Protocadherin Fat 1

Overview
NameProtocadherin Fat 1
Smed IDSMED30009079
Length (bp)3521
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Protocadherin Fat 1 (SMED30009079) t-SNE clustered cells

Violin plots show distribution of expression levels for Protocadherin Fat 1 (SMED30009079) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Protocadherin Fat 1 (SMED30009079) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Protocadherin Fat 1 (SMED30009079) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30009079

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
muscle cellSMED30009079SMESG000048159.1 dd_Smed_v4_11837_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30009079SMESG000048159.1 dd_Smed_v4_11837_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30009079SMESG000048159.1 dd_Smed_v6_11837_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
dorsal-ventral muscle cellSMED30009079SMESG000048159.1 dd_Smed_v4_11837_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Protocadherin Fat 1 vs. Ensembl Human
Match: PCDH1 (protocadherin 1 [Source:HGNC Symbol;Acc:HGNC:8655])

HSP 1 Score: 214.157 bits (544), Expect = 4.716e-56
Identity = 196/691 (28.36%), Postives = 312/691 (45.15%), Query Frame = 3
Query:  417 IKILDQNDKAPQFSSIKRPF--FKIPENVEVGKVIDLPMAVDSDSEKYSVRRYSLSYIYHLDQTHDFRLHVTNDNPPR-PQLIVNSKLDYEKINKYVFRLFAYDFDEKSIGNSCSTTIEIEIEDLNDNVPKFNQLTYNANIDENKR-DDKLIKFTVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSV--SNSVSIIEGLPAHSLVVEVRVTDADTHSNMIHCKLVDYNDLFYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFP---KP------IIVTDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEP-KGDHSSYFDIDRYTGDLRTRKPLDRETLESISIKVTAKNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAPKFIPRLNMKQKVEFIVEQFVDGNTCTELPYTVQDIDDGGINGQNCCYTILENDYNKLFSLMTDTPSYIC---LQRKPEKYQSYTVTLIARDRPP 2432
            I++ D ND  P F+S   P     IPEN  +G +  +P+A D D+    V  Y L       +   F L V  D   + PQLIV   LD E+ + Y   +   D    S   + S  + + + D NDN PKF + +Y A + EN      +I+   +D D G N  +      +  E+ +R  +  + RN   + +   +D E D     F++LA D+GT   S+ AQV + +K++NDN P I+ + +G         +I E +   + V  V+V+D D   N     +V  +  F L   S+  +    K F L+T   +D E      + I    + + P   +++  SL +Q+ DVNDNAP+F+Q +             V FP   KP      I  +D DSG N +  + LE     +    F I   +G+I  + SLD E +  +  K++A D+G   L  ++T+ +NVLD NDN P+F  S Y F+V EN+     +G +  ID D   +N  +  S+E   GD    F I   TG + +    DRE   + + ++ A +        V    + V V I V+D NDNAP      N   K   +  Q   G T +++    +D D  G+N +   Y+I   +   LF + + + +      ++R+        V +  R +PP
Sbjct:  156 IEVQDINDNTPNFAS---PVITLAIPENTNIGSLFPIPLASDRDAGPNGVASYELQAGPEAQEL--FGLQVAEDQEEKQPQLIVMGNLDRERWDSYDLTIKVQDG--GSPPRASSALLRVTVLDTNDNAPKFERPSYEAELSENSPIGHSVIQVKANDSDQGANAEIEYTF-HQAPEVVRR--LLRLDRNTGLITVQGPVDRE-DLSTLRFSVLAKDRGTNPKSARAQVVVTVKDMNDNAPTIEIRGIGLVTHQDGMANISEDVAEETAVALVQVSDRDEGENAAVTCVVAGDVPFQLRQASETGSDSKKKYF-LQTTTPLDYEKVKDYTIEIVAVDSGNPP---LSSTNSLKVQVVDVNDNAPVFTQSV-----------TEVAFPENNKPGEVIAEITASDADSGSNAELVYSLEP--EPAAKGLFTISPETGEIQVKTSLDREQRESYELKVVAADRGSPSLQGTATVLVNVLDCNDNDPKFMLSGYNFSVMENMPALSPVGMVTVIDGDKG-ENAQVQLSVEQDNGD----FVIQNGTGTILSSLSFDREQQSTYTFQLKAVDGG------VPPRSAYVGVTINVLDENDNAPYITAPSNTSHK--LLTPQTRLGETVSQV--AAEDFDS-GVNAE-LIYSIAGGNPYGLFQIGSHSGAITLEKEIERRHHGLHRLVVKVSDRGKPP 801          

HSP 2 Score: 142.51 bits (358), Expect = 1.105e-33
Identity = 153/594 (25.76%), Postives = 261/594 (43.94%), Query Frame = 3
Query:  384 TPTDPGTFFILIKILDQNDKAPQFSSIKRPFF--KIPENVEVGKVIDLPMAVDSDSEKYSVRRYSLSYIYHLDQTHDFRLHVTNDNPPRPQLIVNSKLDYEKINKYVFRLFAYDFDEKSIGNSCSTTIEIEIEDLNDNVP-----KFNQLTYN---ANIDENKRDDKLIKFT-VSDPDSGRNGIVTVNIV-DKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVS-NSVSIIEGLPAHSLVVEVRVTDADTHSNMIHCKLVDYNDLFYLDSPSKFNTLLNYKP--FNLKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPII-VTDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSE----SHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLRTRKPLDR--ETLESISIKVTAKN-PNKYSSHFV 2096
            +P    +  + + +LD ND AP+F   +RP +  ++ EN  +G  +    A DSD    +     + Y +H       RL   + N     + V   +D E ++   F + A D        S    + + ++D+NDN P         +T+    ANI E+  ++  +    VSD D G N  VT  +  D   +L +  +     + ++FL+    LDYE     +   ++A D G P LSS+  +K+ + ++NDN P        F+ S   V+  E      ++ E+  +DAD+ SN    +LV     + L+       L    P    ++    +DRE      L++ ++     PS Q T    +N+   D NDN P F   +  G       N+    P  ++ V D D G N + +  +E      D+ DF+I   +G I +  S D E ++ + F++ A+D G  P ++   +TINVLD NDNAP  +     SH +        +G  +  + A D D+   N ++ YSI   G+    F I  ++G +   K ++R    L  + +KV+ +  P +Y +  V
Sbjct:  257 SPPRASSALLRVTVLDTNDNAPKF---ERPSYEAELSENSPIGHSVIQVKANDSDQGANA----EIEYTFHQAPEVVRRLLRLDRN--TGLITVQGPVDREDLSTLRFSVLAKDRGTNP--KSARAQVVVTVKDMNDNAPTIEIRGIGLVTHQDGMANISEDVAEETAVALVQVSDRDEGENAAVTCVVAGDVPFQLRQASETGSDSKKKYFLQTTTPLDYEKVKD-YTIEIVAVDSGNPPLSSTNSLKVQVVDVNDNAPV-------FTQSVTEVAFPENNKPGEVIAEITASDADSGSN---AELV-----YSLEPEPAAKGLFTISPETGEIQVKTSLDREQRESYELKV-VAADRGSPSLQGTATVLVNVL--DCNDNDPKF---MLSGYNFSVMENMPALSPVGMVTVIDGDKGENAQVQLSVE-----QDNGDFVIQNGTGTILSSLSFDREQQSTYTFQLKAVDGGVPPRSAYVGVTINVLDENDNAPYITAPSNTSHKLLT--PQTRLGETVSQVAAEDFDSG-VNAELIYSIA-GGNPYGLFQIGSHSGAITLEKEIERRHHGLHRLVVKVSDRGKPPRYGTALV 808          

HSP 3 Score: 136.732 bits (343), Expect = 8.612e-32
Identity = 139/492 (28.25%), Postives = 232/492 (47.15%), Query Frame = 3
Query:  762 EIEIEDLNDNVPKFNQLTYNANIDENKRDDKLIKFTV-SDPDSGRNGIVTVNIVDKTDELSKRF--KIFEIQRN-EFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDADTHSNMIHCKLVDYNDLFYLDSPSKFNTLLNY-KPFNLKTI-NKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFS-QQIYI-----GXXXXXXXXXXXXFPKPIIVTDRDSGLN--------GKFEFYL-EDFRNFSDSSDFLIDKISGKIFTQRS--LDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLRTRKPLDRETLESISIKVTAKNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAPKFI 2168
            +IE++D+NDN P F        I EN     L    + SD D+G NG+ +  +     E  + F  ++ E Q   +  L ++ +LD E     ++ T+   D G+P  +SSA +++ + + NDN P  KF++  +    S    E  P    V++V+  D+D  +N      ++Y    +  +P     LL   +   L T+   +DRE    S LR ++   D   + + +    + + ++D+NDNAP    + I +     G  + ++          + V+DRD G N        G   F L +     SDS          K F Q +  LDYE    +  +I+A+D G  PL+S++++ + V+D+NDNAP F++S       EN   G  I  + A D D+   N ++ YS+EP+      F I   TG+++ +  LDRE  ES  +KV A +     S  ++ T +   V++ V+D NDN PKF+
Sbjct:  155 QIEVQDINDNTPNFASPVITLAIPENTNIGSLFPIPLASDRDAGPNGVASYEL-QAGPEAQELFGLQVAEDQEEKQPQLIVMGNLDRERW-DSYDLTIKVQDGGSPPRASSALLRVTVLDTNDNAP--KFERPSYEAELS----ENSPIGHSVIQVKANDSDQGANA----EIEYT---FHQAPEVVRRLLRLDRNTGLITVQGPVDREDL--STLRFSVLAKDRGTNPK-SARAQVVVTVKDMNDNAPTIEIRGIGLVTHQDGMANISEDVAEETAVALVQVSDRDEGENAAVTCVVAGDVPFQLRQASETGSDSKK--------KYFLQTTTPLDYEKVKDYTIEIVAVDSGNPPLSSTNSLKVQVVDVNDNAPVFTQSVTEVAFPENNKPGEVIAEITASDADSG-SNAELVYSLEPEPAAKGLFTISPETGEIQVKTSLDREQRESYELKVVAAD---RGSPSLQGTAT---VLVNVLDCNDNDPKFM 613          
BLAST of Protocadherin Fat 1 vs. Ensembl Human
Match: PCDH1 (protocadherin 1 [Source:HGNC Symbol;Acc:HGNC:8655])

HSP 1 Score: 214.157 bits (544), Expect = 7.438e-56
Identity = 196/691 (28.36%), Postives = 312/691 (45.15%), Query Frame = 3
Query:  417 IKILDQNDKAPQFSSIKRPF--FKIPENVEVGKVIDLPMAVDSDSEKYSVRRYSLSYIYHLDQTHDFRLHVTNDNPPR-PQLIVNSKLDYEKINKYVFRLFAYDFDEKSIGNSCSTTIEIEIEDLNDNVPKFNQLTYNANIDENKR-DDKLIKFTVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNS--VSIIEGLPAHSLVVEVRVTDADTHSNMIHCKLVDYNDLFYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFP---KP------IIVTDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEP-KGDHSSYFDIDRYTGDLRTRKPLDRETLESISIKVTAKNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAPKFIPRLNMKQKVEFIVEQFVDGNTCTELPYTVQDIDDGGINGQNCCYTILENDYNKLFSLMTDTPSYIC---LQRKPEKYQSYTVTLIARDRPP 2432
            I++ D ND  P F+S   P     IPEN  +G +  +P+A D D+    V  Y L       +   F L V  D   + PQLIV   LD E+ + Y   +   D    S   + S  + + + D NDN PKF + +Y A + EN      +I+   +D D G N  +      +  E+ +R  +  + RN   + +   +D E D     F++LA D+GT   S+ AQV + +K++NDN P I+ + +G         +I E +   + V  V+V+D D   N     +V  +  F L   S+  +    K F L+T   +D E      + I    + + P   +++  SL +Q+ DVNDNAP+F+Q +             V FP   KP      I  +D DSG N +  + LE     +    F I   +G+I  + SLD E +  +  K++A D+G   L  ++T+ +NVLD NDN P+F  S Y F+V EN+     +G +  ID D   +N  +  S+E   GD    F I   TG + +    DRE   + + ++ A +        V    + V V I V+D NDNAP      N   K   +  Q   G T +++    +D D  G+N +   Y+I   +   LF + + + +      ++R+        V +  R +PP
Sbjct:  156 IEVQDINDNTPNFAS---PVITLAIPENTNIGSLFPIPLASDRDAGPNGVASYELQAGPEAQEL--FGLQVAEDQEEKQPQLIVMGNLDRERWDSYDLTIKVQDG--GSPPRASSALLRVTVLDTNDNAPKFERPSYEAELSENSPIGHSVIQVKANDSDQGANAEIEYTF-HQAPEVVRR--LLRLDRNTGLITVQGPVDRE-DLSTLRFSVLAKDRGTNPKSARAQVVVTVKDMNDNAPTIEIRGIGLVTHQDGMANISEDVAEETAVALVQVSDRDEGENAAVTCVVAGDVPFQLRQASETGSDSKKKYF-LQTTTPLDYEKVKDYTIEIVAVDSGNPP---LSSTNSLKVQVVDVNDNAPVFTQSV-----------TEVAFPENNKPGEVIAEITASDADSGSNAELVYSLEP--EPAAKGLFTISPETGEIQVKTSLDREQRESYELKVVAADRGSPSLQGTATVLVNVLDCNDNDPKFMLSGYNFSVMENMPALSPVGMVTVIDGDKG-ENAQVQLSVEQDNGD----FVIQNGTGTILSSLSFDREQQSTYTFQLKAVDGG------VPPRSAYVGVTINVLDENDNAPYITAPSNTSHK--LLTPQTRLGETVSQV--AAEDFDS-GVNAE-LIYSIAGGNPYGLFQIGSHSGAITLEKEIERRHHGLHRLVVKVSDRGKPP 801          

HSP 2 Score: 142.51 bits (358), Expect = 1.608e-33
Identity = 153/594 (25.76%), Postives = 261/594 (43.94%), Query Frame = 3
Query:  384 TPTDPGTFFILIKILDQNDKAPQFSSIKRPFF--KIPENVEVGKVIDLPMAVDSDSEKYSVRRYSLSYIYHLDQTHDFRLHVTNDNPPRPQLIVNSKLDYEKINKYVFRLFAYDFDEKSIGNSCSTTIEIEIEDLNDNVP-----KFNQLTYN---ANIDENKRDDKLIKFT-VSDPDSGRNGIVTVNIV-DKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVS-NSVSIIEGLPAHSLVVEVRVTDADTHSNMIHCKLVDYNDLFYLDSPSKFNTLLNYKP--FNLKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPII-VTDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSE----SHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLRTRKPLDR--ETLESISIKVTAKN-PNKYSSHFV 2096
            +P    +  + + +LD ND AP+F   +RP +  ++ EN  +G  +    A DSD    +     + Y +H       RL   + N     + V   +D E ++   F + A D        S    + + ++D+NDN P         +T+    ANI E+  ++  +    VSD D G N  VT  +  D   +L +  +     + ++FL+    LDYE     +   ++A D G P LSS+  +K+ + ++NDN P        F+ S   V+  E      ++ E+  +DAD+ SN    +LV     + L+       L    P    ++    +DRE      L++ ++     PS Q T    +N+   D NDN P F   +  G       N+    P  ++ V D D G N + +  +E      D+ DF+I   +G I +  S D E ++ + F++ A+D G  P ++   +TINVLD NDNAP  +     SH +        +G  +  + A D D+   N ++ YSI   G+    F I  ++G +   K ++R    L  + +KV+ +  P +Y +  V
Sbjct:  257 SPPRASSALLRVTVLDTNDNAPKF---ERPSYEAELSENSPIGHSVIQVKANDSDQGANA----EIEYTFHQAPEVVRRLLRLDRN--TGLITVQGPVDREDLSTLRFSVLAKDRGTNP--KSARAQVVVTVKDMNDNAPTIEIRGIGLVTHQDGMANISEDVAEETAVALVQVSDRDEGENAAVTCVVAGDVPFQLRQASETGSDSKKKYFLQTTTPLDYEKVKD-YTIEIVAVDSGNPPLSSTNSLKVQVVDVNDNAPV-------FTQSVTEVAFPENNKPGEVIAEITASDADSGSN---AELV-----YSLEPEPAAKGLFTISPETGEIQVKTSLDREQRESYELKV-VAADRGSPSLQGTATVLVNVL--DCNDNDPKF---MLSGYNFSVMENMPALSPVGMVTVIDGDKGENAQVQLSVE-----QDNGDFVIQNGTGTILSSLSFDREQQSTYTFQLKAVDGGVPPRSAYVGVTINVLDENDNAPYITAPSNTSHKLLT--PQTRLGETVSQVAAEDFDSG-VNAELIYSIA-GGNPYGLFQIGSHSGAITLEKEIERRHHGLHRLVVKVSDRGKPPRYGTALV 808          

HSP 3 Score: 136.732 bits (343), Expect = 8.109e-32
Identity = 139/492 (28.25%), Postives = 231/492 (46.95%), Query Frame = 3
Query:  762 EIEIEDLNDNVPKFNQLTYNANIDENKRDDKLIKFTV-SDPDSGRNGIVTVNIVDKTDELSKRF--KIFEIQRN-EFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDADTHSNMIHCKLVDYNDLFYLDSPSKFNTLLNY-KPFNLKTI-NKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFS-QQIYI-----GXXXXXXXXXXXXFPKPIIVTDRDSGLN--------GKFEFYL-EDFRNFSDSSDFLIDKISGKIFTQRS--LDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLRTRKPLDRETLESISIKVTAKNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAPKFI 2168
            +IE++D+NDN P F        I EN     L    + SD D+G NG+ +  +     E  + F  ++ E Q   +  L ++ +LD E     ++ T+   D G+P  +SSA +++ + + NDN PK +       +S +  I      HS V++V+  D+D  +N      ++Y    +  +P     LL   +   L T+   +DRE    S LR ++   D   +   +    + + ++D+NDNAP    + I +     G  + ++          + V+DRD G N        G   F L +     SDS          K F Q +  LDYE    +  +I+A+D G  PL+S++++ + V+D+NDNAP F++S       EN   G  I  + A D D+   N ++ YS+EP+      F I   TG+++ +  LDRE  ES  +KV A +     S  ++ T +   V++ V+D NDN PKF+
Sbjct:  155 QIEVQDINDNTPNFASPVITLAIPENTNIGSLFPIPLASDRDAGPNGVASYEL-QAGPEAQELFGLQVAEDQEEKQPQLIVMGNLDRERW-DSYDLTIKVQDGGSPPRASSALLRVTVLDTNDNAPKFERPSYEAELSENSPI-----GHS-VIQVKANDSDQGANA----EIEYT---FHQAPEVVRRLLRLDRNTGLITVQGPVDREDL--STLRFSVLAKDRG-TNPKSARAQVVVTVKDMNDNAPTIEIRGIGLVTHQDGMANISEDVAEETAVALVQVSDRDEGENAAVTCVVAGDVPFQLRQASETGSDSKK--------KYFLQTTTPLDYEKVKDYTIEIVAVDSGNPPLSSTNSLKVQVVDVNDNAPVFTQSVTEVAFPENNKPGEVIAEITASDADSG-SNAELVYSLEPEPAAKGLFTISPETGEIQVKTSLDREQRESYELKVVAAD---RGSPSLQGTAT---VLVNVLDCNDNDPKFM 613          
BLAST of Protocadherin Fat 1 vs. Ensembl Human
Match: DCHS1 (dachsous cadherin-related 1 [Source:HGNC Symbol;Acc:HGNC:13681])

HSP 1 Score: 194.897 bits (494), Expect = 1.757e-49
Identity = 179/617 (29.01%), Postives = 277/617 (44.89%), Query Frame = 3
Query:  372 FQYLTPTDPGTFFILIKILDQNDKAPQFSSIKRPFFKIPENVEVGKVIDLPMAVDSDSEKYSVRRYSLSYIYHLDQTHDFRLHVTN--DNPPRPQLIVNSKLDYEKINKYVFRLFAYDFDEKSIGNSCSTTIEIEIEDLNDNVPKFNQLTYNANIDEN-KRDDKLIKFTVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDAD----THSNMI------HCKLVDYNDLFYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPIIVTDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEP--KGDHSSYFDIDRYTGDLRTRKPLDRET-LESISIKVTAKNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAPKFIPR 2174
            F  +TP D  T  + +++ D ND AP F    R   ++PE+   G    L  A D+D+ +   + Y+LS          FRL      D  P P+L+V  +LD E  + Y+ +L AYD    S        +++ + D+ND+ P FNQ  Y+A + E+      +++   SD D+G NG VT  I  +  E    F    I  +   L+L   LD+E    + E  + A D G      SA V +H+++ NDN P +    +  S   S  + E  P   LV  + V+D D     H N+       H  L   + + YL   ++                ++DRE      LR+T + + S P R      +  + + DVNDNAP F +Q+Y       +V +  +F   +   D D G NG+  + L      + +  F ID  SG I T  SLDYE + + +  ++A D G  PL SS+T+++ + D+NDN P+F  + Y  ++ E    G     + A D D+      + YS+        S  F ID ++GD+ T + LDR+    S    VTA +             S V V + + D NDN P+F PR
Sbjct:  117 FTAVTP-DGATVEVTVRVADINDHAPAFPQ-ARAALQVPEHTAFGTRYPLEPARDADAGRLGTQGYALS---GDGAGETFRLETRPGPDGTPVPELVVTGELDRENRSHYMLQLEAYD--GGSPPRRAQALLDVTLLDINDHAPAFNQSRYHAVVSESLAPGSPVLQVFASDADAGVNGAVTYEINRRQSEGDGPF---SIDAHTGLLQLERPLDFEQR-RVHELVVQARDGGAHPELGSAFVTVHVRDANDNQPSMTV--IFLSADGSPQVSEAAPPGQLVARISVSDPDDGDFAHVNVSLEGGEGHFALSTQDSVIYLVCVAR----------------RLDREERDAYNLRVTATDSGSPPLR---AEAAFVLHVTDVNDNAPAFDRQLY-RPEPLPEVALPGSFVVRVTARDPDQGTNGQVTYSLAPG---AHTHWFSIDPTSGIITTAASLDYELEPQPQLIVVATDGGLPPLASSATVSVALQDVNDNEPQFQRTFYNASLPEGTQPGTCFLQVTATDADSGPFGL-LSYSLGAGLGSSGSPPFRIDAHSGDVCTTRTLDRDQGPSSFDFTVTAVDGG--------GLKSMVYVKVFLSDENDNPPQFYPR 688          

HSP 2 Score: 135.191 bits (339), Expect = 4.791e-31
Identity = 148/599 (24.71%), Postives = 249/599 (41.57%), Query Frame = 3
Query:  411 ILIKILDQNDKAPQFSSIKRPF-FKIPENVEVGKVIDLPMAVDSDSEKYSVRRYSLSYIYHLDQTHDFRLHVTNDNPPRPQLIVNSK---------LDYEKINKYVFRLFAYDFDEKSIGNSCSTTIEIE-IEDLNDNVPKFNQLTYNANIDENKRDDKLIKFTVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDADTHSNMIHCKLVDYNDLFYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPIIV---TDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLRTRKPLDRETLESISIKVTAKNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAPKF 2165
            + +++ D+N+ AP F+  + P    +PEN E G  +    A D+D                     D R  +    PP P L ++++         LD E     +  + A D    +     +       + D NDN P F   +     ++       +     DPD G    V+  +    D        F +  +   L ++  LD E        T++A+D G+P  S++  + + + ++ND  P  + ++       SV + E  P  + ++ +R TD D  +N      V Y  +    S   F+  L+     L T+  +DRE      + +T+   D     Q+T + ++ + +ED ND+AP F      G+   +        P+ + +   +D D G NG+ ++ + D      S  F++D  SG+  T R LD E +  F+ +I A D G   L+++  +T+ VLD ND+AP F    Y   V E+V  G  +  LQA D D        +Y        +  F ++  +G+LRT   LDRE   S +  V+A +             + V V I V DVND+AP F
Sbjct: 1422 VQVQVQDENEHAPAFA--RDPLALALPENPEPGAALYTFRASDADGP---------------GPNSDVRYRLLRQEPPVPALRLDARTGALSAPRGLDRETTPALLLLVEATDRPANASRRRAARVSARVFVTDENDNAPVFASPSRVRLPEDQPPGPAALHVVARDPDLGEAARVSYRLASGGD------GHFRLHSSTGALSVVRPLDREQRAEHV-LTVVASDHGSPPRSATQVLTVSVADVNDEAPTFQQQEY------SVLLRENNPPGTSLLTLRATDPDVGAN----GQVTYGGV----SSESFS--LDPDTGVLTTLRALDREEQEE--INLTVYAQDRGSPPQLT-HVTVRVAVEDENDHAPTF------GSAHLSLEVPEGQDPQTLTMLRASDPDVGANGQLQYRILDG---DPSGAFVLDLASGEFGTMRPLDREVEPAFQLRIEARDGGQPALSATLLLTVTVLDANDHAPAFPVPAYSVEVPEDVPAGTLLLQLQAHDPDAGANGHVTYYL---GAGTAGAFLLEPSSGELRTAAALDREQCPSYTFSVSAVDGAAAGP-----LSTTVSVTITVRDVNDHAPTF 1960          

HSP 3 Score: 122.479 bits (306), Expect = 3.531e-27
Identity = 140/543 (25.78%), Postives = 233/543 (42.91%), Query Frame = 3
Query:  423 ILDQNDKAPQFSSIKRPFFKIPENVEVGKVIDLPMAVDSDSEKYSVRRYSLSYIYHLDQTHDFRLHVTNDNPPRPQLIVNSKLDYEKINKYVFRLFAYDFDEKSIGNSCSTTIEIEIEDLNDNVPKFNQLTYNANIDENKR-DDKLIKFTVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDADTHSN-MIHCKLVDYNDLFYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPIIVTDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQ-PLTSSSTITINVLDLNDNAPRFSESHYIFNV------FENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLR-TRKPL 2021
            + D+ND AP F+S  R   ++PE+   G      +A D D  + +   Y L+          FRLH +        L V   LD E+  ++V  + A D    S   S +  + + + D+ND  P F Q  Y+  + EN      L+    +DPD G NG VT   V            F +  +   L  + +LD E    +   T+ A D+G+P   +   V++ +++ ND+ P      L      S+ + EG    +L + +R +D D  +N  +  +++D       D    F  +L+       T+  +DRE      LRI       +P+  ++    L + + D ND+AP F    Y  +V+  +          +   D D+G NG   +YL        +  FL++  SG++ T  +LD E    + F + A+D     PL+++ ++TI V D+ND+AP F  S     +      F   ++   + TL+A D D    N  I Y +   G       +D YTG++R  R P+
Sbjct: 1536 VTDENDNAPVFASPSR--VRLPEDQPPGPAALHVVARDPDLGEAARVSYRLAS----GGDGHFRLHSSTG-----ALSVVRPLDREQRAEHVLTVVASD--HGSPPRSATQVLTVSVADVNDEAPTFQQQEYSVLLRENNPPGTSLLTLRATDPDVGANGQVTYGGVSSES--------FSLDPDTGVLTTLRALDREEQEEI-NLTVYAQDRGSPPQLTHVTVRVAVEDENDHAPTFGSAHL------SLEVPEGQDPQTLTM-LRASDPDVGANGQLQYRILDG------DPSGAF--VLDLASGEFGTMRPLDREVEPAFQLRIEAR-DGGQPA--LSATLLLTVTVLDANDHAPAFPVPAY--SVEVPEDVPAGTLLLQLQAHDPDAGANGHVTYYL----GAGTAGAFLLEPSSGELRTAAALDREQCPSYTFSVSAVDGAAAGPLSTTVSVTITVRDVNDHAPTFPTSPLRLRLPRPGPSFSTPTLA--LATLRAEDRDAG-ANASILYRL--AGTPPPGTTVDSYTGEIRVARSPV 2027          

HSP 4 Score: 120.168 bits (300), Expect = 1.901e-26
Identity = 140/599 (23.37%), Postives = 254/599 (42.40%), Query Frame = 3
Query:  399 GTFFILIKILDQNDKAPQFSSIKRPFFKIPENVEV---GKVIDLPMAVDSDSEKYSVRRYSLSYIYHLDQTHDFRLHVTNDNPPRPQLIVNSKLDYEKINKYVFRLFAYDFDEKSIGNSCSTTIEIEIEDLNDNVPKFNQLTYNAN-IDENKRDDK-LIKFTVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDADTHSNMIHCKLVDYNDLFYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPIIVTDRDSGLNGKFEFYLEDFRNFSDSSD--FLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLRTRKPLDRETLESI---SIKVTAKNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAPKF 2165
            G+ F+ + + D ND  P  + I       P+  E    G+++      D D   ++    SL       +  +    ++  +     + V  +LD E+ + Y  R+ A D     +         + + D+NDN P F++  Y    + E       +++ T  DPD G NG VT ++             F I      +    SLDYE +P   +  ++ATD G P L+SSA V + L+++NDN P+  F++  ++ S    + EG    +  ++V  TDAD+        L+ Y+    L S       ++    ++ T   +DR+    SF   T++  D    + +     + + + D NDN P F  + Y  ++              +   D D G +G+  +++      + +S   F +D+ SG +     L     +  + +I A D G      S+ + I+++      P F +  Y+F+V E+V+ G  +G +QA   +   +   +  S+   GD    F +D  +G L+T +PLDRE L  +    ++  +  P  ++   VR         + + DVNDN+P F
Sbjct:  344 GSAFVTVHVRDANDNQPSMTVIFLSADGSPQVSEAAPPGQLVARISVSDPDDGDFAHVNVSL-------EGGEGHFALSTQDSVIYLVCVARRLDREERDAYNLRVTATDSGSPPL--RAEAAFVLHVTDVNDNAPAFDRQLYRPEPLPEVALPGSFVVRVTARDPDQGTNGQVTYSLAP-----GAHTHWFSIDPTSGIITTAASLDYELEPQP-QLIVVATDGGLPPLASSATVSVALQDVNDNEPQ--FQRTFYNAS----LPEGTQPGTCFLQVTATDADSGP----FGLLSYSLGAGLGSSGSPPFRIDAHSGDVCTTRTLDRDQGPSSF-DFTVTAVDGGGLKSMVY---VKVFLSDENDNPPQFYPREYAASISAQSPPGTAVLR--LRAHDPDQGSHGRLSYHI-----LAGNSPPLFTLDEQSGLLTVAWPLARRANSVVQLEIGAEDGGGLQAEPSARVDISIVPGTPTPPIFEQLQYVFSVPEDVAPGTSVGIVQA--HNPPGRLAPVTLSLS-GGDPRGLFSLDAVSGLLQTLRPLDRELLGPVLELEVRAGSGVPPAFAVARVR---------VLLDDVNDNSPAF 894          

HSP 5 Score: 113.235 bits (282), Expect = 2.239e-24
Identity = 144/619 (23.26%), Postives = 251/619 (40.55%), Query Frame = 3
Query:  342 KADLCCKLIGFQYLTPTDPGTFFILIKILDQNDKAPQFSSIKRPFFKIPENVEVGKVIDLPMAVDSDSEKYSVRRYSLSYIYHLDQTHDFRLHVTNDNPPRPQLIVNSKLDYEKINKYVFRLFAYDFDEKSIGNSCSTTIEIEIEDLNDNVPKFNQLTYNANIDENKRDDKLIKFTVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSV-SNSVSIIEGLPAHSLVVEVRVTDADTHSNMIHCKLVDYNDLFYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPIIV------TDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFTQRS-LDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDL--RTRKPLDRETLESISIKVTAKNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAPKFI 2168
            +A+    ++   + +P    T  + + + D ND+AP F   +     + EN   G  +    A D D              Y    +  F L     +P    L     LD E+  +    L  Y  D  S       T+ + +ED ND+ P F     +  + E +    L     SDPD G NG +   I+D   + S  F + ++   EF    +  LD E +P  F+  + A D G P+LS++  + + + + ND+ P        F V + SV + E +PA +L+++++  D D  +N         +  +YL + +    LL      L+T   +DRE         ++S  D   +  ++T  S+ I + DVND+AP F        +         +F  P +        DRD+G N    + L      +      +D  +G+I   RS +    +++  F I+A D G    +++  I + +    +  PRF  +     + EN   G  I + +A+       N  I YSI   G+    F I   TG +  R+ + LD E    + + + A++   ++   +          + + D NDNAP+F+
Sbjct: 1612 RAEHVLTVVASDHGSPPRSATQVLTVSVADVNDEAPTFQQQEYSVL-LRENNPPGTSLLTLRATDPDVGANG------QVTYGGVSSESFSL-----DPDTGVLTTLRALDREEQEE--INLTVYAQDRGSPPQLTHVTVRVAVEDENDHAPTFGSAHLSLEVPEGQDPQTLTMLRASDPDVGANGQLQYRILD--GDPSGAF-VLDLASGEF--GTMRPLDREVEP-AFQLRIEARDGGQPALSATLLLTVTVLDANDHAP-------AFPVPAYSVEVPEDVPAGTLLLQLQAHDPDAGANG--------HVTYYLGAGTAGAFLLEPSSGELRTAAALDREQCPS--YTFSVSAVDGAAAGPLSTTVSVTITVRDVNDHAPTFPTS----PLRLRLPRPGPSFSTPTLALATLRAEDRDAGANASILYRLAG----TPPPGTTVDSYTGEIRVARSPVALGPRDRVLF-IVATDLGRPARSATGVIIVGLQGEAERGPRFPRASSEATIRENAPPGTPIVSPRAVH--AGGTNGPITYSIL-SGNEKGTFSIQPSTGAITVRSAEGLDFEVSPRLRLVLQAESGGAFAFTVL---------TLTLQDANDNAPRFL 2172          

