGRVMVVREKETGSYYALKIMIIEDILKMKQVEHVLSEKQILEQISHPFIVDLYWTKSDIKFLYMLLEYACGGELFTYLRNMAKFPDSTAMFYSAEIVSAISYLHGLRIVYRDLKPENLLLDQKGHIKITDFGFAKFLTDRTYTMCGTPEYLAPEIIQGKGYNKAVDWWALGILIYEMLSGNPPFSDDNPMQIYQKILNSKFEFPKQ-IDSIAKDLIKKLLISDRMRRLGNMKGGSEDVMRHRWFKSIDWNELLKRKIEPPIIPNITHVGDTRCYDNYDEQDWRKISPATTKSQEIFRNF 357          
BLAST of cAMP-dependent protein kinase, catalytic subunit-like vs. Planmine SMEST
Match: SMESG000000892.1 (SMESG000000892.1)

HSP 1 Score: 353.214 bits (905), Expect = 4.964e-120
Identity = 168/314 (53.50%), Postives = 229/314 (72.93%), Query Frame = 3
Query:  162 NFTLKKVELLRTVGTGTFGRVMAVREKETNTYYALKILVIEDVIRMKQVEHVKNEKLILEKVNHPFIVNLFWTRHDVKFLYMLLEYICGGELFTYLRNQGKFNNETGLFFSCEIISALSYLHSLQIVYRDLKPENLLIDQNGHIKITDFGFAKVLRDRTYTMCGTPEYLAPEIIQGKGYNRAVDWWALGVLIYEMLVGNPPFFDDNPMNIYSKILSNKFDFPQNLVEPDARDLIRKLLVSDRTKRLGNMKDGTDDVLNHKWF-ANISWNDVLERKLKPVIMPQVTHVGDTRCYDKYDEQDWRKIPSCSTAAQEM 1100
            N TL +   ++T+GTGTFG V+ V + +T+TYYA+K+L  + +++MKQVEH  NEK IL+ VN PF+VNL ++  D  +LY++LEY+ GGE+F++LR  G+++     F++ +++    YLH L IVYRDLKPEN+LI++NG+IKITDFGFAK ++ RT+T+CGTPEYLAPEII  KGYN+AVDWWALG+LIYEM+VG PPF  D P++IY KI+  KF FP N V PDA+DLIR LL SD TKR GN+K+G  D+ NHKWF  N  W ++ + K+ P   P++  +GDT  +D YDE+   KI      A+E 
Sbjct:   35 NATLAEFTRVKTLGTGTFGTVILVYKPQTDTYYAMKVLNKQKIVKMKQVEHTLNEKRILQAVNFPFLVNLHYSFKDNSYLYLVLEYVVGGEMFSHLRKSGRYSECQANFYASQVVMTFEYLHYLDIVYRDLKPENILINKNGYIKITDFGFAKRIKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGILIYEMIVGYPPFIADQPIHIYEKIVIGKFKFP-NYVSPDAKDLIRCLLQSDLTKRYGNLKNGVADIKNHKWFYGNSDWINIYKEKILPPFKPELKSIGDTSYFDDYDEEP-LKISKREKCAKEF 346          
BLAST of cAMP-dependent protein kinase, catalytic subunit-like vs. Planmine SMEST
Match: SMESG000000892.1 (SMESG000000892.1)

HSP 1 Score: 352.829 bits (904), Expect = 7.193e-120
Identity = 168/314 (53.50%), Postives = 229/314 (72.93%), Query Frame = 3
Query:  162 NFTLKKVELLRTVGTGTFGRVMAVREKETNTYYALKILVIEDVIRMKQVEHVKNEKLILEKVNHPFIVNLFWTRHDVKFLYMLLEYICGGELFTYLRNQGKFNNETGLFFSCEIISALSYLHSLQIVYRDLKPENLLIDQNGHIKITDFGFAKVLRDRTYTMCGTPEYLAPEIIQGKGYNRAVDWWALGVLIYEMLVGNPPFFDDNPMNIYSKILSNKFDFPQNLVEPDARDLIRKLLVSDRTKRLGNMKDGTDDVLNHKWF-ANISWNDVLERKLKPVIMPQVTHVGDTRCYDKYDEQDWRKIPSCSTAAQEM 1100
            N TL +   ++T+GTGTFG V+ V + +T+TYYA+K+L  + +++MKQVEH  NEK IL+ VN PF+VNL ++  D  +LY++LEY+ GGE+F++LR  G+++     F++ +++    YLH L IVYRDLKPEN+LI++NG+IKITDFGFAK ++ RT+T+CGTPEYLAPEII  KGYN+AVDWWALG+LIYEM+VG PPF  D P++IY KI+  KF FP N V PDA+DLIR LL SD TKR GN+K+G  D+ NHKWF  N  W ++ + K+ P   P++  +GDT  +D YDE+   KI      A+E 
Sbjct:   36 NATLAEFTRVKTLGTGTFGTVILVYKPQTDTYYAMKVLNKQKIVKMKQVEHTLNEKRILQAVNFPFLVNLHYSFKDNSYLYLVLEYVVGGEMFSHLRKSGRYSECQANFYASQVVMTFEYLHYLDIVYRDLKPENILINKNGYIKITDFGFAKRIKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGILIYEMIVGYPPFIADQPIHIYEKIVIGKFKFP-NYVSPDAKDLIRCLLQSDLTKRYGNLKNGVADIKNHKWFYGNSDWINIYKEKILPPFKPELKSIGDTSYFDDYDEEP-LKISKREKCAKEF 347          
BLAST of cAMP-dependent protein kinase, catalytic subunit-like vs. Planmine SMEST
Match: SMESG000016651.1 (SMESG000016651.1)

HSP 1 Score: 325.094 bits (832), Expect = 5.214e-109
