Mushroom body large-type Kenyon-related protein

Overview
NameMushroom body large-type Kenyon-related protein
Smed IDSMED30009090
Length (bp)1840
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Mushroom body large-type Kenyon-related protein (SMED30009090) t-SNE clustered cells

Violin plots show distribution of expression levels for Mushroom body large-type Kenyon-related protein (SMED30009090) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Mushroom body large-type Kenyon-related protein (SMED30009090) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Mushroom body large-type Kenyon-related protein (SMED30009090) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30009090

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 14

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30009090SMESG000070784.1 SmedASXL_010435SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30009090SMESG000070784.1 dd_Smed_v4_17498_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30009090SMESG000070784.1 dd_Smed_v4_17498_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30009090SMESG000070784.1 dd_Smed_v4_17498_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30009090SMESG000070784.1 dd_Smed_v4_17498_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30009090SMESG000070784.1 dd_Smed_v4_17498_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30009090SMESG000070784.1 SMESG000042307.1 SMESG000004870.1 SMESG000016992.1 SMESG000005801.1 Contig36855newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30009090SMESG000070784.1 SMESG000042307.1 SMESG000004870.1 SMESG000016992.1 SMESG000005801.1 Contig36855uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
head regionSMED30009090SMESG000070784.1 dd_Smed_v6_17498_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
neuronSMED30009090SMESG000070784.1 Contig45195newmark_estsPMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
neuronSMED30009090SMESG000070784.1 Contig45195uc_Smed_v2PMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
lateral branchSMED30009090SMESG000070784.1 Contig45195newmark_estsPMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
lateral branchSMED30009090SMESG000070784.1 Contig45195uc_Smed_v2PMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
head regionSMED30009090SMESG000070784.1 OX_Smed_1.0.11085ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Mushroom body large-type Kenyon-related protein vs. Ensembl Human
Match: LCOR (ligand dependent nuclear receptor corepressor [Source:HGNC Symbol;Acc:HGNC:29503])

HSP 1 Score: 70.0922 bits (170), Expect = 4.168e-12
Identity = 30/49 (61.22%), Postives = 39/49 (79.59%), Query Frame = 1
Query: 1390 HKKRGHYRQYNTEMLNKAIDAVRFGEMSVHKAGNHFGVPHSTLEYRVKQ 1536
             KKRG YRQYN+E+L +AI  V  G+MSV KA + +G+PHSTLEY+VK+
Sbjct:  340 RKKRGRYRQYNSEILEEAISVVMSGKMSVSKAQSIYGIPHSTLEYKVKE 388          
BLAST of Mushroom body large-type Kenyon-related protein vs. Ensembl Human
Match: LCOR (ligand dependent nuclear receptor corepressor [Source:HGNC Symbol;Acc:HGNC:29503])

HSP 1 Score: 70.0922 bits (170), Expect = 4.481e-12
Identity = 30/49 (61.22%), Postives = 39/49 (79.59%), Query Frame = 1
Query: 1390 HKKRGHYRQYNTEMLNKAIDAVRFGEMSVHKAGNHFGVPHSTLEYRVKQ 1536
             KKRG YRQYN+E+L +AI  V  G+MSV KA + +G+PHSTLEY+VK+
Sbjct:  340 RKKRGRYRQYNSEILEEAISVVMSGKMSVSKAQSIYGIPHSTLEYKVKE 388          
BLAST of Mushroom body large-type Kenyon-related protein vs. Ensembl Human
Match: LCOR (ligand dependent nuclear receptor corepressor [Source:HGNC Symbol;Acc:HGNC:29503])

HSP 1 Score: 70.0922 bits (170), Expect = 4.481e-12
Identity = 30/49 (61.22%), Postives = 39/49 (79.59%), Query Frame = 1
Query: 1390 HKKRGHYRQYNTEMLNKAIDAVRFGEMSVHKAGNHFGVPHSTLEYRVKQ 1536
             KKRG YRQYN+E+L +AI  V  G+MSV KA + +G+PHSTLEY+VK+
Sbjct:  340 RKKRGRYRQYNSEILEEAISVVMSGKMSVSKAQSIYGIPHSTLEYKVKE 388          
BLAST of Mushroom body large-type Kenyon-related protein vs. Ensembl Human
Match: LCOR (ligand dependent nuclear receptor corepressor [Source:HGNC Symbol;Acc:HGNC:29503])

HSP 1 Score: 70.0922 bits (170), Expect = 4.481e-12
Identity = 30/49 (61.22%), Postives = 39/49 (79.59%), Query Frame = 1
Query: 1390 HKKRGHYRQYNTEMLNKAIDAVRFGEMSVHKAGNHFGVPHSTLEYRVKQ 1536
             KKRG YRQYN+E+L +AI  V  G+MSV KA + +G+PHSTLEY+VK+
Sbjct:  340 RKKRGRYRQYNSEILEEAISVVMSGKMSVSKAQSIYGIPHSTLEYKVKE 388          
BLAST of Mushroom body large-type Kenyon-related protein vs. Ensembl Human
Match: LCORL (ligand dependent nuclear receptor corepressor like [Source:HGNC Symbol;Acc:HGNC:30776])

HSP 1 Score: 65.855 bits (159), Expect = 1.180e-10
Identity = 30/54 (55.56%), Postives = 39/54 (72.22%), Query Frame = 1
Query: 1390 HKKRGHYRQYNTEMLNKAIDAVRFGEMSVHKAGNHFGVPHSTLEYRVKQMTEGL 1551
             KKRG YRQY+ E++ +AI  V  G+MSV KA   +GVPHSTLEY+VK+ +  L
Sbjct:  432 RKKRGRYRQYDHEIMEEAIAMVMSGKMSVSKAQGIYGVPHSTLEYKVKERSGTL 485          
BLAST of Mushroom body large-type Kenyon-related protein vs. Ensembl Celegans
Match: mbr-1 (Mblk-1-related factor 1 [Source:UniProtKB/Swiss-Prot;Acc:G5EGQ5])

HSP 1 Score: 71.2478 bits (173), Expect = 6.678e-13
Identity = 29/47 (61.70%), Postives = 40/47 (85.11%), Query Frame = 1
Query: 1396 KRGHYRQYNTEMLNKAIDAVRFGEMSVHKAGNHFGVPHSTLEYRVKQ 1536
            KRG YR+Y+   L++A+ +VR GEM+VH+AG+ FGVPHSTLEY+VK+
Sbjct:  336 KRGQYRKYDKNALDEAVRSVRRGEMTVHRAGSFFGVPHSTLEYKVKE 382          

HSP 2 Score: 55.0694 bits (131), Expect = 1.018e-7
Identity = 31/78 (39.74%), Postives = 45/78 (57.69%), Query Frame = 1
Query:  316 EHVSQSEPLDLSLSSPTSINEKIDYQSPRKHVISNSSYSERELISAVRAICCGRIGTRRAAALYGIPRSTLRNRIFKV 549
            E V+  +P+D SL+               K  I   +Y+  +L  AV  I  G++GTRRA+ +YGIPRSTLRN+I+K+
Sbjct:  132 ESVAPEKPVDESLN---------------KSNILRRNYTVEDLTQAVEDIRQGKLGTRRASVVYGIPRSTLRNKIYKL 194          
BLAST of Mushroom body large-type Kenyon-related protein vs. Ensembl Fly
Match: Eip93F (gene:FBgn0264490 transcript:FBtr0112874)