HSP 6 Score: 113.235 bits (282), Expect = 2.239e-24
Identity = 140/601 (23.29%), Postives = 256/601 (42.60%), Query Frame = 3
Query:  384 TPTDPGTFFILIKILDQNDKAPQFSSIKRPF-FKIPENVEVGKVIDLPMAVDSDSEKYSVRRYSLSYIYHLDQTHDFRLHVTNDNPPRPQ-----------LIVNSKLDYEKINKYVFRLFAYDFDEKSIGNSCSTTIEIEIEDLNDNVPKFNQLTYNANIDENKR-DDKLIKFTVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINSLDYETD-PHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSN-SVSIIEGLPAHSLVVEVRVTDAD---THSNMIHCKLV-DYNDLFYLD------------SPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPIIVTDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIE--PKGDHSSYFDIDRYTGDLRTRKPLDRETLESISIKVTAKNPNKYSS 2087
            +P   G+  + + ++D ND  P   +I +P+  ++ E+  +G  I      D DS    V  Y LS                   P  PQ           + +   LD+E+ ++Y  +L A+D   +   N     + + +ED+NDN P F+Q  Y   + E+      ++  + +D DSG NG ++ ++    D  S          N     ++ ++    D     +  L A D G P  ++ A V + L++ ND+ P        F++S+  V++ E LP  S ++ +  TDAD   +H+ + +  +  ++  +F L+             P     L+  +P + +++ + +          +T++  D     Q ++   + + + DVNDN P+F++  Y   V E+           +  +D D G +G   F +    +   S  F +D+ SG +    +LD ET+ + +  + A D       + + +TI V D+ND+ P F  +    +V EN   G  + TL AID D     +  +  +E  P  +    F ++  TG+LR R P D E  ES  + V A +    S+
Sbjct: 2254 SPALVGSATLTVMVIDTNDNRP---TIPQPWELRVSEDALLGSEIAQVTGNDVDSG--PVLWYVLS-------------------PSGPQDPFSVGRYGGRVSLTGPLDFEQCDRYQLQLLAHDGPHEGRAN-----LTVLVEDVNDNAPAFSQSLYQVMLLEHTPPGSAILSVSATDRDSGANGHISYHLASPADGFSVD------PNNGTLFTIVGTVALGHDGSGAVDVVLEARDHGAPGRAARATVHVQLQDQNDHAPS-------FTLSHYRVAVTEDLPPGSTLLTLEATDADGSRSHAAVDYSIISGNWGRVFQLEPRLAEAGESAGPGPRALGCLVLLEPLDFESLTQYN----------LTVAAADRGQPPQ-SSVVPVTVTVLDVNDNPPVFTRASYRVTVPEDTPVGAELLH--VEASDADPGPHGLVRFTVS---SGDPSGLFELDESSGTLRLAHALDCETQARHQLVVQAADPAGAHF-ALAPVTIEVQDVNDHGPAFPLNLLSTSVAENQPPGTLVTTLHAIDGDAGAFGRLRYSLLEAGPGPEGREAFALNSSTGELRARVPFDYEHTESFRLLVGAADAGNLSA 2795          

HSP 7 Score: 100.908 bits (250), Expect = 1.382e-20
Identity = 117/467 (25.05%), Postives = 198/467 (42.40%), Query Frame = 3
Query:  753 TTIEIEIEDLNDNVPKFNQLTYNANIDENKR-DDKLIKFTVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDADTHSNMIHCKLVDYNDLFYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTDSEPSR---QITTNE-------SLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPIIVTDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFT---QRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDID--------------RYTGDLRTRKPLDRETLESISIKVTAKN 2069
            T + + ++D NDN P+F +  Y A + E++  +  L++    D D G  G ++ ++            +F +      +     LD E         L+ATD+G+P+L  SA + + + + NDN P I  +     VS    +   +         +VT  D  S  +         L+Y+ SPS         PF++           +G  + +T      +  R   Q+  ++       +L + +EDVNDNAP FSQ +Y   + E+           +  TDRDSG NG   ++L      S +  F +D  +G +FT     +L ++        + A D G     + +T+ + + D ND+AP F+ SHY   V E++  G  + TL+A D D  R +  + YSI   G+    F ++              R  G L   +PLD E+L   ++ V A +
Sbjct: 2155 TVLTLTLQDANDNAPRFLRPHYVAFLPESRPLEGPLLQVEADDLDQGSGGQISYSLAASQPARG----LFHVDPTTGTITTTAILDREIWAET-RLVLMATDRGSPALVGSATLTVMVIDTNDNRPTIP-QPWELRVSEDALLGSEI--------AQVTGNDVDSGPV---------LWYVLSPSG-----PQDPFSV---------GRYGGRVSLTGPLDFEQCDRYQLQLLAHDGPHEGRANLTVLVEDVNDNAPAFSQSLYQVMLLEHTPPGSAILS--VSATDRDSGANGHISYHLA-----SPADGFSVDPNNGTLFTIVGTVALGHDGSGAVDVVLEARDHGAPGRAARATVHVQLQDQNDHAPSFTLSHYRVAVTEDLPPGSTLLTLEATDADGSRSHAAVDYSI-ISGNWGRVFQLEPRLAEAGESAGPGPRALGCLVLLEPLDFESLTQYNLTVAAAD 2576          

HSP 8 Score: 98.2117 bits (243), Expect = 7.803e-20
Identity = 108/434 (24.88%), Postives = 189/434 (43.55%), Query Frame = 3
Query:  759 IEIEIEDLNDNVPKFNQLTYNANIDENKRDDKLI-KFTVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDADTHSNMIHCKLVDYNDLFYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRI-TISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQ---IYIGXXXXXXXXXXXXFPKPIIVTDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESH------YIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLRTRKPLDR 2027
            + + ++D+NDN P F        +  N      I      DPDSG N  VT  +      L+     F +      + L+  L     P   E  L A D G+P  +S  ++++ ++++   G   +F     S +  V +  G  A + V++V+    D      H      +  F L+  S +          L     +DRE+     L++  +S + +E  +Q T   ++ + I + N+++P  S+    + +        +V   F      TDRDSG NG+  + L+      DS  F I   +G++ T ++LD E ++ ++  +   D G  P +++ T+ + VLDLNDN+P F ++           V + V  G  + TLQA D D + +N  I Y++   G  S  F +  ++G+L T  PL R
Sbjct:  880 VRVLLDDVNDNSPAFPAPEDTVLLPPNTAPGTPIYTLRALDPDSGVNSRVTFTL------LAGGGGAFTVDPTTGHVRLMRPLGPSGGP-AHELELEARDGGSPPRTSHFRLRVVVQDVGTRGLAPRFN----SPTYRVDLPSGTTAGTQVLQVQAQAPDGGPITYHLAAEGASSPFGLEPQSGW----------LWVRAALDREAQELYILKVMAVSGSKAELGQQ-TGTATVRVSILNQNEHSPRLSEDPTFLAVAENQPPGTSVGRVF-----ATDRDSGPNGRLTYSLQQLS--EDSKAFRIHPQTGEVTTLQTLDREQQSSYQLLVQVQDGGSPPRSTTGTVHVAVLDLNDNSPTFLQASGAAGGGLPIQVPDRVPPGTLVTTLQAKDPD-EGENGTILYTLTGPG--SELFSLHPHSGELLTAAPLIR 1281          

HSP 9 Score: 92.4337 bits (228), Expect = 4.885e-18
Identity = 139/609 (22.82%), Postives = 242/609 (39.74%), Query Frame = 3
Query:  387 PTDPGTFFILIKILDQNDKAPQFSSIKRPFFKIPENVEVGKVIDLPMAVDSDSEKYSVRRYSLSYIYHLDQTHDFRLHVTNDNPPRPQLIVNSKLDYEKINKYVFRLFAYDFDEKSIGNSCSTTIEIEI--EDLNDNVPKFNQLTYNANIDE-----NKRDDKLIKFTVSDPDSGRNGIVTVNIV------DKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDADTHSNMIHCKLVDYNDLFYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPII---VTDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLRTRKPLDRETLESISIKVTAKNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAPKF 2165
            P    T  + + +LD ND AP F  +     ++PE+V  G ++    A D D+         ++Y         F L      P   +L   + LD E+   Y F + A D    +     STT+ + I   D+ND+ P F        +       +     L      D D+G N  +   +          D  +   ++    R+   L          D  LF   ++ATD G P+ S++  + + L+   + GP+          S+  +I E  P  + +V  R   A   +  I   ++  N+         F+   +     +++   +D E +    LR+ +   +S  +   T    L + ++D NDNAP F +  Y+  + E++         P++     D D G  G+  + L   +       F +D  +G I T   LD E   + R  ++A D+G   L  S+T+T+ V+D NDN P   +  +   V E+  +G +I  +   D D+      ++Y + P G     F + RY G +    PLD E  +   +++ A +      H     +   ++ + V DVNDNAP F
Sbjct: 1833 PALSATLLLTVTVLDANDHAPAFP-VPAYSVEVPEDVPAGTLLLQLQAHDPDAGANG----HVTYYLGAGTAGAFLLE-----PSSGELRTAAALDREQCPSYTFSVSAVD---GAAAGPLSTTVSVTITVRDVNDHAPTFPTSPLRLRLPRPGPSFSTPTLALATLRAEDRDAGANASILYRLAGTPPPGTTVDSYTGEIRV---ARSPVALG-------PRDRVLF---IVATDLGRPARSATGVIIVGLQGEAERGPRFP------RASSEATIRENAPPGTPIVSPRAVHAGGTNGPITYSILSGNE------KGTFSIQPSTGAITVRSAEGLDFEVS--PRLRLVLQ-AESGGAFAFTV---LTLTLQDANDNAPRFLRPHYVAFLPESRP-----LEGPLLQVEADDLDQGSGGQISYSLAASQ--PARGLFHVDPTTGTITTTAILDREIWAETRLVLMATDRGSPALVGSATLTVMVIDTNDNRPTIPQP-WELRVSEDALLGSEIAQVTGNDVDS---GPVLWYVLSPSGPQDP-FSVGRYGGRVSLTGPLDFEQCDRYQLQLLAHD----GPH-----EGRANLTVLVEDVNDNAPAF 2376          

HSP 10 Score: 88.9669 bits (219), Expect = 5.890e-17
Identity = 171/708 (24.15%), Postives = 265/708 (37.43%), Query Frame = 3
Query:  399 GTFFILIKILDQNDKAPQFSSIKRPFFKIPENVEVGKVIDLPMAVDSDSEKYSVRRYSLSYIYHLDQTHDFRLHVTNDNPPRPQLIVNSKLDYEKINKYVFRLFAYDFDEKSIGNSCSTTIEIEIEDLNDNVPKFNQLTYNAN-------IDENKRDDKLIKFTVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHL---KNLNDNGPKIKFKKLG--FSVSNSVSIIEGLPAHSLVVEVRVTDADTHSNMIHCKL--VDYNDLFYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPIIVTDRDS-----GLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITIN---VLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLRTRKPLDRETLESISIKVTAKNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAPKFIPRLNMKQKVEFIV---EQFVDGNTCTELPYTVQDIDDGGINGQNCCYTILENDYNKLFSLMTDTPSYICLQR-KPEKYQSYTVTLIARDR--PPNV 2438
            GT  + + IL+QN+ +P+ S     F  + EN   G  +    A D DS       YSL  +   + +  FR+H     P   ++     LD E+ + Y  +L     D  S   S + T+ + + DLNDN P F Q +  A         D       +      DPD G NG +   +     EL      F +  +   L     L     PH +  TL A DQG+P  S+S Q+ + +     L +  P +  +       V  +V+  EGL   SL+  V   +      + +  +   D    F LD+ S    L   +P + +           G   R  ++     P         + +Q++D N++AP F++                  P   + T R S     G N    + L   R         +D  +G +   R LD ET       + A D+        +        V D NDNAP F+    +  + E+   G     + A D D     + + Y +   GD   +F +   TG L   +PLDRE      + V A      S H      +   + + V DVND AP F       Q+ E+ V   E    G +   L  T  D+   G NGQ   Y  + ++    FSL  DT     L+    E+ +   +T+ A+DR  PP +
Sbjct: 1087 GTATVRVSILNQNEHSPRLSE-DPTFLAVAENQPPGTSVGRVFATDRDSGPNGRLTYSLQQLS--EDSKAFRIH-----PQTGEVTTLQTLDREQQSSY--QLLVQVQDGGSPPRSTTGTVHVAVLDLNDNSPTFLQASGAAGGGLPIQVPDRVPPGTLVTTLQAKDPDEGENGTILYTLTGPGSEL------FSLHPHSGELLTAAPLIRAERPH-YVLTLSAHDQGSPPRSASLQLLVQVLPSARLAEPPPDLAERDPAAPVPVVLTVTAAEGLRPGSLLGSVAAPEPAGVGALTYTLVGGADPEGTFALDAAS--GRLYLARPLDFEA----------GPPWR-ALTVRAEGPGGAGARLLRVQVQVQDENEHAPAFARD------PLALALPENPEPGAALYTFRASDADGPGPNSDVRYRL--LRQEPPVPALRLDARTGALSAPRGLDRETTPALLLLVEATDRPANASRRRAARVSARVFVTDENDNAPVFASPSRV-RLPEDQPPGPAALHVVARDPDLGEAAR-VSYRLASGGD--GHFRLHSSTGALSVVRPLDREQRAEHVLTVVA------SDHGSPPRSATQVLTVSVADVNDEAPTF-------QQQEYSVLLRENNPPGTSLLTLRATDPDV---GANGQ-VTYGGVSSES---FSLDPDTGVLTTLRALDREEQEEINLTVYAQDRGSPPQL 1732          

HSP 11 Score: 80.4925 bits (197), Expect = 1.938e-14
Identity = 150/604 (24.83%), Postives = 244/604 (40.40%), Query Frame = 3
Query:  411 ILIKILDQNDKAPQFSSIKRPFFK--IPENVEVGKVIDLPMAVDSDSEKYSVRRYSLSYIYHLDQTHDFRLHVTNDNPPRPQLIVNSKLDYEKINKYVFRLFAYDFDEKSIGNSCSTTIEIEIEDLNDNVPKFNQLTYNANIDENKR-DDKLIKFTVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVS-NSVSIIEGLPAHSLVVEVRVTDADTHSN-MIHCKLVDYNDLFYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTD-SEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPIIVTDRD-------------SGLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLRTRKPLDRETLESISIKVTAKNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAPKF 2165
            + + + D ND AP+F    RP +   +PE+  +   +    A D D        YSL+      Q      HV   +P    +   + LD E   +    L A D    ++  S   T+ + + D NDN P   Q  +   + E+     ++ + T +D DSG      ++     D        F + R    + L   LD+E     ++  LLA D         A + + ++++NDN P        FS S   V ++E  P  S ++ V  TD D+ +N  I   L    D F +D  +   TL          +  +    +    + + +   D   P R      ++++Q++D ND+AP F+   Y   V E+           +  TD D             SG  G+  F LE     +  S     +  G +     LD+E+  ++   + A D+G  P +S   +T+ VLD+NDN P F+ + Y   V E+  VG ++  ++A   D D     +       GD S  F++D  +G LR    LD ET     + V A +P    +HF     +   V I+V DVND+ P F
Sbjct: 2157 LTLTLQDANDNAPRFL---RPHYVAFLPESRPLEGPLLQVEADDLDQGSGGQISYSLA----ASQPARGLFHV---DPTTGTITTTAILDREIWAETRLVLMATDRGSPALVGS--ATLTVMVIDTNDNRPTIPQ-PWELRVSEDALLGSEIAQVTGNDVDSGPVLWYVLSPSGPQDP-------FSVGRYGGRVSLTGPLDFEQCDR-YQLQLLAHDG---PHEGRANLTVLVEDVNDNAP-------AFSQSLYQVMLLEHTPPGSAILSVSATDRDSGANGHISYHLASPADGFSVDPNN--GTLFT-------IVGTVALGHDGSGAVDVVLEARDHGAPGR--AARATVHVQLQDQNDHAPSFTLSHYRVAVTEDLPPGSTLLT--LEATDADGSRSHAAVDYSIISGNWGRV-FQLEPRLAEAGESAGPGPRALGCLVLLEPLDFESLTQYNLTVAAADRGQPPQSSVVPVTVTVLDVNDNPPVFTRASYRVTVPEDTPVGAELLHVEA--SDADPGPHGLVRFTVSSGDPSGLFELDESSGTLRLAHALDCETQARHQLVVQAADPA--GAHF-----ALAPVTIEVQDVNDHGPAF 2706          

HSP 12 Score: 79.337 bits (194), Expect = 4.779e-14
Identity = 109/480 (22.71%), Postives = 198/480 (41.25%), Query Frame = 3
Query:  750 STTIEIEIEDLNDNVPKFNQLTYNANIDENKRDDKLIKFTVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDADT--HSNMIHCKLVDYNDLFYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDN--APMFSQQIYIGXXXXXXXXXXXXFPKPIIVTDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPL---TSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLRTRKPLDRETLESISIKVTAKNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAPKFI 2168
            S  ++I I       P F QL Y  ++ E+      +    +    GR   VT+++            +F +      L+ +  LD E    + E  + A   G P   + A+V++ L ++NDN P   F     +V    +   G P ++L    R  D D+  +S +    L      F +D  +    L+     +    ++++ E+  G             P R  T++  L + ++DV     AP F+   Y        +         ++     +   G   ++L        SS F ++  SG ++ + +LD E +  +  K++A+      L   T ++T+ +++L+ N+++PR SE      V EN   G  +G + A D D+   N  + YS++   + S  F I   TG++ T + LDRE   S  + V  ++         R+T   V V   V+D+NDN+P F+
Sbjct:  773 SARVDISIVPGTPTPPIFEQLQYVFSVPEDVAPGTSVGIVQAHNPPGRLAPVTLSLSGGDPR-----GLFSLDAVSGLLQTLRPLDRELLGPVLELEVRA-GSGVPPAFAVARVRVLLDDVNDNSPA--FPAPEDTVLLPPNTAPGTPIYTL----RALDPDSGVNSRVTFTLLAGGGGAFTVDPTTGHVRLMRPLGPSGGPAHELELEARDGG-----------SPPR--TSHFRLRVVVQDVGTRGLAPRFNSPTY-----RVDLPSGTTAGTQVLQVQAQAPDGGPITYHLA---AEGASSPFGLEPQSGWLWVRAALDREAQELYILKVMAVSGSKAELGQQTGTATVRVSILNQNEHSPRLSEDPTFLAVAENQPPGTSVGRVFATDRDSG-PNGRLTYSLQQLSEDSKAFRIHPQTGEVTTLQTLDREQQSSYQLLVQVQDGGSPP----RSTTGTVHV--AVLDLNDNSPTFL 1212          

HSP 13 Score: 66.2402 bits (160), Expect = 4.379e-10
Identity = 121/553 (21.88%), Postives = 222/553 (40.14%), Query Frame = 3
Query:  705 LFAYDFDEKSIGNSCSTTIEIEIEDLNDNVPKFNQLTYNANIDENKRDDKLIKFTVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINS--LDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSII-EGLPAHSLVVEVRVTDADTHSNMIHCKLVDYNDLFYLDSPSKFNTLLNYKPFNLKTINK--IDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPIIVTDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLRT---RKPLDRETLESISIKVTAKNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAPKFIPRLNMKQKVEFIVEQFVDGNTCTELPYTVQDIDDGGINGQNCCYTILENDYNKLFSL 2339
            LF    D      S +  I + ++   +  P+F + +  A I EN      I    +    G NG +T +I+   ++ +     F IQ +   + + ++  LD+E  P L    L A   G  + +    + + L++ NDN P+       F   + V+ + E  P    +++V   D D  S       + Y+    L +      L +  P          +DRE    +  R+ +  TD   S  +  + +L + + D NDN P   Q   +   ++  +   +     +   D DSG      +Y+       D   F + +  G++     LD+E  ++++ +++A D    P    + +T+ V D+NDNAP FS+S Y   + E+   G  I ++ A D D+   N  I Y +    D    F +D   G L T      L  +   ++ + + A++      H      +   V +++ D ND+AP F     +      + E    G+T   L  T     DG  +     Y+I+  ++ ++F L
Sbjct: 2036 LFIVATDLGRPARSATGVIIVGLQGEAERGPRFPRASSEATIRENAPPGTPIVSPRAVHAGGTNGPITYSILSGNEKGT-----FSIQPSTGAITVRSAEGLDFEVSPRL-RLVLQAESGGAFAFTV---LTLTLQDANDNAPR-------FLRPHYVAFLPESRPLEGPLLQVEADDLDQGSG----GQISYS----LAASQPARGLFHVDPTTGTITTTAILDREI--WAETRLVLMATD-RGSPALVGSATLTVMVIDTNDNRPTIPQPWELRVSEDALLGSEI---AQVTGNDVDSG---PVLWYVLSPSGPQDP--FSVGRYGGRVSLTGPLDFEQCDRYQLQLLAHDG---PHEGRANLTVLVEDVNDNAPAFSQSLYQVMLLEHTPPGSAILSVSATDRDSG-ANGHISYHLASPADG---FSVDPNNGTLFTIVGTVALGHDGSGAVDVVLEARD------HGAPGRAARATVHVQLQDQNDHAPSF----TLSHYRVAVTEDLPPGSTLLTLEATDA---DGSRSHAAVDYSIISGNWGRVFQL 2533          
BLAST of Protocadherin Fat 1 vs. Ensembl Human
Match: PCDH11Y (protocadherin 11 Y-linked [Source:HGNC Symbol;Acc:HGNC:15813])

HSP 1 Score: 183.341 bits (464), Expect = 4.406e-46
Identity = 186/672 (27.68%), Postives = 310/672 (46.13%), Query Frame = 3
Query:  396 PGTFFILIKIL----DQNDKAPQFSSIKRPFFKIPENVEVGKVIDLPMAVDSDSEKYSVRRYSLSYIYHLDQTHDFRLHV--TNDNPPRPQLIVNSKLDYEKINKYVFRLFAYD--FDEKSIGNSCSTTIEIEIEDLNDNVPKFNQLTYNANIDENKR-DDKLIKFTVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDADT-HSNMIHCKLVDYNDLFYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPIIVTDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLRTRKPLDRETLESISIKVTAKNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAPKFI-PRLNMKQKVEFIVEQFVDGNTCTELPYTVQDID-DGGINGQNCCYTILENDYNKLFSLMTDTPSYICLQR 2375
            P   F L+KI     D ND AP F +       IPEN  +     LP AVD D     V+ Y L     +   + F L V  T +    PQLIV  +LD E+ + YV ++   D  F ++S     +  +++ + D NDN P F +     +I EN      + +   +D D G N  +  +  +    +++R  +F +      + +   LD E  P+  +  +LA+D G   + + A V +++ ++NDN P I  + +   V+++V + E +P ++ +  + VTD D  H+  + C   D+   F L  P   N  L      L+    +D ES     +++  +     P  Q   +  L I+++D NDNAP+F+Q  ++        +  +   K +  TD DSG N +  + L          +F +D+ +G +   + LD E ++K+ F I+A D G  PLTS+ T+ ++++D NDN+P F+ + Y F V EN+     +G +   D D    N  +  SI  + D    F ID  TG +R     DRE  ES +  V A++  + S        S   V I V+DVNDN P FI P  N     E ++     G       + V  +D D G+N +   Y+I+  +   LF++  +T +   +++
Sbjct:  148 PDEIFRLVKIRFLIEDINDNAPLFPATVI-NISIPENSAINSKYTLPAAVDPDVGINGVQNYEL-----IKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRS----STAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARR--LFHLNATTGLITIKEPLDREETPN-HKLLVLASDGGL--MPARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTC-FTDHEIPFRL-RPVFSNQFL------LENAAYLDYESTKEYAIKLLAADAGKPPLNQ---SAMLFIKVKDENDNAPVFTQS-FVTVSIPENNSPGIQLMK-VSATDADSGPNAEINYLL----GPDAPPEFSLDRRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYKFYVPENLPRHGTVGLITVTDPDYG-DNSAVTLSILDENDD---FTIDSQTGVIRPNISFDREKQESYTFYVKAEDGGRVSR------SSSAKVTINVVDVNDNKPVFIVPPYNY--SYELVLPSTNPGTVV----FQVIAVDNDTGMNAE-VRYSIVGGNTRDLFAIDQETGNITLMEK 770          
BLAST of Protocadherin Fat 1 vs. Ensembl Human
Match: PCDH11X (protocadherin 11 X-linked [Source:HGNC Symbol;Acc:HGNC:8656])

HSP 1 Score: 182.57 bits (462), Expect = 6.250e-46
Identity = 187/673 (27.79%), Postives = 308/673 (45.77%), Query Frame = 3
Query:  396 PGTFFILIKIL----DQNDKAPQFSSIKRPFFKIPENVEVGKVIDLPMAVDSDSEKYSVRRYSL---SYIYHLDQTHDFRLHVTNDNPPRPQLIVNSKLDYEKINKYVFRLFAYD--FDEKSIGNSCSTTIEIEIEDLNDNVPKFNQLTYNANIDENKR-DDKLIKFTVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDADT-HSNMIHCKLVDYNDLFYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPIIVTDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLRTRKPLDRETLESISIKVTAKNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAPKFI-PRLNMKQKVEFIVEQFVDGNTCTELPYTVQDID-DGGINGQNCCYTILENDYNKLFSLMTDTPSYICLQR 2375
            P   F L+KI     D ND AP F +       IPEN  +     LP AVD D     V+ Y L     I+ LD         T +    PQLIV  +LD E+ + YV ++   D  F ++S     +  +++ + D NDN P F +     +I EN      + +   +D D G N  +  +  +    +++R  +F +      + +   LD E  P+  +  +LA+D G   + + A V +++ ++NDN P I  + +   V+++V + E +P ++ +  + VTD D  H+  + C   D+   F L  P   N  L      L+T   +D ES     +++  +     P  Q   +  L I+++D NDNAP+F+Q  ++        +  +   K +   D DSG N K  + L          +F +D  +G +   + LD E ++K+ F I+A D G  PLTS+ T+ ++++D NDN+P F+ + Y F V EN+     +G +   D D    N  +  SI  + D    F ID  TG +R     DRE  ES +  V A++  + S        S   V I V+DVNDN P FI P  N     E ++     G       + V  +D D G+N +   Y+I+  +   LF++  +T +   +++
Sbjct:  116 PDEIFRLVKIRFLIEDINDNAPLFPATVI-NISIPENSAINSKYTLPAAVDPDVGINGVQNYELIKSQNIFGLDVIE------TPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRS----STAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARR--LFHLNATTGLITIKEPLDREETPN-HKLLVLASDGGL--MPARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTC-FTDHEIPFRL-RPVFSNQFL------LETAAYLDYESTKEYAIKLLAADAGKPPLNQ---SAMLFIKVKDENDNAPVFTQS-FVTVSIPENNSPGIQLTK-VSAMDADSGPNAKINYLL----GPDAPPEFSLDCRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYNFYVPENLPRHGTVGLITVTDPDYG-DNSAVTLSILDENDD---FTIDSQTGVIRPNISFDREKQESYTFYVKAEDGGRVSR------SSSAKVTINVVDVNDNKPVFIVPPSNC--SYELVLPSTNPGTVV----FQVIAVDNDTGMNAE-VRYSIVGGNTRDLFAIDQETGNITLMEK 738          
BLAST of Protocadherin Fat 1 vs. Ensembl Celegans
Match: fmi-1 (FlaMIngo (Cadherin plus 7TM domain) homolog [Source:UniProtKB/TrEMBL;Acc:A0A0K3AUS4])

HSP 1 Score: 141.354 bits (355), Expect = 1.791e-33
Identity = 167/625 (26.72%), Postives = 268/625 (42.88%), Query Frame = 3
Query:  387 PTDPGTFFILIKILDQNDKAPQFSSIKRPFFKIPENVEVGKVIDLPMAVDSDSEKYSVRRYSLSYIYHLDQTHDFRLHVTNDNPPRPQLIVNSKL-DYEKINKYVFRLFAYDFDEKSIGNSCSTTIEIEIEDLNDNVPKFNQLTYNANIDENK-RDDKLIKFTVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDADTHSNMIHCKLVDYNDLFYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPIIVTDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDID---RYTGDLR--TRKPLDRETLESISIKVTAKNPNKYSSHFVRNT---DSEVDVMIKVMDVNDNAPK---FIPRLN------MKQKVEFI 2204
            P    T  + I ++D ND AP   + ++    + ENV +G+ +    A+D DS    + +YS+      + + DF +   +       LI  +KL D E   +Y  ++ A D    S+  S  TTI + ++D+NDN P F++  YN  I E   R  ++I     D D  +   +T  I +   E+   F I +I      L +   L  +   H     + ATDQG   L     V + + ++N + P   F    FSV     I E  P    V+ ++  D D   N      +D +  F +D  S           ++   + +DRE +  +F  I  +   + P   + T+  + + ++D+NDN+P F+   Y   + E+            I  D D G NG  +++L +  +      F +D+ SG +     LD E        I A D+G   L+++S IT+ + D+NDNAP F +  Y   + EN  VG  +GT+ A D D +  N DI + I    D +  FDI+      G +R  TR   D E              NK+      ++    S V V I V DVNDN P    F+  +N      M +++ FI
Sbjct:  457 PALSSTVPLTINVIDINDHAPTLIAAQK-MITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSM------EGSEDFIIDEDSG------LIKTTKLLDRETTARYSLKVTARDMGTPSLNTS--TTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDNDEDQK--ITYRIEEADREV---FSILDIGDQGAILSVSGELKRQD--HKVRVEISATDQG--GLQGRCVVNVFIDDVN-SAPY--FNDHPFSVK----IPEHSPIGYPVITLKAEDHDRGDNARIVYSIDSSQFFRIDPSSG----------DISVSSDLDRE-DRATFSVIVTASDHASPP--LNTSTQIEVILDDINDNSPQFTSSSYAATISEDIPVGTSFLQVSAI--DADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTPSLSAASEITLTLSDVNDNAPTFEQLSYDLYIAENSPVGSTVGTIVARDAD-EGDNADISFRIFGGAD-AKLFDIEEDAEQNGVVRILTRAEFDYEA-----------KANKFFFELQASSGQLSSTVPVRIHVSDVNDNKPALKDFVILMNRFDNVQMARQIGFI 1022          

HSP 2 Score: 139.813 bits (351), Expect = 6.285e-33
Identity = 138/489 (28.22%), Postives = 235/489 (48.06%), Query Frame = 3
Query:  669 LDYEKINKYVFRLFAYDFDEKSIGNSCSTTIEIEIEDLNDNVPKFNQLTYNANIDENKRDDKLIKFTV-----SDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDADTHSN-MIHCKLVDYNDLFYLDSPSKFNTL-LNYKPFNLKTINKIDRESNHGSFLRITISCTD-SEPSRQITTNESLNIQIEDVNDNAP-MFSQQIYIGXXXXXXXXXXXXFPKPIIVTDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHS--SYFDIDRYTGDLRTRKPLDRETLESISIKVTAKNPNKYSSHFVRN 2102
            +D E ++K++ ++ AY+  + +I  S STT+ + + D+ DN P F + +Y   I    R+D  I  TV      D DSG NG +  ++ +   +      +  I      ++    LD ET   L    ++A+D+GTP   S+A V+I + ++NDN P         S S +V+I+E +   +++  V+ TD D  +N  +H         + + S S    L ++Y    +    +ID ++   S +   I   D ++P+  +++   L I + D+ND+AP + + Q  I   +   +   V     +   D DSG NG  ++ +E       S DF+ID+ SG I T + LD ET  ++  K+ A D G   L +S+TI + + D+NDNAP F +  Y   + E +  G +I TL+A+D+D D+K   I Y IE + D    S  DI      L     L R+    + ++++A +        V N
Sbjct:  228 MDREVLDKHILKVTAYERVDPTI--SASTTVVVHVLDVQDNSPIFEKDSYFGEI----REDAPIGTTVLSVFARDLDSGENGEIEYSLGEGNGK-----NLLAINAKSGVIQTAAPLDRET-LSLIRLDVIASDKGTPKRESTAMVEITVVDVNDNAPVFA------SDSYNVTILENITIPAVIATVKATDEDFGTNGKVH---------YSMASSSGIGGLTIDYSTGEVTLRERIDAKN---SPITAVIRAKDGAQPA--LSSTVPLTINVIDINDHAPTLIAAQKMITLEENVAIGEEV---GRVYAIDEDSGPNGIIKYSMEG------SEDFIIDEDSGLIKTTKLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDNDEDQK---ITYRIE-EADREVFSILDIGDQGAILSVSGELKRQD-HKVRVEISATDQGGLQGRCVVN 670          

HSP 3 Score: 103.99 bits (258), Expect = 5.796e-22
Identity = 143/557 (25.67%), Postives = 239/557 (42.91%), Query Frame = 3
Query:  384 TPTDPGTFFILIKILDQNDKAPQFSSIKRPFFKIPENVEVGKVIDLPMAVDSDSEKYSVRRYSLSYIYHLDQTHDFRLHVTNDNPPRPQLIVNSKLDYEKINKYVFRLFAYDFDEKSIGNSCSTTIEIEIEDLNDNVPKFNQLTYNANIDENKRDD-KLIKFTVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDADTHSNMIHCKLVDYNDLFYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTD-SEPSRQITTNESLNIQIEDVNDNAPMFSQ---QIYIGXXXXXXXXXXXXFPKPIIVTDRDSGLNGKFEFYL---EDFRNFSDSSDFLIDKISGKIFTQRSLDYETK-NKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLRTRKPLDR 2027
            TP+   +  I + + D ND AP F   K     I E +  G  I    AVD+D ++           Y +++       + +       L V+ +L   K   +  R+     D+  +   C   + + I+D+N + P FN   ++  I E+      +I     D D G N  +  +I D +       + F I  +   + + + LD E D   F   + A+D  +P L++S Q+++ L ++NDN P+        S S + +I E +P  +  ++V   DAD   N I    VDY       SPS     L+     L+  +K+DRE    + + + I   D   PS  ++    + + + DVNDNAP F Q    +YI         V       I+  D D G N    F +    D + F    D   + +  +I T+   DYE K NKF F++ A       L+S+  + I+V D+NDN P   +   + N F+NV +  +IG + A D D   +N  + Y +E     +   + ++YTG +  ++   R
Sbjct:  558 TPSLNTSTTIAVVLKDINDNAPTFDK-KEYNVTISEEMPRGSQIITLKAVDNDEDQ--------KITYRIEEADREVFSILDIGDQGAILSVSGEL---KRQDHKVRVEISATDQGGLQGRC--VVNVFIDDVN-SAPYFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSI-DSS-------QFFRIDPSSGDISVSSDLDRE-DRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFT------SSSYAATISEDIPVGTSFLQVSAIDADIGPNGI----VDYFLNESSSSPSIQLFRLDRTSGTLRVSSKLDRE--QFAVIVLPIFARDRGTPS--LSAASEITLTLSDVNDNAPTFEQLSYDLYIAENSPVGSTVGT-----IVARDADEGDNADISFRIFGGADAKLFDIEEDAEQNGVV-RILTRAEFDYEAKANKFFFELQA---SSGQLSSTVPVRIHVSDVNDNKPALKDFVILMNRFDNVQMARQIGFIPAFDPD---QNATLEYFLE----ENDLIEAEKYTGKILVKQEWKR 1060          