Identity = 147/319 (46.08%), Postives = 219/319 (68.65%), Query Frame = 3
Query:  156 RENFTLKKVELLRTVGTGTFGRVMAVREKETNTYYALKILVIEDVIRMKQVEHVKNEKLILEKVNHPFIVNLFWTRHDVKFLYMLLEYICGGELFTYLRNQGKFNNETGLFFSCEIISALSYLHSLQIVYRDLKPENLLIDQNGHIKITDFGFAKVLRDRTYTMCGTPEYLAPEIIQGKGYNRAVDWWALGVLIYEMLVGNPPFFDDNPMNIYSKILSNKFDFPQNLVEPDARDLIRKLLVSDRTKRLGNMKDGTDDVLNHKWFANISWNDVLERKLKPVIMPQVTHVGDTRCYDKYDEQDWRKIPSCSTAAQEMFAEF 1112
            +E + L + E+L+T+GTG+FGRV+    K++  Y+A+K+L    ++++KQVEH  NEK IL+ ++ PF++ L ++  D   LYM+LE++ GGE+F++LR  GKF+     F++ +++ A  YLH L ++YRDLKPEN+LID  G++KITDFGFAK ++ RT+T+CGTPEYLAPEII  KGYN AVDWWALG+LI+EM  G PPFF D P+ IY KI++ K  FP +   P+ +DL+R +L +D T+R GNM++G  D+ NH WF +  W    +++L    +P+    GDT  +D Y+E+  +   +C    +  F EF
Sbjct:   37 QETYKLDEFEILKTLGTGSFGRVILALHKKSKKYHAVKVLDKLKIVKLKQVEHTLNEKRILQAIDFPFLIKLDYSFKDNSNLYMVLEFVNGGEMFSHLRRVGKFSENHAKFYASQVVLAFEYLHHLDLIYRDLKPENILIDTKGYLKITDFGFAKRIKGRTWTLCGTPEYLAPEIIMSKGYNNAVDWWALGILIFEMAAGYPPFFADQPIKIYEKIVAAKIKFPSHF-SPELKDLLRNILQTDLTRRFGNMRNGASDIKNHVWFHSFDWYSAFKKELIAPFIPKCRGPGDTSNFDNYEEEVLKISTTCKCTDE--FVEF 352          
The following BLAST results are available for this feature:
BLAST of cAMP-dependent protein kinase, catalytic subunit-like vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PRKX3.209e-14259.49protein kinase X-linked [Source:HGNC Symbol;Acc:HG... [more]
PRKACA2.098e-11751.91protein kinase cAMP-activated catalytic subunit al... [more]
PRKACA2.098e-11751.91protein kinase cAMP-activated catalytic subunit al... [more]
PRKACA2.112e-11751.91protein kinase cAMP-activated catalytic subunit al... [more]
PRKACA2.112e-11751.91protein kinase cAMP-activated catalytic subunit al... [more]
back to top
BLAST of cAMP-dependent protein kinase, catalytic subunit-like vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
F47F2.11.229e-11950.78cAMP-dependent protein kinase, catalytic subunit-l... [more]
F47F2.11.229e-11950.78cAMP-dependent protein kinase, catalytic subunit-l... [more]
F47F2.11.229e-11950.78cAMP-dependent protein kinase, catalytic subunit-l... [more]
F47F2.11.770e-11850.78cAMP-dependent protein kinase, catalytic subunit-l... [more]
kin-11.215e-11450.96cAMP-dependent protein kinase catalytic subunit [... [more]
back to top
BLAST of cAMP-dependent protein kinase, catalytic subunit-like vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pka-C37.730e-14359.81gene:FBgn0000489 transcript:FBtr0075529[more]
Pka-C39.253e-14259.81gene:FBgn0000489 transcript:FBtr0075528[more]
Pka-C11.371e-11451.75gene:FBgn0000273 transcript:FBtr0335495[more]
Pka-C11.371e-11451.75gene:FBgn0000273 transcript:FBtr0079852[more]
Pka-C11.371e-11451.75gene:FBgn0000273 transcript:FBtr0079851[more]
back to top
BLAST of cAMP-dependent protein kinase, catalytic subunit-like vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
prkx1.275e-14359.18protein kinase X-linked [Source:ZFIN;Acc:ZDB-GENE-... [more]
prkacbb1.042e-11549.85protein kinase, cAMP-dependent, catalytic, beta b ... [more]
prkacaa3.719e-11551.11protein kinase, cAMP-dependent, catalytic, alpha, ... [more]