HSP 1 Score: 69.707 bits (169), Expect = 5.100e-12
Identity = 29/47 (61.70%), Postives = 40/47 (85.11%), Query Frame = 1
Query: 1396 KRGHYRQYNTEMLNKAIDAVRFGEMSVHKAGNHFGVPHSTLEYRVKQ 1536
            KRG YR Y+ + L +A+ AV+ GEMSVH+AG+++GVPHSTLEY+VK+
Sbjct:  786 KRGKYRNYDRDSLVEAVKAVQRGEMSVHRAGSYYGVPHSTLEYKVKE 832          
BLAST of Mushroom body large-type Kenyon-related protein vs. Ensembl Fly
Match: Eip93F (gene:FBgn0264490 transcript:FBtr0084169)

HSP 1 Score: 69.707 bits (169), Expect = 5.113e-12
Identity = 29/47 (61.70%), Postives = 40/47 (85.11%), Query Frame = 1
Query: 1396 KRGHYRQYNTEMLNKAIDAVRFGEMSVHKAGNHFGVPHSTLEYRVKQ 1536
            KRG YR Y+ + L +A+ AV+ GEMSVH+AG+++GVPHSTLEY+VK+
Sbjct:  763 KRGKYRNYDRDSLVEAVKAVQRGEMSVHRAGSYYGVPHSTLEYKVKE 809          
BLAST of Mushroom body large-type Kenyon-related protein vs. Ensembl Fly
Match: Eip93F (gene:FBgn0264490 transcript:FBtr0330384)

HSP 1 Score: 69.707 bits (169), Expect = 5.463e-12
Identity = 29/47 (61.70%), Postives = 40/47 (85.11%), Query Frame = 1
Query: 1396 KRGHYRQYNTEMLNKAIDAVRFGEMSVHKAGNHFGVPHSTLEYRVKQ 1536
            KRG YR Y+ + L +A+ AV+ GEMSVH+AG+++GVPHSTLEY+VK+
Sbjct:  763 KRGKYRNYDRDSLVEAVKAVQRGEMSVHRAGSYYGVPHSTLEYKVKE 809          
BLAST of Mushroom body large-type Kenyon-related protein vs. Ensembl Zebrafish
Match: lcor (ligand dependent nuclear receptor corepressor [Source:ZFIN;Acc:ZDB-GENE-061201-6])

HSP 1 Score: 70.8626 bits (172), Expect = 1.761e-12
Identity = 31/49 (63.27%), Postives = 39/49 (79.59%), Query Frame = 1
Query: 1390 HKKRGHYRQYNTEMLNKAIDAVRFGEMSVHKAGNHFGVPHSTLEYRVKQ 1536
             KKRG YRQYN+E+L +AI  V  G+MSV KA N +G+PHSTLEY+VK+
Sbjct:  360 RKKRGRYRQYNSEILEEAIAVVMSGKMSVSKAQNIYGIPHSTLEYKVKE 408          
BLAST of Mushroom body large-type Kenyon-related protein vs. Ensembl Zebrafish
Match: CR769781.1 (ligand dependent nuclear receptor corepressor-like [Source:NCBI gene;Acc:558430])

HSP 1 Score: 65.4698 bits (158), Expect = 1.043e-10
Identity = 30/51 (58.82%), Postives = 38/51 (74.51%), Query Frame = 1
Query: 1390 HKKRGHYRQYNTEMLNKAIDAVRFGEMSVHKAGNHFGVPHSTLEYRVKQMT 1542
             KKRG YRQY+ ++L +AI  V  G+MSV KA   +GVPHSTLEY+VK+ T
Sbjct:  476 RKKRGRYRQYDHDILEEAIAMVIGGKMSVSKAQGVYGVPHSTLEYKVKERT 526          
BLAST of Mushroom body large-type Kenyon-related protein vs. Ensembl Zebrafish
Match: lcorl (ligand dependent nuclear receptor corepressor-like [Source:ZFIN;Acc:ZDB-GENE-030131-6300])

HSP 1 Score: 65.4698 bits (158), Expect = 1.053e-10
Identity = 30/51 (58.82%), Postives = 38/51 (74.51%), Query Frame = 1
Query: 1390 HKKRGHYRQYNTEMLNKAIDAVRFGEMSVHKAGNHFGVPHSTLEYRVKQMT 1542
             KKRG YRQY+ ++L +AI  V  G+MSV KA   +GVPHSTLEY+VK+ T
Sbjct:  482 RKKRGRYRQYDHDILEEAIAMVIGGKMSVSKAQGVYGVPHSTLEYKVKERT 532          
BLAST of Mushroom body large-type Kenyon-related protein vs. Ensembl Zebrafish
Match: CR762426.1 (ligand dependent nuclear receptor corepressor-like [Source:NCBI gene;Acc:558430])

HSP 1 Score: 65.4698 bits (158), Expect = 1.071e-10
Identity = 30/51 (58.82%), Postives = 38/51 (74.51%), Query Frame = 1
Query: 1390 HKKRGHYRQYNTEMLNKAIDAVRFGEMSVHKAGNHFGVPHSTLEYRVKQMT 1542
             KKRG YRQY+ ++L +AI  V  G+MSV KA   +GVPHSTLEY+VK+ T
Sbjct:  476 RKKRGRYRQYDHDILEEAIAMVIGGKMSVSKAQGVYGVPHSTLEYKVKERT 526          
BLAST of Mushroom body large-type Kenyon-related protein vs. Ensembl Zebrafish
Match: CR391911.1 (ligand dependent nuclear receptor corepressor-like [Source:NCBI gene;Acc:558430])

HSP 1 Score: 65.4698 bits (158), Expect = 1.168e-10
Identity = 30/51 (58.82%), Postives = 38/51 (74.51%), Query Frame = 1
Query: 1390 HKKRGHYRQYNTEMLNKAIDAVRFGEMSVHKAGNHFGVPHSTLEYRVKQMT 1542
             KKRG YRQY+ ++L +AI  V  G+MSV KA   +GVPHSTLEY+VK+ T
Sbjct:  488 RKKRGRYRQYDHDILEEAIAMVIGGKMSVSKAQGVYGVPHSTLEYKVKERT 538          
BLAST of Mushroom body large-type Kenyon-related protein vs. Ensembl Xenopus
Match: lcor (ligand dependent nuclear receptor corepressor [Source:NCBI gene;Acc:100125102])

HSP 1 Score: 68.5514 bits (166), Expect = 1.886e-11
Identity = 30/49 (61.22%), Postives = 39/49 (79.59%), Query Frame = 1
Query: 1390 HKKRGHYRQYNTEMLNKAIDAVRFGEMSVHKAGNHFGVPHSTLEYRVKQ 1536
             KKRG YRQYN+E+L +AI  V  G+MSV KA + +G+PHSTLEY+VK+
Sbjct:  485 RKKRGRYRQYNSEILEEAIAVVMNGKMSVSKAQSIYGIPHSTLEYKVKE 533          
BLAST of Mushroom body large-type Kenyon-related protein vs. Ensembl Xenopus
Match: trmt5 (tRNA methyltransferase 5 [Source:Xenbase;Acc:XB-GENE-957548])

HSP 1 Score: 61.2326 bits (147), Expect = 3.405e-9
Identity = 28/51 (54.90%), Postives = 37/51 (72.55%), Query Frame = 1
Query: 1399 RGHYRQYNTEMLNKAIDAVRFGEMSVHKAGNHFGVPHSTLEYRVKQMTEGL 1551
            RG YRQY+ E++ +AI  V  G+MSV KA   +GVPHSTLEY+VK+ +  L
Sbjct:  493 RGRYRQYDHEIMEEAIAMVLGGKMSVSKAQGIYGVPHSTLEYKVKERSGTL 543          
BLAST of Mushroom body large-type Kenyon-related protein vs. Ensembl Mouse
Match: Lcor (ligand dependent nuclear receptor corepressor [Source:MGI Symbol;Acc:MGI:2443930])