HSP 4 Score: 100.908 bits (250), Expect = 4.261e-21
Identity = 91/338 (26.92%), Postives = 160/338 (47.34%), Query Frame = 3
Query: 1182 EGLPAHSLVVEVRVTDADT---HSNMIHCKLVDYNDLFYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPIIVTDRDSGLNGKFEFYLEDFRNFSDSSDFL-IDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLRTRKPLDRETLESISIKVTAKNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAPKFIPRLNM 2183
            E  P  +++  V+ + A +   + +M+  +     +LF LD+ S            ++    +DRE      L++T +    +P+  I+ + ++ + + DV DN+P+F +  Y G + E+           +   D DSG NG+ E+ L +     +  + L I+  SG I T   LD ET +  R  +IA DKG     S++ + I V+D+NDNAP F+   Y   + EN+++   I T++A D+D     K + YS+           ID  TG++  R+ +D +    I+  + AK+  + +        S V + I V+D+ND+AP  I    M
Sbjct:  176 EDTPIETIIASVKASHASSQPLYYSMVAPQDSRSQNLFTLDTMSG----------EIRLAKSMDREVLDKHILKVT-AYERVDPT--ISASTTVVVHVLDVQDNSPIFEKDSYFGEIREDAPIGTTVLS--VFARDLDSGENGEIEYSLGE----GNGKNLLAINAKSGVIQTAAPLDRETLSLIRLDVIASDKGTPKRESTAMVEITVVDVNDNAPVFASDSYNVTILENITIPAVIATVKATDEDFGTNGK-VHYSMASSSGIGG-LTIDYSTGEVTLRERIDAKN-SPITAVIRAKDGAQPA------LSSTVPLTINVIDINDHAPTLIAAQKM 485          
BLAST of Protocadherin Fat 1 vs. Ensembl Celegans
Match: fmi-1 (FlaMIngo (Cadherin plus 7TM domain) homolog [Source:UniProtKB/TrEMBL;Acc:A0A0K3AUS4])

HSP 1 Score: 141.354 bits (355), Expect = 2.032e-33
Identity = 167/625 (26.72%), Postives = 268/625 (42.88%), Query Frame = 3
Query:  387 PTDPGTFFILIKILDQNDKAPQFSSIKRPFFKIPENVEVGKVIDLPMAVDSDSEKYSVRRYSLSYIYHLDQTHDFRLHVTNDNPPRPQLIVNSKL-DYEKINKYVFRLFAYDFDEKSIGNSCSTTIEIEIEDLNDNVPKFNQLTYNANIDENK-RDDKLIKFTVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDADTHSNMIHCKLVDYNDLFYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPIIVTDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDID---RYTGDLR--TRKPLDRETLESISIKVTAKNPNKYSSHFVRNT---DSEVDVMIKVMDVNDNAPK---FIPRLN------MKQKVEFI 2204
            P    T  + I ++D ND AP   + ++    + ENV +G+ +    A+D DS    + +YS+      + + DF +   +       LI  +KL D E   +Y  ++ A D    S+  S  TTI + ++D+NDN P F++  YN  I E   R  ++I     D D  +   +T  I +   E+   F I +I      L +   L  +   H     + ATDQG   L     V + + ++N + P   F    FSV     I E  P    V+ ++  D D   N      +D +  F +D  S           ++   + +DRE +  +F  I  +   + P   + T+  + + ++D+NDN+P F+   Y   + E+            I  D D G NG  +++L +  +      F +D+ SG +     LD E        I A D+G   L+++S IT+ + D+NDNAP F +  Y   + EN  VG  +GT+ A D D +  N DI + I    D +  FDI+      G +R  TR   D E              NK+      ++    S V V I V DVNDN P    F+  +N      M +++ FI
Sbjct:   98 PALSSTVPLTINVIDINDHAPTLIAAQK-MITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSM------EGSEDFIIDEDSG------LIKTTKLLDRETTARYSLKVTARDMGTPSLNTS--TTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDNDEDQK--ITYRIEEADREV---FSILDIGDQGAILSVSGELKRQD--HKVRVEISATDQG--GLQGRCVVNVFIDDVN-SAPY--FNDHPFSVK----IPEHSPIGYPVITLKAEDHDRGDNARIVYSIDSSQFFRIDPSSG----------DISVSSDLDRE-DRATFSVIVTASDHASPP--LNTSTQIEVILDDINDNSPQFTSSSYAATISEDIPVGTSFLQVSAI--DADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTPSLSAASEITLTLSDVNDNAPTFEQLSYDLYIAENSPVGSTVGTIVARDAD-EGDNADISFRIFGGAD-AKLFDIEEDAEQNGVVRILTRAEFDYEA-----------KANKFFFELQASSGQLSSTVPVRIHVSDVNDNKPALKDFVILMNRFDNVQMARQIGFI 663          

HSP 2 Score: 105.916 bits (263), Expect = 1.423e-22
Identity = 124/471 (26.33%), Postives = 217/471 (46.07%), Query Frame = 3
Query:  759 IEIEIEDLNDNVPKFNQLTYNANIDENKRDDKLIK-FTVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDADTHSNMIHCKLVDYNDLFYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPIIVTDRDSGLNGKFEFYLEDFRNFSDSSD-FLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLRTRKPLDRETLESISIKVTAKNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAPKF 2165
            +EI + D+NDN P F   +YN  I EN     +I     +D D G NG V  ++       S       I  +   + L   +D +  P      + A D   P+LSS+  + I++ ++ND+ P +   +   ++  +V+I E       V  V   D D+  N I    ++ ++ F +D  S            +KT   +DRE+     L++T     + PS  + T+ ++ + ++D+NDNAP F ++ Y   + E             +  D D  +  + E    +  +  D  D   I  +SG++  Q        +K R +I A D+G   L     + + + D+N +AP F++  +   + E+  +G+ + TL+A D D    N  I YSI    D S +F ID  +GD+     LDRE   + S+ VTA +   ++S  + NT ++++V++   D+NDN+P+F
Sbjct:    2 VEITVVDVNDNAPVFASDSYNVTILENITIPAVIATVKATDEDFGTNGKVHYSMAS-----SSGIGGLTIDYSTGEVTLRERIDAKNSP--ITAVIRAKDGAQPALSSTVPLTINVIDINDHAPTLIAAQKMITLEENVAIGEE------VGRVYAIDEDSGPNGIIKYSMEGSEDFIIDEDSGL----------IKTTKLLDRETTARYSLKVTARDMGT-PS--LNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDNDEDQKITYRIEEADREVFSILDIGDQGAILSVSGELKRQ-------DHKVRVEISATDQG--GLQGRCVVNVFIDDVN-SAPYFNDHPFSVKIPEHSPIGYPVITLKAEDHDRG-DNARIVYSI----DSSQFFRIDPSSGDISVSSDLDREDRATFSVIVTASD---HASPPL-NTSTQIEVILD--DINDNSPQF 425          

HSP 3 Score: 103.605 bits (257), Expect = 6.980e-22
Identity = 143/557 (25.67%), Postives = 239/557 (42.91%), Query Frame = 3
Query:  384 TPTDPGTFFILIKILDQNDKAPQFSSIKRPFFKIPENVEVGKVIDLPMAVDSDSEKYSVRRYSLSYIYHLDQTHDFRLHVTNDNPPRPQLIVNSKLDYEKINKYVFRLFAYDFDEKSIGNSCSTTIEIEIEDLNDNVPKFNQLTYNANIDENKRDD-KLIKFTVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDADTHSNMIHCKLVDYNDLFYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTD-SEPSRQITTNESLNIQIEDVNDNAPMFSQ---QIYIGXXXXXXXXXXXXFPKPIIVTDRDSGLNGKFEFYL---EDFRNFSDSSDFLIDKISGKIFTQRSLDYETK-NKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLRTRKPLDR 2027
            TP+   +  I + + D ND AP F   K     I E +  G  I    AVD+D ++           Y +++       + +       L V+ +L   K   +  R+     D+  +   C   + + I+D+N + P FN   ++  I E+      +I     D D G N  +  +I D +       + F I  +   + + + LD E D   F   + A+D  +P L++S Q+++ L ++NDN P+        S S + +I E +P  +  ++V   DAD   N I    VDY       SPS     L+     L+  +K+DRE    + + + I   D   PS  ++    + + + DVNDNAP F Q    +YI         V       I+  D D G N    F +    D + F    D   + +  +I T+   DYE K NKF F++ A       L+S+  + I+V D+NDN P   +   + N F+NV +  +IG + A D D   +N  + Y +E     +   + ++YTG +  ++   R
Sbjct:  199 TPSLNTSTTIAVVLKDINDNAPTFDK-KEYNVTISEEMPRGSQIITLKAVDNDEDQ--------KITYRIEEADREVFSILDIGDQGAILSVSGEL---KRQDHKVRVEISATDQGGLQGRC--VVNVFIDDVN-SAPYFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSI-DSS-------QFFRIDPSSGDISVSSDLDRE-DRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFT------SSSYAATISEDIPVGTSFLQVSAIDADIGPNGI----VDYFLNESSSSPSIQLFRLDRTSGTLRVSSKLDRE--QFAVIVLPIFARDRGTPS--LSAASEITLTLSDVNDNAPTFEQLSYDLYIAENSPVGSTVGT-----IVARDADEGDNADISFRIFGGADAKLFDIEEDAEQNGVV-RILTRAEFDYEAKANKFFFELQA---SSGQLSSTVPVRIHVSDVNDNKPALKDFVILMNRFDNVQMARQIGFIPAFDPD---QNATLEYFLE----ENDLIEAEKYTGKILVKQEWKR 701          

HSP 4 Score: 56.9954 bits (136), Expect = 1.132e-7
Identity = 40/134 (29.85%), Postives = 67/134 (50.00%), Query Frame = 3
Query: 1782 ITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLRTRKPLDRETLESISIKVTAKNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAPKFIPRLNM 2183
            + I V+D+NDNAP F+   Y   + EN+++   I T++A D+D     K + YS+           ID  TG++  R+ +D +    I+  + AK+  + +        S V + I V+D+ND+AP  I    M
Sbjct:    2 VEITVVDVNDNAPVFASDSYNVTILENITIPAVIATVKATDEDFGTNGK-VHYSMASSSGIGG-LTIDYSTGEVTLRERIDAKN-SPITAVIRAKDGAQPA------LSSTVPLTINVIDINDHAPTLIAAQKM 126          
BLAST of Protocadherin Fat 1 vs. Ensembl Celegans
Match: cdh-1 (CaDHerin family [Source:UniProtKB/TrEMBL;Acc:Q5F4W0])

HSP 1 Score: 136.346 bits (342), Expect = 6.381e-32
Identity = 157/596 (26.34%), Postives = 264/596 (44.30%), Query Frame = 3
Query:  402 TFFILIKILDQNDKAPQFSSIKRPFFKIPENVEVGKVIDLPMAVDSDSEKYSVRRYSLSYIYHLDQTHDFRLHVTNDNPP-RPQLIVNSKLDYEKINKYVFRLFAYDFDEKS-IGN-SCSTTIEIEIEDLNDNVPKFNQLTYNANIDEN-KRDDKLIKFTVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDADTHSNMIHCKLVDYNDLFYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMF-SQQIYIGXXXXXXXXXXXXFPKPIIVTDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKN-KDIFYSIEPKGDHSSYFDIDRYTGDLRTRKPLDRETLESISIKVTAKNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAPKFIP 2171
            T  IL+++ D+ND AP F+  +    +I E  ++G    LP   D D  K+ V R+    I   +  + F+L     N   +  L+VN +LD E  +KY   + A D  + + IG   CS    IEI D NDN P F++  Y A++  N      LI    +D D G N  ++ +I  KT   S     F I ++       + L   T     +  ++A+D G+PSLSSSA V I +     + P +    +    SNS  ++E     S+V  V +      + +   +L+  + L     P + +    Y    L     +DRE+     L+  +     E   QI       + I D+NDNAP + S QI+I        +      + +   D D G NG   + + D    S      IDK +G+IF   ++D    ++ +F++ A D G   L++   +  ++LD     P+F ++ +   + E+  +G  +  ++ + +++   N K I YS++ + +H     +D  +G +  +K  D E  +S    V A N N  +S  +        + I++ DVNDN P F P
Sbjct:  105 TIDILVEVDDENDNAPSFAD-QVVKLEISEFAQLGTSFALPTVTDGDGPKFDVHRF---VILQGNVNNVFKLASRKVNEQLQADLVVNGQLDREFRDKYELLIEAQDGGKPAKIGQLRCS----IEIIDANDNAPVFSRSRYTASVSANISIGSHLITVQATDADIGENSRISYDI-KKTSAPSNSN--FAISQSGVITTTASLLPAST----HDVIVVASDHGSPSLSSSAVVTITVLGSTLSSPPLDI--IWLVESNSAHLMENSTLGSIVARVSIAQQYRDTKL---RLIGSSAL----CPQQTDQAHVYL---LLLCGILDRETASEHHLKFLL-----EKDGQIIIEHPQLLTIGDINDNAPQWHSSQIHISLNRTQGGS------RTLTAKDPDLGQNGWIRYSVLDTELVS------IDKETGRIFVPNTIDCNIGSEIKFRVRAEDGGSPALSTDLQVVADLLDTESKPPQFEKALWQVEIPEDTPIGTCL--VKVVANNSQCGNSKRIRYSLQNQDEH---LTVDTMSGTVCIQKTFDFEKQKSYQTTVIATNANSETSTSL--------ISIRLKDVNDNWPIFYP 643          

HSP 2 Score: 130.183 bits (326), Expect = 5.013e-30
Identity = 150/589 (25.47%), Postives = 256/589 (43.46%), Query Frame = 3
Query:  411 ILIKILDQNDKAPQFSSIKRPFFK--IPENVEVGKVIDLPMAVDSDSEKYSVRRYSLSYIYHLDQTHDFRLHVTNDNPPRPQLIVNSKLDYEKINKYVFRLFAYDFDEKSIGNSCSTTIEIEIEDLNDNVPKFNQLTYNANIDEN-KRDDKLIKFTVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDADTHSNMIHCKLVDYNDLFYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPIIV---TDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLRTRKPLDRETLESISIKVTAKNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAP 2159
            ++  +LD   K PQF   ++  ++  IPE+  +G  +   +A +S        RYSL       Q  D  L V   +     + +    D+EK   Y   + A + + ++     ++ I I ++D+NDN P F    Y+  + E  K ++ L+  + SD DSG  G V+ +I+ +    S  F I  +    F  + +           F   + A D G  S  +SA   IH+  ++ +    +F +  + +  +  I+ G+   S+    +V  +      I+    D+N  F +D  +    +  Y          +D + +    L I  +    E     +    + I IED NDN P FS  +      E  +   +   +P  V   +D+D   NG+  + +    +    S   ID+ +G++ T   LDYE    ++ ++ A D G  P +S+ T+ I+VLD+NDNAP F +S Y   V EN      +G + A D D+  +N  I Y I    + S YF ID   G++ T++ +DRE +  + I + A++        V    S     I V+DVNDN P
Sbjct:  526 VVADLLDTESKPPQF---EKALWQVEIPEDTPIGTCLVKVVANNSQCGNSKRIRYSL-------QNQDEHLTV---DTMSGTVCIQKTFDFEKQKSYQTTVIATNANSET----STSLISIRLKDVNDNWPIFYPNEYHLTVREGPKPEEPLLVVSASDMDSGTFGEVSYHILSE----SSSFSINPVTGEVFAQKPLAR-------GRFHLVVSAKDGGGQSSENSA--NIHITVIDKDTKTPQFSRSKYEIRTTEDILPGIAIGSVGAMSKVKYS------IYSGDQDHN--FSIDEDTGKIYVTRY----------LDADVHDTVLLNIQATLPSGE-----SNQTQVVIFIEDHNDNPPQFSSSLV-----EISIREDLKLHEPFYVVQASDKDKKKNGEVRYSI---ISSHPGSSIEIDQFTGQLSTGSLLDYEATRNYKLRVKATDLGIPPRSSNMTLFIHVLDVNDNAPEFEKSWYTMEVLENSPPKTIVGKVVARDKDS-LENGQIVYRIT---NGSEYFGIDEKLGNVYTKRSIDREVISHVDISIVAEDKG------VPPRSSTASARISVLDVNDNPP 1043          

HSP 3 Score: 68.1662 bits (165), Expect = 4.588e-11
Identity = 54/172 (31.40%), Postives = 88/172 (51.16%), Query Frame = 3
Query: 1650 DFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLRTRKPLDRETLESISIKVTAKNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAPKF 2165
            +F ID+ +GKI+  R LD +  +     I A     +  ++ + + I + D NDN P+FS S    ++ E++ +      +QA D D  +KN ++ YSI      SS  +ID++TG L T   LD E   +  ++V A +        +    S + + I V+DVNDNAP+F
Sbjct:  781 NFSIDEDTGKIYVTRYLDADVHDTVLLNIQATLPSGE--SNQTQVVIFIEDHNDNPPQFSSSLVEISIREDLKLHEPFYVVQASDKD-KKKNGEVRYSIISSHPGSS-IEIDQFTGQLSTGSLLDYEATRNYKLRVKATDLG------IPPRSSNMTLFIHVLDVNDNAPEF 942          

HSP 4 Score: 65.4698 bits (158), Expect = 2.742e-10
Identity = 140/637 (21.98%), Postives = 258/637 (40.50%), Query Frame = 3
Query:  417 IKILDQNDKAPQFSSIKRPFFKIPENVEVGKVIDLPMAVDSDSEKYSVRRYSLSYIYHLDQTHDFRLHVTNDNPPRPQLIVNSKLDYEKINKYVFRLFAYD--FDEKSIGNSCSTTIEIEIEDLNDNVPKFNQLTYNANIDEN--KRDDKLIKFTVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLN-DNGPKIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDADTHSNMIHCKLVD--YNDLFYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPIIVTDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISGKI----FTQRSLDYETKNKFRFKIIAIDKGY--QPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLRTRKPLDRETLESISIKVTAKNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAPKFIPRLNMKQKVEFIVEQFVDGNTCTELPYTVQDID-DGGING 2285
            +++ + ND  P F  + +P  ++PEN+ VG  +    A D D+         L Y    D +     H   D      + + + LD+E + ++   + A D  FD         T + I + D+NDN P F++  Y   +            K    D D+   G +T ++   +  +   F++   +    F++++           +  T+ ATD G PS S+S  V + +      + P  +  +  F V  +  I  GL   +L  E         S   H ++ D   + +F +D   KF  L    P        IDRE       ++ I   D+E           ++ + D NDN P+F+   Y  ++ ++  +        I+ +D+DSG NG+  + +    + +D +   ++  +G I    +    LD      ++  + A D G+  +       +++ +   + +AP F    Y  +V E+ SVG  +  ++A  +    +N  + YS++   +H     ID  TG+L  +  LD E+   IS+ ++  + N  S        + V + I V  V++ AP F        K  + + Q        E    +Q ID DGG++G
Sbjct: 1915 VRVNNLNDNVPSFP-MSKPR-RVPENLRVGSYVATVGAKDVDN------LAPLRYFLVSDSSGQTPTHFNIDQF-TGTIHLTAPLDFEVLPEHTLTIKATDGSFD-------TFTNLTIFVSDINDNAPTFSKPLYQTTVSPATFSPGQPFAKIEAHDLDA--RGALTYSLGQGSSSI---FRVAP-ESGALFMKVLPPAGER-----YLVTVTATDNGVPSFSTSVPVSVIIGEAEPTDKPGFEKAEFRFEVMENSKI--GLQIGNLSGE--------ESREFHYRIQDPEASKIFSID---KFGRLFVAGP--------IDREQRATHEFQVEI---DNEMMTSQKVQCKCHVIVLDENDNLPVFTSVAYYLSLKDSMAHGQKI--GQIMASDQDSGENGRVSYRI---LSGNDLNIVTLNPDTGSIQLNEWNDAQLDEFPNATWQILVEARDHGHPARAAVGKVQVSLKMSSWSGSAPFFVLPVYEVHVLEDTSVGTVLQKIRA-SNRLGMRNDGLLYSLK---EHQGKLGIDVKTGELTLKTHLDWESEPIISMYLSVSDGNGRS--------AVVPLKIVVEPVDEFAPVFT-------KSSYTL-QIPISTPAGESVGQMQAIDEDGGVHG 2475          

HSP 5 Score: 65.0846 bits (157), Expect = 3.273e-10
Identity = 100/428 (23.36%), Postives = 169/428 (39.49%), Query Frame = 3
Query: 1086 QVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDADTHSNMIHCKLVDYNDLFYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPIIVTDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLN-DNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLRTRKPLDRETLESISIKVTAKNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAPKFIP---RLNMKQKVEFIVEQFVDGNTCTELPYTVQDIDDGGINGQNCCYTILENDYNKLFSLMTDTPS 2357
            +V + + NLNDN P        F +S    + E L   S V  V   D D  + + +  + D +      +P+ FN        +L      +    H     +TI  TD        T  +L I + D+NDNAP FS+ +Y   V     +    F K   +   D    G   + L        SS F +   SG +F +  +      ++   + A D G    ++S  +++ + +    + P F ++ + F V EN  +G +IG L         ++++  Y I+   + S  F ID++ G L    P+DRE   +   +V   N        + +   +    + V+D NDN P F      L++K       +    G    ++  + Q   D G NG+   Y IL  +   + +L  DT S
Sbjct: 1912 RVDVRVNNLNDNVPS-------FPMSKPRRVPENLRVGSYVATVGAKDVDNLAPLRYFLVSDSSG----QTPTHFNIDQFTGTIHLTAPLDFEVLPEH----TLTIKATDG----SFDTFTNLTIFVSDINDNAPTFSKPLYQTTVSPATFSPGQPFAK---IEAHDLDARGALTYSLGQ----GSSSIFRVAPESGALFMK--VLPPAGERYLVTVTATDNGVPSFSTSVPVSVIIGEAEPTDKPGFEKAEFRFEVMENSKIGLQIGNLSG------EESREFHYRIQDP-EASKIFSIDKF-GRLFVAGPIDREQRATHEFQVEIDN------EMMTSQKVQCKCHVIVLDENDNLPVFTSVAYYLSLK-------DSMAHGQKIGQIMASDQ---DSGENGR-VSYRILSGNDLNIVTLNPDTGS 2286          

HSP 6 Score: 51.2174 bits (121), Expect = 6.234e-6
Identity = 46/181 (25.41%), Postives = 84/181 (46.41%), Query Frame = 3
Query: 1644 SSDFL-IDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDI------DRYTGDLRTRKPLDRETLESISIKVTAKNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAPKF 2165
            +S FL +D+ SG+I T   LDYE ++KF    + +++  + +     I + V D NDNAP F++      + E   +G         D D  + +   F  ++  G+ ++ F +      ++   DL     LDRE  +   + + A++  K +         ++   I+++D NDNAP F
Sbjct:   65 TSKFLKVDERSGEISTIAHLDYEKRSKFDIVAVKVEESGETI----DILVEVDDENDNAPSFADQVVKLEISEFAQLGTSFALPTVTDGDGPKFDVHRFVILQ--GNVNNVFKLASRKVNEQLQADLVVNGQLDREFRDKYELLIEAQDGGKPAKI------GQLRCSIEIIDANDNAPVF 233          
BLAST of Protocadherin Fat 1 vs. Ensembl Celegans
Match: hmr-1 (Cadherin-related hmr-1 [Source:UniProtKB/Swiss-Prot;Acc:Q967F4])

HSP 1 Score: 111.309 bits (277), Expect = 3.142e-24
Identity = 152/635 (23.94%), Postives = 281/635 (44.25%), Query Frame = 3
Query:  381 LTPTD-----PGTFFILIKILDQNDKAPQFS------SIKRPFFKIPENVEV--GKVIDLPMAVDSDSEK-YSVRRYSLSYIYHLDQTHDFRLHVTNDNPPRPQLIVNSKLDYEKINKYVFRLFAYDFDEKSIG-----NSCSTTIEIEIEDLNDNVPKFNQLTYNANIDENKRDDKLIKFTVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDADT--HSNMIHCKL--VDYNDLFYLDSPSKFNTLLNYKPFNLKTINKIDRESNHG-SFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQI--YIGXXXXXXXXXXXXFPKPIIVTDRD----SGLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFTQRSLDYE--TKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDR-----YTGDLRTRKPLDRETLES-----ISIKVTAKNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAP 2159
            LT TD       T   ++++ D ND  PQF+      +I        E++E   GK I    A+D+DS+   +   Y +    + ++T  FR+     +    ++  N K D EKI+ Y+  + A D    ++      N  +  ++I I D+NDN P F +  Y   + E++ +   +  T+   D  ++  +  +++        R   F ++ +   + +   LD+E     +   L+A+D      +++  V IH++++NDN P+ + +K   +V     I E +    ++  V  TDAD    S+ I  +L     +++F +   S            ++ +  +DR+   G       +   D +    +     + + + D+NDN+P+F +++  YI    E   +  V F   + V  RD    +  N   E+ +   +  +  S F ID+ +GKIF  RSLD E  ++ +F  ++ A D+G       + +TI V D+NDNAP F ++ Y  +V E   +G  + +  A D D + K+    Y +  + D+  Y   D+       G LR ++PLD E +       + I+V+               D+E  V + ++D ND+AP
Sbjct: 1182 LTATDMTSRVASTKTFVVEVRDVNDVVPQFTVDLFTGTIDEEMTP-NEHLEKTNGKPIVTVKAIDTDSDGPQNEVHYRIVGEANGEETKHFRI-----DELTGEIFPNEKFDREKIDMYILTVEASDRSVSALPGANGPNKDNVKVQIVINDVNDNAPSFEEQKYIGRVKESEGEGHDV-ITIKAHDLDKHSNLRYHLIGAG---GGRIP-FGVRTDSGTIFVKEPLDFEASDQ-YHLVLIASDG---RHNATTNVYIHIEDVNDNAPQFEQQKYATTV-----IEEDVDIPKVLFNVHATDADQDEKSSRIVYRLEGQGADEVFRIGKYSG----------TIELVKALDRDPPAGVPSWNFVVQAIDDD-GNGLVGYADVQVNVRDINDNSPIFPERLFGYIEENREPIHSDGVYF---MDVQARDFDDPTTENANIEYGIVRNKLINGESVFRIDQNTGKIFAMRSLDREISSEREFIIEVRANDRGVPSREGFANVTIKVTDMNDNAPFFEKTRYEGSVEETAPIGAAVMSFSAFDADEEAKDNVFTYQLSEESDY-FYVTTDKDSKQSSVGVLRVKQPLDYEDVTQRDGFHLGIRVSDG-----------RHDAEAAVHVALVDRNDHAP 1770          

HSP 2 Score: 106.686 bits (265), Expect = 7.292e-23
Identity = 152/652 (23.31%), Postives = 277/652 (42.48%), Query Frame = 3
Query:  354 CCKLIGFQYLTPTDPGTFFILIKILDQNDKAPQFSSIKRPFFKIPENVEVGKVIDLPM-----AVDSDSEKYSVRRYSLSYIYHLDQTHDFRLHVTNDNPPRPQLIVNSKLDYEKINKYVFRLFAYDFDEKSIGNSCSTTIEIEIEDLNDNVPKFNQLTYNANIDE-NKRDDKLIKFTVSDPDSGRNGIVTVNI-VDKT--DELSKRFKIFE-IQRNEFFLELINSLDYETDPHLFEFTLLATDQGTP-SLSSSAQVKIHLKNLNDNGPKIKFK---KLGFSVSNSVSIIEGLPAHSLVVEVR-VTDADTHSNMIHCKLVDYNDLFYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXX---XXXXXFPKPIIVT---DRDS-GLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSST-------ITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLRTRKPLDRETLESISIKVTAKNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAPKFIPRLNMKQKVEFIVEQFVD 2222
            CC      Y + T      +LI I D N+  P+F    + +  I + +E     D P      A D DS       YSL Y     +        T    P P ++     D E   +    + A D  ++ +   C     +E+ D+NDN P+F + +Y  ++         +I     D D+  N  +T ++ +D T  +E       FE + R    + LI  +  +T    F F ++A D G P +L SSAQV +++ +     PK +     K G +V  +V +      + +++  R V+  D+ ++ +  KL          + SKF     ++  N      I    ++      T++ T ++ + ++ + ++  +++ DVND  P F+  ++ G +DE      ++     KPI+     D DS G   +  + +    N  ++  F ID+++G+IF     D E  + +   + A D+    L  ++        + I + D+NDNAP F E  YI  V E+   G  + T++A D D   K+ ++ Y +   G     F +   +G +  ++PLD E  +   + + A +            ++  +V I + DVNDNAP+F      ++    ++E+ VD
Sbjct:  837 CCV-----YPSKTHTSYATLLIGIEDVNNNKPEFPDCAK-YSDIAKIMEGTYKTDPPTIVKVEATDDDSSANGDIVYSLYYTQSESRKAFVIDRQTGVLTPSPHVV----FDRETRPREDVTVKATDRGDRPLIGFCQ--FSVEVVDINDNSPQFERPSYETSVSRFEAVGTSVITVFAFDNDAAHNAEITYSLEIDTTAGEEHQNDLDFFELVNRRSGEITLIKPIPMKT--QKFIFNVIADDNGIPEALQSSAQVTLNVLDKQQKAPKWQTSPDCKPGITVDENVEL------NKVILRCRAVSSGDSRNSDVIYKLTASGGPGN-KAESKFRQFNKFENGNEWVEVVIMEGLDYEQVNNYTLTLTATDMTSRVASTKTFVVEVRDVNDVVPQFTVDLFTGTIDEEMTPNEHLEKTNGKPIVTVKAIDTDSDGPQNEVHYRIVGEANGEETKHFRIDELTGEIFPNEKFDREKIDMYILTVEASDRSVSALPGANGPNKDNVKVQIVINDVNDNAPSFEEQKYIGRVKESEGEGHDVITIKAHDLD---KHSNLRYHLIGAGGGRIPFGVRTDSGTIFVKEPLDFEASDQYHLVLIASDGRH---------NATTNVYIHIEDVNDNAPQF----EQQKYATTVIEEDVD 1451          

HSP 3 Score: 105.916 bits (263), Expect = 1.547e-22
Identity = 154/617 (24.96%), Postives = 260/617 (42.14%), Query Frame = 3
Query:  417 IKILDQNDKAPQFSSIKRPFFK--IPENVEVGKVIDLPMAVDSDSEKYSVRRYSLSYIYHLDQTHDFRLHVTNDNPPRPQLIVNSKLDYEKINKYVFRLFAYDFDEKSIGNS--CSTTIEIEIEDLNDNVPKFN---QLTYNANIDENKRDDKLIKF--TVSDPDSGRNGIVTVNIV------DKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHS----LVVEVRVTDADTHSNMIHCKLV-----DYNDLFYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITIS--CTDSEPSRQITTNESLNIQI--EDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPIIVTDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFE-NVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLRTRKPLDRETLESI-SIKVTAKNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAPKFIPRL 2177
            ++++D ND +PQF   +RP ++  +     VG  +    A D+D+   +   YSL       + H   L        R   I   K    K  K++F + A   D+  I  +   S  + + + D     PK+           +DEN   +K+I     VS  DS RN  V   +       +K +   ++F  FE       + ++  LDYE   + +  TL ATD  T  ++S+    + ++++ND  P+        ++   ++  E L   +    + V+   TD+D   N +H ++V     +    F +D        L  + F  +   K DRE      L +  S     + P       +++ +QI   DVNDNAP F +Q YIG V E++          I +   D   +    ++L           F +   SG IF +  LD+E  +++   +IA D  +   T+   + I++ D+NDNAP+F +  Y   V E +V +   +  + A D D D K+  I Y +E +G     F I +Y+G +   K LDR+    + S     +  +   +  V       DV + V D+NDN+P F  RL
Sbjct:  967 VEVVDINDNSPQF---ERPSYETSVSRFEAVGTSVITVFAFDNDAAHNAEITYSLEIDTTAGEEHQNDLDFFELVNRRSGEITLIKPIPMKTQKFIFNVIA---DDNGIPEALQSSAQVTLNVLDKQQKAPKWQTSPDCKPGITVDENVELNKVILRCRAVSSGDS-RNSDVIYKLTASGGPGNKAESKFRQFNKFENGNEWVEVVIMEGLDYE-QVNNYTLTLTATDM-TSRVASTKTFVVEVRDVNDVVPQFTVDLFTGTIDEEMTPNEHLEKTNGKPIVTVKAIDTDSDGPQNEVHYRIVGEANGEETKHFRIDE-------LTGEIFPNE---KFDREKIDMYILTVEASDRSVSALPGANGPNKDNVKVQIVINDVNDNAPSFEEQKYIGRVKESEGEGHDV----ITIKAHDLDKHSNLRYHL--IGAGGGRIPFGVRTDSGTIFVKEPLDFEASDQYHLVLIASDGRHNATTN---VYIHIEDVNDNAPQFEQQKYATTVIEEDVDIPKVLFNVHATDADQDEKSSRIVYRLEGQG-ADEVFRIGKYSGTIELVKALDRDPPAGVPSWNFVVQAIDDDGNGLV----GYADVQVNVRDINDNSPIFPERL 1550          

HSP 4 Score: 105.531 bits (262), Expect = 1.960e-22
Identity = 130/509 (25.54%), Postives = 219/509 (43.03%), Query Frame = 3
Query:  759 IEIEIEDLNDNVPKFNQLTYNANIDEN-KRDDKLIKFTVSDPDSGRNGIVTVNI------VDKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTP-SLSSSAQVKIHLKNLNDNG----PKIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDAD----THSNM-IHCKLVDYNDLFYLDSPSKFNTLLN----------YKPFNLKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPII---VTDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFTQRSL--DYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIE----PKGDHSSYFD----IDRYTGDLRTRKPLDRETLESISIKVTAKNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAPKF 2165
            + I I+D+NDNVP F +  Y A + E+   +  ++K T  D D+G N  +T ++      ++   E+S + ++   Q NE                ++ F + A D G P SLSSSA + I  +N ND      P  ++            + E     + V++++  DAD    T+S M  + +     +LF +D  +    L +            P NL  I + D             SC    PS+  T+  +L I IEDVN+N P F       ++ +         P  I+    TD DS  NG   + L   ++ S  + F+ID+ +G +     +  D ET+ +    + A D+G +PL      ++ V+D+NDN+P+F    Y  +V    +VG  + T+ A D+D    N +I YS+E       +H +  D    ++R +G++   KP+  +T + I   +   N             S   V + V+D    APK+
Sbjct:  628 LTIRIDDVNDNVPTFTRPLYTAQVREDIPLNQTILKVTAVDKDTGDNSRITYSVDNHNFSINSNGEISAKVRLDADQLNERHF-------------VYRFNVTARDHGEPVSLSSSAMIHIRTENTNDESAVFLPTSQYTAF---------VAEDAQGGTPVIQIQARDADRDEVTYSFMDKNGRSTQKMNLFSIDEHTGLVKLRHGVSAADLAEAENPINLTVIVQDDG------------SCC-VYPSKTHTSYATLLIGIEDVNNNKPEFPDCAKYSDIAKIMEGTYKTDPPTIVKVEATDDDSSANGDIVYSLYYTQSESRKA-FVIDRQTGVLTPSPHVVFDRETRPREDVTVKATDRGDRPLIGFCQFSVEVVDINDNSPQFERPSYETSVSRFEAVGTSVITVFAFDNDA-AHNAEITYSLEIDTTAGEEHQNDLDFFELVNRRSGEITLIKPIPMKTQKFIFNVIADDN------GIPEALQSSAQVTLNVLDKQQKAPKW 1093          