prkacab1.548e-11350.32protein kinase, cAMP-dependent, catalytic, alpha, ... [more]
prkacba2.475e-11148.66protein kinase, cAMP-dependent, catalytic, beta a ... [more]
back to top
BLAST of cAMP-dependent protein kinase, catalytic subunit-like vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000036207.12.417e-15060.90protein kinase X-linked [Source:NCBI gene;Acc:1004... [more]
prkacb1.190e-11651.75protein kinase cAMP-activated catalytic subunit be... [more]
prkacb1.749e-11651.75protein kinase cAMP-activated catalytic subunit be... [more]
ints84.700e-11550.32integrator complex subunit 8 [Source:Xenbase;Acc:X... [more]
ints85.359e-11550.32integrator complex subunit 8 [Source:Xenbase;Acc:X... [more]
back to top
BLAST of cAMP-dependent protein kinase, catalytic subunit-like vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Prkx1.408e-13755.86protein kinase, X-linked [Source:MGI Symbol;Acc:MG... [more]
Prkaca5.647e-11751.27protein kinase, cAMP dependent, catalytic, alpha [... [more]
Prkaca9.057e-11751.27protein kinase, cAMP dependent, catalytic, alpha [... [more]
Prkacb1.495e-11450.15protein kinase, cAMP dependent, catalytic, beta [S... [more]
Prkacb1.745e-11450.15protein kinase, cAMP dependent, catalytic, beta [S... [more]
back to top
BLAST of cAMP-dependent protein kinase, catalytic subunit-like vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P51817|PRKX_HUMAN1.541e-14159.49cAMP-dependent protein kinase catalytic subunit PR... [more]
sp|P16912|KAPC3_DROME9.276e-14159.81cAMP-dependent protein kinase catalytic subunit 3 ... [more]
sp|Q922R0|PRKX_MOUSE9.850e-13755.86cAMP-dependent protein kinase catalytic subunit PR... [more]
sp|Q7JP68|KAPC2_CAEEL2.252e-11750.78cAMP-dependent protein kinase, catalytic subunit-l... [more]
sp|P17612|KAPCA_HUMAN1.014e-11651.91cAMP-dependent protein kinase catalytic subunit al... [more]
back to top
BLAST of cAMP-dependent protein kinase, catalytic subunit-like vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267DYK97.354e-17671.03Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267E1A08.831e-17166.07Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267E1221.858e-17066.27Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267GL641.962e-17066.27Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267DLZ82.613e-16666.56Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
back to top
BLAST of cAMP-dependent protein kinase, catalytic subunit-like vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
prkx6.508e-14458.20protein kinase X-linked [Source:NCBI gene;Acc:1030... [more]
ENSAMXT00000001472.28.710e-13755.69cAMP-dependent protein kinase catalytic subunit PR... [more]
ENSAMXT00000045721.14.788e-11853.18protein kinase cAMP-activated catalytic subunit be... [more]
ENSAMXT00000050353.17.449e-11853.18protein kinase cAMP-activated catalytic subunit be... [more]
ENSAMXT00000056663.13.661e-11753.18protein kinase cAMP-activated catalytic subunit be... [more]
back to top