HSP 1 Score: 69.707 bits (169), Expect = 3.003e-12
Identity = 30/49 (61.22%), Postives = 39/49 (79.59%), Query Frame = 1
Query: 1390 HKKRGHYRQYNTEMLNKAIDAVRFGEMSVHKAGNHFGVPHSTLEYRVKQ 1536
             KKRG YRQYN+E+L +AI  V  G+MSV KA + +G+PHSTLEY+VK+
Sbjct:  340 RKKRGRYRQYNSEILEEAISVVMSGKMSVSKAQSIYGIPHSTLEYKVKE 388          
BLAST of Mushroom body large-type Kenyon-related protein vs. Ensembl Mouse
Match: Lcor (ligand dependent nuclear receptor corepressor [Source:MGI Symbol;Acc:MGI:2443930])

HSP 1 Score: 70.0922 bits (170), Expect = 3.132e-12
Identity = 30/49 (61.22%), Postives = 39/49 (79.59%), Query Frame = 1
Query: 1390 HKKRGHYRQYNTEMLNKAIDAVRFGEMSVHKAGNHFGVPHSTLEYRVKQ 1536
             KKRG YRQYN+E+L +AI  V  G+MSV KA + +G+PHSTLEY+VK+
Sbjct:  340 RKKRGRYRQYNSEILEEAISVVMSGKMSVSKAQSIYGIPHSTLEYKVKE 388          
BLAST of Mushroom body large-type Kenyon-related protein vs. Ensembl Mouse
Match: Lcor (ligand dependent nuclear receptor corepressor [Source:MGI Symbol;Acc:MGI:2443930])

HSP 1 Score: 70.0922 bits (170), Expect = 3.132e-12
Identity = 30/49 (61.22%), Postives = 39/49 (79.59%), Query Frame = 1
Query: 1390 HKKRGHYRQYNTEMLNKAIDAVRFGEMSVHKAGNHFGVPHSTLEYRVKQ 1536
             KKRG YRQYN+E+L +AI  V  G+MSV KA + +G+PHSTLEY+VK+
Sbjct:  340 RKKRGRYRQYNSEILEEAISVVMSGKMSVSKAQSIYGIPHSTLEYKVKE 388          
BLAST of Mushroom body large-type Kenyon-related protein vs. Ensembl Mouse
Match: Lcorl (ligand dependent nuclear receptor corepressor-like [Source:MGI Symbol;Acc:MGI:2651932])

HSP 1 Score: 65.855 bits (159), Expect = 9.053e-11
Identity = 30/54 (55.56%), Postives = 39/54 (72.22%), Query Frame = 1
Query: 1390 HKKRGHYRQYNTEMLNKAIDAVRFGEMSVHKAGNHFGVPHSTLEYRVKQMTEGL 1551
             KKRG YRQY+ E++ +AI  V  G+MSV KA   +GVPHSTLEY+VK+ +  L
Sbjct:  432 RKKRGRYRQYDHEIMEEAIAMVMSGKMSVSKAQGIYGVPHSTLEYKVKERSGTL 485          
BLAST of Mushroom body large-type Kenyon-related protein vs. Ensembl Mouse
Match: Lcorl (ligand dependent nuclear receptor corepressor-like [Source:MGI Symbol;Acc:MGI:2651932])

HSP 1 Score: 65.0846 bits (157), Expect = 1.494e-10
Identity = 30/54 (55.56%), Postives = 39/54 (72.22%), Query Frame = 1
Query: 1390 HKKRGHYRQYNTEMLNKAIDAVRFGEMSVHKAGNHFGVPHSTLEYRVKQMTEGL 1551
             KKRG YRQY+ E++ +AI  V  G+MSV KA   +GVPHSTLEY+VK+ +  L
Sbjct:  515 RKKRGRYRQYDHEIMEEAIAMVMSGKMSVSKAQGIYGVPHSTLEYKVKERSGTL 568          
BLAST of Mushroom body large-type Kenyon-related protein vs. UniProt/SwissProt
Match: sp|G5EGQ5|MBR1_CAEEL (Mblk-1-related factor 1 OS=Caenorhabditis elegans OX=6239 GN=mbr-1 PE=2 SV=1)

HSP 1 Score: 71.2478 bits (173), Expect = 8.495e-12
Identity = 29/47 (61.70%), Postives = 40/47 (85.11%), Query Frame = 1
Query: 1396 KRGHYRQYNTEMLNKAIDAVRFGEMSVHKAGNHFGVPHSTLEYRVKQ 1536
            KRG YR+Y+   L++A+ +VR GEM+VH+AG+ FGVPHSTLEY+VK+
Sbjct:  336 KRGQYRKYDKNALDEAVRSVRRGEMTVHRAGSFFGVPHSTLEYKVKE 382          

HSP 2 Score: 55.0694 bits (131), Expect = 1.294e-6
Identity = 31/78 (39.74%), Postives = 45/78 (57.69%), Query Frame = 1
Query:  316 EHVSQSEPLDLSLSSPTSINEKIDYQSPRKHVISNSSYSERELISAVRAICCGRIGTRRAAALYGIPRSTLRNRIFKV 549
            E V+  +P+D SL+               K  I   +Y+  +L  AV  I  G++GTRRA+ +YGIPRSTLRN+I+K+
Sbjct:  132 ESVAPEKPVDESLN---------------KSNILRRNYTVEDLTQAVEDIRQGKLGTRRASVVYGIPRSTLRNKIYKL 194          
BLAST of Mushroom body large-type Kenyon-related protein vs. UniProt/SwissProt
Match: sp|Q96JN0|LCOR_HUMAN (Ligand-dependent corepressor OS=Homo sapiens OX=9606 GN=LCOR PE=1 SV=2)

HSP 1 Score: 70.0922 bits (170), Expect = 2.152e-11
Identity = 30/49 (61.22%), Postives = 39/49 (79.59%), Query Frame = 1
Query: 1390 HKKRGHYRQYNTEMLNKAIDAVRFGEMSVHKAGNHFGVPHSTLEYRVKQ 1536
             KKRG YRQYN+E+L +AI  V  G+MSV KA + +G+PHSTLEY+VK+
Sbjct:  340 RKKRGRYRQYNSEILEEAISVVMSGKMSVSKAQSIYGIPHSTLEYKVKE 388          
BLAST of Mushroom body large-type Kenyon-related protein vs. UniProt/SwissProt
Match: sp|Q6ZPI3|LCOR_MOUSE (Ligand-dependent corepressor OS=Mus musculus OX=10090 GN=Lcor PE=2 SV=2)

HSP 1 Score: 70.0922 bits (170), Expect = 2.191e-11
Identity = 30/49 (61.22%), Postives = 39/49 (79.59%), Query Frame = 1
Query: 1390 HKKRGHYRQYNTEMLNKAIDAVRFGEMSVHKAGNHFGVPHSTLEYRVKQ 1536
             KKRG YRQYN+E+L +AI  V  G+MSV KA + +G+PHSTLEY+VK+
Sbjct:  340 RKKRGRYRQYNSEILEEAISVVMSGKMSVSKAQSIYGIPHSTLEYKVKE 388          
BLAST of Mushroom body large-type Kenyon-related protein vs. UniProt/SwissProt
Match: sp|Q95YM8|MBLK1_APIME (Mushroom body large-type Kenyon cell-specific protein 1 OS=Apis mellifera OX=7460 GN=Mblk-1 PE=1 SV=1)

HSP 1 Score: 68.9366 bits (167), Expect = 9.612e-11
Identity = 29/47 (61.70%), Postives = 40/47 (85.11%), Query Frame = 1
Query: 1396 KRGHYRQYNTEMLNKAIDAVRFGEMSVHKAGNHFGVPHSTLEYRVKQ 1536
            KRG YR Y+ + L +A+ AV+ GEMSVH+AG+++GVPHSTLEY+VK+
Sbjct: 1036 KRGKYRNYDRDSLVEAVRAVQRGEMSVHRAGSYYGVPHSTLEYKVKE 1082          