HSP 5 Score: 103.219 bits (256), Expect = 9.930e-22
Identity = 155/631 (24.56%), Postives = 257/631 (40.73%), Query Frame = 3
Query:  411 ILIKILDQNDKAPQFSSIKRPFFKIPENVEVGKVIDLPMAVDSDSEKYSVRRYSLSYIYHLDQTHDFRLHVTNDNPPR---------PQLIVNSKLDYEKINKYVFRLFAYDFDEKSIGNSCSTTIEIEIEDLNDNVPKFNQLTYNANIDENKRDDKLIKFTVSDPDSGRNGIVTVNIVDKTDELSKRFK------IFEIQRNEFFLELINSLDYETDPHL--FEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHS-----LVVEVRVTDADTHSN------MIHCKLVDYNDLFYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTD-SEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPIIVTDRDSGLNGKFEFYLEDFRNFSDSSDFL---IDKIS-----GKIFTQRSLDYE---TKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLRTRKPLDRETLESISIKVTA-KNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAPK--FIPR 2174
            + I I D ND AP F           E   +G+V       +S+ E + V        + LD+  + R H+      R           + V   LD+E  ++Y   L A D       ++ +T + I IED+NDN P+F Q  Y   + E   D   + F V   D+ ++        +K+  +  R +      +F I +    +EL+ +LD +    +  + F + A D     L   A V+++++++NDN P    +  G+   N        P HS     + V+ R  D  T  N      ++  KL++   +F +D  +        K F ++++   DRE +      I +   D   PSR+   N  + I++ D+NDNAP F +  Y G+V+E                D ++  N  F + L      S+ SD+     DK S     G +  ++ LDYE    ++ F   I   D  +    + + + + ++D ND+AP    +     V E+V  G  IG   A D D     +   + I  + D    F ID+  G LR    LDRE +   ++ + A  N N      V          + + DVNDN P+   +PR
Sbjct: 1321 VQIVINDVNDNAPSFE----------EQKYIGRV------KESEGEGHDVITIKA---HDLDKHSNLRYHLIGAGGGRIPFGVRTDSGTIFVKEPLDFEASDQYHLVLIASDGR-----HNATTNVYIHIEDVNDNAPQFEQQKYATTVIEEDVDIPKVLFNVHATDADQD--------EKSSRIVYRLEGQGADEVFRIGKYSGTIELVKALDRDPPAGVPSWNFVVQAIDDDGNGLVGYADVQVNVRDINDNSPIFPERLFGYIEENRE------PIHSDGVYFMDVQARDFDDPTTENANIEYGIVRNKLINGESVFRIDQNTG-------KIFAMRSL---DREISSEREFIIEVRANDRGVPSREGFAN--VTIKVTDMNDNAPFFEKTRYEGSVEETAPIGAAVMSFSAFDADEEAKDN-VFTYQL------SEESDYFYVTTDKDSKQSSVGVLRVKQPLDYEDVTQRDGFHLGIRVSDGRHD---AEAAVHVALVDRNDHAPHIHGATE-HRVREDVPRGTSIGRYTATDRDAGDTAR---FRINRQSDPKRQFTIDQ-DGTLRVAHTLDREDIAVYNLIIEAYDNSNNIGRQMV---------AVYLQDVNDNGPEPYTVPR 1877          

HSP 6 Score: 57.7658 bits (138), Expect = 5.489e-8
Identity = 92/386 (23.83%), Postives = 160/386 (41.45%), Query Frame = 3
Query:  387 PTDPGTFFILIKILDQNDKAPQFSSIKRPFFKIPENVEVGKVIDLPMAVDSDSE-KYSVRRYSLSYIYHLDQTHDFRLHVTNDNPPRPQ----LIVNSKLDYEKINKY-VFRLFAYDFDEKSIGNSCSTTIEIEIEDLNDNVPKFNQLTYNANIDENKRDDKLIKFTVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHSL-VVEVRVTDADTHSNMIHCKLVDYNDLFYLD-SPS-KFNTLLNY----------KPFNLKTINKIDRESN-HGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDN 1484
            P+  G   + IK+ D ND AP F    R    + E   +G  +    A D+D E K +V      + Y L +  D+  +VT D   +      L V   LDYE + +   F L     D +   +     + + + D ND+ P  +  T +   ++  R   + ++T +D D+G      +N   +  +  ++F I +    +  L + ++LD E D  ++   + A D           V ++L+++NDNGP+       ++V       E  P + L   E+R TD DT          ++   F ++ SPS K++  LN               +  + + DRE+   G  L I +   D    R      S+++ I D+NDN
Sbjct: 1639 PSREGFANVTIKVTDMNDNAPFFEKT-RYEGSVEETAPIGAAVMSFSAFDADEEAKDNV------FTYQLSEESDY-FYVTTDKDSKQSSVGVLRVKQPLDYEDVTQRDGFHLGIRVSDGR---HDAEAAVHVALVDRNDHAPHIHGATEHRVREDVPRGTSIGRYTATDRDAGDTARFRIN---RQSDPKRQFTIDQ----DGTLRVAHTLDRE-DIAVYNLIIEAYDNSNN--IGRQMVAVYLQDVNDNGPE------PYTVPRPCIFRENTPVNQLGTCEIRATDRDT---------AEFGPPFTMEVSPSFKYSQYLNVIFNANGDGGNGSMTITPLQEFDREAPVPGKILEIPLILADRAGRRN---EASVHVIIGDLNDN 1985          
BLAST of Protocadherin Fat 1 vs. Ensembl Celegans
Match: hmr-1 (Cadherin-related hmr-1 [Source:UniProtKB/Swiss-Prot;Acc:Q967F4])

HSP 1 Score: 111.309 bits (277), Expect = 3.142e-24
Identity = 152/635 (23.94%), Postives = 281/635 (44.25%), Query Frame = 3
Query:  381 LTPTD-----PGTFFILIKILDQNDKAPQFS------SIKRPFFKIPENVEV--GKVIDLPMAVDSDSEK-YSVRRYSLSYIYHLDQTHDFRLHVTNDNPPRPQLIVNSKLDYEKINKYVFRLFAYDFDEKSIG-----NSCSTTIEIEIEDLNDNVPKFNQLTYNANIDENKRDDKLIKFTVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDADT--HSNMIHCKL--VDYNDLFYLDSPSKFNTLLNYKPFNLKTINKIDRESNHG-SFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQI--YIGXXXXXXXXXXXXFPKPIIVTDRD----SGLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFTQRSLDYE--TKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDR-----YTGDLRTRKPLDRETLES-----ISIKVTAKNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAP 2159
            LT TD       T   ++++ D ND  PQF+      +I        E++E   GK I    A+D+DS+   +   Y +    + ++T  FR+     +    ++  N K D EKI+ Y+  + A D    ++      N  +  ++I I D+NDN P F +  Y   + E++ +   +  T+   D  ++  +  +++        R   F ++ +   + +   LD+E     +   L+A+D      +++  V IH++++NDN P+ + +K   +V     I E +    ++  V  TDAD    S+ I  +L     +++F +   S            ++ +  +DR+   G       +   D +    +     + + + D+NDN+P+F +++  YI    E   +  V F   + V  RD    +  N   E+ +   +  +  S F ID+ +GKIF  RSLD E  ++ +F  ++ A D+G       + +TI V D+NDNAP F ++ Y  +V E   +G  + +  A D D + K+    Y +  + D+  Y   D+       G LR ++PLD E +       + I+V+               D+E  V + ++D ND+AP
Sbjct: 1182 LTATDMTSRVASTKTFVVEVRDVNDVVPQFTVDLFTGTIDEEMTP-NEHLEKTNGKPIVTVKAIDTDSDGPQNEVHYRIVGEANGEETKHFRI-----DELTGEIFPNEKFDREKIDMYILTVEASDRSVSALPGANGPNKDNVKVQIVINDVNDNAPSFEEQKYIGRVKESEGEGHDV-ITIKAHDLDKHSNLRYHLIGAG---GGRIP-FGVRTDSGTIFVKEPLDFEASDQ-YHLVLIASDG---RHNATTNVYIHIEDVNDNAPQFEQQKYATTV-----IEEDVDIPKVLFNVHATDADQDEKSSRIVYRLEGQGADEVFRIGKYSG----------TIELVKALDRDPPAGVPSWNFVVQAIDDD-GNGLVGYADVQVNVRDINDNSPIFPERLFGYIEENREPIHSDGVYF---MDVQARDFDDPTTENANIEYGIVRNKLINGESVFRIDQNTGKIFAMRSLDREISSEREFIIEVRANDRGVPSREGFANVTIKVTDMNDNAPFFEKTRYEGSVEETAPIGAAVMSFSAFDADEEAKDNVFTYQLSEESDY-FYVTTDKDSKQSSVGVLRVKQPLDYEDVTQRDGFHLGIRVSDG-----------RHDAEAAVHVALVDRNDHAP 1770          

HSP 2 Score: 106.686 bits (265), Expect = 7.292e-23
Identity = 152/652 (23.31%), Postives = 277/652 (42.48%), Query Frame = 3
Query:  354 CCKLIGFQYLTPTDPGTFFILIKILDQNDKAPQFSSIKRPFFKIPENVEVGKVIDLPM-----AVDSDSEKYSVRRYSLSYIYHLDQTHDFRLHVTNDNPPRPQLIVNSKLDYEKINKYVFRLFAYDFDEKSIGNSCSTTIEIEIEDLNDNVPKFNQLTYNANIDE-NKRDDKLIKFTVSDPDSGRNGIVTVNI-VDKT--DELSKRFKIFE-IQRNEFFLELINSLDYETDPHLFEFTLLATDQGTP-SLSSSAQVKIHLKNLNDNGPKIKFK---KLGFSVSNSVSIIEGLPAHSLVVEVR-VTDADTHSNMIHCKLVDYNDLFYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXX---XXXXXFPKPIIVT---DRDS-GLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSST-------ITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLRTRKPLDRETLESISIKVTAKNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAPKFIPRLNMKQKVEFIVEQFVD 2222
            CC      Y + T      +LI I D N+  P+F    + +  I + +E     D P      A D DS       YSL Y     +        T    P P ++     D E   +    + A D  ++ +   C     +E+ D+NDN P+F + +Y  ++         +I     D D+  N  +T ++ +D T  +E       FE + R    + LI  +  +T    F F ++A D G P +L SSAQV +++ +     PK +     K G +V  +V +      + +++  R V+  D+ ++ +  KL          + SKF     ++  N      I    ++      T++ T ++ + ++ + ++  +++ DVND  P F+  ++ G +DE      ++     KPI+     D DS G   +  + +    N  ++  F ID+++G+IF     D E  + +   + A D+    L  ++        + I + D+NDNAP F E  YI  V E+   G  + T++A D D   K+ ++ Y +   G     F +   +G +  ++PLD E  +   + + A +            ++  +V I + DVNDNAP+F      ++    ++E+ VD
Sbjct:  837 CCV-----YPSKTHTSYATLLIGIEDVNNNKPEFPDCAK-YSDIAKIMEGTYKTDPPTIVKVEATDDDSSANGDIVYSLYYTQSESRKAFVIDRQTGVLTPSPHVV----FDRETRPREDVTVKATDRGDRPLIGFCQ--FSVEVVDINDNSPQFERPSYETSVSRFEAVGTSVITVFAFDNDAAHNAEITYSLEIDTTAGEEHQNDLDFFELVNRRSGEITLIKPIPMKT--QKFIFNVIADDNGIPEALQSSAQVTLNVLDKQQKAPKWQTSPDCKPGITVDENVEL------NKVILRCRAVSSGDSRNSDVIYKLTASGGPGN-KAESKFRQFNKFENGNEWVEVVIMEGLDYEQVNNYTLTLTATDMTSRVASTKTFVVEVRDVNDVVPQFTVDLFTGTIDEEMTPNEHLEKTNGKPIVTVKAIDTDSDGPQNEVHYRIVGEANGEETKHFRIDELTGEIFPNEKFDREKIDMYILTVEASDRSVSALPGANGPNKDNVKVQIVINDVNDNAPSFEEQKYIGRVKESEGEGHDVITIKAHDLD---KHSNLRYHLIGAGGGRIPFGVRTDSGTIFVKEPLDFEASDQYHLVLIASDGRH---------NATTNVYIHIEDVNDNAPQF----EQQKYATTVIEEDVD 1451          

HSP 3 Score: 105.916 bits (263), Expect = 1.547e-22
Identity = 154/617 (24.96%), Postives = 260/617 (42.14%), Query Frame = 3
Query:  417 IKILDQNDKAPQFSSIKRPFFK--IPENVEVGKVIDLPMAVDSDSEKYSVRRYSLSYIYHLDQTHDFRLHVTNDNPPRPQLIVNSKLDYEKINKYVFRLFAYDFDEKSIGNS--CSTTIEIEIEDLNDNVPKFN---QLTYNANIDENKRDDKLIKF--TVSDPDSGRNGIVTVNIV------DKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHS----LVVEVRVTDADTHSNMIHCKLV-----DYNDLFYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITIS--CTDSEPSRQITTNESLNIQI--EDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPIIVTDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFE-NVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLRTRKPLDRETLESI-SIKVTAKNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAPKFIPRL 2177
            ++++D ND +PQF   +RP ++  +     VG  +    A D+D+   +   YSL       + H   L        R   I   K    K  K++F + A   D+  I  +   S  + + + D     PK+           +DEN   +K+I     VS  DS RN  V   +       +K +   ++F  FE       + ++  LDYE   + +  TL ATD  T  ++S+    + ++++ND  P+        ++   ++  E L   +    + V+   TD+D   N +H ++V     +    F +D        L  + F  +   K DRE      L +  S     + P       +++ +QI   DVNDNAP F +Q YIG V E++          I +   D   +    ++L           F +   SG IF +  LD+E  +++   +IA D  +   T+   + I++ D+NDNAP+F +  Y   V E +V +   +  + A D D D K+  I Y +E +G     F I +Y+G +   K LDR+    + S     +  +   +  V       DV + V D+NDN+P F  RL
Sbjct:  967 VEVVDINDNSPQF---ERPSYETSVSRFEAVGTSVITVFAFDNDAAHNAEITYSLEIDTTAGEEHQNDLDFFELVNRRSGEITLIKPIPMKTQKFIFNVIA---DDNGIPEALQSSAQVTLNVLDKQQKAPKWQTSPDCKPGITVDENVELNKVILRCRAVSSGDS-RNSDVIYKLTASGGPGNKAESKFRQFNKFENGNEWVEVVIMEGLDYE-QVNNYTLTLTATDM-TSRVASTKTFVVEVRDVNDVVPQFTVDLFTGTIDEEMTPNEHLEKTNGKPIVTVKAIDTDSDGPQNEVHYRIVGEANGEETKHFRIDE-------LTGEIFPNE---KFDREKIDMYILTVEASDRSVSALPGANGPNKDNVKVQIVINDVNDNAPSFEEQKYIGRVKESEGEGHDV----ITIKAHDLDKHSNLRYHL--IGAGGGRIPFGVRTDSGTIFVKEPLDFEASDQYHLVLIASDGRHNATTN---VYIHIEDVNDNAPQFEQQKYATTVIEEDVDIPKVLFNVHATDADQDEKSSRIVYRLEGQG-ADEVFRIGKYSGTIELVKALDRDPPAGVPSWNFVVQAIDDDGNGLV----GYADVQVNVRDINDNSPIFPERL 1550          

HSP 4 Score: 105.531 bits (262), Expect = 1.960e-22
Identity = 130/509 (25.54%), Postives = 219/509 (43.03%), Query Frame = 3
Query:  759 IEIEIEDLNDNVPKFNQLTYNANIDEN-KRDDKLIKFTVSDPDSGRNGIVTVNI------VDKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTP-SLSSSAQVKIHLKNLNDNG----PKIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDAD----THSNM-IHCKLVDYNDLFYLDSPSKFNTLLN----------YKPFNLKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPII---VTDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFTQRSL--DYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIE----PKGDHSSYFD----IDRYTGDLRTRKPLDRETLESISIKVTAKNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAPKF 2165
            + I I+D+NDNVP F +  Y A + E+   +  ++K T  D D+G N  +T ++      ++   E+S + ++   Q NE                ++ F + A D G P SLSSSA + I  +N ND      P  ++            + E     + V++++  DAD    T+S M  + +     +LF +D  +    L +            P NL  I + D             SC    PS+  T+  +L I IEDVN+N P F       ++ +         P  I+    TD DS  NG   + L   ++ S  + F+ID+ +G +     +  D ET+ +    + A D+G +PL      ++ V+D+NDN+P+F    Y  +V    +VG  + T+ A D+D    N +I YS+E       +H +  D    ++R +G++   KP+  +T + I   +   N             S   V + V+D    APK+
Sbjct:  628 LTIRIDDVNDNVPTFTRPLYTAQVREDIPLNQTILKVTAVDKDTGDNSRITYSVDNHNFSINSNGEISAKVRLDADQLNERHF-------------VYRFNVTARDHGEPVSLSSSAMIHIRTENTNDESAVFLPTSQYTAF---------VAEDAQGGTPVIQIQARDADRDEVTYSFMDKNGRSTQKMNLFSIDEHTGLVKLRHGVSAADLAEAENPINLTVIVQDDG------------SCC-VYPSKTHTSYATLLIGIEDVNNNKPEFPDCAKYSDIAKIMEGTYKTDPPTIVKVEATDDDSSANGDIVYSLYYTQSESRKA-FVIDRQTGVLTPSPHVVFDRETRPREDVTVKATDRGDRPLIGFCQFSVEVVDINDNSPQFERPSYETSVSRFEAVGTSVITVFAFDNDA-AHNAEITYSLEIDTTAGEEHQNDLDFFELVNRRSGEITLIKPIPMKTQKFIFNVIADDN------GIPEALQSSAQVTLNVLDKQQKAPKW 1093          

HSP 5 Score: 103.219 bits (256), Expect = 9.930e-22
Identity = 155/631 (24.56%), Postives = 257/631 (40.73%), Query Frame = 3
Query:  411 ILIKILDQNDKAPQFSSIKRPFFKIPENVEVGKVIDLPMAVDSDSEKYSVRRYSLSYIYHLDQTHDFRLHVTNDNPPR---------PQLIVNSKLDYEKINKYVFRLFAYDFDEKSIGNSCSTTIEIEIEDLNDNVPKFNQLTYNANIDENKRDDKLIKFTVSDPDSGRNGIVTVNIVDKTDELSKRFK------IFEIQRNEFFLELINSLDYETDPHL--FEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHS-----LVVEVRVTDADTHSN------MIHCKLVDYNDLFYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTD-SEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPIIVTDRDSGLNGKFEFYLEDFRNFSDSSDFL---IDKIS-----GKIFTQRSLDYE---TKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLRTRKPLDRETLESISIKVTA-KNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAPK--FIPR 2174
            + I I D ND AP F           E   +G+V       +S+ E + V        + LD+  + R H+      R           + V   LD+E  ++Y   L A D       ++ +T + I IED+NDN P+F Q  Y   + E   D   + F V   D+ ++        +K+  +  R +      +F I +    +EL+ +LD +    +  + F + A D     L   A V+++++++NDN P    +  G+   N        P HS     + V+ R  D  T  N      ++  KL++   +F +D  +        K F ++++   DRE +      I +   D   PSR+   N  + I++ D+NDNAP F +  Y G+V+E                D ++  N  F + L      S+ SD+     DK S     G +  ++ LDYE    ++ F   I   D  +    + + + + ++D ND+AP    +     V E+V  G  IG   A D D     +   + I  + D    F ID+  G LR    LDRE +   ++ + A  N N      V          + + DVNDN P+   +PR
Sbjct: 1321 VQIVINDVNDNAPSFE----------EQKYIGRV------KESEGEGHDVITIKA---HDLDKHSNLRYHLIGAGGGRIPFGVRTDSGTIFVKEPLDFEASDQYHLVLIASDGR-----HNATTNVYIHIEDVNDNAPQFEQQKYATTVIEEDVDIPKVLFNVHATDADQD--------EKSSRIVYRLEGQGADEVFRIGKYSGTIELVKALDRDPPAGVPSWNFVVQAIDDDGNGLVGYADVQVNVRDINDNSPIFPERLFGYIEENRE------PIHSDGVYFMDVQARDFDDPTTENANIEYGIVRNKLINGESVFRIDQNTG-------KIFAMRSL---DREISSEREFIIEVRANDRGVPSREGFAN--VTIKVTDMNDNAPFFEKTRYEGSVEETAPIGAAVMSFSAFDADEEAKDN-VFTYQL------SEESDYFYVTTDKDSKQSSVGVLRVKQPLDYEDVTQRDGFHLGIRVSDGRHD---AEAAVHVALVDRNDHAPHIHGATE-HRVREDVPRGTSIGRYTATDRDAGDTAR---FRINRQSDPKRQFTIDQ-DGTLRVAHTLDREDIAVYNLIIEAYDNSNNIGRQMV---------AVYLQDVNDNGPEPYTVPR 1877          

HSP 6 Score: 57.7658 bits (138), Expect = 5.489e-8
Identity = 92/386 (23.83%), Postives = 160/386 (41.45%), Query Frame = 3
Query:  387 PTDPGTFFILIKILDQNDKAPQFSSIKRPFFKIPENVEVGKVIDLPMAVDSDSE-KYSVRRYSLSYIYHLDQTHDFRLHVTNDNPPRPQ----LIVNSKLDYEKINKY-VFRLFAYDFDEKSIGNSCSTTIEIEIEDLNDNVPKFNQLTYNANIDENKRDDKLIKFTVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHSL-VVEVRVTDADTHSNMIHCKLVDYNDLFYLD-SPS-KFNTLLNY----------KPFNLKTINKIDRESN-HGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDN 1484
            P+  G   + IK+ D ND AP F    R    + E   +G  +    A D+D E K +V      + Y L +  D+  +VT D   +      L V   LDYE + +   F L     D +   +     + + + D ND+ P  +  T +   ++  R   + ++T +D D+G      +N   +  +  ++F I +    +  L + ++LD E D  ++   + A D           V ++L+++NDNGP+       ++V       E  P + L   E+R TD DT          ++   F ++ SPS K++  LN               +  + + DRE+   G  L I +   D    R      S+++ I D+NDN
Sbjct: 1639 PSREGFANVTIKVTDMNDNAPFFEKT-RYEGSVEETAPIGAAVMSFSAFDADEEAKDNV------FTYQLSEESDY-FYVTTDKDSKQSSVGVLRVKQPLDYEDVTQRDGFHLGIRVSDGR---HDAEAAVHVALVDRNDHAPHIHGATEHRVREDVPRGTSIGRYTATDRDAGDTARFRIN---RQSDPKRQFTIDQ----DGTLRVAHTLDRE-DIAVYNLIIEAYDNSNN--IGRQMVAVYLQDVNDNGPE------PYTVPRPCIFRENTPVNQLGTCEIRATDRDT---------AEFGPPFTMEVSPSFKYSQYLNVIFNANGDGGNGSMTITPLQEFDREAPVPGKILEIPLILADRAGRRN---EASVHVIIGDLNDN 1985          
BLAST of Protocadherin Fat 1 vs. Ensembl Fly
Match: ds (gene:FBgn0284247 transcript:FBtr0078045)

HSP 1 Score: 187.193 bits (474), Expect = 2.459e-47
Identity = 176/620 (28.39%), Postives = 287/620 (46.29%), Query Frame = 3
Query:  417 IKILDQNDKAPQF-SSIKRPFFKIPENVEVGKVIDLPMAVDSDSEK-----YSVRRYSLSYIYHLDQTHDFRLHVTNDNPPRPQLIVNSKLDYEKINKYVFRLFAYDFDEKSIGNSCSTTIEIEIEDLNDNVPKFNQLTYNANIDENKR-DDKLIKFTVSDPDSGRNGIVTVNIVDK----------TDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDADTHSNM-IHCKLVDYNDLFYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTD-SEPSRQITTNESLNIQIEDVNDNAPMFS--QQIYIGXXXXXXXXXXXXFPKPIIVTDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDR---------KNKDIFYSIEP--KGDHSSYFDIDRYTGDLRTRKPLDRET-----LESISIKVTAKNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAPKF 2165
            I++ D ND AP+F +S+ R    +PE+ E+G  +    A D DS       YS+ + S   ++ +D                  LI++  LDYE   ++   + A D    S+  S + TI ++++D+NDN P F +  Y+ N+ E++  + ++I+   SD D+G N  +T  IVD           + ++S+ F IF    N  ++ L   LD ET    ++ T+LATD GTP+  +  +V + + + NDN PK +  K  F +       E L   S+V  V  +D D   N  I   L+  N  F +   +            + T   +DRE        + +   D   P R  +    + I + DVNDNAP  +  Q+  +   +E      V   + +   DRD G N    + +   R+      F ID  SG I T+  LD+E ++ +R  + A D G  P  +   + + VLDLNDN P F+ S  +F V E+ ++G  +G++  I+   D          ++  + Y++ P  K    + FDIDR++G+L   + LDRE      LE  ++  TA N  + S+         + V I+V DVNDNAP++
Sbjct:  919 IEVEDVNDNAPEFEASMVR--ISVPESAELGAPLYAAHAHDKDSGSSGQVTYSLVKESGKGLFAIDARSG-------------HLILSQHLDYESSQRHTLIVTATDGGVPSL--STNLTILVDVQDVNDNPPVFEKDEYSVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFP---NSGWIYLRAPLDRETRDR-YQLTVLATDNGTPAAHAKTRVIVRVLDANDNDPKFQKSKYEFRIE------ENLRRGSVVGVVTASDLDLGENAAIRYSLLPINSSFQVHPVTG----------EISTREPLDRELRE--LYDLVVEARDQGTPVR--SARVPVRIHVSDVNDNAPEIADPQEDVVSVREEQPPGTEVVRVRAV---DRDHGQNASITYSIVKGRDSDGHGLFSIDPTSGVIRTRVVLDHEERSIYRLGVAASDGGNPPRETVRMLRVEVLDLNDNRPTFTSSSLVFRVREDAALGHVVGSISPIERPADVVRNSVEESFEDLRVTYTLNPLTKDLIEAAFDIDRHSGNLVVARLLDREVQSEFRLEIRALDTTASNNPQSSA---------ITVKIEVADVNDNAPEW 1485          

HSP 2 Score: 162.54 bits (410), Expect = 9.183e-40
Identity = 167/593 (28.16%), Postives = 268/593 (45.19%), Query Frame = 3
Query:  411 ILIKILDQNDKAPQFSSIKRPFFKIPENV--EVGKVIDLPMAVDSDSEKYSVRRYSLSYIYHLDQTHDFRL--HVTNDNPPRPQLIVNSKLDYEKINKYVFRLFAYDFDEKSIGNSCSTTIEIEIEDLNDNVPKFNQLTYNANIDENKR-DDKLIKFTVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDADTHSNMIHCKLVDYNDLFYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPIIVTDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLRTRKPLDRETLESISIKVTAKNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAPKFIPR 2174
            +L+ + D+ND AP F        + PEN   EV + + LP A D D E Y+ +RY+   I   +    FRL  H   D      L ++  LD E    Y   + A D     +      T+ I I+D+NDN P FNQ  Y A + EN      +++   SD D+  NG+V   I  +    S + ++F I      + +  +LD+ET   L E  ++A D G   L ++A V I + ++NDN P I    L    S  +S  E       V  + V D D+ +   +  +       +    ++ N++     + +     +DRE      L +  +   + P   +  ++S+ ++I DVNDN P F Q +Y  NV E            ++  DRD GLN    + L +    + +  F ID  +G I T+  +D ET+   +  ++A D G  PL+S++T+ + + D+NDN P F +S Y  +V EN  VG  I  + A D D    N  + Y+I     H + F++   +G++     LD E   S    V A +    S+  +        + +++ DVNDN P F PR
Sbjct:  160 VLVTVKDENDNAPTFPQTSM-HIEFPENTPREVKRTL-LP-ARDLDLEPYNTQRYN---IVSGNVNDAFRLSSHRERDGVLYLDLQISGFLDRETTPGYSLLIEALDGGTPPL--RGFMTVNITIQDVNDNQPIFNQSRYFATVPENATVGTSVLQVYASDTDADENGLVEYAINRRQ---SDKEQMFRIDPRTGAIYINKALDFETK-ELHELVVVAKDHGEQPLETTAFVSIRVTDVNDNQPTINVIFLSDDASPKIS--ESAQPGEFVARISVHDPDSKTEYANVNVTLNGGDGHFALTTRDNSI-----YLVIVHLPLDREIVSNYTLSVVATDKGTPP---LHASKSIFLRITDVNDNPPEFEQDLYHANVMEVADPGTSVLQ--VLAHDRDEGLNSALTYSLAETPE-THAQWFQIDPQTGLITTRSHIDCETEPVPQLTVVARDGGVPPLSSTATVLVTIHDVNDNEPIFDQSFYNVSVAENEPVGRCILKVSASDPDCG-VNAMVNYTIGEGFKHLTEFEVRSASGEICIAGELDFERRSSYEFPVLATDRGGLSTTAM--------IKMQLTDVNDNRPVFYPR 718          

HSP 3 Score: 144.436 bits (363), Expect = 3.363e-34
Identity = 159/617 (25.77%), Postives = 273/617 (44.25%), Query Frame = 3
Query:  381 LTPTDPGTF------FILIKILDQNDKAPQFSSIKRPFFKIPENVEVGKVIDLPMAVDSDSEKYSVRRYSLSYIYHLDQTHDFRLHVTNDNPPRPQLIVNSKLDYEKINKYVFRLFAYDFDEKSIGNSCSTTIEIEIEDLNDNVPKFNQLTYNANIDENKR-DDKLIKFTVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDADTHSNM-IHCKLVDY------NDLFYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTD-SEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPIIVTDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHY-IFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKG---DHSSYFDIDRYTGDLRTRKPLDRETLESISIKVTAK---NPNKYSSHFVRNTDSEVDVMIKVMDVNDNAPKF 2165
            ++ TD G         + + I+D   + P F   +  ++ + E++  G V+   +A   D    S  RYS   IY  D    F +   + N     + +   LD+E  ++ +  + A   +    G+   T + IE+ED+NDN P+F       ++ E+      L      D DSG +G VT ++V ++ +      +F I      L L   LDYE+        + ATD G PSLS++  + + ++++NDN P  +  +   +VS S SI      ++ +++V  +D DT +N  I  ++VD       N +   D    F    N     L+    +DRE+      ++T+  TD   P+    T   + +++ D NDN P F +  Y       +     +    +  +D D G N    + L        +S F +  ++G+I T+  LD E +  +   + A D+G    ++   + I+V D+NDNAP  ++    + +V E    G ++  ++A+D D   +N  I YSI  KG   D    F ID  +G +RTR  LD E      + V A    NP + +   +R         ++V+D+NDN P F
Sbjct:  797 ISATDGGNLRSNADAVVFLSIIDAMQRPPIFEKARYNYY-VKEDIPRGTVVGSVIAASGDVAHRSPVRYS---IYSGDPDGYFSIETNSGN-----IRIAKPLDHEAKSQVLLNIQATLGEPPVYGH---TQVNIEVEDVNDNAPEFEASMVRISVPESAELGAPLYAAHAHDKDSGSSGQVTYSLVKESGK-----GLFAIDARSGHLILSQHLDYESS-QRHTLIVTATDGGVPSLSTNLTILVDVQDVNDNPPVFEKDEYSVNVSESRSI------NAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIYLRA--PLDRETR--DRYQLTVLATDNGTPAAHAKTR--VIVRVLDANDNDPKFQKSKY--EFRIEENLRRGSVVGVVTASDLDLGENAAIRYSL-----LPINSSFQVHPVTGEISTREPLDRELRELYDLVVEARDQGTPVRSARVPVRIHVSDVNDNAPEIADPQEDVVSVREEQPPGTEVVRVRAVDRDHG-QNASITYSIV-KGRDSDGHGLFSIDPTSGVIRTRVVLDHEERSIYRLGVAASDGGNPPRETVRMLR---------VEVLDLNDNRPTF 1365          

HSP 4 Score: 140.198 bits (352), Expect = 6.315e-33
Identity = 174/693 (25.11%), Postives = 305/693 (44.01%), Query Frame = 3
Query:  402 TFFILIKILDQNDKAPQFSSI-----KRPFFKIPENVEVGKVIDLPMAVDSDSE-KYSVRRYSLSYIYHLDQTHDFRLHVTNDNPPRPQLIVNSKLDYEKINKYVFRLFAYDFDEKSIGNSCSTTIEIEIEDLNDNVPKFNQLTYNANIDE-NKRDDKLIKFTVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDADTHSNMIHCKLVDYNDLFYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPIIV---TDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFTQR--SLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLRTRKPLDRETLESI--SIKVTAKNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAPKF---IPRLNMKQKVEFIVEQFVDGNTCTELPYTVQDID-DGGINGQNCCYTILENDYNKLFSLMTDTPSYICLQRKP-EKYQSYTVTLIARD 2423
            T F+ I++ D ND  P  + I       P  KI E+ + G+ +      D DS+ +Y+    +L+         D    +T  +     +IV+  LD E ++ Y   + A D     +    S +I + I D+NDN P+F Q  Y+AN+ E       +++    D D G N  +T ++ + T E   ++  F+I      +   + +D ET+P + + T++A D G P LSS+A V + + ++NDN P   F +  ++VS    + E  P    +++V  +D D   N     +V+Y         ++F          +      +R S++       +  TD      ++T   + +Q+ DVNDN P+F  + Y  ++ E+          PI+    TD D G  G+  + +      +++  F ID+ +G+IF  R   L   T+      I A D G     + + + ++++D     P F ++ Y + V E++  G  +G++ A   D   ++  + YSI   GD   YF I+  +G++R  KPLD E    +  +I+ T   P  Y             V I+V DVNDNAP+F   + R+++ +  E                Y     D D G +GQ   Y++++     LF++   +   I  Q    E  Q +T+ + A D
Sbjct:  376 TAFVSIRVTDVNDNQPTINVIFLSDDASP--KISESAQPGEFVARISVHDPDSKTEYANVNVTLN-------GGDGHFALTTRDNSIYLVIVHLPLDREIVSNYTLSVVATDKGTPPL--HASKSIFLRITDVNDNPPEFEQDLYHANVMEVADPGTSVLQVLAHDRDEGLNSALTYSLAE-TPETHAQW--FQIDPQTGLITTRSHIDCETEP-VPQLTVVARDGGVPPLSSTATVLVTIHDVNDNEPI--FDQSFYNVS----VAENEPVGRCILKVSASDPDCGVN----AMVNYTIGEGFKHLTEFEVRSASGEICIAGELDFERRSSY----EFPVLATDRG---GLSTTAMIKMQLTDVNDNRPVFYPREYKVSLRESPKASSQASSTPIVAVVATDPDYGNFGQVSYRIV---AGNEAGIFRIDRSTGEIFVVRPDMLSVRTQPMHMLNISATDGGNLRSNADAVVFLSIIDAMQRPPIFEKARYNYYVKEDIPRGTVVGSVIAASGDVAHRSP-VRYSIY-SGDPDGYFSIETNSGNIRIAKPLDHEAKSQVLLNIQATLGEPPVY---------GHTQVNIEVEDVNDNAPEFEASMVRISVPESAELGAPL-----------YAAHAHDKDSGSSGQ-VTYSLVKESGKGLFAIDARSGHLILSQHLDYESSQRHTLIVTATD 1010          