BLAST of cAMP-dependent protein kinase, catalytic subunit-like vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000001814.12.916e-10450.52pep scaffold:Pmarinus_7.0:GL481074:830:17391:1 gen... [more]
ENSPMAT00000002200.14.253e-8042.71pep scaffold:Pmarinus_7.0:GL479132:31244:36905:-1 ... [more]
ENSPMAT00000008480.18.827e-7842.33pep scaffold:Pmarinus_7.0:GL482122:191709:206473:1... [more]
ENSPMAT00000004761.14.356e-7358.82pep scaffold:Pmarinus_7.0:GL481731:9563:15328:1 ge... [more]
ENSPMAT00000006766.12.598e-6939.93pep scaffold:Pmarinus_7.0:GL478342:9725:27922:-1 g... [more]
back to top
BLAST of cAMP-dependent protein kinase, catalytic subunit-like vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
TPK13.575e-10948.83cAMP-dependent protein kinase catalytic subunit; p... [more]
TPK23.695e-10647.02cAMP-dependent protein kinase catalytic subunit; p... [more]
TPK31.706e-10447.00cAMP-dependent protein kinase catalytic subunit; p... [more]
YPK11.805e-7942.43S/T protein kinase; phosphorylates, downregulates ... [more]
YPK21.498e-7842.43Protein kinase similar to S/T protein kinase Ypk1p... [more]
back to top
BLAST of cAMP-dependent protein kinase, catalytic subunit-like vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO352282.885e-15664.44Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO384076.859e-7844.60Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO411662.318e-7740.84Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO378001.900e-7439.10Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO383991.031e-6944.91Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of cAMP-dependent protein kinase, catalytic subunit-like vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
prkx1.228e-14458.99protein kinase X-linked [Source:NCBI gene;Acc:1011... [more]
prkx1.391e-12755.49protein kinase X-linked [Source:NCBI gene;Acc:1011... [more]
ENSORLT00000007944.22.221e-11753.20protein kinase cAMP-activated catalytic subunit be... [more]
ENSORLT00000028912.14.980e-11753.20protein kinase cAMP-activated catalytic subunit be... [more]
prkacaa1.322e-11650.62cAMP-dependent protein kinase catalytic subunit al... [more]
back to top
BLAST of cAMP-dependent protein kinase, catalytic subunit-like vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000041798.10.000e+099.70SMESG000041798.1[more]
SMESG000077752.10.000e+071.91SMESG000077752.1[more]
SMESG000000892.14.964e-12053.50SMESG000000892.1[more]
SMESG000000892.17.193e-12053.50SMESG000000892.1[more]
SMESG000016651.15.214e-10946.08SMESG000016651.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30009106 ID=SMED30009106|Name=cAMP-dependent protein kinase, catalytic subunit-like|organism=Schmidtea mediterranea sexual|type=transcript|length=1245bp
CATGAACTTAAGATTTCGCAAATATTTGATTAGTTATTTGTAAATTATCA
AATTTTAAATTTTATTTTAAATTACAAAAATATTTTCGTGCAAATAAATA
AATTTAATGTGCAATGAGCAGCGAAAATTGTGAAAATGACAAACCGAATT
TTGATCGAGAAAACTTTACTTTGAAAAAAGTGGAATTACTTCGAACTGTT
GGCACGGGAACTTTCGGCCGAGTGATGGCAGTCCGCGAGAAAGAAACCAA
CACTTATTATGCTTTGAAAATTTTAGTAATCGAAGACGTTATCCGAATGA
AACAAGTGGAACATGTGAAAAATGAAAAACTCATCCTGGAAAAAGTCAAC