HSP 2 Score: 61.2326 bits (147), Expect = 2.377e-8
Identity = 25/42 (59.52%), Postives = 36/42 (85.71%), Query Frame = 1
Query:  424 SYSERELISAVRAICCGRIGTRRAAALYGIPRSTLRNRIFKV 549
            +Y+E EL +A+R I  G++GTRRAA +YGIPRSTLRN+++K+
Sbjct:  590 AYTEEELQAALRDIQSGKLGTRRAAVIYGIPRSTLRNKVYKL 631          
BLAST of Mushroom body large-type Kenyon-related protein vs. UniProt/SwissProt
Match: sp|Q8N3X6|LCORL_HUMAN (Ligand-dependent nuclear receptor corepressor-like protein OS=Homo sapiens OX=9606 GN=LCORL PE=1 SV=4)

HSP 1 Score: 65.4698 bits (158), Expect = 8.734e-10
Identity = 30/54 (55.56%), Postives = 39/54 (72.22%), Query Frame = 1
Query: 1390 HKKRGHYRQYNTEMLNKAIDAVRFGEMSVHKAGNHFGVPHSTLEYRVKQMTEGL 1551
             KKRG YRQY+ E++ +AI  V  G+MSV KA   +GVPHSTLEY+VK+ +  L
Sbjct:  516 RKKRGRYRQYDHEIMEEAIAMVMSGKMSVSKAQGIYGVPHSTLEYKVKERSGTL 569          
BLAST of Mushroom body large-type Kenyon-related protein vs. TrEMBL
Match: A0A1Z1R179 (Mushroom body large-type Kenyon-related protein OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 979.163 bits (2530), Expect = 0.000e+0
Identity = 535/538 (99.44%), Postives = 537/538 (99.81%), Query Frame = 1
Query:   79 MYCSKCYHERKYTRLELATWQDKIPVIVGIEEIVKTIFEYSFDQVDEDKPIKTTVIKDWNEEEIYCLCEKKISEINNSHEHVSQSEPLDLSLSSPTSINEKIDYQSPRKHVISNSSYSERELISAVRAICCGRIGTRRAAALYGIPRSTLRNRIFKVYDAKKIHDTDQRMSMVDFFKKILKDDSMFTNLFHQKYQRXXXXXXXXXXXXXXXXXXVHFRQKENHVSNKELFKNELNEIIKHQQKKDSSRIQEIQLSDSFLDYNKPDFPXXXXXXXXXXPDLLTSYFQQDHQTNIMSSYLFMMCQQNLLSSVYSSLMMPDWQLPNFNFGNIPSPHNLYSTKKSXXXXXXXXXXXXXXXKDQADKHSILETEHFYNQPLNFAKNSLGEINISSEICKNDQSDNKPEESIEESDTSVSAPSKVTNEFNIAALSDEISESSRHKKRGHYRQYNTEMLNKAIDAVRFGEMSVHKAGNHFGVPHSTLEYRVKQMTEGLAAEKLLNKQTHXXXXXXXXXXXXXXDGESKKTDSDGCNTNVSLNSQI 1692
            MYCSKCYHERKYTRLELATWQDKIPVIVGIEEIVKTIFEYSFDQVDEDKPIKTTVIKDWNEEEIYCLCEKKISEINNSHEHVSQSEPLDLSLSSPTSINEKIDYQSPRKHVISNSSYSERELISAVRAICCGRIGTRRAAALYGIPRSTLRNRIFKVYDAKKIHDTDQRMSMVDFFKKILKDDSMFTNLFHQKYQRENKEEKKKTVITEKENNKVHFRQKENHVSNKELFKNELNEIIKHQQKKDSSRIQEIQLSDSFLDYNKPDFPINQININSNIPD LTSYFQQDHQTNIMSSYLFMMCQQNLLSSVYSSLMMPDWQLPNFNFG+IPSPHNLYSTKKSEIINNKENHLENINNKDQA+KHSILETEHFYNQPLNFAKNSLGEINISSEICKNDQSDNKPEESIEESDTSVSAPSKVTNEFNIAALSDEISESSRHKKRGHYRQYNTEMLNKAIDAVRFGEMSVHKAGNHFGVPHSTLEYRVKQMTEGLAAEKLLNKQTHKRKKSNSLENSKSNDGESKKTDSDGCNTNVSLNSQI
Sbjct:    1 MYCSKCYHERKYTRLELATWQDKIPVIVGIEEIVKTIFEYSFDQVDEDKPIKTTVIKDWNEEEIYCLCEKKISEINNSHEHVSQSEPLDLSLSSPTSINEKIDYQSPRKHVISNSSYSERELISAVRAICCGRIGTRRAAALYGIPRSTLRNRIFKVYDAKKIHDTDQRMSMVDFFKKILKDDSMFTNLFHQKYQRENKEEKKKTVITEKENNKVHFRQKENHVSNKELFKNELNEIIKHQQKKDSSRIQEIQLSDSFLDYNKPDFPINQININSNIPDSLTSYFQQDHQTNIMSSYLFMMCQQNLLSSVYSSLMMPDWQLPNFNFGDIPSPHNLYSTKKSEIINNKENHLENINNKDQAEKHSILETEHFYNQPLNFAKNSLGEINISSEICKNDQSDNKPEESIEESDTSVSAPSKVTNEFNIAALSDEISESSRHKKRGHYRQYNTEMLNKAIDAVRFGEMSVHKAGNHFGVPHSTLEYRVKQMTEGLAAEKLLNKQTHKRKKSNSLENSKSNDGESKKTDSDGCNTNVSLNSQI 538          
BLAST of Mushroom body large-type Kenyon-related protein vs. TrEMBL
Match: A0A1S3JRV9 (ligand-dependent nuclear receptor corepressor-like protein isoform X3 OS=Lingula unguis OX=7574 GN=LOC106175323 PE=4 SV=1)

HSP 1 Score: 90.5077 bits (223), Expect = 3.048e-15
Identity = 64/194 (32.99%), Postives = 94/194 (48.45%), Query Frame = 1
Query:   91 KCYHERKYTRLELATWQDKIPVIVGIEEIVKTIFEYSFDQVDED-KP---IKTTVIKDWNEEEIYCLCEKKIS---------------EINNSHEHVSQ--SEPLDLSLSS-----PTSINE---------------KIDYQSPRKHVISNSSYSERELISAVRAICCGRIGTRRAAALYGIPRSTLRNRIFKV 549
            +C  ER+  + +L +W  KIP+ VG+E I K     S D +D+  +P   ++   +KDW  E     C  ++                  N + E + Q  ++PLDLS +S     P    E               +I   + RK      +Y+E EL +AV  I  G++GTRRAA+LYGIPRSTLRN+IFK+
Sbjct:    8 RCAQERRAFKKDLLSWTKKIPLAVGLETIAKEF--ASKDVMDKLLEPFNNLEPDTVKDWEPETTCHFCFSRLKFMIETVENGSSTEDESCNRTREDIEQEDNQPLDLSATSQAAKSPGKYTEESAAVTKPPVELKVPQIKVNTSRKKDTGRRTYTEEELSAAVDDIRSGKLGTRRAASLYGIPRSTLRNKIFKL 199          