HSP 5 Score: 129.413 bits (324), Expect = 1.279e-29
Identity = 151/639 (23.63%), Postives = 275/639 (43.04%), Query Frame = 3
Query:  411 ILIKILDQNDKAPQFSSIKRPFFKIPENVEVGKVIDLPMAVDSDSEKYSVRRYSLS----YIYHLDQTHDFRLHVTNDNPPRPQLIVNSKLDYEKINKYVFRLFAYDFDEKSIGNSCSTTIEIEIEDLNDNVPKFNQLTYNANIDENKRDDK-LIKFTVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDADTHSNMIHCKLVDYND--LFYLDSPS---KFNT--LLNYKPFNLKTINKIDR---------------------ESNHGSFLRITISCTDSEPSRQ-------------ITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPIIVTDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDD-----TDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLRTRKPLDRETLESISIKVTAKNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAPKFIPR 2174
            I I + DQND AP+F  + +    + E+  +G  +    AVD+D    +   YSL+    + + +D                  +    KLD E    Y F + A D     +  S +  ++I + D+NDN P F +  Y   +    +  + L+K    D D G N  +  ++  +   +S +F+I     +   L    SL  E+   L    ++A D+G P  SS   +++ +       P ++F+   + V     + E  P+ + +++V    +D     +       N+  +  LDS S   + N   LL+Y  F+  +++ + R                       +  +    + + T+S+P+               + +   L I++ED NDN+P FSQ+ ++  V E        F   +   D D+G N +  +++ D  +  D++  +    SG + T   LD E ++ ++ KIIA D+G   +T ++TI + ++D+NDN P F  ++ +  V E   +G  I ++ A D D     T R   +    IE    + S F +DRY+G L  ++ LD E  +   + V A +    ++H  R       + ++V D NDNAP F+ +
Sbjct: 1938 ITIFVEDQNDNAPRFK-LSKYTGSVQEDAPLGTSVVQISAVDADLGVNARLVYSLANETQWQFAIDGQSGL-------------ITTVGKLDRELQASYNFMVLATDGGRYEV-RSATVPVQINVLDINDNRPIFERYPYIGQVPALIQPGQTLLKVQALDADLGANAEIVYSLNAENSAVSAKFRI---NPSTGALSASQSLASESG-KLLHLEVVARDKGNPPQSSLGLIELLIGEAPQGTPVLRFQNETYRVM----LKENSPSGTRLLQVVALRSDGRRQKVQFSFGAGNEDGILSLDSLSGEIRVNKPHLLDYDRFSTPSMSALSRGRALHYEEEIDESSEEDPNNSTRSQRALTSSSFALTNSQPNEIRVVLVARTADAPFLASYAELVIELEDENDNSPKFSQKQFVATVSEGNNKGT--FVAQVHAFDSDAGSNARLRYHIVDGNH--DNAFVIEPAFSGIVRTNIVLDREIRDIYKLKIIATDEGVPQMTGTATIRVQIVDVNDNQPTFPPNNLV-TVSEATELGAVITSISANDVDTYPALTYRLGAESTVDIE----NMSIFALDRYSGKLVLKRRLDYELQQEYELDVIASD----AAHEARTV-----LTVRVNDENDNAPVFLAQ 2535          

HSP 6 Score: 119.013 bits (297), Expect = 1.682e-26
Identity = 169/717 (23.57%), Postives = 295/717 (41.14%), Query Frame = 3
Query:  384 TPTDPGTFFILIKILDQNDKAPQFSSIKRPFFKIPENVEVGKVIDLPMAVDSDSEKYSVRRYSLSYIYHLDQTHDFRLHVTNDNPPRPQLIVNSKLDYEKINKYVFRLFAYDFDEKSIGNSCSTTIEIEIEDLNDNVPKFN--QLTYNANIDENKRDDKLIKFTVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDADTHSNMIHCKLVDYNDLFYLDSPSK------FNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTDSEPSRQITTNE-SLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPIIV-----TDRDSGLNGKFEFYL-EDFRNFSDSSD-----FLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKG---YQPLTSSSTITINVLDLNDNAPRF----SESHYIFNVF--ENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLRTRKPL-----DRETLESISIKVTAKNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAPKFIPRLNMKQKVEFIVEQFVDGNTCTELPYTVQDIDDGGINGQNCCYTILENDYNKLFSLMTDTPSYICLQRKP---EKYQSYTVTLIARD 2423
            TP       +++++LD ND  P+F   K   F+I EN+  G V+ +  A D D  + +  RYSL  I    Q H     ++   P          LD E   + ++ L     D+ +   S    + I + D+NDN P+    Q    +  +E     ++++    D D G+N  +T +IV   D  S    +F I      +     LD+E +  ++   + A+D G P   +   +++ + +LNDN P      L F V    ++   + + S +       AD   N +     D    + L+  +K      F+  ++    NL     +DRE    S  R+ I   D+  S    ++  ++ I++ DVNDNAP + Q           + V    P   I+     TD D+G NG  ++ L   F   ++S +     F +D ++G +  Q  LD+E   ++   + A+D+     + L +S T+ + +LD ND+AP F    S      ++F  +   +G  +  + A+D+D+   N  + Y I   G+    F I+  TG +   K L     D E     ++ + AK+  +          S +++ + V   ++N P+F+  +        I+E    G+    L  T + +   G    N  Y I     N LF +  D    I   R     E   SY + +  RD
Sbjct: 1130 TPAAHAKTRVIVRVLDANDNDPKFQKSKYE-FRIEENLRRGSVVGVVTASDLDLGENAAIRYSLLPINSSFQVHPVTGEISTREP----------LDREL--RELYDLVVEARDQGTPVRSARVPVRIHVSDVNDNAPEIADPQEDVVSVREEQPPGTEVVRVRAVDRDHGQNASITYSIVKGRD--SDGHGLFSIDPTSGVIRTRVVLDHE-ERSIYRLGVAASDGGNPPRETVRMLRVEVLDLNDNRPTFTSSSLVFRVREDAALGHVVGSISPIER----PADVVRNSVEESFEDLRVTYTLNPLTKDLIEAAFD--IDRHSGNLVVARLLDREVQ--SEFRLEIRALDTTASNNPQSSAITVKIEVADVNDNAPEWPQD-------PIDLQVSEATPVGTIIHNFTATDADTGTNGDLQYRLIRYFPQLNESQEQAMSLFRMDSLTGALSLQAPLDFEAVQEYLLIVQALDQSSNVTERLQTSVTVRLRILDANDHAPHFVSPNSSGGKTASLFISDATRIGEVVAHIVAVDEDSG-DNGQLTYEIT-GGNGEGRFRINSQTGIIELVKSLPPATEDVEKGGRFNLIIGAKDHGQPEP-----KKSSLNLHLIVQGSHNNPPRFLQAVYRAT----ILENVPSGSFV--LQVTAKSLH--GAENANLSYEIPAGVANDLFHV--DWQRGIITTRGQFDRESQASYVLPVYVRD 1798          

HSP 7 Score: 117.472 bits (293), Expect = 4.841e-26
Identity = 147/591 (24.87%), Postives = 255/591 (43.15%), Query Frame = 3
Query:  411 ILIKILDQNDKAPQFSSIKRPFFKIPENVEVGKVIDLPMAVDSDSEKYSVRRYSLSYIYHLDQTHDFRLHVTNDNPPRPQLIVNSKLDYEKINKYVFRLFAYDFDEKSIGNSCSTTIEIEIEDLNDNVPKFNQLTYNANIDENKRDDK-LIKFTVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDADTHS-NMIHCKLVDYND--LFYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPIIVTDRDSGLNGKFEFYLEDFRNFSDSSD--FLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLRTRKPLDRETLESISIKVTAKNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAPKF 2165
            I ++I D ND  P+F         + E  + G  +   +A D D    S   YSL+      +TH     +   +P    +   S +D E        + A D     +  S + T+ + I D+NDN P F+Q  YN ++ EN+   + ++K + SDPD G N +V   I +    L++    FE++     + +   LD+E     +EF +LATD+G   LS++A +K+ L ++NDN P    ++   S+  S        + + +V V  TD D  +   +  ++V  N+  +F +D  +    ++     +++T      +  H     + IS TD    R    +  + + I D     P+F +  Y          V  + P+  +V    +            +  +S   D  F I+  SG I   + LD+E K++    I A   G  P+   + + I V D+NDNAP F  S    +V E+  +G  +    A D D+    +  +  ++  G     F ID  +G L   + LD E+ +  ++ VTA +        V +  + + +++ V DVNDN P F
Sbjct:  490 IFLRITDVNDNPPEFEQ-DLYHANVMEVADPGTSVLQVLAHDRDEGLNSALTYSLA---ETPETHAQWFQI---DPQTGLITTRSHIDCETEPVPQLTVVARDGGVPPL--SSTATVLVTIHDVNDNEPIFDQSFYNVSVAENEPVGRCILKVSASDPDCGVNAMVNYTIGEGFKHLTE----FEVRSASGEICIAGELDFERRSS-YEFPVLATDRG--GLSTTAMIKMQLTDVNDNRPVFYPREYKVSLRESPK-ASSQASSTPIVAVVATDPDYGNFGQVSYRIVAGNEAGIFRIDRSTGEIFVVRPDMLSVRT------QPMH----MLNISATDGGNLRS-NADAVVFLSIIDAMQRPPIFEKARY-------NYYVKEDIPRGTVVGSVIAASGDVAHRSPVRYSIYSGDPDGYFSIETNSGNIRIAKPLDHEAKSQVLLNIQAT-LGEPPVYGHTQVNIEVEDVNDNAPEFEASMVRISVPESAELGAPLYAAHAHDKDSGSSGQVTYSLVKESG--KGLFAIDARSGHLILSQHLDYESSQRHTLIVTATDGG------VPSLSTNLTILVDVQDVNDNPPVF 1036          

HSP 8 Score: 108.997 bits (271), Expect = 1.921e-23
Identity = 173/740 (23.38%), Postives = 291/740 (39.32%), Query Frame = 3
Query:  384 TPTDPGTFFILIKILDQNDKAPQFSSIKRPFFKIPENVEVGKVIDLPMAVDSDSEKYSVRRYSLSYIYHLDQTHDFRLHVTNDNPPRPQLIVNSKLDYEKINKYVFRLFAYDFDEKSIGNSCSTTIEIEIEDLNDNVPKFNQLTYNANIDENKRDDKLIKFTVSD-------PDSGRNGI--------VTVNIVDKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHL-FEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDADTHSNM-IHCKLVDY-----------NDLFYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMF----SQQIYIGXXXXXXXXXXXXFPKPIIVTDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFTQRSL-----DYETKNKFRFKIIAIDKGY-QPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLRTRKPLDRETLESISIKVTAKNPNKYSS------HFVRNTDSEVD-----------VMIKVMDVNDNAPKFIP----RLNMKQKVEFIVEQFVDGNTCTELPYTVQDIDDGGINGQNCCYTILENDYNKLFSLMTDTPSYICLQRKPEKYQSYTVTLIARDR 2426
            TP       + I + D ND AP+ +  +     + E    G  +    AVD D  + +   YS+      D    F +     +P    +     LD+E+  + ++RL     D  +        + +E+ DLNDN P F   +    +    R+D  +   V          D  RN +        VT  +   T +L +    F+I R+   L +   LD E       E   L T       SS+  VKI + ++NDN P+     +   VS      E  P  +++     TDADT +N  +  +L+ Y             LF +DS +   +L    P + + + +          L +      S  + ++ T+ ++ ++I D ND+AP F    S      ++  +    +      I+  D DSG NG+  +   +    +    F I+  +G I   +SL     D E   +F   I A D G  +P  SS  + + V   ++N PRF ++ Y   + ENV  G  +  + A       +N ++ Y I P G  +  F +D   G + TR   DRE+  S  + V  ++ N+ S+         R++DS  D           + I V DVNDN+P+F P     L++ +  E  V   V             D+D+G     +  Y+I   +    FS+ + +          E++  YT+ + A DR
Sbjct: 1233 TPVRSARVPVRIHVSDVNDNAPEIADPQEDVVSVREEQPPGTEVVRVRAVDRDHGQNASITYSIVKGRDSDGHGLFSI-----DPTSGVIRTRVVLDHEE--RSIYRLGVAASDGGNPPRETVRMLRVEVLDLNDNRPTFTSSSLVFRV----REDAALGHVVGSISPIERPADVVRNSVEESFEDLRVTYTLNPLTKDLIE--AAFDIDRHSGNLVVARLLDREVQSEFRLEIRALDTTASNNPQSSAITVKIEVADVNDNAPEWPQDPIDLQVS------EATPVGTIIHNFTATDADTGTNGDLQYRLIRYFPQLNESQEQAMSLFRMDSLTGALSL--QAPLDFEAVQEY--------LLIVQALDQSSNVTERLQTSVTVRLRILDANDHAPHFVSPNSSGGKTASLFISDATRIGEVVAHIVAVDEDSGDNGQLTY---EITGGNGEGRFRINSQTGIIELVKSLPPATEDVEKGGRFNLIIGAKDHGQPEPKKSSLNLHLIVQGSHNNPPRFLQAVYRATILENVPSGSFVLQVTA-KSLHGAENANLSYEI-PAGVANDLFHVDWQRGIITTRGQFDRESQASYVLPVYVRDANRQSTLSSSAVRKQRSSDSIGDTSNGQHFDVATIYITVGDVNDNSPEFRPGSCYGLSVPENSEPGVIHTV----------VASDLDEG--PNADLIYSITGGNLGNKFSIDSSSGELSARPLDREQHSRYTLQIQASDR 1926          

HSP 9 Score: 97.8265 bits (242), Expect = 5.432e-20
Identity = 145/587 (24.70%), Postives = 238/587 (40.55%), Query Frame = 3
Query:  411 ILIKILDQNDKAPQF-----SSIKRPFFKIPENVEVGKVIDLPMAVDSDSEKYSVRRYSLSYIYHLDQTHDFRLHVTNDNPPRPQLIVNSKLDYEKINKYVFRLFAYDFDEKSIGNSCSTTIEIEIEDLNDNVPKFNQLTYNANIDENKRDDKLI-KFTVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVK----------------------IHLKNLNDNGPKIKFKKL-GFSV--SNSVSIIEGLPAHSLVVEVRVTDADTHSNMIHC-KLVDYNDLFYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPIIVTDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKG-YQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDH-SSYFDIDRYTGDLRTRKPLDRETLESISIKVTAKN 2069
            + ++ILD ND AP F     S  K     I +   +G+V+   +AVD DS       Y    I   +    FR++         + +  +  D EK  ++   + A D  +     S S  + + ++  ++N P+F Q  Y A I EN      + + T        N  ++  I            +F +      +      D E+         +       +LSSSA  K                      I + ++NDN P+ +     G SV  ++   +I  + A  L       D   ++++I+     +  + F +DS S     L+ +P        +DRE +    L+I  S      SRQ   N  + I +ED NDNAP F    Y G+V E+           I   D D G+N +  + L +   +     F ID  SG I T   LD E +  + F ++A D G Y+  +++  + INVLD+NDN P F    YI  V   +  G  +  +QA+D D    N +I YS+  +    S+ F I+  TG L   + L  E+ + + ++V A++
Sbjct: 1588 VRLRILDANDHAPHFVSPNSSGGKTASLFISDATRIGEVVAHIVAVDEDSGDNGQLTYE---ITGGNGEGRFRINSQTGIIELVKSLPPATEDVEKGGRFNLIIGAKDHGQPEPKKS-SLNLHLIVQGSHNNPPRFLQAVYRATILENVPSGSFVLQVTAKSLHGAENANLSYEIPAGVAN-----DLFHVDWQRGIITTRGQFDRESQASYVLPVYVRDANRQSTLSSSAVRKQRSSDSIGDTSNGQHFDVATIYITVGDVNDNSPEFRPGSCYGLSVPENSEPGVIHTVVASDL-------DEGPNADLIYSITGGNLGNKFSIDSSSGE---LSARP--------LDREQHSRYTLQIQASDRGQPKSRQGHCN--ITIFVEDQNDNAPRFKLSKYTGSVQEDAPLGTSVV--QISAVDADLGVNARLVYSLANETQWQ----FAIDGQSGLITTVGKLDRELQASYNFMVLATDGGRYEVRSATVPVQINVLDINDNRPIFERYPYIGQVPALIQPGQTLLKVQALDADLG-ANAEIVYSLNAENSAVSAKFRINPSTGALSASQSLASESGKLLHLEVVARD 2138          

HSP 10 Score: 89.7373 bits (221), Expect = 1.591e-17
Identity = 157/654 (24.01%), Postives = 258/654 (39.45%), Query Frame = 3
Query:  264 LIQPN-NGVNREAVCRDNPGEKVRKFCKADLCCKLIGFQYLTPTDPGTFFILIKILDQNDKAPQFSSIKRPFFKIPENVEVGKVIDLPMAVDSDSEKYSVRRYSLSYIYHLDQTHDFRLHVTNDNPPRPQLIVNSKLDYEKINKYVFRLFAYDFDEKSIGNSCSTTIEIEIEDLNDNVPKFNQ---------LTYNANIDENKRDD-KLIKFTVSDPDSGRNGIVTVNIVDKTDE---LSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGP-KIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDADTHSNMIHCKLVDYNDLFYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLN---IQIEDVNDNAPMFSQQI-YIGXXXXXXXXXXXXFPKPIIVTDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNK-FRFKIIAIDKGYQ-PLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPK-GDHSSY--FDIDRYTG--------DLRTRKPLDRETL--------ESISIKVTAKNPNKYSSHFVRNT 2105
            +I+P  +G+ R  +  D    ++R   K     K+I      P   GT  I ++I+D ND  P F         + E  E+G VI    A D D+      R        ++    F L   +      +L++  +LDYE   +Y   + A D       +   T + + + D NDN P F           L   + I E+   D  L+    +D DS  N    + I++   E   +     +  +  +     + +S DY          ++A D G P+L SS  +++     NDNG  + +F +  +       I E  P  S+V+++     D    +I             +  S F  LL  K   L  +  +DRE N    LR+ +S     P      + S     I I D NDN P+F +   Y   + E             I  D+++  N +  +   D  + +D   F ID ++G +F    LDY++  K +   I A D  +Q PL S     + + D NDN P+F  + Y+  + EN  VG  +    A D D     + + YSI P   D SS+  F +D  +G        D   R+  D E L         S++++V  ++ ++++  F   T
Sbjct: 2371 VIEPAFSGIVRTNIVLD---REIRDIYK----LKIIATDEGVPQMTGTATIRVQIVDVNDNQPTFP--PNNLVTVSEATELGAVITSISANDVDTYPALTYRLGAESTVDIENMSIFALDRYSG-----KLVLKRRLDYELQQEYELDVIASD-----AAHEARTVLTVRVNDENDNAPVFLAQQPPAYFAILPAISEISESLSVDFDLLTVNATDADSEGNNSKVIYIIEPAQEGFSVHPSNGVVSVNMSRLQPAVSSSGDYFV-------RIIAKDAGKPALKSSTLLRVQA---NDNGSGRSQFLQNQYRAQ----ISEAAPLGSVVLQLGQDALDQSLAIIAG-----------NEESAFE-LLQSKAIVL--VKPLDRERNDLYKLRLVLSHPHGPPLISSLNSSSGISVIITILDANDNFPIFDRSAKYEAEISELAPLRYSIAQLQAIDADQENTPNSEVVY---DITSGNDEHMFTIDLVTGVLFVNNRLDYDSGAKSYELIIRACDSHHQRPLCSLQPFRLELHDENDNEPKFPLTEYVHFLAENEPVGSSVFRAHASDLDKGPFGQ-LNYSIGPAPSDESSWKMFRVDSESGLVTSAFVFDYEQRQRYDMELLASDMGGKKASVAVRVEIESRDEFTPQFTERT 2973          

HSP 11 Score: 80.1073 bits (196), Expect = 1.464e-14
Identity = 80/259 (30.89%), Postives = 123/259 (47.49%), Query Frame = 3
Query: 1698 LDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPK-GDHSSYFDIDRYTGDLRTRKPLDRETLESISIKVTAKNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAPKF---------IPRLN-MKQKVEFIVEQFV-DGNTCTELPYTVQDIDDGGINGQNCCYTILENDYNKLFSLMTDTPSYICLQRKPEKYQSYTVTLIARDR--PP 2432
            LD ET   +   I A+D G  PL    T+ I + D+NDN P F++S Y   V EN +VG  +  + A D D D +N  + Y+I  +  D    F ID  TG +   K LD ET E   + V AK+      H  +  ++   V I+V DVNDN P            P+++   Q  EF+    V D ++ TE  Y   ++    +NG +  + +   D N ++ ++   P    L R  E   +YT++++A D+  PP
Sbjct:  244 LDRETTPGYSLLIEALDGGTPPLRGFMTVNITIQDVNDNQPIFNQSRYFATVPENATVGTSVLQVYASDTDAD-ENGLVEYAINRRQSDKEQMFRIDPRTGAIYINKALDFETKELHELVVVAKD------HGEQPLETTAFVSIRVTDVNDNQPTINVIFLSDDASPKISESAQPGEFVARISVHDPDSKTE--YANVNVT---LNGGDGHFALTTRD-NSIYLVIVHLP----LDR--EIVSNYTLSVVATDKGTPP 483          

HSP 12 Score: 68.5514 bits (166), Expect = 4.014e-11
Identity = 164/712 (23.03%), Postives = 287/712 (40.31%), Query Frame = 3
Query:  411 ILIKILDQNDKAPQFSSIKRPFFKIPENVEVGKVIDLPMAVDSDSEKYSVRRYSLSYIYHLDQTHDFRLHVTNDNPPRPQLIVNSKLDYEKINKYVFRLFAYDFDEKSIGNSCSTTIEIEIEDLNDNVPKF--NQLTYNANIDENKRDDKLIKFTVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKK--LGFSVSNSVS-IIEGLPAHSLVVEVRVTDADTHSNMIHCKLVDYNDLFYLDSPSKFNTLLNYKPFNLKTINKIDR-----ESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPIIVTDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSST------ITINVLDLNDNAPRFSES-HYIFNVFENVSVGWKIGTLQAIDDDTDRK-NKDIFYSIEPKGDHSSYFDIDRYTGDLRTRKPLDRET-LESISIKVTAKNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAPKFIPRLNMKQKVEFIVEQFVDGNTCTELPYTVQDIDDGGINGQNCCYTILENDYNKLFSLMTDTPSYICLQR---KPEKYQSYTVTLIARDRPPNVEGGLTSKISFPVLI 2480
            ++I++ D+ND +P+FS  K+    + E    G  +    A DSD+   +  RY +     +D  HD    +     P    IV + +  ++  + +++L     DE     + + TI ++I D+NDN P F  N L     + E      +I  ++S  D      +T  +  ++    +   IF + R    L L   LDYE     +E  ++A+D    +  +   + + + + NDN P    ++    F++  ++S I E L     ++ V  TDAD+  N         + + Y+  P++     +  P N      + R      S+   F+RI I+    +P+ + +T   L +Q  D       F Q  Y       Q++        ++   +D+      +  L       +S+  L+   S  I   + LD E  + ++ +++       PL SS        + I +LD NDN P F  S  Y   + E   + + I  LQAID D +   N ++ Y I   G+    F ID  TG L     LD ++  +S  + + A +     SH  R   S     +++ D NDN PKF     + + V F+ E    G++         D+D G     N       +D +       D+ S +         E+ Q Y + L+A D      GG  + ++  V I
Sbjct: 2308 LVIELEDENDNSPKFSQ-KQFVATVSEGNNKGTFVAQVHAFDSDAGSNARLRYHI-----VDGNHDNAFVIE----PAFSGIVRTNIVLDREIRDIYKLKIIATDEGVPQMTGTATIRVQIVDVNDNQPTFPPNNLV---TVSEATELGAVIT-SISANDVDTYPALTYRLGAESTVDIENMSIFALDRYSGKLVLKRRLDYELQQE-YELDVIASDA---AHEARTVLTVRVNDENDNAPVFLAQQPPAYFAILPAISEISESLSVDFDLLTVNATDADSEGN--------NSKVIYIIEPAQEG--FSVHPSNGVVSVNMSRLQPAVSSSGDYFVRI-IAKDAGKPALKSST--LLRVQANDNGSGRSQFLQNQY-----RAQISEAAPLGSVVLQLGQDA-----LDQSLAIIAGNEESAFELLQ--SKAIVLVKPLDRERNDLYKLRLVLSHPHGPPLISSLNSSSGISVIITILDANDNFPIFDRSAKYEAEISELAPLRYSIAQLQAIDADQENTPNSEVVYDIT-SGNDEHMFTIDLVTGVLFVNNRLDYDSGAKSYELIIRACD-----SHHQRPLCSLQPFRLELHDENDNEPKF----PLTEYVHFLAENEPVGSSV--FRAHASDLDKGPFGQLNYSIGPAPSDESSWKMFRVDSESGLVTSAFVFDYEQRQRYDMELLASDM-----GGKKASVAVRVEI 2959          
BLAST of Protocadherin Fat 1 vs. Ensembl Fly
Match: ds (gene:FBgn0284247 transcript:FBtr0343249)

HSP 1 Score: 187.193 bits (474), Expect = 2.459e-47
Identity = 176/620 (28.39%), Postives = 287/620 (46.29%), Query Frame = 3
Query:  417 IKILDQNDKAPQF-SSIKRPFFKIPENVEVGKVIDLPMAVDSDSEK-----YSVRRYSLSYIYHLDQTHDFRLHVTNDNPPRPQLIVNSKLDYEKINKYVFRLFAYDFDEKSIGNSCSTTIEIEIEDLNDNVPKFNQLTYNANIDENKR-DDKLIKFTVSDPDSGRNGIVTVNIVDK----------TDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDADTHSNM-IHCKLVDYNDLFYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTD-SEPSRQITTNESLNIQIEDVNDNAPMFS--QQIYIGXXXXXXXXXXXXFPKPIIVTDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDR---------KNKDIFYSIEP--KGDHSSYFDIDRYTGDLRTRKPLDRET-----LESISIKVTAKNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAPKF 2165
            I++ D ND AP+F +S+ R    +PE+ E+G  +    A D DS       YS+ + S   ++ +D                  LI++  LDYE   ++   + A D    S+  S + TI ++++D+NDN P F +  Y+ N+ E++  + ++I+   SD D+G N  +T  IVD           + ++S+ F IF    N  ++ L   LD ET    ++ T+LATD GTP+  +  +V + + + NDN PK +  K  F +       E L   S+V  V  +D D   N  I   L+  N  F +   +            + T   +DRE        + +   D   P R  +    + I + DVNDNAP  +  Q+  +   +E      V   + +   DRD G N    + +   R+      F ID  SG I T+  LD+E ++ +R  + A D G  P  +   + + VLDLNDN P F+ S  +F V E+ ++G  +G++  I+   D          ++  + Y++ P  K    + FDIDR++G+L   + LDRE      LE  ++  TA N  + S+         + V I+V DVNDNAP++
Sbjct:  919 IEVEDVNDNAPEFEASMVR--ISVPESAELGAPLYAAHAHDKDSGSSGQVTYSLVKESGKGLFAIDARSG-------------HLILSQHLDYESSQRHTLIVTATDGGVPSL--STNLTILVDVQDVNDNPPVFEKDEYSVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFP---NSGWIYLRAPLDRETRDR-YQLTVLATDNGTPAAHAKTRVIVRVLDANDNDPKFQKSKYEFRIE------ENLRRGSVVGVVTASDLDLGENAAIRYSLLPINSSFQVHPVTG----------EISTREPLDRELRE--LYDLVVEARDQGTPVR--SARVPVRIHVSDVNDNAPEIADPQEDVVSVREEQPPGTEVVRVRAV---DRDHGQNASITYSIVKGRDSDGHGLFSIDPTSGVIRTRVVLDHEERSIYRLGVAASDGGNPPRETVRMLRVEVLDLNDNRPTFTSSSLVFRVREDAALGHVVGSISPIERPADVVRNSVEESFEDLRVTYTLNPLTKDLIEAAFDIDRHSGNLVVARLLDREVQSEFRLEIRALDTTASNNPQSSA---------ITVKIEVADVNDNAPEW 1485          

HSP 2 Score: 162.54 bits (410), Expect = 9.183e-40
Identity = 167/593 (28.16%), Postives = 268/593 (45.19%), Query Frame = 3
Query:  411 ILIKILDQNDKAPQFSSIKRPFFKIPENV--EVGKVIDLPMAVDSDSEKYSVRRYSLSYIYHLDQTHDFRL--HVTNDNPPRPQLIVNSKLDYEKINKYVFRLFAYDFDEKSIGNSCSTTIEIEIEDLNDNVPKFNQLTYNANIDENKR-DDKLIKFTVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDADTHSNMIHCKLVDYNDLFYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPIIVTDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLRTRKPLDRETLESISIKVTAKNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAPKFIPR 2174
            +L+ + D+ND AP F        + PEN   EV + + LP A D D E Y+ +RY+   I   +    FRL  H   D      L ++  LD E    Y   + A D     +      T+ I I+D+NDN P FNQ  Y A + EN      +++   SD D+  NG+V   I  +    S + ++F I      + +  +LD+ET   L E  ++A D G   L ++A V I + ++NDN P I    L    S  +S  E       V  + V D D+ +   +  +       +    ++ N++     + +     +DRE      L +  +   + P   +  ++S+ ++I DVNDN P F Q +Y  NV E            ++  DRD GLN    + L +    + +  F ID  +G I T+  +D ET+   +  ++A D G  PL+S++T+ + + D+NDN P F +S Y  +V EN  VG  I  + A D D    N  + Y+I     H + F++   +G++     LD E   S    V A +    S+  +        + +++ DVNDN P F PR
Sbjct:  160 VLVTVKDENDNAPTFPQTSM-HIEFPENTPREVKRTL-LP-ARDLDLEPYNTQRYN---IVSGNVNDAFRLSSHRERDGVLYLDLQISGFLDRETTPGYSLLIEALDGGTPPL--RGFMTVNITIQDVNDNQPIFNQSRYFATVPENATVGTSVLQVYASDTDADENGLVEYAINRRQ---SDKEQMFRIDPRTGAIYINKALDFETK-ELHELVVVAKDHGEQPLETTAFVSIRVTDVNDNQPTINVIFLSDDASPKIS--ESAQPGEFVARISVHDPDSKTEYANVNVTLNGGDGHFALTTRDNSI-----YLVIVHLPLDREIVSNYTLSVVATDKGTPP---LHASKSIFLRITDVNDNPPEFEQDLYHANVMEVADPGTSVLQ--VLAHDRDEGLNSALTYSLAETPE-THAQWFQIDPQTGLITTRSHIDCETEPVPQLTVVARDGGVPPLSSTATVLVTIHDVNDNEPIFDQSFYNVSVAENEPVGRCILKVSASDPDCG-VNAMVNYTIGEGFKHLTEFEVRSASGEICIAGELDFERRSSYEFPVLATDRGGLSTTAM--------IKMQLTDVNDNRPVFYPR 718          

HSP 3 Score: 144.436 bits (363), Expect = 3.363e-34
Identity = 159/617 (25.77%), Postives = 273/617 (44.25%), Query Frame = 3
Query:  381 LTPTDPGTF------FILIKILDQNDKAPQFSSIKRPFFKIPENVEVGKVIDLPMAVDSDSEKYSVRRYSLSYIYHLDQTHDFRLHVTNDNPPRPQLIVNSKLDYEKINKYVFRLFAYDFDEKSIGNSCSTTIEIEIEDLNDNVPKFNQLTYNANIDENKR-DDKLIKFTVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDADTHSNM-IHCKLVDY------NDLFYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTD-SEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPIIVTDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHY-IFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKG---DHSSYFDIDRYTGDLRTRKPLDRETLESISIKVTAK---NPNKYSSHFVRNTDSEVDVMIKVMDVNDNAPKF 2165
            ++ TD G         + + I+D   + P F   +  ++ + E++  G V+   +A   D    S  RYS   IY  D    F +   + N     + +   LD+E  ++ +  + A   +    G+   T + IE+ED+NDN P+F       ++ E+      L      D DSG +G VT ++V ++ +      +F I      L L   LDYE+        + ATD G PSLS++  + + ++++NDN P  +  +   +VS S SI      ++ +++V  +D DT +N  I  ++VD       N +   D    F    N     L+    +DRE+      ++T+  TD   P+    T   + +++ D NDN P F +  Y       +     +    +  +D D G N    + L        +S F +  ++G+I T+  LD E +  +   + A D+G    ++   + I+V D+NDNAP  ++    + +V E    G ++  ++A+D D   +N  I YSI  KG   D    F ID  +G +RTR  LD E      + V A    NP + +   +R         ++V+D+NDN P F
Sbjct:  797 ISATDGGNLRSNADAVVFLSIIDAMQRPPIFEKARYNYY-VKEDIPRGTVVGSVIAASGDVAHRSPVRYS---IYSGDPDGYFSIETNSGN-----IRIAKPLDHEAKSQVLLNIQATLGEPPVYGH---TQVNIEVEDVNDNAPEFEASMVRISVPESAELGAPLYAAHAHDKDSGSSGQVTYSLVKESGK-----GLFAIDARSGHLILSQHLDYESS-QRHTLIVTATDGGVPSLSTNLTILVDVQDVNDNPPVFEKDEYSVNVSESRSI------NAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIYLRA--PLDRETR--DRYQLTVLATDNGTPAAHAKTR--VIVRVLDANDNDPKFQKSKY--EFRIEENLRRGSVVGVVTASDLDLGENAAIRYSL-----LPINSSFQVHPVTGEISTREPLDRELRELYDLVVEARDQGTPVRSARVPVRIHVSDVNDNAPEIADPQEDVVSVREEQPPGTEVVRVRAVDRDHG-QNASITYSIV-KGRDSDGHGLFSIDPTSGVIRTRVVLDHEERSIYRLGVAASDGGNPPRETVRMLR---------VEVLDLNDNRPTF 1365          