CATCCGTTTATAGTTAATCTGTTTTGGACGAGGCATGATGTAAAATTTCT
TTACATGCTCCTGGAATATATTTGCGGCGGAGAATTGTTTACTTATTTGC
GTAATCAAGGAAAATTCAACAACGAAACCGGATTGTTTTTTTCGTGTGAA
ATTATTTCCGCTCTTTCTTATCTTCACAGTTTGCAAATTGTGTATCGAGA
TTTAAAGCCAGAAAATCTACTCATAGATCAAAATGGTCATATAAAAATTA
CAGATTTTGGATTTGCAAAAGTATTAAGAGACAGAACATATACCATGTGT
GGAACTCCAGAATACTTAGCTCCAGAAATTATTCAAGGAAAAGGATATAA
TCGCGCAGTCGATTGGTGGGCTCTTGGTGTTTTAATTTACGAAATGCTAG
TTGGAAATCCACCATTTTTCGATGACAATCCAATGAATATATATTCTAAA
ATTCTAAGCAACAAATTCGATTTCCCCCAGAATCTAGTTGAGCCAGATGC
AAGAGATTTAATAAGGAAGTTGCTAGTCAGTGATCGCACCAAACGTTTGG
GAAATATGAAGGATGGCACTGATGATGTTCTGAATCACAAATGGTTTGCC
AATATCAGCTGGAACGATGTGTTAGAGCGCAAATTGAAGCCCGTCATTAT
GCCACAGGTCACTCATGTTGGGGACACCCGCTGCTATGACAAATATGATG
AACAAGATTGGCGAAAAATTCCTTCTTGTTCTACTGCAGCTCAGGAAATG
TTTGCTGAATTTTAGATTTTATATTTGAATTTATTTTGAGACATGTAGAT
AAACTGTTCAATAAAATTTGATTCGATGATTTTAGAAATTATTATTATTA
AAAGATAACGCCAATAAAAAGCTTTTCGTACGATATATTTCGATA
back to top

protein sequence of SMED30009106-orf-1

>SMED30009106-orf-1 ID=SMED30009106-orf-1|Name=SMED30009106-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=334bp
MSSENCENDKPNFDRENFTLKKVELLRTVGTGTFGRVMAVREKETNTYYA
LKILVIEDVIRMKQVEHVKNEKLILEKVNHPFIVNLFWTRHDVKFLYMLL
EYICGGELFTYLRNQGKFNNETGLFFSCEIISALSYLHSLQIVYRDLKPE
NLLIDQNGHIKITDFGFAKVLRDRTYTMCGTPEYLAPEIIQGKGYNRAVD
WWALGVLIYEMLVGNPPFFDDNPMNIYSKILSNKFDFPQNLVEPDARDLI
RKLLVSDRTKRLGNMKDGTDDVLNHKWFANISWNDVLERKLKPVIMPQVT
HVGDTRCYDKYDEQDWRKIPSCSTAAQEMFAEF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0004679AMP-activated protein kinase activity
GO:0004672protein kinase activity
GO:0005524ATP binding
GO:0004674protein serine/threonine kinase activity
GO:0000166nucleotide binding
GO:0004691cAMP-dependent protein kinase activity
GO:0004871signal transducer activity
GO:0005515protein binding
GO:0016301kinase activity
GO:0016740transferase activity
GO:0034237protein kinase A regulatory subunit binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000070intestinal phagocyte
PLANA:0003104enteric muscle cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR000719Prot_kinase_dom
IPR017441Protein_kinase_ATP_BS
IPR008271Ser/Thr_kinase_AS
IPR000961AGC-kinase_C
IPR011009Kinase-like_dom_sf
Vocabulary: biological process
TermDefinition
GO:0006468protein phosphorylation
GO:0007165signal transduction
GO:0010628positive regulation of gene expression
GO:0010629negative regulation of gene expression
GO:0010737protein kinase A signaling
GO:0016310phosphorylation
GO:0030435sporulation resulting in formation of a cellular spore
GO:0031154culmination involved in sorocarp development
GO:0031285regulation of sorocarp stalk cell differentiation
GO:0031288sorocarp morphogenesis
GO:0042173regulation of sporulation resulting in formation of a cellular spore
GO:0043405regulation of MAP kinase activity
GO:0044671sorocarp spore cell differentiation
GO:1901261regulation of sorocarp spore cell differentiation
GO:1904643response to curcumin
Vocabulary: cellular component
TermDefinition
GO:0005813centrosome
GO:0005829cytosol
GO:0005952cAMP-dependent protein kinase complex