HSP 2 Score: 76.2554 bits (186), Expect = 1.071e-10
Identity = 31/47 (65.96%), Postives = 43/47 (91.49%), Query Frame = 1
Query: 1396 KRGHYRQYNTEMLNKAIDAVRFGEMSVHKAGNHFGVPHSTLEYRVKQ 1536
            KRG YR+YN+++L +A+ AV+ GEMSVH+AG++FGVPHSTLEY+VK+
Sbjct:  432 KRGQYRKYNSQLLMEAVRAVQRGEMSVHRAGSYFGVPHSTLEYKVKE 478          
BLAST of Mushroom body large-type Kenyon-related protein vs. TrEMBL
Match: A0A1I8BYX5 (Uncharacterized protein OS=Meloidogyne hapla OX=6305 PE=4 SV=1)

HSP 1 Score: 83.9593 bits (206), Expect = 3.660e-13
Identity = 35/51 (68.63%), Postives = 44/51 (86.27%), Query Frame = 1
Query: 1384 SRHKKRGHYRQYNTEMLNKAIDAVRFGEMSVHKAGNHFGVPHSTLEYRVKQ 1536
             + +KRG YR+YN E L+KA+ AVR GEMSVH+AG+HFGVPHSTLEY+VK+
Sbjct:  416 GKRQKRGQYRKYNKEALDKAVTAVRNGEMSVHRAGSHFGVPHSTLEYKVKE 466          
BLAST of Mushroom body large-type Kenyon-related protein vs. TrEMBL
Match: A0A0R3W630 (HTH psq-type domain-containing protein OS=Taenia asiatica OX=60517 GN=TASK_LOCUS5624 PE=4 SV=1)

HSP 1 Score: 82.4185 bits (202), Expect = 3.853e-13
Identity = 41/89 (46.07%), Postives = 61/89 (68.54%), Query Frame = 1
Query:  400 RKHVISNSSYSERELISAVRAICCGRIGTRRAAALYGIPRSTLRNRIFKVYDAKKIHDT---DQRMSMVDFFKKILKDDSMFTNLFHQK 657
            R  V +N  Y+  EL SAVRAIC G++GTRRAA++YGIPRSTLRN+I K+ + +K  +T    + +S+ DFF +    + + ++ FH+K
Sbjct:  196 RCAVEANGPYTASELASAVRAICSGQLGTRRAASMYGIPRSTLRNKICKLNEIRKHEETMRGGKPISLSDFFHQFTSSEKLPSDPFHRK 284          
BLAST of Mushroom body large-type Kenyon-related protein vs. TrEMBL
Match: A0A0V1BHW2 (Mushroom body large-type Kenyon cell-specific protein 1 OS=Trichinella spiralis OX=6334 GN=Mblk-1 PE=4 SV=1)

HSP 1 Score: 82.0333 bits (201), Expect = 1.854e-12
Identity = 47/118 (39.83%), Postives = 66/118 (55.93%), Query Frame = 1
Query: 1225 LGEINISSEICKNDQS-------------DNKPEESIE-ESDTSVSAPSKVTNEFNIAALSDEISESSRHKKRGHYRQYNTEMLNKAIDAVRFGEMSVHKAGNHFGVPHSTLEYRVKQ 1536
            LG I + +E+C N  S             D++P+ + E  SD + S  S   N+       DE +     +KRG YR+Y+   L  A+ +VR GEMSVHKAG+ +GVPHSTLEY+VK+
Sbjct:  455 LGLIGLDAELCTNTDSRAAGNVADRSSIVDSRPQMTAEASSDGAGSRSSSDANQL------DEANAKKLRRKRGQYRKYDKNALALAVQSVRRGEMSVHKAGSFYGVPHSTLEYKVKE 566          
BLAST of Mushroom body large-type Kenyon-related protein vs. Ensembl Cavefish
Match: lcor (ligand dependent nuclear receptor corepressor [Source:ZFIN;Acc:ZDB-GENE-061201-6])

HSP 1 Score: 72.7886 bits (177), Expect = 3.161e-13
Identity = 33/58 (56.90%), Postives = 41/58 (70.69%), Query Frame = 1
Query: 1363 SDEISESSRHKKRGHYRQYNTEMLNKAIDAVRFGEMSVHKAGNHFGVPHSTLEYRVKQ 1536
            +D        KKRG YRQYNTE+L +AI  V  G+MSV KA N +G+PHSTLEY+VK+
Sbjct:  337 ADPTGSKQPRKKRGRYRQYNTEILEEAIAVVMGGKMSVSKAQNIYGIPHSTLEYKVKE 394          
BLAST of Mushroom body large-type Kenyon-related protein vs. Ensembl Cavefish
Match: lcor (ligand dependent nuclear receptor corepressor [Source:ZFIN;Acc:ZDB-GENE-061201-6])

HSP 1 Score: 72.7886 bits (177), Expect = 3.867e-13
Identity = 33/58 (56.90%), Postives = 41/58 (70.69%), Query Frame = 1
Query: 1363 SDEISESSRHKKRGHYRQYNTEMLNKAIDAVRFGEMSVHKAGNHFGVPHSTLEYRVKQ 1536
            +D        KKRG YRQYNTE+L +AI  V  G+MSV KA N +G+PHSTLEY+VK+
Sbjct:  355 ADPTGSKQPRKKRGRYRQYNTEILEEAIAVVMGGKMSVSKAQNIYGIPHSTLEYKVKE 412          
BLAST of Mushroom body large-type Kenyon-related protein vs. Ensembl Cavefish
Match: LCORL (ligand dependent nuclear receptor corepressor like [Source:NCBI gene;Acc:103045877])

HSP 1 Score: 64.6994 bits (156), Expect = 1.584e-10
Identity = 29/49 (59.18%), Postives = 37/49 (75.51%), Query Frame = 1
Query: 1390 HKKRGHYRQYNTEMLNKAIDAVRFGEMSVHKAGNHFGVPHSTLEYRVKQ 1536
             KKRG YRQY+ ++L +AI  V  G+MSV KA   +GVPHSTLEY+VK+
Sbjct:  488 RKKRGRYRQYDHDILEEAIAMVMGGKMSVSKAQGVYGVPHSTLEYKVKE 536          
BLAST of Mushroom body large-type Kenyon-related protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003404.1 (pep scaffold:Pmarinus_7.0:GL476560:346958:365324:1 gene:ENSPMAG00000003112.1 transcript:ENSPMAT00000003404.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 63.1586 bits (152), Expect = 9.728e-11
Identity = 27/49 (55.10%), Postives = 36/49 (73.47%), Query Frame = 1
Query: 1390 HKKRGHYRQYNTEMLNKAIDAVRFGEMSVHKAGNHFGVPHSTLEYRVKQ 1536
             +KRG YRQY++ +L +AI  V  G MSV KA   +G+PHSTLEY+VK+
Sbjct:  515 RRKRGRYRQYDSGILEEAISMVMSGRMSVSKAQALYGIPHSTLEYKVKE 563          
BLAST of Mushroom body large-type Kenyon-related protein vs. Ensembl Medaka
Match: lcor (ligand dependent nuclear receptor corepressor [Source:NCBI gene;Acc:105356745])

HSP 1 Score: 73.1738 bits (178), Expect = 3.057e-13
Identity = 37/77 (48.05%), Postives = 51/77 (66.23%), Query Frame = 1
Query: 1306 DTSVSAPSKVTNEFNIAALSDEISESSRHKKRGHYRQYNTEMLNKAIDAVRFGEMSVHKAGNHFGVPHSTLEYRVKQ 1536
            D S S P+     ++I+ +  + S     KKRG YRQYN+E+L +AI  V  G+MSV KA N +G+PHSTLEY+VK+
Sbjct:  406 DHSSSGPA-----YSISDVEGDPSSKQPRKKRGRYRQYNSEILEEAIAVVMSGKMSVSKAQNMYGIPHSTLEYKVKE 477          
BLAST of Mushroom body large-type Kenyon-related protein vs. Ensembl Medaka
Match: lcor (ligand dependent nuclear receptor corepressor [Source:NCBI gene;Acc:105356745])