HSP 4 Score: 140.198 bits (352), Expect = 6.315e-33
Identity = 174/693 (25.11%), Postives = 305/693 (44.01%), Query Frame = 3
Query:  402 TFFILIKILDQNDKAPQFSSI-----KRPFFKIPENVEVGKVIDLPMAVDSDSE-KYSVRRYSLSYIYHLDQTHDFRLHVTNDNPPRPQLIVNSKLDYEKINKYVFRLFAYDFDEKSIGNSCSTTIEIEIEDLNDNVPKFNQLTYNANIDE-NKRDDKLIKFTVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDADTHSNMIHCKLVDYNDLFYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPIIV---TDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFTQR--SLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLRTRKPLDRETLESI--SIKVTAKNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAPKF---IPRLNMKQKVEFIVEQFVDGNTCTELPYTVQDID-DGGINGQNCCYTILENDYNKLFSLMTDTPSYICLQRKP-EKYQSYTVTLIARD 2423
            T F+ I++ D ND  P  + I       P  KI E+ + G+ +      D DS+ +Y+    +L+         D    +T  +     +IV+  LD E ++ Y   + A D     +    S +I + I D+NDN P+F Q  Y+AN+ E       +++    D D G N  +T ++ + T E   ++  F+I      +   + +D ET+P + + T++A D G P LSS+A V + + ++NDN P   F +  ++VS    + E  P    +++V  +D D   N     +V+Y         ++F          +      +R S++       +  TD      ++T   + +Q+ DVNDN P+F  + Y  ++ E+          PI+    TD D G  G+  + +      +++  F ID+ +G+IF  R   L   T+      I A D G     + + + ++++D     P F ++ Y + V E++  G  +G++ A   D   ++  + YSI   GD   YF I+  +G++R  KPLD E    +  +I+ T   P  Y             V I+V DVNDNAP+F   + R+++ +  E                Y     D D G +GQ   Y++++     LF++   +   I  Q    E  Q +T+ + A D
Sbjct:  376 TAFVSIRVTDVNDNQPTINVIFLSDDASP--KISESAQPGEFVARISVHDPDSKTEYANVNVTLN-------GGDGHFALTTRDNSIYLVIVHLPLDREIVSNYTLSVVATDKGTPPL--HASKSIFLRITDVNDNPPEFEQDLYHANVMEVADPGTSVLQVLAHDRDEGLNSALTYSLAE-TPETHAQW--FQIDPQTGLITTRSHIDCETEP-VPQLTVVARDGGVPPLSSTATVLVTIHDVNDNEPI--FDQSFYNVS----VAENEPVGRCILKVSASDPDCGVN----AMVNYTIGEGFKHLTEFEVRSASGEICIAGELDFERRSSY----EFPVLATDRG---GLSTTAMIKMQLTDVNDNRPVFYPREYKVSLRESPKASSQASSTPIVAVVATDPDYGNFGQVSYRIV---AGNEAGIFRIDRSTGEIFVVRPDMLSVRTQPMHMLNISATDGGNLRSNADAVVFLSIIDAMQRPPIFEKARYNYYVKEDIPRGTVVGSVIAASGDVAHRSP-VRYSIY-SGDPDGYFSIETNSGNIRIAKPLDHEAKSQVLLNIQATLGEPPVY---------GHTQVNIEVEDVNDNAPEFEASMVRISVPESAELGAPL-----------YAAHAHDKDSGSSGQ-VTYSLVKESGKGLFAIDARSGHLILSQHLDYESSQRHTLIVTATD 1010          

HSP 5 Score: 129.413 bits (324), Expect = 1.279e-29
Identity = 151/639 (23.63%), Postives = 275/639 (43.04%), Query Frame = 3
Query:  411 ILIKILDQNDKAPQFSSIKRPFFKIPENVEVGKVIDLPMAVDSDSEKYSVRRYSLS----YIYHLDQTHDFRLHVTNDNPPRPQLIVNSKLDYEKINKYVFRLFAYDFDEKSIGNSCSTTIEIEIEDLNDNVPKFNQLTYNANIDENKRDDK-LIKFTVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDADTHSNMIHCKLVDYND--LFYLDSPS---KFNT--LLNYKPFNLKTINKIDR---------------------ESNHGSFLRITISCTDSEPSRQ-------------ITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPIIVTDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDD-----TDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLRTRKPLDRETLESISIKVTAKNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAPKFIPR 2174
            I I + DQND AP+F  + +    + E+  +G  +    AVD+D    +   YSL+    + + +D                  +    KLD E    Y F + A D     +  S +  ++I + D+NDN P F +  Y   +    +  + L+K    D D G N  +  ++  +   +S +F+I     +   L    SL  E+   L    ++A D+G P  SS   +++ +       P ++F+   + V     + E  P+ + +++V    +D     +       N+  +  LDS S   + N   LL+Y  F+  +++ + R                       +  +    + + T+S+P+               + +   L I++ED NDN+P FSQ+ ++  V E        F   +   D D+G N +  +++ D  +  D++  +    SG + T   LD E ++ ++ KIIA D+G   +T ++TI + ++D+NDN P F  ++ +  V E   +G  I ++ A D D     T R   +    IE    + S F +DRY+G L  ++ LD E  +   + V A +    ++H  R       + ++V D NDNAP F+ +
Sbjct: 1938 ITIFVEDQNDNAPRFK-LSKYTGSVQEDAPLGTSVVQISAVDADLGVNARLVYSLANETQWQFAIDGQSGL-------------ITTVGKLDRELQASYNFMVLATDGGRYEV-RSATVPVQINVLDINDNRPIFERYPYIGQVPALIQPGQTLLKVQALDADLGANAEIVYSLNAENSAVSAKFRI---NPSTGALSASQSLASESG-KLLHLEVVARDKGNPPQSSLGLIELLIGEAPQGTPVLRFQNETYRVM----LKENSPSGTRLLQVVALRSDGRRQKVQFSFGAGNEDGILSLDSLSGEIRVNKPHLLDYDRFSTPSMSALSRGRALHYEEEIDESSEEDPNNSTRSQRALTSSSFALTNSQPNEIRVVLVARTADAPFLASYAELVIELEDENDNSPKFSQKQFVATVSEGNNKGT--FVAQVHAFDSDAGSNARLRYHIVDGNH--DNAFVIEPAFSGIVRTNIVLDREIRDIYKLKIIATDEGVPQMTGTATIRVQIVDVNDNQPTFPPNNLV-TVSEATELGAVITSISANDVDTYPALTYRLGAESTVDIE----NMSIFALDRYSGKLVLKRRLDYELQQEYELDVIASD----AAHEARTV-----LTVRVNDENDNAPVFLAQ 2535          

HSP 6 Score: 119.013 bits (297), Expect = 1.682e-26
Identity = 169/717 (23.57%), Postives = 295/717 (41.14%), Query Frame = 3
Query:  384 TPTDPGTFFILIKILDQNDKAPQFSSIKRPFFKIPENVEVGKVIDLPMAVDSDSEKYSVRRYSLSYIYHLDQTHDFRLHVTNDNPPRPQLIVNSKLDYEKINKYVFRLFAYDFDEKSIGNSCSTTIEIEIEDLNDNVPKFN--QLTYNANIDENKRDDKLIKFTVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDADTHSNMIHCKLVDYNDLFYLDSPSK------FNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTDSEPSRQITTNE-SLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPIIV-----TDRDSGLNGKFEFYL-EDFRNFSDSSD-----FLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKG---YQPLTSSSTITINVLDLNDNAPRF----SESHYIFNVF--ENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLRTRKPL-----DRETLESISIKVTAKNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAPKFIPRLNMKQKVEFIVEQFVDGNTCTELPYTVQDIDDGGINGQNCCYTILENDYNKLFSLMTDTPSYICLQRKP---EKYQSYTVTLIARD 2423
            TP       +++++LD ND  P+F   K   F+I EN+  G V+ +  A D D  + +  RYSL  I    Q H     ++   P          LD E   + ++ L     D+ +   S    + I + D+NDN P+    Q    +  +E     ++++    D D G+N  +T +IV   D  S    +F I      +     LD+E +  ++   + A+D G P   +   +++ + +LNDN P      L F V    ++   + + S +       AD   N +     D    + L+  +K      F+  ++    NL     +DRE    S  R+ I   D+  S    ++  ++ I++ DVNDNAP + Q           + V    P   I+     TD D+G NG  ++ L   F   ++S +     F +D ++G +  Q  LD+E   ++   + A+D+     + L +S T+ + +LD ND+AP F    S      ++F  +   +G  +  + A+D+D+   N  + Y I   G+    F I+  TG +   K L     D E     ++ + AK+  +          S +++ + V   ++N P+F+  +        I+E    G+    L  T + +   G    N  Y I     N LF +  D    I   R     E   SY + +  RD
Sbjct: 1130 TPAAHAKTRVIVRVLDANDNDPKFQKSKYE-FRIEENLRRGSVVGVVTASDLDLGENAAIRYSLLPINSSFQVHPVTGEISTREP----------LDREL--RELYDLVVEARDQGTPVRSARVPVRIHVSDVNDNAPEIADPQEDVVSVREEQPPGTEVVRVRAVDRDHGQNASITYSIVKGRD--SDGHGLFSIDPTSGVIRTRVVLDHE-ERSIYRLGVAASDGGNPPRETVRMLRVEVLDLNDNRPTFTSSSLVFRVREDAALGHVVGSISPIER----PADVVRNSVEESFEDLRVTYTLNPLTKDLIEAAFD--IDRHSGNLVVARLLDREVQ--SEFRLEIRALDTTASNNPQSSAITVKIEVADVNDNAPEWPQD-------PIDLQVSEATPVGTIIHNFTATDADTGTNGDLQYRLIRYFPQLNESQEQAMSLFRMDSLTGALSLQAPLDFEAVQEYLLIVQALDQSSNVTERLQTSVTVRLRILDANDHAPHFVSPNSSGGKTASLFISDATRIGEVVAHIVAVDEDSG-DNGQLTYEIT-GGNGEGRFRINSQTGIIELVKSLPPATEDVEKGGRFNLIIGAKDHGQPEP-----KKSSLNLHLIVQGSHNNPPRFLQAVYRAT----ILENVPSGSFV--LQVTAKSLH--GAENANLSYEIPAGVANDLFHV--DWQRGIITTRGQFDRESQASYVLPVYVRD 1798          

HSP 7 Score: 117.472 bits (293), Expect = 4.841e-26
Identity = 147/591 (24.87%), Postives = 255/591 (43.15%), Query Frame = 3
Query:  411 ILIKILDQNDKAPQFSSIKRPFFKIPENVEVGKVIDLPMAVDSDSEKYSVRRYSLSYIYHLDQTHDFRLHVTNDNPPRPQLIVNSKLDYEKINKYVFRLFAYDFDEKSIGNSCSTTIEIEIEDLNDNVPKFNQLTYNANIDENKRDDK-LIKFTVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDADTHS-NMIHCKLVDYND--LFYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPIIVTDRDSGLNGKFEFYLEDFRNFSDSSD--FLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLRTRKPLDRETLESISIKVTAKNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAPKF 2165
            I ++I D ND  P+F         + E  + G  +   +A D D    S   YSL+      +TH     +   +P    +   S +D E        + A D     +  S + T+ + I D+NDN P F+Q  YN ++ EN+   + ++K + SDPD G N +V   I +    L++    FE++     + +   LD+E     +EF +LATD+G   LS++A +K+ L ++NDN P    ++   S+  S        + + +V V  TD D  +   +  ++V  N+  +F +D  +    ++     +++T      +  H     + IS TD    R    +  + + I D     P+F +  Y          V  + P+  +V    +            +  +S   D  F I+  SG I   + LD+E K++    I A   G  P+   + + I V D+NDNAP F  S    +V E+  +G  +    A D D+    +  +  ++  G     F ID  +G L   + LD E+ +  ++ VTA +        V +  + + +++ V DVNDN P F
Sbjct:  490 IFLRITDVNDNPPEFEQ-DLYHANVMEVADPGTSVLQVLAHDRDEGLNSALTYSLA---ETPETHAQWFQI---DPQTGLITTRSHIDCETEPVPQLTVVARDGGVPPL--SSTATVLVTIHDVNDNEPIFDQSFYNVSVAENEPVGRCILKVSASDPDCGVNAMVNYTIGEGFKHLTE----FEVRSASGEICIAGELDFERRSS-YEFPVLATDRG--GLSTTAMIKMQLTDVNDNRPVFYPREYKVSLRESPK-ASSQASSTPIVAVVATDPDYGNFGQVSYRIVAGNEAGIFRIDRSTGEIFVVRPDMLSVRT------QPMH----MLNISATDGGNLRS-NADAVVFLSIIDAMQRPPIFEKARY-------NYYVKEDIPRGTVVGSVIAASGDVAHRSPVRYSIYSGDPDGYFSIETNSGNIRIAKPLDHEAKSQVLLNIQAT-LGEPPVYGHTQVNIEVEDVNDNAPEFEASMVRISVPESAELGAPLYAAHAHDKDSGSSGQVTYSLVKESG--KGLFAIDARSGHLILSQHLDYESSQRHTLIVTATDGG------VPSLSTNLTILVDVQDVNDNPPVF 1036          

HSP 8 Score: 108.997 bits (271), Expect = 1.921e-23
Identity = 173/740 (23.38%), Postives = 291/740 (39.32%), Query Frame = 3
Query:  384 TPTDPGTFFILIKILDQNDKAPQFSSIKRPFFKIPENVEVGKVIDLPMAVDSDSEKYSVRRYSLSYIYHLDQTHDFRLHVTNDNPPRPQLIVNSKLDYEKINKYVFRLFAYDFDEKSIGNSCSTTIEIEIEDLNDNVPKFNQLTYNANIDENKRDDKLIKFTVSD-------PDSGRNGI--------VTVNIVDKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHL-FEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDADTHSNM-IHCKLVDY-----------NDLFYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMF----SQQIYIGXXXXXXXXXXXXFPKPIIVTDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFTQRSL-----DYETKNKFRFKIIAIDKGY-QPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLRTRKPLDRETLESISIKVTAKNPNKYSS------HFVRNTDSEVD-----------VMIKVMDVNDNAPKFIP----RLNMKQKVEFIVEQFVDGNTCTELPYTVQDIDDGGINGQNCCYTILENDYNKLFSLMTDTPSYICLQRKPEKYQSYTVTLIARDR 2426
            TP       + I + D ND AP+ +  +     + E    G  +    AVD D  + +   YS+      D    F +     +P    +     LD+E+  + ++RL     D  +        + +E+ DLNDN P F   +    +    R+D  +   V          D  RN +        VT  +   T +L +    F+I R+   L +   LD E       E   L T       SS+  VKI + ++NDN P+     +   VS      E  P  +++     TDADT +N  +  +L+ Y             LF +DS +   +L    P + + + +          L +      S  + ++ T+ ++ ++I D ND+AP F    S      ++  +    +      I+  D DSG NG+  +   +    +    F I+  +G I   +SL     D E   +F   I A D G  +P  SS  + + V   ++N PRF ++ Y   + ENV  G  +  + A       +N ++ Y I P G  +  F +D   G + TR   DRE+  S  + V  ++ N+ S+         R++DS  D           + I V DVNDN+P+F P     L++ +  E  V   V             D+D+G     +  Y+I   +    FS+ + +          E++  YT+ + A DR
Sbjct: 1233 TPVRSARVPVRIHVSDVNDNAPEIADPQEDVVSVREEQPPGTEVVRVRAVDRDHGQNASITYSIVKGRDSDGHGLFSI-----DPTSGVIRTRVVLDHEE--RSIYRLGVAASDGGNPPRETVRMLRVEVLDLNDNRPTFTSSSLVFRV----REDAALGHVVGSISPIERPADVVRNSVEESFEDLRVTYTLNPLTKDLIE--AAFDIDRHSGNLVVARLLDREVQSEFRLEIRALDTTASNNPQSSAITVKIEVADVNDNAPEWPQDPIDLQVS------EATPVGTIIHNFTATDADTGTNGDLQYRLIRYFPQLNESQEQAMSLFRMDSLTGALSL--QAPLDFEAVQEY--------LLIVQALDQSSNVTERLQTSVTVRLRILDANDHAPHFVSPNSSGGKTASLFISDATRIGEVVAHIVAVDEDSGDNGQLTY---EITGGNGEGRFRINSQTGIIELVKSLPPATEDVEKGGRFNLIIGAKDHGQPEPKKSSLNLHLIVQGSHNNPPRFLQAVYRATILENVPSGSFVLQVTA-KSLHGAENANLSYEI-PAGVANDLFHVDWQRGIITTRGQFDRESQASYVLPVYVRDANRQSTLSSSAVRKQRSSDSIGDTSNGQHFDVATIYITVGDVNDNSPEFRPGSCYGLSVPENSEPGVIHTV----------VASDLDEG--PNADLIYSITGGNLGNKFSIDSSSGELSARPLDREQHSRYTLQIQASDR 1926          

HSP 9 Score: 97.8265 bits (242), Expect = 5.432e-20
Identity = 145/587 (24.70%), Postives = 238/587 (40.55%), Query Frame = 3
Query:  411 ILIKILDQNDKAPQF-----SSIKRPFFKIPENVEVGKVIDLPMAVDSDSEKYSVRRYSLSYIYHLDQTHDFRLHVTNDNPPRPQLIVNSKLDYEKINKYVFRLFAYDFDEKSIGNSCSTTIEIEIEDLNDNVPKFNQLTYNANIDENKRDDKLI-KFTVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVK----------------------IHLKNLNDNGPKIKFKKL-GFSV--SNSVSIIEGLPAHSLVVEVRVTDADTHSNMIHC-KLVDYNDLFYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPIIVTDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKG-YQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDH-SSYFDIDRYTGDLRTRKPLDRETLESISIKVTAKN 2069
            + ++ILD ND AP F     S  K     I +   +G+V+   +AVD DS       Y    I   +    FR++         + +  +  D EK  ++   + A D  +     S S  + + ++  ++N P+F Q  Y A I EN      + + T        N  ++  I            +F +      +      D E+         +       +LSSSA  K                      I + ++NDN P+ +     G SV  ++   +I  + A  L       D   ++++I+     +  + F +DS S     L+ +P        +DRE +    L+I  S      SRQ   N  + I +ED NDNAP F    Y G+V E+           I   D D G+N +  + L +   +     F ID  SG I T   LD E +  + F ++A D G Y+  +++  + INVLD+NDN P F    YI  V   +  G  +  +QA+D D    N +I YS+  +    S+ F I+  TG L   + L  E+ + + ++V A++
Sbjct: 1588 VRLRILDANDHAPHFVSPNSSGGKTASLFISDATRIGEVVAHIVAVDEDSGDNGQLTYE---ITGGNGEGRFRINSQTGIIELVKSLPPATEDVEKGGRFNLIIGAKDHGQPEPKKS-SLNLHLIVQGSHNNPPRFLQAVYRATILENVPSGSFVLQVTAKSLHGAENANLSYEIPAGVAN-----DLFHVDWQRGIITTRGQFDRESQASYVLPVYVRDANRQSTLSSSAVRKQRSSDSIGDTSNGQHFDVATIYITVGDVNDNSPEFRPGSCYGLSVPENSEPGVIHTVVASDL-------DEGPNADLIYSITGGNLGNKFSIDSSSGE---LSARP--------LDREQHSRYTLQIQASDRGQPKSRQGHCN--ITIFVEDQNDNAPRFKLSKYTGSVQEDAPLGTSVV--QISAVDADLGVNARLVYSLANETQWQ----FAIDGQSGLITTVGKLDRELQASYNFMVLATDGGRYEVRSATVPVQINVLDINDNRPIFERYPYIGQVPALIQPGQTLLKVQALDADLG-ANAEIVYSLNAENSAVSAKFRINPSTGALSASQSLASESGKLLHLEVVARD 2138          

HSP 10 Score: 89.7373 bits (221), Expect = 1.591e-17
Identity = 157/654 (24.01%), Postives = 258/654 (39.45%), Query Frame = 3
Query:  264 LIQPN-NGVNREAVCRDNPGEKVRKFCKADLCCKLIGFQYLTPTDPGTFFILIKILDQNDKAPQFSSIKRPFFKIPENVEVGKVIDLPMAVDSDSEKYSVRRYSLSYIYHLDQTHDFRLHVTNDNPPRPQLIVNSKLDYEKINKYVFRLFAYDFDEKSIGNSCSTTIEIEIEDLNDNVPKFNQ---------LTYNANIDENKRDD-KLIKFTVSDPDSGRNGIVTVNIVDKTDE---LSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGP-KIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDADTHSNMIHCKLVDYNDLFYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLN---IQIEDVNDNAPMFSQQI-YIGXXXXXXXXXXXXFPKPIIVTDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNK-FRFKIIAIDKGYQ-PLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPK-GDHSSY--FDIDRYTG--------DLRTRKPLDRETL--------ESISIKVTAKNPNKYSSHFVRNT 2105
            +I+P  +G+ R  +  D    ++R   K     K+I      P   GT  I ++I+D ND  P F         + E  E+G VI    A D D+      R        ++    F L   +      +L++  +LDYE   +Y   + A D       +   T + + + D NDN P F           L   + I E+   D  L+    +D DS  N    + I++   E   +     +  +  +     + +S DY          ++A D G P+L SS  +++     NDNG  + +F +  +       I E  P  S+V+++     D    +I             +  S F  LL  K   L  +  +DRE N    LR+ +S     P      + S     I I D NDN P+F +   Y   + E             I  D+++  N +  +   D  + +D   F ID ++G +F    LDY++  K +   I A D  +Q PL S     + + D NDN P+F  + Y+  + EN  VG  +    A D D     + + YSI P   D SS+  F +D  +G        D   R+  D E L         S++++V  ++ ++++  F   T
Sbjct: 2371 VIEPAFSGIVRTNIVLD---REIRDIYK----LKIIATDEGVPQMTGTATIRVQIVDVNDNQPTFP--PNNLVTVSEATELGAVITSISANDVDTYPALTYRLGAESTVDIENMSIFALDRYSG-----KLVLKRRLDYELQQEYELDVIASD-----AAHEARTVLTVRVNDENDNAPVFLAQQPPAYFAILPAISEISESLSVDFDLLTVNATDADSEGNNSKVIYIIEPAQEGFSVHPSNGVVSVNMSRLQPAVSSSGDYFV-------RIIAKDAGKPALKSSTLLRVQA---NDNGSGRSQFLQNQYRAQ----ISEAAPLGSVVLQLGQDALDQSLAIIAG-----------NEESAFE-LLQSKAIVL--VKPLDRERNDLYKLRLVLSHPHGPPLISSLNSSSGISVIITILDANDNFPIFDRSAKYEAEISELAPLRYSIAQLQAIDADQENTPNSEVVY---DITSGNDEHMFTIDLVTGVLFVNNRLDYDSGAKSYELIIRACDSHHQRPLCSLQPFRLELHDENDNEPKFPLTEYVHFLAENEPVGSSVFRAHASDLDKGPFGQ-LNYSIGPAPSDESSWKMFRVDSESGLVTSAFVFDYEQRQRYDMELLASDMGGKKASVAVRVEIESRDEFTPQFTERT 2973          

HSP 11 Score: 80.1073 bits (196), Expect = 1.464e-14
Identity = 80/259 (30.89%), Postives = 123/259 (47.49%), Query Frame = 3
Query: 1698 LDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPK-GDHSSYFDIDRYTGDLRTRKPLDRETLESISIKVTAKNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAPKF---------IPRLN-MKQKVEFIVEQFV-DGNTCTELPYTVQDIDDGGINGQNCCYTILENDYNKLFSLMTDTPSYICLQRKPEKYQSYTVTLIARDR--PP 2432
            LD ET   +   I A+D G  PL    T+ I + D+NDN P F++S Y   V EN +VG  +  + A D D D +N  + Y+I  +  D    F ID  TG +   K LD ET E   + V AK+      H  +  ++   V I+V DVNDN P            P+++   Q  EF+    V D ++ TE  Y   ++    +NG +  + +   D N ++ ++   P    L R  E   +YT++++A D+  PP
Sbjct:  244 LDRETTPGYSLLIEALDGGTPPLRGFMTVNITIQDVNDNQPIFNQSRYFATVPENATVGTSVLQVYASDTDAD-ENGLVEYAINRRQSDKEQMFRIDPRTGAIYINKALDFETKELHELVVVAKD------HGEQPLETTAFVSIRVTDVNDNQPTINVIFLSDDASPKISESAQPGEFVARISVHDPDSKTE--YANVNVT---LNGGDGHFALTTRD-NSIYLVIVHLP----LDR--EIVSNYTLSVVATDKGTPP 483          

HSP 12 Score: 68.5514 bits (166), Expect = 4.014e-11
Identity = 164/712 (23.03%), Postives = 287/712 (40.31%), Query Frame = 3
Query:  411 ILIKILDQNDKAPQFSSIKRPFFKIPENVEVGKVIDLPMAVDSDSEKYSVRRYSLSYIYHLDQTHDFRLHVTNDNPPRPQLIVNSKLDYEKINKYVFRLFAYDFDEKSIGNSCSTTIEIEIEDLNDNVPKF--NQLTYNANIDENKRDDKLIKFTVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKK--LGFSVSNSVS-IIEGLPAHSLVVEVRVTDADTHSNMIHCKLVDYNDLFYLDSPSKFNTLLNYKPFNLKTINKIDR-----ESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPIIVTDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSST------ITINVLDLNDNAPRFSES-HYIFNVFENVSVGWKIGTLQAIDDDTDRK-NKDIFYSIEPKGDHSSYFDIDRYTGDLRTRKPLDRET-LESISIKVTAKNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAPKFIPRLNMKQKVEFIVEQFVDGNTCTELPYTVQDIDDGGINGQNCCYTILENDYNKLFSLMTDTPSYICLQR---KPEKYQSYTVTLIARDRPPNVEGGLTSKISFPVLI 2480
            ++I++ D+ND +P+FS  K+    + E    G  +    A DSD+   +  RY +     +D  HD    +     P    IV + +  ++  + +++L     DE     + + TI ++I D+NDN P F  N L     + E      +I  ++S  D      +T  +  ++    +   IF + R    L L   LDYE     +E  ++A+D    +  +   + + + + NDN P    ++    F++  ++S I E L     ++ V  TDAD+  N         + + Y+  P++     +  P N      + R      S+   F+RI I+    +P+ + +T   L +Q  D       F Q  Y       Q++        ++   +D+      +  L       +S+  L+   S  I   + LD E  + ++ +++       PL SS        + I +LD NDN P F  S  Y   + E   + + I  LQAID D +   N ++ Y I   G+    F ID  TG L     LD ++  +S  + + A +     SH  R   S     +++ D NDN PKF     + + V F+ E    G++         D+D G     N       +D +       D+ S +         E+ Q Y + L+A D      GG  + ++  V I
Sbjct: 2308 LVIELEDENDNSPKFSQ-KQFVATVSEGNNKGTFVAQVHAFDSDAGSNARLRYHI-----VDGNHDNAFVIE----PAFSGIVRTNIVLDREIRDIYKLKIIATDEGVPQMTGTATIRVQIVDVNDNQPTFPPNNLV---TVSEATELGAVIT-SISANDVDTYPALTYRLGAESTVDIENMSIFALDRYSGKLVLKRRLDYELQQE-YELDVIASDA---AHEARTVLTVRVNDENDNAPVFLAQQPPAYFAILPAISEISESLSVDFDLLTVNATDADSEGN--------NSKVIYIIEPAQEG--FSVHPSNGVVSVNMSRLQPAVSSSGDYFVRI-IAKDAGKPALKSST--LLRVQANDNGSGRSQFLQNQY-----RAQISEAAPLGSVVLQLGQDA-----LDQSLAIIAGNEESAFELLQ--SKAIVLVKPLDRERNDLYKLRLVLSHPHGPPLISSLNSSSGISVIITILDANDNFPIFDRSAKYEAEISELAPLRYSIAQLQAIDADQENTPNSEVVYDIT-SGNDEHMFTIDLVTGVLFVNNRLDYDSGAKSYELIIRACD-----SHHQRPLCSLQPFRLELHDENDNEPKF----PLTEYVHFLAENEPVGSSV--FRAHASDLDKGPFGQLNYSIGPAPSDESSWKMFRVDSESGLVTSAFVFDYEQRQRYDMELLASDM-----GGKKASVAVRVEI 2959          
BLAST of Protocadherin Fat 1 vs. Ensembl Fly
Match: stan (gene:FBgn0024836 transcript:FBtr0304900)

HSP 1 Score: 183.726 bits (465), Expect = 2.793e-46
Identity = 185/601 (30.78%), Postives = 286/601 (47.59%), Query Frame = 3
Query:  384 TPTDPGTFFILIKILDQNDKAPQFSSIKRPFFK--IPENVEVGKVIDLPMAVDSDSEKYSVRRYSLSYIYHLDQTHDFRLHVTNDNPPRPQLIVNSK-LDYEKINKYVFRLFAYDFDEKSIGNSCSTTIEIEIEDLNDNVPKFNQLTYNANIDENKR-DDKLIKFTVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDADTHSNMIHCKLVDYNDLFYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPIIVTDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLR----TRKPLDRE-TLESISIKVTAKNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAP 2159
            +P+   T  +L+ ++D ND AP+F + +   F+  + ENV VG  I    A DSD    +   YS+S     ++  +F L V     PR   +   K LD E+  ++ F++ A D        S S+++ I ++D+NDN P FN   Y AN+ E++     +   T +DPD        ++    T     RF I   Q     + +  SLDY+ +   F  T+ ATD G    S +A V I++ + N+  P  +      +   S S+ E  P  + V+ V  TD+D   N      ++   +  L SP  F+  +N +   + T   +DRE+  G  L +T       PS   TT+  + I + DVNDNAP F   +Y  ++ E+ +         +  +D D GLNG+ ++ L D R+  D S F+ID  SG I T + LD E+   F    IA+DKG  PL+S+  + I + D+ND+ P F+       V EN  VG  +G + A D D +  N  + YSI   GD S+ F +    G  R    T   LD E T +   + V A +P       +RN D+ ++++  V DVNDNAP
Sbjct:  666 SPSRSNTTQLLVNVIDANDNAPRFYTSQ---FQESVLENVPVGYNIIRVQAYDSDEGANAEITYSIS-----ERDDNFPLAVD----PRTGWVQTIKPLDREEQGRFAFQVVAKDGGVPP--KSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDEDSR----LHYEITTGNTRGRFAITS-QNGRGLITIAQSLDYKQEKR-FLLTVAATDSG--GRSDTATVHINITDANNFAPIFE------NAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFS--INPQTGAIVTNAPLDRETTSGYLLTVTAK-DGGNPSLSDTTD--VEIGVTDVNDNAPAFKSPLYQASILEDALVGTSVIQ--VAASDPDVGLNGRIKYLLSD-RDIEDGS-FVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRLEDVNDSPPTFASDKITLYVPENSPVGSVVGEIHAHDPD-EGVNAVVHYSI-IGGDDSNAFSLVTRPGSERAQLLTMTELDYESTRKRFELVVRAASPP------LRN-DAHIEIL--VTDVNDNAP 1218          

HSP 2 Score: 159.458 bits (402), Expect = 7.195e-39
Identity = 165/650 (25.38%), Postives = 285/650 (43.85%), Query Frame = 3
Query:  387 PTDPGTFFILIKILDQNDKAPQFSSIKRPFFKIPENVEVGKVIDLPMAVDSDSEKYSVRRYSLSYIY-HLDQTHDFRLHVTNDNPPRPQLIVNSKLDYEKINKYVFRLFAYDF-DEKSIGNSCSTTIEIEIEDLNDNVPKFNQLTYNANIDENK----RDDKLIKFTVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDADTHSNM-IHCKLVDYNDLFYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIY---IGXXXXXXXXXXXXFPKPIIVTDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISGK--IFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHS----SYFDIDRYTGDLRTRKPLDRETLESISIKVTAKNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAPKFIPRLNMKQKVEFIVEQFVDGNTCTELPYTVQDIDDGGINGQ 2288
            P   GT  + + +LD ND +P F + ++    I E   VG  +    A D D  K +   Y +  +        D  + +   +     +   S LD E  + Y   + A D    +S   + + ++++++ D NDN P+F++ TY   + E++     D+ +     +D D G N  +   I+    +       F I      + L+  LDYE+    +   + A D G+PS S++ Q+ +++ + NDN P+       ++     S++E +P    ++ V+  D+D  +N  I   + + +D F L         ++ +   ++TI  +DRE   G F    ++     P +  + + S+ I ++DVNDN P F+ + Y   +G        V       +  TD D      +E    + R       F I   +G+  I   +SLDY+ + +F   + A D G +  + ++T+ IN+ D N+ AP F  + Y  +VFE+  VG  +  + A D D    N  I YS+  +  +       F I+  TG + T  PLDRET     + VTAK+    S           DV I V DVNDNAP F   L        I+E  + G +  ++  +  D+   G+NG+
Sbjct:  442 PPRSGTTTLQVNVLDCNDHSPTFEA-EQFEASIREGATVGSTVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNTQ-----SQFSIDSMSGDVSLVKPLDYES-VRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRF------YTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISERDDNFPL--------AVDPRTGWVQTIKPLDRE-EQGRFAFQVVAKDGGVPPK--SASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTT-----VTATDPDEDSRLHYEITTGNTRG-----RFAITSQNGRGLITIAQSLDYKQEKRFLLTVAATDSGGR--SDTATVHINITDANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVG-VNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPS------LSDTTDVEIGVTDVNDNAPAFKSPLYQAS----ILEDALVGTSVIQVAASDPDV---GLNGR 1041          