HSP 1 Score: 73.1738 bits (178), Expect = 3.057e-13
Identity = 37/77 (48.05%), Postives = 51/77 (66.23%), Query Frame = 1
Query: 1306 DTSVSAPSKVTNEFNIAALSDEISESSRHKKRGHYRQYNTEMLNKAIDAVRFGEMSVHKAGNHFGVPHSTLEYRVKQ 1536
            D S S P+     ++I+ +  + S     KKRG YRQYN+E+L +AI  V  G+MSV KA N +G+PHSTLEY+VK+
Sbjct:  406 DHSSSGPA-----YSISDVEGDPSSKQPRKKRGRYRQYNSEILEEAIAVVMSGKMSVSKAQNMYGIPHSTLEYKVKE 477          
BLAST of Mushroom body large-type Kenyon-related protein vs. Ensembl Medaka
Match: lcor (ligand dependent nuclear receptor corepressor [Source:NCBI gene;Acc:105356745])

HSP 1 Score: 73.1738 bits (178), Expect = 4.511e-13
Identity = 37/77 (48.05%), Postives = 51/77 (66.23%), Query Frame = 1
Query: 1306 DTSVSAPSKVTNEFNIAALSDEISESSRHKKRGHYRQYNTEMLNKAIDAVRFGEMSVHKAGNHFGVPHSTLEYRVKQ 1536
            D S S P+     ++I+ +  + S     KKRG YRQYN+E+L +AI  V  G+MSV KA N +G+PHSTLEY+VK+
Sbjct:  526 DHSSSGPA-----YSISDVEGDPSSKQPRKKRGRYRQYNSEILEEAIAVVMSGKMSVSKAQNMYGIPHSTLEYKVKE 597          
BLAST of Mushroom body large-type Kenyon-related protein vs. Ensembl Medaka
Match: lcor (ligand dependent nuclear receptor corepressor [Source:NCBI gene;Acc:105356745])

HSP 1 Score: 72.7886 bits (177), Expect = 5.265e-13
Identity = 37/77 (48.05%), Postives = 51/77 (66.23%), Query Frame = 1
Query: 1306 DTSVSAPSKVTNEFNIAALSDEISESSRHKKRGHYRQYNTEMLNKAIDAVRFGEMSVHKAGNHFGVPHSTLEYRVKQ 1536
            D S S P+     ++I+ +  + S     KKRG YRQYN+E+L +AI  V  G+MSV KA N +G+PHSTLEY+VK+
Sbjct:  548 DHSSSGPA-----YSISDVEGDPSSKQPRKKRGRYRQYNSEILEEAIAVVMSGKMSVSKAQNMYGIPHSTLEYKVKE 619          
BLAST of Mushroom body large-type Kenyon-related protein vs. Planmine SMEST
Match: SMESG000070784.1 (SMESG000070784.1)

HSP 1 Score: 982.63 bits (2539), Expect = 0.000e+0
Identity = 536/538 (99.63%), Postives = 538/538 (100.00%), Query Frame = 1
Query:   79 MYCSKCYHERKYTRLELATWQDKIPVIVGIEEIVKTIFEYSFDQVDEDKPIKTTVIKDWNEEEIYCLCEKKISEINNSHEHVSQSEPLDLSLSSPTSINEKIDYQSPRKHVISNSSYSERELISAVRAICCGRIGTRRAAALYGIPRSTLRNRIFKVYDAKKIHDTDQRMSMVDFFKKILKDDSMFTNLFHQKYQRXXXXXXXXXXXXXXXXXXVHFRQKENHVSNKELFKNELNEIIKHQQKKDSSRIQEIQLSDSFLDYNKPDFPXXXXXXXXXXPDLLTSYFQQDHQTNIMSSYLFMMCQQNLLSSVYSSLMMPDWQLPNFNFGNIPSPHNLYSTKKSXXXXXXXXXXXXXXXKDQADKHSILETEHFYNQPLNFAKNSLGEINISSEICKNDQSDNKPEESIEESDTSVSAPSKVTNEFNIAALSDEISESSRHKKRGHYRQYNTEMLNKAIDAVRFGEMSVHKAGNHFGVPHSTLEYRVKQMTEGLAAEKLLNKQTHXXXXXXXXXXXXXXDGESKKTDSDGCNTNVSLNSQI 1692
            MYCSKCYHERKYTRLELATWQDKIPVIVGIEEIVKTIFEYSFDQVDEDKPIKTTVIKDWNEEEIYCLCEKKISEINNSHEHVSQSEPLDLSLSSPTSINEKIDYQSPRKHVISNSSYSERELISAVRAICCGRIGTRRAAALYGIPRSTLRNRIFKVYDAKKIHDTDQRMSMVDFFKKILKDDSMFTNLFHQKYQRENKEEKKKTVITEKENNKVHFRQKENHVSNKELFKNELNEIIKHQQ+KDSSRIQEIQLSDSFLDYNKPDFPINQININSNIPDLLTSYFQQDHQTNIMSSYLFMMCQQNLLSSVYSSLMMPDWQLPNFNFGNIPSPHNLYSTKKSEIINNKENHLENINNKDQA+KHSILETEHFYNQPLNFAKNSLGEINISSEICKNDQSDNKPEESIEESDTSVSAPSKVTNEFNIAALSDEISESSRHKKRGHYRQYNTEMLNKAIDAVRFGEMSVHKAGNHFGVPHSTLEYRVKQMTEGLAAEKLLNKQTHKRKKSNSLENSKSNDGESKKTDSDGCNTNVSLNSQI
Sbjct:    1 MYCSKCYHERKYTRLELATWQDKIPVIVGIEEIVKTIFEYSFDQVDEDKPIKTTVIKDWNEEEIYCLCEKKISEINNSHEHVSQSEPLDLSLSSPTSINEKIDYQSPRKHVISNSSYSERELISAVRAICCGRIGTRRAAALYGIPRSTLRNRIFKVYDAKKIHDTDQRMSMVDFFKKILKDDSMFTNLFHQKYQRENKEEKKKTVITEKENNKVHFRQKENHVSNKELFKNELNEIIKHQQQKDSSRIQEIQLSDSFLDYNKPDFPINQININSNIPDLLTSYFQQDHQTNIMSSYLFMMCQQNLLSSVYSSLMMPDWQLPNFNFGNIPSPHNLYSTKKSEIINNKENHLENINNKDQAEKHSILETEHFYNQPLNFAKNSLGEINISSEICKNDQSDNKPEESIEESDTSVSAPSKVTNEFNIAALSDEISESSRHKKRGHYRQYNTEMLNKAIDAVRFGEMSVHKAGNHFGVPHSTLEYRVKQMTEGLAAEKLLNKQTHKRKKSNSLENSKSNDGESKKTDSDGCNTNVSLNSQI 538          
BLAST of Mushroom body large-type Kenyon-related protein vs. Planmine SMEST
Match: SMESG000070784.1 (SMESG000070784.1)