HSP 3 Score: 154.836 bits (390), Expect = 2.302e-37
Identity = 135/471 (28.66%), Postives = 219/471 (46.50%), Query Frame = 3
Query:  777 DLNDNVPKFNQLTYNANI-DENKRDDKLIKFTVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINSLDYE-TDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDADTHSNM-IHCKLVDYNDLFYLDSPSKFNTL-LNYKPFNLKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIY-IGXXXXXXXXXXXXFPKPIIVTDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLRTRKPLDRETLESISIKVTAKNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAPKFIPR 2174
            +L +  P F Q  Y A++ +E      +      DP+        V+++D     S+   +F++      +    SLD E  D H F   ++ATD   P  S +  +++++ + ND+ P  + ++         SI EG    S V+ +R TD D   N  I   +    D   L    +     ++ +   + T + +DRE++    L +T +   S  S + T   S+ +++ D NDN P FS++ Y +   ++       N    I  TD D G N    + +      +  S F ID +SG +   + LDYE+   +R  I A D G    ++++ + +NV+D NDNAPRF  S +  +V ENV VG+ I  +QA D D +  N +I YSI  + D+     +D  TG ++T KPLDRE     + +V AK+        V    +   V+I V DVNDN P F P+
Sbjct:  351 ELRNQSPYFEQALYVASVLEEQPAGAAVTTVRARDPEDSPVVYSMVSLLD-----SRSQSLFKVDSRTGVVTTSASLDRELMDVHYFR--VVATDDSFPPRSGTTTLQVNVLDCNDHSPTFEAEQF------EASIREGATVGSTVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAI---IGGNTQSQFSIDSMSGDVSLVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSD-EGANAEITYSISERDDNFP-LAVDPRTGWVQTIKPLDREEQGRFAFQVVAKDGG------VPPKSASSSVVITVQDVNDNDPAFNPK 797          

HSP 4 Score: 150.599 bits (379), Expect = 4.646e-36
Identity = 178/657 (27.09%), Postives = 284/657 (43.23%), Query Frame = 3
Query:  399 GTFFILIKILDQNDKAPQFSSIKRPF-FKIPENVEVGK---VIDLPMAVDSDSEKYSVRRYSLSYIYHLDQTHDFRLHVTNDNPPRPQLIVNSKLDYEKINKYVFRLFAYDFDEKSIGNSCSTTIEIEIEDLNDNVPKFNQLTYNANIDEN-KRDDKLIKFTVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDADTHSNMIHCKLVDYNDLFYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPIIVTDRDSGLNGKFEFYL--EDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLRTRKPLDRETLESISIKVTAKNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAPKFIPRLNMKQKVEFIV-EQFVDGNTCTELPYTVQDIDDGGINGQNCCYTILENDYNKLFSLMT 2345
             T  + +K+LD ND  PQFS  +R +  ++PE+   G     +    A D+D    +  RY+   I   +    F +   + +     + +   LDYE +  Y   + A D    S  N+  T + + + D NDN P+F    +  ++ EN      +I+    D D G N  +T +I ++ D          +     +++ I  LD E +   F F ++A D G P  S+S+ V I ++++NDN P    K    +V       E  P  + V  V  TD D  S + H ++   N      +  +F  + +     L TI +         FL +T++ TDS       T   ++I I D N+ AP+F    Y  +V E+           +  TD D G+N +  + L  E          F I+  +G I T   LD ET + +   + A D G   L+ ++ + I V D+NDNAP F    Y  ++ E+  VG  +  + A D D    N  I Y +  +      F ID  +G +RT K LDRE++    +  TA   +K S        S V+V I++ DVND+ P F        K+   V E    G+   E+     D D+ G+N     Y+I+  D +  FSL+T
Sbjct:  563 ATASVQVKVLDDNDNYPQFS--ERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYA---IIGGNTQSQFSIDSMSGD-----VSLVKPLDYESVRSYRLVIRAQDGGSPSRSNT--TQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISERDDNFP-----LAVDPRTGWVQTIKPLDRE-EQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVG------EDQPPGTPVTTVTATDPDEDSRL-HYEITTGN------TRGRF-AITSQNGRGLITIAQSLDYKQEKRFL-LTVAATDSGGRSDTAT---VHINITDANNFAPIFENAPYSASVFEDAPVGTTVLV--VSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDALVGTSVIQVAASDPDVG-LNGRIKYLLSDRDIEDGSFVIDPTSGTIRTNKGLDRESVAVFHL--TAIAVDKGSPPL----SSTVEVQIRLEDVNDSPPTF-----ASDKITLYVPENSPVGSVVGEI--HAHDPDE-GVNAV-VHYSIIGGDDSNAFSLVT 1165          

HSP 5 Score: 120.939 bits (302), Expect = 4.390e-27
Identity = 155/610 (25.41%), Postives = 252/610 (41.31%), Query Frame = 3
Query:  651 LIVNSKLDYEKINKYVFRLFAYDFDEKSIGNSCSTTIEIEIEDLNDNVPKFNQLTYNANIDENKR-DDKLIKFTVSDPDSGRNGIVTVNIVDKTDELS----KRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDADTHSNM-IHCKLVDYN--DLFYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTDS-EPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPIIVTDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGD--LRTRKPLDRETLESISIKVTAKNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAPKFIPRLNMKQKVEFIVEQFVDGNTCTELPYTVQDIDDGGINGQNCCYTILENDYNKL-----FSLMTDTPSYIC---LQRKPEKYQSYTVTLIARD 2423
            +  ++ LD E ++ + FR+ A D  +     S +TT+++ + D ND+ P F    + A+I E       +I    +D D G+N  +   I   TD       +   IF I      +   +SLD ET          A      S   +A   + +K L+DN    +F +  ++V        G   ++ V  +R TDAD  +N  I   ++  N    F +DS S   +L+  KP + +++             R+ I   D   PSR  TT   L + + D NDNAP F    +  +V EN           +   D D G N +  + + +     D+    +D  +G + T + LD E + +F F+++A D G  P ++SS++ I V D+NDN P F+  +Y  NV E+   G  + T+ A D D D +   + Y I   G+    F I    G   +   + LD +  +   + V A +    S            V I + D N+ AP F       +   +    F D    T +        D G+N Q   Y++ E   N L     FS+   T + +    L R  E    Y +T+ A+D
Sbjct:  416 VTTSASLDRELMDVHYFRVVATD--DSFPPRSGTTTLQVNVLDCNDHSPTFEAEQFEASIREGATVGSTVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNT-VAHIRATDADQGNNAAIRYAIIGGNTQSQFSIDSMSGDVSLV--KPLDYESVRS----------YRLVIRAQDGGSPSRSNTTQ--LLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIR--VQAYDSDEGANAEITYSISER---DDNFPLAVDPRTGWVQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDEDSR---LHYEIT-TGNTRGRFAITSQNGRGLITIAQSLDYKQEKRFLLTVAATDSGGRS--------DTATVHINITDANNFAPIF-------ENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQ-ITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDR--ETTSGYLLTVTAKD 981          

HSP 6 Score: 101.293 bits (251), Expect = 4.943e-21
Identity = 138/543 (25.41%), Postives = 230/543 (42.36%), Query Frame = 3
Query:  411 ILIKILDQNDKAPQFSSIKRPFFKIPENVEVGKVIDLPMAVDSDSEKYSVRRYSLSYIYHLDQTHDFRLHVTNDNPPRPQLIVNSKLDYEKINKYVFRLFAYDFDEKSIGNSCSTTIEIEIEDLNDNVPKFNQLTYNANIDENK-RDDKLIKFTVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDADTHSNMIHCKLVDYNDL----FYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQ---IYIGXXXXXXXXXXXXFPKPIIVTDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISG----KIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDL 2003
            ++I + D ND  P F+  K     + E+   G  +    A D D +        L Y      T   R  +T+ N  R  + +   LDY++  +++  + A D    S G S + T+ I I D N+  P F    Y+A++ E+      ++  + +D D G N  +T ++ +++         F I      +     LD ET    +  T+ A D G PSLS +  V+I + ++NDN P  K      S     SI+E     + V++V  +D D   N     L+   D+    F +D  S            ++T   +DRES    F    I+     P   +++   + I++EDVND+ P F+     +Y+         V       I   D D G+N    + +       DS+ F +    G    ++ T   LDYE+  K RF+++ +     PL + + I I V D+NDNAP   +   IFN F +     +IG + A D D   K   + Y I   G++++   ++  +G L
Sbjct:  780 VVITVQDVNDNDPAFNP-KYYEANVGEDQPPGTPVTTVTATDPDEDS------RLHYEITTGNTRG-RFAITSQNG-RGLITIAQSLDYKQEKRFLLTVAATD----SGGRSDTATVHINITDANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSG-YLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFK------SPLYQASILEDALVGTSVIQVAASDPDVGLNGRIKYLLSDRDIEDGSFVIDPTSG----------TIRTNKGLDRESV-AVFHLTAIAVDKGSPP--LSSTVEVQIRLEDVNDSPPTFASDKITLYVPENSPVGSVVGE-----IHAHDPDEGVNAVVHYSI---IGGDDSNAFSLVTRPGSERAQLLTMTELDYESTRK-RFELV-VRAASPPLRNDAHIEILVTDVNDNAPVLRDFQVIFNNFRDHFPSGEIGRIPAFDADVSDK---LHYRIL-SGNNANLLRLNSSSGGL 1275          
BLAST of Protocadherin Fat 1 vs. Ensembl Fly
Match: stan (gene:FBgn0024836 transcript:FBtr0303223)

HSP 1 Score: 183.341 bits (464), Expect = 3.672e-46
Identity = 185/601 (30.78%), Postives = 286/601 (47.59%), Query Frame = 3
Query:  384 TPTDPGTFFILIKILDQNDKAPQFSSIKRPFFK--IPENVEVGKVIDLPMAVDSDSEKYSVRRYSLSYIYHLDQTHDFRLHVTNDNPPRPQLIVNSK-LDYEKINKYVFRLFAYDFDEKSIGNSCSTTIEIEIEDLNDNVPKFNQLTYNANIDENKR-DDKLIKFTVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDADTHSNMIHCKLVDYNDLFYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPIIVTDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLR----TRKPLDRE-TLESISIKVTAKNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAP 2159
            +P+   T  +L+ ++D ND AP+F + +   F+  + ENV VG  I    A DSD    +   YS+S     ++  +F L V     PR   +   K LD E+  ++ F++ A D        S S+++ I ++D+NDN P FN   Y AN+ E++     +   T +DPD        ++    T     RF I   Q     + +  SLDY+ +   F  T+ ATD G    S +A V I++ + N+  P  +      +   S S+ E  P  + V+ V  TD+D   N      ++   +  L SP  F+  +N +   + T   +DRE+  G  L +T       PS   TT+  + I + DVNDNAP F   +Y  ++ E+ +         +  +D D GLNG+ ++ L D R+  D S F+ID  SG I T + LD E+   F    IA+DKG  PL+S+  + I + D+ND+ P F+       V EN  VG  +G + A D D +  N  + YSI   GD S+ F +    G  R    T   LD E T +   + V A +P       +RN D+ ++++  V DVNDNAP
Sbjct:  666 SPSRSNTTQLLVNVIDANDNAPRFYTSQ---FQESVLENVPVGYNIIRVQAYDSDEGANAEITYSIS-----ERDDNFPLAVD----PRTGWVQTIKPLDREEQGRFAFQVVAKDGGVPP--KSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDEDSR----LHYEITTGNTRGRFAITS-QNGRGLITIAQSLDYKQEKR-FLLTVAATDSG--GRSDTATVHINITDANNFAPIFE------NAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFS--INPQTGAIVTNAPLDRETTSGYLLTVTAK-DGGNPSLSDTTD--VEIGVTDVNDNAPAFKSPLYQASILEDALVGTSVIQ--VAASDPDVGLNGRIKYLLSD-RDIEDGS-FVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRLEDVNDSPPTFASDKITLYVPENSPVGSVVGEIHAHDPD-EGVNAVVHYSI-IGGDDSNAFSLVTRPGSERAQLLTMTELDYESTRKRFELVVRAASPP------LRN-DAHIEIL--VTDVNDNAP 1218          

HSP 2 Score: 159.073 bits (401), Expect = 9.364e-39
Identity = 165/650 (25.38%), Postives = 285/650 (43.85%), Query Frame = 3
Query:  387 PTDPGTFFILIKILDQNDKAPQFSSIKRPFFKIPENVEVGKVIDLPMAVDSDSEKYSVRRYSLSYIY-HLDQTHDFRLHVTNDNPPRPQLIVNSKLDYEKINKYVFRLFAYDF-DEKSIGNSCSTTIEIEIEDLNDNVPKFNQLTYNANIDENK----RDDKLIKFTVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDADTHSNM-IHCKLVDYNDLFYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIY---IGXXXXXXXXXXXXFPKPIIVTDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISGK--IFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHS----SYFDIDRYTGDLRTRKPLDRETLESISIKVTAKNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAPKFIPRLNMKQKVEFIVEQFVDGNTCTELPYTVQDIDDGGINGQ 2288
            P   GT  + + +LD ND +P F + ++    I E   VG  +    A D D  K +   Y +  +        D  + +   +     +   S LD E  + Y   + A D    +S   + + ++++++ D NDN P+F++ TY   + E++     D+ +     +D D G N  +   I+    +       F I      + L+  LDYE+    +   + A D G+PS S++ Q+ +++ + NDN P+       ++     S++E +P    ++ V+  D+D  +N  I   + + +D F L         ++ +   ++TI  +DRE   G F    ++     P +  + + S+ I ++DVNDN P F+ + Y   +G        V       +  TD D      +E    + R       F I   +G+  I   +SLDY+ + +F   + A D G +  + ++T+ IN+ D N+ AP F  + Y  +VFE+  VG  +  + A D D    N  I YS+  +  +       F I+  TG + T  PLDRET     + VTAK+    S           DV I V DVNDNAP F   L        I+E  + G +  ++  +  D+   G+NG+
Sbjct:  442 PPRSGTTTLQVNVLDCNDHSPTFEA-EQFEASIREGATVGSTVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNTQ-----SQFSIDSMSGDVSLVKPLDYES-VRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRF------YTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISERDDNFPL--------AVDPRTGWVQTIKPLDRE-EQGRFAFQVVAKDGGVPPK--SASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTT-----VTATDPDEDSRLHYEITTGNTRG-----RFAITSQNGRGLITIAQSLDYKQEKRFLLTVAATDSGGR--SDTATVHINITDANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVG-VNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPS------LSDTTDVEIGVTDVNDNAPAFKSPLYQAS----ILEDALVGTSVIQVAASDPDV---GLNGR 1041          

HSP 3 Score: 154.451 bits (389), Expect = 2.775e-37
Identity = 135/471 (28.66%), Postives = 219/471 (46.50%), Query Frame = 3
Query:  777 DLNDNVPKFNQLTYNANI-DENKRDDKLIKFTVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINSLDYE-TDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDADTHSNM-IHCKLVDYNDLFYLDSPSKFNTL-LNYKPFNLKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIY-IGXXXXXXXXXXXXFPKPIIVTDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLRTRKPLDRETLESISIKVTAKNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAPKFIPR 2174
            +L +  P F Q  Y A++ +E      +      DP+        V+++D     S+   +F++      +    SLD E  D H F   ++ATD   P  S +  +++++ + ND+ P  + ++         SI EG    S V+ +R TD D   N  I   +    D   L    +     ++ +   + T + +DRE++    L +T +   S  S + T   S+ +++ D NDN P FS++ Y +   ++       N    I  TD D G N    + +      +  S F ID +SG +   + LDYE+   +R  I A D G    ++++ + +NV+D NDNAPRF  S +  +V ENV VG+ I  +QA D D +  N +I YSI  + D+     +D  TG ++T KPLDRE     + +V AK+        V    +   V+I V DVNDN P F P+
Sbjct:  351 ELRNQSPYFEQALYVASVLEEQPAGAAVTTVRARDPEDSPVVYSMVSLLD-----SRSQSLFKVDSRTGVVTTSASLDRELMDVHYFR--VVATDDSFPPRSGTTTLQVNVLDCNDHSPTFEAEQF------EASIREGATVGSTVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAI---IGGNTQSQFSIDSMSGDVSLVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSD-EGANAEITYSISERDDNFP-LAVDPRTGWVQTIKPLDREEQGRFAFQVVAKDGG------VPPKSASSSVVITVQDVNDNDPAFNPK 797          

HSP 4 Score: 149.828 bits (377), Expect = 6.200e-36
Identity = 178/657 (27.09%), Postives = 284/657 (43.23%), Query Frame = 3
Query:  399 GTFFILIKILDQNDKAPQFSSIKRPF-FKIPENVEVGK---VIDLPMAVDSDSEKYSVRRYSLSYIYHLDQTHDFRLHVTNDNPPRPQLIVNSKLDYEKINKYVFRLFAYDFDEKSIGNSCSTTIEIEIEDLNDNVPKFNQLTYNANIDEN-KRDDKLIKFTVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDADTHSNMIHCKLVDYNDLFYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPIIVTDRDSGLNGKFEFYL--EDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLRTRKPLDRETLESISIKVTAKNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAPKFIPRLNMKQKVEFIV-EQFVDGNTCTELPYTVQDIDDGGINGQNCCYTILENDYNKLFSLMT 2345
             T  + +K+LD ND  PQFS  +R +  ++PE+   G     +    A D+D    +  RY+   I   +    F +   + +     + +   LDYE +  Y   + A D    S  N+  T + + + D NDN P+F    +  ++ EN      +I+    D D G N  +T +I ++ D          +     +++ I  LD E +   F F ++A D G P  S+S+ V I ++++NDN P    K    +V       E  P  + V  V  TD D  S + H ++   N      +  +F  + +     L TI +         FL +T++ TDS       T   ++I I D N+ AP+F    Y  +V E+           +  TD D G+N +  + L  E          F I+  +G I T   LD ET + +   + A D G   L+ ++ + I V D+NDNAP F    Y  ++ E+  VG  +  + A D D    N  I Y +  +      F ID  +G +RT K LDRE++    +  TA   +K S        S V+V I++ DVND+ P F        K+   V E    G+   E+     D D+ G+N     Y+I+  D +  FSL+T
Sbjct:  563 ATASVQVKVLDDNDNYPQFS--ERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYA---IIGGNTQSQFSIDSMSGD-----VSLVKPLDYESVRSYRLVIRAQDGGSPSRSNT--TQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISERDDNFP-----LAVDPRTGWVQTIKPLDRE-EQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVG------EDQPPGTPVTTVTATDPDEDSRL-HYEITTGN------TRGRF-AITSQNGRGLITIAQSLDYKQEKRFL-LTVAATDSGGRSDTAT---VHINITDANNFAPIFENAPYSASVFEDAPVGTTVLV--VSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDALVGTSVIQVAASDPDVG-LNGRIKYLLSDRDIEDGSFVIDPTSGTIRTNKGLDRESVAVFHL--TAIAVDKGSPPL----SSTVEVQIRLEDVNDSPPTF-----ASDKITLYVPENSPVGSVVGEI--HAHDPDE-GVNAV-VHYSIIGGDDSNAFSLVT 1165          

HSP 5 Score: 120.553 bits (301), Expect = 5.470e-27
Identity = 155/610 (25.41%), Postives = 252/610 (41.31%), Query Frame = 3
Query:  651 LIVNSKLDYEKINKYVFRLFAYDFDEKSIGNSCSTTIEIEIEDLNDNVPKFNQLTYNANIDENKR-DDKLIKFTVSDPDSGRNGIVTVNIVDKTDELS----KRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDADTHSNM-IHCKLVDYN--DLFYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTDS-EPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPIIVTDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGD--LRTRKPLDRETLESISIKVTAKNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAPKFIPRLNMKQKVEFIVEQFVDGNTCTELPYTVQDIDDGGINGQNCCYTILENDYNKL-----FSLMTDTPSYIC---LQRKPEKYQSYTVTLIARD 2423
            +  ++ LD E ++ + FR+ A D  +     S +TT+++ + D ND+ P F    + A+I E       +I    +D D G+N  +   I   TD       +   IF I      +   +SLD ET          A      S   +A   + +K L+DN    +F +  ++V        G   ++ V  +R TDAD  +N  I   ++  N    F +DS S   +L+  KP + +++             R+ I   D   PSR  TT   L + + D NDNAP F    +  +V EN           +   D D G N +  + + +     D+    +D  +G + T + LD E + +F F+++A D G  P ++SS++ I V D+NDN P F+  +Y  NV E+   G  + T+ A D D D +   + Y I   G+    F I    G   +   + LD +  +   + V A +    S            V I + D N+ AP F       +   +    F D    T +        D G+N Q   Y++ E   N L     FS+   T + +    L R  E    Y +T+ A+D
Sbjct:  416 VTTSASLDRELMDVHYFRVVATD--DSFPPRSGTTTLQVNVLDCNDHSPTFEAEQFEASIREGATVGSTVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNT-VAHIRATDADQGNNAAIRYAIIGGNTQSQFSIDSMSGDVSLV--KPLDYESVRS----------YRLVIRAQDGGSPSRSNTTQ--LLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIR--VQAYDSDEGANAEITYSISER---DDNFPLAVDPRTGWVQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDEDSR---LHYEIT-TGNTRGRFAITSQNGRGLITIAQSLDYKQEKRFLLTVAATDSGGRS--------DTATVHINITDANNFAPIF-------ENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQ-ITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDR--ETTSGYLLTVTAKD 981          

HSP 6 Score: 100.908 bits (250), Expect = 6.422e-21
Identity = 138/543 (25.41%), Postives = 230/543 (42.36%), Query Frame = 3
Query:  411 ILIKILDQNDKAPQFSSIKRPFFKIPENVEVGKVIDLPMAVDSDSEKYSVRRYSLSYIYHLDQTHDFRLHVTNDNPPRPQLIVNSKLDYEKINKYVFRLFAYDFDEKSIGNSCSTTIEIEIEDLNDNVPKFNQLTYNANIDENK-RDDKLIKFTVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDADTHSNMIHCKLVDYNDL----FYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQ---IYIGXXXXXXXXXXXXFPKPIIVTDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISG----KIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDL 2003
            ++I + D ND  P F+  K     + E+   G  +    A D D +        L Y      T   R  +T+ N  R  + +   LDY++  +++  + A D    S G S + T+ I I D N+  P F    Y+A++ E+      ++  + +D D G N  +T ++ +++         F I      +     LD ET    +  T+ A D G PSLS +  V+I + ++NDN P  K      S     SI+E     + V++V  +D D   N     L+   D+    F +D  S            ++T   +DRES    F    I+     P   +++   + I++EDVND+ P F+     +Y+         V       I   D D G+N    + +       DS+ F +    G    ++ T   LDYE+  K RF+++ +     PL + + I I V D+NDNAP   +   IFN F +     +IG + A D D   K   + Y I   G++++   ++  +G L
Sbjct:  780 VVITVQDVNDNDPAFNP-KYYEANVGEDQPPGTPVTTVTATDPDEDS------RLHYEITTGNTRG-RFAITSQNG-RGLITIAQSLDYKQEKRFLLTVAATD----SGGRSDTATVHINITDANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSG-YLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFK------SPLYQASILEDALVGTSVIQVAASDPDVGLNGRIKYLLSDRDIEDGSFVIDPTSG----------TIRTNKGLDRESV-AVFHLTAIAVDKGSPP--LSSTVEVQIRLEDVNDSPPTFASDKITLYVPENSPVGSVVGE-----IHAHDPDEGVNAVVHYSI---IGGDDSNAFSLVTRPGSERAQLLTMTELDYESTRK-RFELV-VRAASPPLRNDAHIEILVTDVNDNAPVLRDFQVIFNNFRDHFPSGEIGRIPAFDADVSDK---LHYRIL-SGNNANLLRLNSSSGGL 1275          
BLAST of Protocadherin Fat 1 vs. Ensembl Fly
Match: stan (gene:FBgn0024836 transcript:FBtr0088214)

HSP 1 Score: 183.341 bits (464), Expect = 3.672e-46
Identity = 185/601 (30.78%), Postives = 286/601 (47.59%), Query Frame = 3
Query:  384 TPTDPGTFFILIKILDQNDKAPQFSSIKRPFFK--IPENVEVGKVIDLPMAVDSDSEKYSVRRYSLSYIYHLDQTHDFRLHVTNDNPPRPQLIVNSK-LDYEKINKYVFRLFAYDFDEKSIGNSCSTTIEIEIEDLNDNVPKFNQLTYNANIDENKR-DDKLIKFTVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDADTHSNMIHCKLVDYNDLFYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPIIVTDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLR----TRKPLDRE-TLESISIKVTAKNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAP 2159
            +P+   T  +L+ ++D ND AP+F + +   F+  + ENV VG  I    A DSD    +   YS+S     ++  +F L V     PR   +   K LD E+  ++ F++ A D        S S+++ I ++D+NDN P FN   Y AN+ E++     +   T +DPD        ++    T     RF I   Q     + +  SLDY+ +   F  T+ ATD G    S +A V I++ + N+  P  +      +   S S+ E  P  + V+ V  TD+D   N      ++   +  L SP  F+  +N +   + T   +DRE+  G  L +T       PS   TT+  + I + DVNDNAP F   +Y  ++ E+ +         +  +D D GLNG+ ++ L D R+  D S F+ID  SG I T + LD E+   F    IA+DKG  PL+S+  + I + D+ND+ P F+       V EN  VG  +G + A D D +  N  + YSI   GD S+ F +    G  R    T   LD E T +   + V A +P       +RN D+ ++++  V DVNDNAP
Sbjct:  666 SPSRSNTTQLLVNVIDANDNAPRFYTSQ---FQESVLENVPVGYNIIRVQAYDSDEGANAEITYSIS-----ERDDNFPLAVD----PRTGWVQTIKPLDREEQGRFAFQVVAKDGGVPP--KSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDEDSR----LHYEITTGNTRGRFAITS-QNGRGLITIAQSLDYKQEKR-FLLTVAATDSG--GRSDTATVHINITDANNFAPIFE------NAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFS--INPQTGAIVTNAPLDRETTSGYLLTVTAK-DGGNPSLSDTTD--VEIGVTDVNDNAPAFKSPLYQASILEDALVGTSVIQ--VAASDPDVGLNGRIKYLLSD-RDIEDGS-FVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRLEDVNDSPPTFASDKITLYVPENSPVGSVVGEIHAHDPD-EGVNAVVHYSI-IGGDDSNAFSLVTRPGSERAQLLTMTELDYESTRKRFELVVRAASPP------LRN-DAHIEIL--VTDVNDNAP 1218          

HSP 2 Score: 159.073 bits (401), Expect = 9.364e-39
Identity = 165/650 (25.38%), Postives = 285/650 (43.85%), Query Frame = 3
Query:  387 PTDPGTFFILIKILDQNDKAPQFSSIKRPFFKIPENVEVGKVIDLPMAVDSDSEKYSVRRYSLSYIY-HLDQTHDFRLHVTNDNPPRPQLIVNSKLDYEKINKYVFRLFAYDF-DEKSIGNSCSTTIEIEIEDLNDNVPKFNQLTYNANIDENK----RDDKLIKFTVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDADTHSNM-IHCKLVDYNDLFYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIY---IGXXXXXXXXXXXXFPKPIIVTDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISGK--IFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHS----SYFDIDRYTGDLRTRKPLDRETLESISIKVTAKNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAPKFIPRLNMKQKVEFIVEQFVDGNTCTELPYTVQDIDDGGINGQ 2288
            P   GT  + + +LD ND +P F + ++    I E   VG  +    A D D  K +   Y +  +        D  + +   +     +   S LD E  + Y   + A D    +S   + + ++++++ D NDN P+F++ TY   + E++     D+ +     +D D G N  +   I+    +       F I      + L+  LDYE+    +   + A D G+PS S++ Q+ +++ + NDN P+       ++     S++E +P    ++ V+  D+D  +N  I   + + +D F L         ++ +   ++TI  +DRE   G F    ++     P +  + + S+ I ++DVNDN P F+ + Y   +G        V       +  TD D      +E    + R       F I   +G+  I   +SLDY+ + +F   + A D G +  + ++T+ IN+ D N+ AP F  + Y  +VFE+  VG  +  + A D D    N  I YS+  +  +       F I+  TG + T  PLDRET     + VTAK+    S           DV I V DVNDNAP F   L        I+E  + G +  ++  +  D+   G+NG+
Sbjct:  442 PPRSGTTTLQVNVLDCNDHSPTFEA-EQFEASIREGATVGSTVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNTQ-----SQFSIDSMSGDVSLVKPLDYES-VRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRF------YTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISERDDNFPL--------AVDPRTGWVQTIKPLDRE-EQGRFAFQVVAKDGGVPPK--SASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTT-----VTATDPDEDSRLHYEITTGNTRG-----RFAITSQNGRGLITIAQSLDYKQEKRFLLTVAATDSGGR--SDTATVHINITDANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVG-VNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPS------LSDTTDVEIGVTDVNDNAPAFKSPLYQAS----ILEDALVGTSVIQVAASDPDV---GLNGR 1041          

HSP 3 Score: 154.451 bits (389), Expect = 2.775e-37
Identity = 135/471 (28.66%), Postives = 219/471 (46.50%), Query Frame = 3
Query:  777 DLNDNVPKFNQLTYNANI-DENKRDDKLIKFTVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINSLDYE-TDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDADTHSNM-IHCKLVDYNDLFYLDSPSKFNTL-LNYKPFNLKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIY-IGXXXXXXXXXXXXFPKPIIVTDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLRTRKPLDRETLESISIKVTAKNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAPKFIPR 2174
            +L +  P F Q  Y A++ +E      +      DP+        V+++D     S+   +F++      +    SLD E  D H F   ++ATD   P  S +  +++++ + ND+ P  + ++         SI EG    S V+ +R TD D   N  I   +    D   L    +     ++ +   + T + +DRE++    L +T +   S  S + T   S+ +++ D NDN P FS++ Y +   ++       N    I  TD D G N    + +      +  S F ID +SG +   + LDYE+   +R  I A D G    ++++ + +NV+D NDNAPRF  S +  +V ENV VG+ I  +QA D D +  N +I YSI  + D+     +D  TG ++T KPLDRE     + +V AK+        V    +   V+I V DVNDN P F P+
Sbjct:  351 ELRNQSPYFEQALYVASVLEEQPAGAAVTTVRARDPEDSPVVYSMVSLLD-----SRSQSLFKVDSRTGVVTTSASLDRELMDVHYFR--VVATDDSFPPRSGTTTLQVNVLDCNDHSPTFEAEQF------EASIREGATVGSTVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAI---IGGNTQSQFSIDSMSGDVSLVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSD-EGANAEITYSISERDDNFP-LAVDPRTGWVQTIKPLDREEQGRFAFQVVAKDGG------VPPKSASSSVVITVQDVNDNDPAFNPK 797          

HSP 4 Score: 149.828 bits (377), Expect = 6.200e-36
Identity = 178/657 (27.09%), Postives = 284/657 (43.23%), Query Frame = 3
Query:  399 GTFFILIKILDQNDKAPQFSSIKRPF-FKIPENVEVGK---VIDLPMAVDSDSEKYSVRRYSLSYIYHLDQTHDFRLHVTNDNPPRPQLIVNSKLDYEKINKYVFRLFAYDFDEKSIGNSCSTTIEIEIEDLNDNVPKFNQLTYNANIDEN-KRDDKLIKFTVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDADTHSNMIHCKLVDYNDLFYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPIIVTDRDSGLNGKFEFYL--EDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLRTRKPLDRETLESISIKVTAKNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAPKFIPRLNMKQKVEFIV-EQFVDGNTCTELPYTVQDIDDGGINGQNCCYTILENDYNKLFSLMT 2345
             T  + +K+LD ND  PQFS  +R +  ++PE+   G     +    A D+D    +  RY+   I   +    F +   + +     + +   LDYE +  Y   + A D    S  N+  T + + + D NDN P+F    +  ++ EN      +I+    D D G N  +T +I ++ D          +     +++ I  LD E +   F F ++A D G P  S+S+ V I ++++NDN P    K    +V       E  P  + V  V  TD D  S + H ++   N      +  +F  + +     L TI +         FL +T++ TDS       T   ++I I D N+ AP+F    Y  +V E+           +  TD D G+N +  + L  E          F I+  +G I T   LD ET + +   + A D G   L+ ++ + I V D+NDNAP F    Y  ++ E+  VG  +  + A D D    N  I Y +  +      F ID  +G +RT K LDRE++    +  TA   +K S        S V+V I++ DVND+ P F        K+   V E    G+   E+     D D+ G+N     Y+I+  D +  FSL+T
Sbjct:  563 ATASVQVKVLDDNDNYPQFS--ERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYA---IIGGNTQSQFSIDSMSGD-----VSLVKPLDYESVRSYRLVIRAQDGGSPSRSNT--TQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISERDDNFP-----LAVDPRTGWVQTIKPLDRE-EQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVG------EDQPPGTPVTTVTATDPDEDSRL-HYEITTGN------TRGRF-AITSQNGRGLITIAQSLDYKQEKRFL-LTVAATDSGGRSDTAT---VHINITDANNFAPIFENAPYSASVFEDAPVGTTVLV--VSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDALVGTSVIQVAASDPDVG-LNGRIKYLLSDRDIEDGSFVIDPTSGTIRTNKGLDRESVAVFHL--TAIAVDKGSPPL----SSTVEVQIRLEDVNDSPPTF-----ASDKITLYVPENSPVGSVVGEI--HAHDPDE-GVNAV-VHYSIIGGDDSNAFSLVT 1165          

HSP 5 Score: 120.553 bits (301), Expect = 5.470e-27
Identity = 155/610 (25.41%), Postives = 252/610 (41.31%), Query Frame = 3
Query:  651 LIVNSKLDYEKINKYVFRLFAYDFDEKSIGNSCSTTIEIEIEDLNDNVPKFNQLTYNANIDENKR-DDKLIKFTVSDPDSGRNGIVTVNIVDKTDELS----KRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDADTHSNM-IHCKLVDYN--DLFYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTDS-EPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPIIVTDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGD--LRTRKPLDRETLESISIKVTAKNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAPKFIPRLNMKQKVEFIVEQFVDGNTCTELPYTVQDIDDGGINGQNCCYTILENDYNKL-----FSLMTDTPSYIC---LQRKPEKYQSYTVTLIARD 2423
            +  ++ LD E ++ + FR+ A D  +     S +TT+++ + D ND+ P F    + A+I E       +I    +D D G+N  +   I   TD       +   IF I      +   +SLD ET          A      S   +A   + +K L+DN    +F +  ++V        G   ++ V  +R TDAD  +N  I   ++  N    F +DS S   +L+  KP + +++             R+ I   D   PSR  TT   L + + D NDNAP F    +  +V EN           +   D D G N +  + + +     D+    +D  +G + T + LD E + +F F+++A D G  P ++SS++ I V D+NDN P F+  +Y  NV E+   G  + T+ A D D D +   + Y I   G+    F I    G   +   + LD +  +   + V A +    S            V I + D N+ AP F       +   +    F D    T +        D G+N Q   Y++ E   N L     FS+   T + +    L R  E    Y +T+ A+D
Sbjct:  416 VTTSASLDRELMDVHYFRVVATD--DSFPPRSGTTTLQVNVLDCNDHSPTFEAEQFEASIREGATVGSTVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNT-VAHIRATDADQGNNAAIRYAIIGGNTQSQFSIDSMSGDVSLV--KPLDYESVRS----------YRLVIRAQDGGSPSRSNTTQ--LLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIR--VQAYDSDEGANAEITYSISER---DDNFPLAVDPRTGWVQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDEDSR---LHYEIT-TGNTRGRFAITSQNGRGLITIAQSLDYKQEKRFLLTVAATDSGGRS--------DTATVHINITDANNFAPIF-------ENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQ-ITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDR--ETTSGYLLTVTAKD 981          