HSP 1 Score: 931.013 bits (2405), Expect = 0.000e+0
Identity = 517/538 (96.10%), Postives = 519/538 (96.47%), Query Frame = 1
Query:   79 MYCSKCYHERKYTRLELATWQDKIPVIVGIEEIVKTIFEYSFDQVDEDKPIKTTVIKDWNEEEIYCLCEKKISEINNSHEHVSQSEPLDLSLSSPTSINEKIDYQSPRKHVISNSSYSERELISAVRAICCGRIGTRRAAALYGIPRSTLRNRIFKVYDAKKIHDTDQRMSMVDFFKKILKDDSMFTNLFHQKYQRXXXXXXXXXXXXXXXXXXVHFRQKENHVSNKELFKNELNEIIKHQQKKDSSRIQEIQLSDSFLDYNKPDFPXXXXXXXXXXPDLLTSYFQQDHQTNIMSSYLFMMCQQNLLSSVYSSLMMPDWQLPNFNFGNIPSPHNLYSTKKSXXXXXXXXXXXXXXXKDQADKHSILETEHFYNQPLNFAKNSLGEINISSEICKNDQSDNKPEESIEESDTSVSAPSKVTNEFNIAALSDEISESSRHKKRGHYRQYNTEMLNKAIDAVRFGEMSVHKAGNHFGVPHSTLEYRVKQMTEGLAAEKLLNKQTHXXXXXXXXXXXXXXDGESKKTDSDGCNTNVSLNSQI 1692
            MYCSKCYHERKYTRLELATWQDKIPVIVGIEEIVKTIFEYSFDQVDEDKPIKTTVIKDWNEEEIYCLCEKKISEINNSHEHVSQSEPLDLSLSSPTSINEKIDYQSPRKHVISNSSYSERELISAVRAICCGRIGTRRAAALYGIPRSTLRNRIFKVYDAKKIHDTDQRMSM                   QKYQRENKEEKKKTVITEKENNKVHFRQKENHVSNKELFKNELNEIIKHQQ+KDSSRIQEIQLSDSFLDYNKPDFPINQININSNIPDLLTSYFQQDHQTNIMSSYLFMMCQQNLLSSVYSSLMMPDWQLPNFNFGNIPSPHNLYSTKKSEIINNKENHLENINNKDQA+KHSILETEHFYNQPLNFAKNSLGEINISSEICKNDQSDNKPEESIEESDTSVSAPSKVTNEFNIAALSDEISESSRHKKRGHYRQYNTEMLNKAIDAVRFGEMSVHKAGNHFGVPHSTLEYRVKQMTEGLAAEKLLNKQTHKRKKSNSLENSKSNDGESKKTDSDGCNTNVSLNSQI
Sbjct:    1 MYCSKCYHERKYTRLELATWQDKIPVIVGIEEIVKTIFEYSFDQVDEDKPIKTTVIKDWNEEEIYCLCEKKISEINNSHEHVSQSEPLDLSLSSPTSINEKIDYQSPRKHVISNSSYSERELISAVRAICCGRIGTRRAAALYGIPRSTLRNRIFKVYDAKKIHDTDQRMSM-------------------QKYQRENKEEKKKTVITEKENNKVHFRQKENHVSNKELFKNELNEIIKHQQQKDSSRIQEIQLSDSFLDYNKPDFPINQININSNIPDLLTSYFQQDHQTNIMSSYLFMMCQQNLLSSVYSSLMMPDWQLPNFNFGNIPSPHNLYSTKKSEIINNKENHLENINNKDQAEKHSILETEHFYNQPLNFAKNSLGEINISSEICKNDQSDNKPEESIEESDTSVSAPSKVTNEFNIAALSDEISESSRHKKRGHYRQYNTEMLNKAIDAVRFGEMSVHKAGNHFGVPHSTLEYRVKQMTEGLAAEKLLNKQTHKRKKSNSLENSKSNDGESKKTDSDGCNTNVSLNSQI 519          
The following BLAST results are available for this feature:
BLAST of Mushroom body large-type Kenyon-related protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
LCOR4.168e-1261.22ligand dependent nuclear receptor corepressor [Sou... [more]
LCOR4.481e-1261.22ligand dependent nuclear receptor corepressor [Sou... [more]
LCOR4.481e-1261.22ligand dependent nuclear receptor corepressor [Sou... [more]
LCOR4.481e-1261.22ligand dependent nuclear receptor corepressor [Sou... [more]
LCORL1.180e-1055.56ligand dependent nuclear receptor corepressor like... [more]
back to top
BLAST of Mushroom body large-type Kenyon-related protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
mbr-16.678e-1361.70Mblk-1-related factor 1 [Source:UniProtKB/Swiss-P... [more]
back to top
BLAST of Mushroom body large-type Kenyon-related protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Eip93F5.100e-1261.70gene:FBgn0264490 transcript:FBtr0112874[more]
Eip93F5.113e-1261.70gene:FBgn0264490 transcript:FBtr0084169[more]
Eip93F5.463e-1261.70gene:FBgn0264490 transcript:FBtr0330384[more]
back to top
BLAST of Mushroom body large-type Kenyon-related protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lcor1.761e-1263.27ligand dependent nuclear receptor corepressor [Sou... [more]
CR769781.11.043e-1058.82ligand dependent nuclear receptor corepressor-like... [more]
lcorl1.053e-1058.82ligand dependent nuclear receptor corepressor-like... [more]
CR762426.11.071e-1058.82ligand dependent nuclear receptor corepressor-like... [more]
CR391911.11.168e-1058.82ligand dependent nuclear receptor corepressor-like... [more]
back to top
BLAST of Mushroom body large-type Kenyon-related protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
lcor1.886e-1161.22ligand dependent nuclear receptor corepressor [Sou... [more]
trmt53.405e-954.90tRNA methyltransferase 5 [Source:Xenbase;Acc:XB-GE... [more]
back to top
BLAST of Mushroom body large-type Kenyon-related protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Lcor3.003e-1261.22ligand dependent nuclear receptor corepressor [Sou... [more]
Lcor3.132e-1261.22ligand dependent nuclear receptor corepressor [Sou... [more]
Lcor3.132e-1261.22ligand dependent nuclear receptor corepressor [Sou... [more]
Lcorl9.053e-1155.56ligand dependent nuclear receptor corepressor-like... [more]
Lcorl1.494e-1055.56ligand dependent nuclear receptor corepressor-like... [more]
back to top
BLAST of Mushroom body large-type Kenyon-related protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|G5EGQ5|MBR1_CAEEL8.495e-1261.70Mblk-1-related factor 1 OS=Caenorhabditis elegans ... [more]
sp|Q96JN0|LCOR_HUMAN2.152e-1161.22Ligand-dependent corepressor OS=Homo sapiens OX=96... [more]
sp|Q6ZPI3|LCOR_MOUSE2.191e-1161.22Ligand-dependent corepressor OS=Mus musculus OX=10... [more]
sp|Q95YM8|MBLK1_APIME9.612e-1161.70Mushroom body large-type Kenyon cell-specific prot... [more]
sp|Q8N3X6|LCORL_HUMAN8.734e-1055.56Ligand-dependent nuclear receptor corepressor-like... [more]
back to top
BLAST of Mushroom body large-type Kenyon-related protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1Z1R1790.000e+099.44Mushroom body large-type Kenyon-related protein OS... [more]
A0A1S3JRV93.048e-1532.99ligand-dependent nuclear receptor corepressor-like... [more]
A0A1I8BYX53.660e-1368.63Uncharacterized protein OS=Meloidogyne hapla OX=63... [more]
A0A0R3W6303.853e-1346.07HTH psq-type domain-containing protein OS=Taenia a... [more]
A0A0V1BHW21.854e-1239.83Mushroom body large-type Kenyon cell-specific prot... [more]
back to top
BLAST of Mushroom body large-type Kenyon-related protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
lcor3.161e-1356.90ligand dependent nuclear receptor corepressor [Sou... [more]
lcor3.867e-1356.90ligand dependent nuclear receptor corepressor [Sou... [more]
LCORL1.584e-1059.18ligand dependent nuclear receptor corepressor like... [more]
back to top
BLAST of Mushroom body large-type Kenyon-related protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000003404.19.728e-1155.10pep scaffold:Pmarinus_7.0:GL476560:346958:365324:1... [more]
back to top
BLAST of Mushroom body large-type Kenyon-related protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Mushroom body large-type Kenyon-related protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Mushroom body large-type Kenyon-related protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 4
Match NameE-valueIdentityDescription
lcor3.057e-1348.05ligand dependent nuclear receptor corepressor [Sou... [more]
lcor3.057e-1348.05ligand dependent nuclear receptor corepressor [Sou... [more]
lcor4.511e-1348.05ligand dependent nuclear receptor corepressor [Sou... [more]
lcor5.265e-1348.05ligand dependent nuclear receptor corepressor [Sou... [more]
back to top
BLAST of Mushroom body large-type Kenyon-related protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000070784.10.000e+099.63SMESG000070784.1[more]
SMESG000070784.10.000e+096.10SMESG000070784.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30009090 ID=SMED30009090|Name=Mushroom body large-type Kenyon-related protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1840bp
CAGTTTTTTTTTAATATATTATAATCAAATATATTTCTCGTCTGTCATCG
TCGATTAAATTTCGGATTCACTCGACCGATGTATTGCTCAAAATGTTACC
ATGAACGAAAATATACCCGGCTCGAATTAGCAACCTGGCAGGATAAAATT
CCAGTAATCGTTGGTATAGAAGAAATTGTTAAAACAATATTTGAATATTC
ATTTGACCAAGTCGATGAAGATAAGCCCATTAAAACAACAGTAATCAAAG
ACTGGAATGAAGAAGAAATTTACTGTTTGTGTGAAAAAAAGATTTCCGAA
ATCAACAATTCTCACGAGCACGTATCACAGTCAGAACCGCTGGACCTGTC
GTTATCTAGTCCCACCTCAATCAATGAAAAAATTGACTATCAAAGTCCAC
GAAAACACGTTATCTCTAATAGTAGTTATTCTGAAAGAGAATTGATCTCA
GCCGTTCGTGCCATATGTTGCGGTCGAATAGGTACCAGACGTGCTGCTGC
ACTTTATGGAATTCCACGTTCAACACTGAGAAATAGAATTTTCAAAGTTT
ATGACGCCAAGAAAATTCACGACACTGACCAAAGAATGTCAATGGTAGAC
TTTTTTAAAAAAATCTTAAAAGATGACTCAATGTTCACTAATCTTTTTCA
TCAAAAATATCAACGTGAAAACAAGGAAGAAAAAAAGAAAACTGTTATAA
CAGAAAAAGAAAACAATAAAGTTCATTTCCGACAGAAAGAAAATCATGTC
AGCAATAAAGAATTGTTTAAAAATGAGCTCAATGAAATTATCAAGCATCA
ACAGAAAAAAGATTCCAGCAGGATTCAAGAAATTCAACTTTCCGATTCAT
TCCTTGATTATAATAAACCAGATTTTCCTATAAATCAAATTAATATTAAT
TCCAACATTCCAGACTTATTAACTTCTTATTTTCAACAAGATCATCAAAC
TAATATTATGTCAAGCTATTTATTTATGATGTGTCAGCAAAACCTTTTAT
CTTCTGTGTACAGCTCATTAATGATGCCCGATTGGCAGCTACCGAATTTT
AATTTTGGAAACATTCCTTCTCCCCATAATTTGTATTCTACTAAAAAGTC
AGAAATCATTAATAACAAAGAGAATCATTTGGAAAATATAAATAACAAAG
ATCAAGCAGACAAACATTCGATTCTCGAAACAGAACATTTTTATAATCAG
CCGTTAAATTTTGCCAAGAATTCTCTTGGCGAAATAAACATATCTTCCGA
AATATGTAAAAATGATCAATCAGACAACAAACCGGAAGAGTCCATTGAAG
AATCTGACACTTCTGTCAGTGCTCCATCAAAAGTAACAAATGAATTCAAT
ATCGCAGCTCTATCAGATGAGATCTCTGAATCCTCTCGTCACAAAAAAAG
AGGTCATTATCGTCAGTACAATACGGAGATGCTAAACAAGGCAATAGATG
CTGTAAGATTTGGCGAAATGAGCGTTCACAAGGCCGGAAATCACTTTGGA
GTGCCTCATTCTACTTTGGAATACCGAGTAAAACAAATGACTGAAGGATT
GGCAGCTGAGAAATTATTAAATAAACAGACTCACAAAAGAAAAAAGTCAA
ATTCGTTAGAAAATTCCAAAAGCAATGATGGAGAATCAAAAAAAACTGAT
TCAGATGGCTGTAATACGAATGTTTCTTTAAATTCTCAAATTTAGTGTCC
TATTGTTAGGAAATTAAATGAATTTGATTGGCATAATATTTATAAAAAAA
TAAATTTTTATTCAATGTCACAAAATATTTTTTGTAAAAATCTTGAAATC
TGATAAAAATCTTTATTATTGTTAAAAAAAGTTTTGCTCA
back to top

protein sequence of SMED30009090-orf-1

>SMED30009090-orf-1 ID=SMED30009090-orf-1|Name=SMED30009090-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=539bp
MYCSKCYHERKYTRLELATWQDKIPVIVGIEEIVKTIFEYSFDQVDEDKP
IKTTVIKDWNEEEIYCLCEKKISEINNSHEHVSQSEPLDLSLSSPTSINE
KIDYQSPRKHVISNSSYSERELISAVRAICCGRIGTRRAAALYGIPRSTL
RNRIFKVYDAKKIHDTDQRMSMVDFFKKILKDDSMFTNLFHQKYQRENKE
EKKKTVITEKENNKVHFRQKENHVSNKELFKNELNEIIKHQQKKDSSRIQ
EIQLSDSFLDYNKPDFPINQININSNIPDLLTSYFQQDHQTNIMSSYLFM
MCQQNLLSSVYSSLMMPDWQLPNFNFGNIPSPHNLYSTKKSEIINNKENH
LENINNKDQADKHSILETEHFYNQPLNFAKNSLGEINISSEICKNDQSDN
KPEESIEESDTSVSAPSKVTNEFNIAALSDEISESSRHKKRGHYRQYNTE
MLNKAIDAVRFGEMSVHKAGNHFGVPHSTLEYRVKQMTEGLAAEKLLNKQ
THKRKKSNSLENSKSNDGESKKTDSDGCNTNVSLNSQI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000099neuron
PLANA:0000418head
PLANA:0000461lateral branch
Vocabulary: INTERPRO
TermDefinition
IPR007889HTH_Psq
IPR009057Homeobox-like_sf
Vocabulary: molecular function
TermDefinition
GO:0003677DNA binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:1.10.10.60coord: 117..157
e-value: 2.8E-12
score: 47.9
coord: 447..488
e-value: 1.7E-17
score: 64.6
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 393..417
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 504..524
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 496..538
NoneNo IPR availablePANTHERPTHR21545TRANSCRIPTION FACTOR MLR1/2coord: 96..198
coord: 430..491
NoneNo IPR availablePANTHERPTHR21545:SF13ECDYSONE-INDUCED PROTEIN 93F, ISOFORM Ccoord: 96..198
coord: 430..491
IPR007889DNA binding HTH domain, Psq-typePFAMPF05225HTH_psqcoord: 121..156
e-value: 3.9E-8
score: 32.9
coord: 450..487
e-value: 2.0E-12
score: 46.6
IPR007889DNA binding HTH domain, Psq-typePROSITEPS50960HTH_PSQcoord: 107..160
score: 8.846
IPR007889DNA binding HTH domain, Psq-typePROSITEPS50960HTH_PSQcoord: 438..490
score: 16.599
IPR009057Homeobox-like domain superfamilySUPERFAMILYSSF46689Homeodomain-likecoord: 115..164
IPR009057Homeobox-like domain superfamilySUPERFAMILYSSF46689Homeodomain-likecoord: 442..489