HSP 6 Score: 100.908 bits (250), Expect = 6.422e-21
Identity = 138/543 (25.41%), Postives = 230/543 (42.36%), Query Frame = 3
Query:  411 ILIKILDQNDKAPQFSSIKRPFFKIPENVEVGKVIDLPMAVDSDSEKYSVRRYSLSYIYHLDQTHDFRLHVTNDNPPRPQLIVNSKLDYEKINKYVFRLFAYDFDEKSIGNSCSTTIEIEIEDLNDNVPKFNQLTYNANIDENK-RDDKLIKFTVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDADTHSNMIHCKLVDYNDL----FYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQ---IYIGXXXXXXXXXXXXFPKPIIVTDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISG----KIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDL 2003
            ++I + D ND  P F+  K     + E+   G  +    A D D +        L Y      T   R  +T+ N  R  + +   LDY++  +++  + A D    S G S + T+ I I D N+  P F    Y+A++ E+      ++  + +D D G N  +T ++ +++         F I      +     LD ET    +  T+ A D G PSLS +  V+I + ++NDN P  K      S     SI+E     + V++V  +D D   N     L+   D+    F +D  S            ++T   +DRES    F    I+     P   +++   + I++EDVND+ P F+     +Y+         V       I   D D G+N    + +       DS+ F +    G    ++ T   LDYE+  K RF+++ +     PL + + I I V D+NDNAP   +   IFN F +     +IG + A D D   K   + Y I   G++++   ++  +G L
Sbjct:  780 VVITVQDVNDNDPAFNP-KYYEANVGEDQPPGTPVTTVTATDPDEDS------RLHYEITTGNTRG-RFAITSQNG-RGLITIAQSLDYKQEKRFLLTVAATD----SGGRSDTATVHINITDANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSG-YLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFK------SPLYQASILEDALVGTSVIQVAASDPDVGLNGRIKYLLSDRDIEDGSFVIDPTSG----------TIRTNKGLDRESV-AVFHLTAIAVDKGSPP--LSSTVEVQIRLEDVNDSPPTFASDKITLYVPENSPVGSVVGE-----IHAHDPDEGVNAVVHYSI---IGGDDSNAFSLVTRPGSERAQLLTMTELDYESTRK-RFELV-VRAASPPLRNDAHIEILVTDVNDNAPVLRDFQVIFNNFRDHFPSGEIGRIPAFDADVSDK---LHYRIL-SGNNANLLRLNSSSGGL 1275          
BLAST of Protocadherin Fat 1 vs. Ensembl Zebrafish
Match: CT030123.1 (protocadherin 1b [Source:NCBI gene;Acc:572016])

HSP 1 Score: 205.682 bits (522), Expect = 1.200e-53
Identity = 202/684 (29.53%), Postives = 312/684 (45.61%), Query Frame = 3
Query:  279 NGVNREAVCRDNPGEKVRKFCKADLCCKLIGFQ-----YLTPTDPGTFFILIKILDQNDKAPQFSSIKRPFF--KIPENVEVGKVIDLPMAVDSDSEKYSVRRYSLSYIYHLDQTHDFRLHVTNDNPPR-PQLIVNSKLDYEKINKYVFRLFAYDFDEKSIGNSCSTTIEIEIEDLNDNVPKFNQLTYNANIDENK-RDDKLIKFTVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNS--VSIIEGLPAHSLVVEVRVTDADTHSNMIHCKLVDYNDLFYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPIIVTDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLRTRKPLDRETLESISIKVTA---KNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAP----------KFI-PRLNMKQKVEFIVEQFVDGNTCTELPYTV 2255
            N ++RE++      +  R   + D C   + F+      +  T P      I+ILD+ND  PQFSS   P     IPEN  VG +  +P+A D DS    +  Y+L+     + T+ F L V  D+  + PQLIV   LD E  + Y   +     D  S     S  + I I D NDNVPKF +  Y   + EN      +++   +D D G NG VT ++   +   S   ++  I RN   + +  S+D E +  + +F + A D G  S SS A V I +K+ NDN P I+ + +G         +I E +P  + V  V V+D D   N +   +V  +  F L S S+       K F L+T   +D E       RI I   DS      +TN SL +Q+ D+NDNAP+FS  +Y     E            ++ TD DSG N +  +  E          F I+  +G++     LD E  + ++F + A DKG   L  ++T+ + VLD NDN P+F  + Y F+V EN+     +G +  ++D  + +N  +  S+EP    +  F I   T  + +    DRE   + S ++ A    +P +          S V + I V+D NDNAP          KF+ PR + +  VE +  + +D    +EL + +
Sbjct:   79 NSIDRESL------KDCRNLFEGDPC--FLEFEVSITDLMKGTGPRLIEGRIEILDENDNTPQFSS---PVLTLSIPENTHVGALFAIPVATDRDSGSNGIADYALT--TGPEATNLFSLQVAQDSDEKLPQLIVLGNLDRELRDSYDLNIKV--VDGGSPPRQSSALLRITITDANDNVPKFERSHYEGELPENSPVGHSVLQVKANDSDMGPNGEVTYSLHQPS---SPVMRLLSIDRNTGIIFVKGSVDRE-EISILKFYVQAKDNGPQSKSSKALVTITVKDQNDNAPSIRIRGIGLVTHEDGVANISEDMPVGTAVALVEVSDRDEGENAVVTCVVAGDVPFQLRSASETGNDRKRKYF-LQTTTLLDYE--RIKEYRIEIVAVDSGNPALSSTN-SLKVQVTDMNDNAPVFSPTLYEVEFFEENQPGDKVL--DVVATDADSGTNAELTYIPEGL--------FEINPNTGEVRVMSQLDREQLDHYQFLVAAADKGVPSLRGTATVVVKVLDRNDNDPKFMLNGYSFSVQENMPPLSPVGMV-TVNDHDEGENARVQLSVEPD---NGKFMIQNGTYTILSTISFDREKESTYSFRLKAVDGGDPPR---------SSYVGITINVLDENDNAPYVTKPANSSYKFLDPRTSPETHVESVEAEDIDIGLNSELDFNI 716          

HSP 2 Score: 92.0485 bits (227), Expect = 2.969e-18
Identity = 90/287 (31.36%), Postives = 125/287 (43.55%), Query Frame = 3
Query: 1347 TINKIDRES---------NHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPIIVTDRDSGLNGKFEFYL----EDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSI-EPKGDHSSYFDIDRYTGDLRTRKPLDRETLESISIKVTAKNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAPKF 2165
            T N IDRES             FL   +S TD          E   I+I D NDN P FS  + +        +V   F  P+  TDRDSG NG  ++ L    E    FS       D+   ++    +LD E ++ +   I  +D G  P  SS+ + I + D NDN P+F  SHY   + EN  VG  +  ++A D D    N ++ YS+ +P         IDR TG +  +  +DRE +  +   V AK+    S        S+  V I V D NDNAP  
Sbjct:   77 TENSIDRESLKDCRNLFEGDPCFLEFEVSITDLMKGTGPRLIEG-RIEILDENDNTPQFSSPV-LTLSIPENTHVGALFAIPV-ATDRDSGSNGIADYALTTGPEATNLFSLQVAQDSDEKLPQLIVLGNLDRELRDSYDLNIKVVDGGSPPRQSSALLRITITDANDNVPKFERSHYEGELPENSPVGHSVLQVKANDSDMG-PNGEVTYSLHQPSSPVMRLLSIDRNTGIIFVKGSVDREEISILKFYVQAKDNGPQSK------SSKALVTITVKDQNDNAPSI 353          
BLAST of Protocadherin Fat 1 vs. Ensembl Zebrafish
Match: pcdh1b (protocadherin 1b [Source:ZFIN;Acc:ZDB-GENE-091015-2])

HSP 1 Score: 204.912 bits (520), Expect = 4.025e-53
Identity = 200/681 (29.37%), Postives = 310/681 (45.52%), Query Frame = 3
Query:  279 NGVNREAVCRDNPGEKVRKFCKADLCCKLIGFQ-----YLTPTDPGTFFILIKILDQNDKAPQFSSIKRPFF--KIPENVEVGKVIDLPMAVDSDSEKYSVRRYSLSYIYHLDQTHDFRLHVTNDNPPR-PQLIVNSKLDYEKINKYVFRLFAYDFDEKSIGNSCSTTIEIEIEDLNDNVPKFNQLTYNANIDENKR-DDKLIKFTVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNS--VSIIEGLPAHSLVVEVRVTDADTHSNMIHCKLVDYNDLFYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPIIVTDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLRTRKPLDRETLESISIKVTAKNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAP----------KFI-PRLNMKQKVEFIVEQFVDGNTCTELPYTV 2255
            N ++RE++      +  R   + D C   + F+      +  T P      I+ILD+ND  PQFSS   P     IPEN  VG +  +P+A D DS    +  Y+L+     + T+ F L V  D+  + PQLIV   LD E  + Y   +     D  S     S  + I I D NDNVPKF +  Y   + EN      +++   +D D G NG VT ++   +   S   ++  I RN   + +  S+D E +  + +F + A D G  S SS A V I +K+ NDN P I+ + +G         +I E +P  + V  V V+D D   N +   +V  +  F L S S+       K F L+T   +D E       RI I   DS      +TN SL +Q+ D+NDNAP+FS  +Y     E            ++ TD DSG N +  + +           F I+  +G++     LD E  + ++F + A DKG   L  ++T+ + VLD NDN P+F  + Y F+V EN+     +G +  ++D  + +N  +  S+EP    +  F I   T  + +    DRE   + S ++ A +             S V + I V+D NDNAP          KF+ PR + +  VE +  + +D    +EL + +
Sbjct:   86 NSIDRESL------KDCRNLFEGDPC--FLEFEVSITDLMKGTGPRLIEGRIEILDENDNTPQFSS---PVLTLSIPENTHVGALFAIPVATDRDSGSNGIADYALT--TGPEATNLFSLQVAQDSDEKLPQLIVLGNLDRELRDSYDLNIKV--VDGGSPPRQSSALLRITITDANDNVPKFERSHYEGELPENSPVGHSVLQVKANDSDMGPNGEVTYSLHQPS---SPVMRLLSIDRNTGIIFVKGSVDRE-EISILKFYVQAKDNGPQSKSSKALVTITVKDQNDNAPSIRIRGIGLVTHEDGVANISEDMPVGTAVALVEVSDRDEGENAVVTCVVAGDVPFQLRSASETGNDRKRKYF-LQTTTLLDYE--RIKEYRIEIVAVDSGNPALSSTN-SLKVQVTDMNDNAPVFSPTLYEVEFFEENQPGDKVL--DVVATDADSGTNAELTYSITG--GSVPEGLFEINPNTGEVRVMSQLDREQLDHYQFLVAAADKGVPSLRGTATVVVKVLDRNDNDPKFMLNGYSFSVQENMPPLSPVGMV-TVNDHDEGENARVQLSVEPD---NGKFMIQNGTYTILSTISFDREKESTYSFRLKAVDGGDPPR------SSYVGITINVLDENDNAPYVTKPANSSYKFLDPRTSPETHVESVEAEDIDIGLNSELDFNI 729          

HSP 2 Score: 92.8189 bits (229), Expect = 1.583e-18
Identity = 88/287 (30.66%), Postives = 125/287 (43.55%), Query Frame = 3
Query: 1347 TINKIDRES---------NHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPIIVTDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFTQ----RSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSI-EPKGDHSSYFDIDRYTGDLRTRKPLDRETLESISIKVTAKNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAPKF 2165
            T N IDRES             FL   +S TD          E   I+I D NDN P FS  + +        +V   F  P+  TDRDSG NG  ++ L      ++     + + S +   Q     +LD E ++ +   I  +D G  P  SS+ + I + D NDN P+F  SHY   + EN  VG  +  ++A D D    N ++ YS+ +P         IDR TG +  +  +DRE +  +   V AK+    S        S+  V I V D NDNAP  
Sbjct:   84 TENSIDRESLKDCRNLFEGDPCFLEFEVSITDLMKGTGPRLIEG-RIEILDENDNTPQFSSPV-LTLSIPENTHVGALFAIPV-ATDRDSGSNGIADYALTTGPEATNLFSLQVAQDSDEKLPQLIVLGNLDRELRDSYDLNIKVVDGGSPPRQSSALLRITITDANDNVPKFERSHYEGELPENSPVGHSVLQVKANDSDMG-PNGEVTYSLHQPSSPVMRLLSIDRNTGIIFVKGSVDREEISILKFYVQAKDNGPQSK------SSKALVTITVKDQNDNAPSI 360          
BLAST of Protocadherin Fat 1 vs. Ensembl Zebrafish
Match: CT030123.1 (protocadherin 1b [Source:NCBI gene;Acc:572016])

HSP 1 Score: 203.756 bits (517), Expect = 4.747e-53
Identity = 191/630 (30.32%), Postives = 292/630 (46.35%), Query Frame = 3
Query:  417 IKILDQNDKAPQFSSIKRPFF--KIPENVEVGKVIDLPMAVDSDSEKYSVRRYSLSYIYHLDQTHDFRLHVTNDNPPR-PQLIVNSKLDYEKINKYVFRLFAYDFDEKSIGNSCSTTIEIEIEDLNDNVPKFNQLTYNANIDENKR-DDKLIKFTVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSV--SNSVSIIEGLPAHSLVVEVRVTDADTHSNMIHCKLVDYNDLFYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPIIVTDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLRTRKPLDRETLESISIKVTAKNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAP----------KFI-PRLNMKQKVEFIVEQFVDGNTCTELPYTV 2255
            I+ILD+ND  PQFSS   P     IPEN  VG +  +P+A D DS    +  Y+L+     + T+ F L V  D+  + PQLIV   LD E  + Y   +     D  S     S  + I I D NDNVPKF +  Y   + EN      +++   +D D G NG VT ++   +   S   ++  I RN   + +  S+D E +  + +F + A D G  S SS A V I +K+ NDN P I+ + +G         +I E +P  + V  V V+D D   N +   +V  +  F L S S+       K F L+T   +D E       RI I   DS      +TN SL +Q+ D+NDNAP+FS  +Y     E            ++ TD DSG N +  + +           F I+  +G++     LD E  + ++F + A DKG   L  ++T+ + VLD NDN P+F  + Y F+V EN+     +G +  ++D  + +N  +  S+EP    +  F I   T  + +    DRE   + S ++ A +             S V + I V+D NDNAP          KF+ PR + +  VE +  + +D    +EL + +
Sbjct:  127 IEILDENDNTPQFSS---PVLTLSIPENTHVGALFAIPVATDRDSGSNGIADYALT--TGPEATNLFSLQVAQDSDEKLPQLIVLGNLDRELRDSYDLNIKV--VDGGSPPRQSSALLRITITDANDNVPKFERSHYEGELPENSPVGHSVLQVKANDSDMGPNGEVTYSLHQPS---SPVMRLLSIDRNTGIIFVKGSVDRE-EISILKFYVQAKDNGPQSKSSKALVTITVKDQNDNAPSIRIRGIGLVTHEDGVANISEDMPVGTAVALVEVSDRDEGENAVVTCVVAGDVPFQLRSASETGNDRKRKYF-LQTTTLLDYE--RIKEYRIEIVAVDSGNPALSSTN-SLKVQVTDMNDNAPVFSPTLYEVEFFEENQPGDKVL--DVVATDADSGTNAELTYSITG--GSVPEGLFEINPNTGEVRVMSQLDREQLDHYQFLVAAADKGVPSLRGTATVVVKVLDRNDNDPKFMLNGYSFSVQENMPPLSPVGMV-TVNDHDEGENARVQLSVEPD---NGKFMIQNGTYTILSTISFDREKESTYSFRLKAVDGGDPPR------SSYVGITINVLDENDNAPYVTKPANSSYKFLDPRTSPETHVESVEAEDIDIGLNSELDFNI 727          

HSP 2 Score: 113.62 bits (283), Expect = 6.571e-25
Identity = 139/497 (27.97%), Postives = 221/497 (44.47%), Query Frame = 3
Query:  384 TPTDPGTFFILIKILDQNDKAPQFSSIKRPFFK--IPENVEVGKVIDLPMAVDSDSEKYSVRRYSLSYIYHLDQTHDFRLHVTNDNPPRPQLIVNSKLDYEKINKYVFRLFAYDFDEKSIGNSCSTTIEIEIEDLNDNVPKF-----NQLTYN---ANIDENKRDDKLIKFT-VSDPDSGRNGIVTVNIV-DKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVS-NSVSIIEGLPAHSLVVEVRVTDADTHSNMIHCKLVDYNDLFY-LDSPSKFNTLLNYKP--FNLKTINKIDRES-NHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPII-VTDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAP 1820
            +P    +  + I I D ND  P+F   +R  ++  +PEN  VG  +    A DSD        YSL    H   +   RL   + N     + V   +D E+I+   F + A D   +S   S    + I ++D NDN P         +T+    ANI E+      +    VSD D G N +VT  +  D   +L    +    ++ ++FL+    LDYE     +   ++A D G P+LSS+  +K+ + ++NDN P        FS +   V   E       V++V  TDAD+ +N          +L Y +   S    L    P    ++ ++++DRE  +H  FL    +     PS + T   ++ +++ D NDN P F   +  G     Q N+    P  ++ V D D G N + +  +E      D+  F+I   +  I +  S D E ++ + F++ A+D G  P +S   ITINVLD NDNAP
Sbjct:  228 SPPRQSSALLRITITDANDNVPKF---ERSHYEGELPENSPVGHSVLQVKANDSDMGPNGEVTYSL----HQPSSPVMRLLSIDRN--TGIIFVKGSVDREEISILKFYVQAKDNGPQS--KSSKALVTITVKDQNDNAPSIRIRGIGLVTHEDGVANISEDMPVGTAVALVEVSDRDEGENAVVTCVVAGDVPFQLRSASETGNDRKRKYFLQTTTLLDYERIKE-YRIEIVAVDSGNPALSSTNSLKVQVTDMNDNAPV-------FSPTLYEVEFFEENQPGDKVLDVVATDADSGTNA---------ELTYSITGGSVPEGLFEINPNTGEVRVMSQLDREQLDHYQFL--VAAADKGVPSLRGTA--TVVVKVLDRNDNDPKF---MLNGYSFSVQENMPPLSPVGMVTVNDHDEGENARVQLSVE-----PDNGKFMIQNGTYTILSTISFDREKESTYSFRLKAVDGGDPPRSSYVGITINVLDENDNAP 684          

HSP 3 Score: 92.8189 bits (229), Expect = 1.608e-18
Identity = 90/287 (31.36%), Postives = 125/287 (43.55%), Query Frame = 3
Query: 1347 TINKIDRES---------NHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPIIVTDRDSGLNGKFEFYL----EDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSI-EPKGDHSSYFDIDRYTGDLRTRKPLDRETLESISIKVTAKNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAPKF 2165
            T N IDRES             FL   +S TD          E   I+I D NDN P FS  + +        +V   F  P+  TDRDSG NG  ++ L    E    FS       D+   ++    +LD E ++ +   I  +D G  P  SS+ + I + D NDN P+F  SHY   + EN  VG  +  ++A D D    N ++ YS+ +P         IDR TG +  +  +DRE +  +   V AK+    S        S+  V I V D NDNAP  
Sbjct:   82 TENSIDRESLKDCRNLFEGDPCFLEFEVSITDLMKGTGPRLIEG-RIEILDENDNTPQFSSPV-LTLSIPENTHVGALFAIPV-ATDRDSGSNGIADYALTTGPEATNLFSLQVAQDSDEKLPQLIVLGNLDRELRDSYDLNIKVVDGGSPPRQSSALLRITITDANDNVPKFERSHYEGELPENSPVGHSVLQVKANDSDMG-PNGEVTYSLHQPSSPVMRLLSIDRNTGIIFVKGSVDREEISILKFYVQAKDNGPQSK------SSKALVTITVKDQNDNAPSI 358          
BLAST of Protocadherin Fat 1 vs. Ensembl Zebrafish
Match: pcdh1b (protocadherin 1b [Source:ZFIN;Acc:ZDB-GENE-091015-2])

HSP 1 Score: 204.142 bits (518), Expect = 4.749e-53
Identity = 200/681 (29.37%), Postives = 310/681 (45.52%), Query Frame = 3
Query:  279 NGVNREAVCRDNPGEKVRKFCKADLCCKLIGFQ-----YLTPTDPGTFFILIKILDQNDKAPQFSSIKRPFF--KIPENVEVGKVIDLPMAVDSDSEKYSVRRYSLSYIYHLDQTHDFRLHVTNDNPPR-PQLIVNSKLDYEKINKYVFRLFAYDFDEKSIGNSCSTTIEIEIEDLNDNVPKFNQLTYNANIDENKR-DDKLIKFTVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSV--SNSVSIIEGLPAHSLVVEVRVTDADTHSNMIHCKLVDYNDLFYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPIIVTDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLRTRKPLDRETLESISIKVTAKNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAP----------KFI-PRLNMKQKVEFIVEQFVDGNTCTELPYTV 2255
            N ++RE++      +  R   + D C   + F+      +  T P      I+ILD+ND  PQFSS   P     IPEN  VG +  +P+A D DS    +  Y+L+     + T+ F L V  D+  + PQLIV   LD E  + Y   +     D  S     S  + I I D NDNVPKF +  Y   + EN      +++   +D D G NG VT ++   +   S   ++  I RN   + +  S+D E +  + +F + A D G  S SS A V I +K+ NDN P I+ + +G         +I E +P  + V  V V+D D   N +   +V  +  F L S S+       K F L+T   +D E       RI I   DS      +TN SL +Q+ D+NDNAP+FS  +Y     E            ++ TD DSG N +  + +           F I+  +G++     LD E  + ++F + A DKG   L  ++T+ + VLD NDN P+F  + Y F+V EN+     +G +  ++D  + +N  +  S+EP    +  F I   T  + +    DRE   + S ++ A +             S V + I V+D NDNAP          KF+ PR + +  VE +  + +D    +EL + +
Sbjct:   86 NSIDRESL------KDCRNLFEGDPC--FLEFEVSITDLMKGTGPRLIEGRIEILDENDNTPQFSS---PVLTLSIPENTHVGALFAIPVATDRDSGSNGIADYALT--TGPEATNLFSLQVAQDSDEKLPQLIVLGNLDRELRDSYDLNIKV--VDGGSPPRQSSALLRITITDANDNVPKFERSHYEGELPENSPVGHSVLQVKANDSDMGPNGEVTYSLHQPS---SPVMRLLSIDRNTGIIFVKGSVDRE-EISILKFYVQAKDNGPQSKSSKALVTITVKDQNDNAPSIRIRGIGLVTHEDGVANISEDMPVGTAVALVEVSDRDEGENAVVTCVVAGDVPFQLRSASETGNDRKRKYF-LQTTTLLDYE--RIKEYRIEIVAVDSGNPALSSTN-SLKVQVTDMNDNAPVFSPTLYEVEFFEENQPGDKVL--DVVATDADSGTNAELTYSITG--GSVPEGLFEINPNTGEVRVMSQLDREQLDHYQFLVAAADKGVPSLRGTATVVVKVLDRNDNDPKFMLNGYSFSVQENMPPLSPVGMV-TVNDHDEGENARVQLSVEPD---NGKFMIQNGTYTILSTISFDREKESTYSFRLKAVDGGDPPR------SSYVGITINVLDENDNAPYVTKPANSSYKFLDPRTSPETHVESVEAEDIDIGLNSELDFNI 729          

HSP 2 Score: 92.8189 bits (229), Expect = 1.823e-18
Identity = 90/287 (31.36%), Postives = 125/287 (43.55%), Query Frame = 3
Query: 1347 TINKIDRES---------NHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPIIVTDRDSGLNGKFEFYL----EDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSI-EPKGDHSSYFDIDRYTGDLRTRKPLDRETLESISIKVTAKNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAPKF 2165
            T N IDRES             FL   +S TD          E   I+I D NDN P FS  + +        +V   F  P+  TDRDSG NG  ++ L    E    FS       D+   ++    +LD E ++ +   I  +D G  P  SS+ + I + D NDN P+F  SHY   + EN  VG  +  ++A D D    N ++ YS+ +P         IDR TG +  +  +DRE +  +   V AK+    S        S+  V I V D NDNAP  
Sbjct:   84 TENSIDRESLKDCRNLFEGDPCFLEFEVSITDLMKGTGPRLIEG-RIEILDENDNTPQFSSPV-LTLSIPENTHVGALFAIPV-ATDRDSGSNGIADYALTTGPEATNLFSLQVAQDSDEKLPQLIVLGNLDRELRDSYDLNIKVVDGGSPPRQSSALLRITITDANDNVPKFERSHYEGELPENSPVGHSVLQVKANDSDMG-PNGEVTYSLHQPSSPVMRLLSIDRNTGIIFVKGSVDREEISILKFYVQAKDNGPQSK------SSKALVTITVKDQNDNAPSI 360          
BLAST of Protocadherin Fat 1 vs. Ensembl Zebrafish
Match: pcdh1a (protocadherin 1a [Source:ZFIN;Acc:ZDB-GENE-091116-32])

HSP 1 Score: 204.527 bits (519), Expect = 5.443e-53
Identity = 187/639 (29.26%), Postives = 297/639 (46.48%), Query Frame = 3
Query:  417 IKILDQNDKAPQFSSIKRPFF--KIPENVEVGKVIDLPMAVDSDSEKYSVRRYSLSYIYHLDQTHDFRLHVTNDNPPR-PQLIVNSKLDYEKINKYVFRLFAYDFDEKSIGNS---CSTTIEIEIEDLNDNVPKFNQLTYNANIDENKR-DDKLIKFTVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGF-SVSNSVS-IIEGLPAHSLVVEVRVTDADTHSNMIHCKLVDYNDLFYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPIIVTDRDSGLNGKFEFYLEDFRNFSDSSD---FLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLRTRKPLDRETLESISIKVTA---KNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAP-----------KFIPRLNMKQKVEFIVEQFVDGNTCTELPYTV 2255
            I++ D ND  PQF S   P     +PEN  +G +  +P+A D D+E+  V  Y+L+     +    F L V  D   + PQLIV   LD E  + Y   + A D      GN     S  + + I D NDN PKF + +Y A + EN      +++   +D D G NG +   +    D + K   +  I R+   + +   LD E   +L +F ++A D+G    SS   V I + + NDN P ++ + +G  + S+ V+ I E +P  + V  V+V+D D   N +   +V  +  F L  P+  +++ N + + L+T   +D E       R+ I   DS      +TN SL +Q+ D NDN+P+FS  ++     E            ++ +D DSG N +  + +      +DSS    F ID  SG++  +  LD E K+++ F++ A DKG      ++T+ I VLD NDN P+F  S Y F+V EN+     +G +   D D + +N  +  S+EP       F I   TG + +    DRE   S + ++ A    +P +          S V V I V+D NDNAP           +  P       VE +  + +D  +  EL Y++
Sbjct:  119 IEVQDINDNTPQFPS---PVLTLSVPENTHMGALFSIPLATDKDTERNGVADYTLTA--GPEAVALFGLQVAEDRGEKLPQLIVLGSLDRELKDSYDLTIKAVDG-----GNPPRYSSALLRVVIADANDNAPKFEKSSYEAEVAENSPIGHSVLQVKANDSDLGPNGEIEYTLHQAIDPVPK---LLRIDRSSGIIYVKGPLDREEINNL-KFYVVARDKGPSPKSSKTYVSIDVTDQNDNAPAVEIRGIGLVTHSDGVANISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDVPFQL-RPASDSSVDNKRKYFLQTTTPLDYERVRD--YRVEIVAVDSGNPALSSTN-SLKVQVTDTNDNSPIFSPTLFEVEFAEENQPGEKVVE--VVASDADSGTNAELVYSI-----IADSSTRGLFEIDPNSGEVRARSPLDREHKDRYEFRVTAADKGVPSHRGTATVVIKVLDRNDNDPKFMLSGYSFSVLENMPPLSPVGMVTVQDMD-EGENAQVQLSVEPD---VGKFVIQNGTGTILSSISFDREKESSYTFRLKAVDGGDPPR---------SSYVGVTINVLDENDNAPVVTKPSNSSFIRLSPMAAPDSVVEVVEAEDIDSGSNAELVYSI 719          
BLAST of Protocadherin Fat 1 vs. Ensembl Xenopus
Match: pcdh17 (protocadherin 17 [Source:Xenbase;Acc:XB-GENE-480220])

HSP 1 Score: 201.83 bits (512), Expect = 4.157e-52
Identity = 189/659 (28.68%), Postives = 301/659 (45.68%), Query Frame = 3
Query:  417 IKILDQNDKAPQFSSIKRPF--FKIPENVEVGKVIDLPMAVDSDSEKYSVRRYSLSYIYHLDQTHDFRLHVTND-NPPRPQLIVNSKLDYEKINKYVFRLFAYDFDEKSIGNSCSTTIEIEIEDLNDNVPKFNQLTYNANIDENK-RDDKLIKFTVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNS--VSIIEGLPAHSLVVEVRVTDADTHSNMIHCKLVDYNDLFYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPK---------PIIVTDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLRTRKPLDRETLESISIKVTA---KNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAPKFIPRLNMKQKVEFIVEQFVDGNTCTELPYTVQDIDDGGINGQNCCYTILENDYNKLFSL 2339
            I+I+D ND  P F+S   P     IPEN  +G +  +P A D DS    V  Y L  I   +    F L V  D +  +PQLIV   LD E+ + Y   +   D    +   + S  + I I D NDN PKF ++ Y A + EN      +++   +D D G N  +  +    +D + +   +  + R+   + +   +D E D    +F+++A D+G    ++  QV I +++ NDN P I+ +  G         +I E +P  + V  V+V+D D   N     +V  +  F L   S   +    K F L+T   +D ES     + I    + + P   +++  SL +Q+ DVNDNAP+FSQ +             V FP+          +  TD DSG N +  + +    + S    F I+  SG+I     LD E +  + F ++A+DKG   L  ++++ I VLD NDN P+F  + Y F+V EN+     +G +  ID D   +N  I  S+EP+   S  F I   TG + +    DRE   + + ++ A    +P +          S V V I V+D NDNAP  +   N+  K  ++  Q   G   T + +   +  D GIN +   Y+I   +  +LF +
Sbjct:  164 IEIMDINDNTPNFNS---PVITLSIPENTNIGMLFPIPAATDRDSGVNGVSSYEL--IVGPEAQDLFGLQVAEDQDEKQPQLIVMGMLDREQRDSYDLTIKVQDGGTPA--RASSALLRISILDTNDNAPKFEKMAYEAELPENSPMGHSVLQVKANDSDQGVNAEIDYSFHQASDTVRR---LLHLDRSTGLITVQGPIDRE-DVGTLKFSVVAKDKGANPKTARTQVTITIRDTNDNKPVIEIRGFGLVTHQGGVANISEDVPVETPVALVQVSDIDEGVNAAVTCVVAGDVPFQLKQVSDTGSDSKKKYF-LQTTTALDYESVKEYTIEIVAVDSGNPP---LSSTNSLKVQVTDVNDNAPVFSQSLM-----------EVVFPENNDINDLVMEVSATDADSGPNSQLHYSI--LPDPSARGIFSINPDSGQIRVNTVLDREQREHYDFHVVAVDKGIPSLKGTASVVITVLDRNDNDPKFMLNGYNFSVMENMPRLSPVGMVTVIDADKG-ENAHIHLSVEPE---SGEFVIQNGTGTILSSISFDREHQSTYTFRLKAVDGGDPPR---------SSYVGVTINVLDENDNAPVIVVPSNISYK--YLTPQTHPG---TPVNWVRAEDMDTGINAE-LDYSIASGNPFELFQI 775          

HSP 2 Score: 131.339 bits (329), Expect = 3.287e-30
Identity = 144/487 (29.57%), Postives = 224/487 (46.00%), Query Frame = 3
Query:  762 EIEIEDLNDNVPKFNQLTYNANIDENKRDDKLIKF-TVSDPDSGRNGIVTVN-IVDKTDELSKRFKIFEIQ-RNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDADTHSNMIHCKLVDYNDLFYLDSPSKFNTLLNYKPFNLKTINK-IDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPM-----FSQQIYIGXXXXXXXXXXXXFPKPII-VTDRDSGLN--------GKFEFYLEDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLRTRKPLDRETLESISIKVTAKNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAPKFI 2168
            +IEI D+NDN P FN      +I EN     L      +D DSG NG+ +   IV    +     ++ E Q   +  L ++  LD E     ++ T+   D GTP+ +SSA ++I + + NDN P  KF+K+ +       + E  P    V++V+  D+D   N      +DY+  F+  S +    L   +   L T+   IDRE      L+ ++   D   + + T    + I I D NDN P+     F    + G V     +V V  P  ++ V+D D G+N        G   F L+   +    S     K    + T  +LDYE+  ++  +I+A+D G  PL+S++++ + V D+NDNAP FS+S       EN  +   +  + A D D+   N  + YSI P       F I+  +G +R    LDRE  E     V A +    S   ++ T S   V+I V+D NDN PKF+
Sbjct:  163 QIEIMDINDNTPNFNSPVITLSIPENTNIGMLFPIPAATDRDSGVNGVSSYELIVGPEAQDLFGLQVAEDQDEKQPQLIVMGMLDREQRDS-YDLTIKVQDGGTPARASSALLRISILDTNDNAP--KFEKMAY----EAELPENSPMGHSVLQVKANDSDQGVN----AEIDYS--FHQASDTVRRLLHLDRSTGLITVQGPIDREDV--GTLKFSVVAKDKGANPK-TARTQVTITIRDTNDNKPVIEIRGFGLVTHQGGVANISEDVPVETPVALVQVSDIDEGVNAAVTCVVAGDVPFQLKQVSDTGSDS-----KKKYFLQTTTALDYESVKEYTIEIVAVDSGNPPLSSTNSLKVQVTDVNDNAPVFSQSLMEVVFPENNDINDLVMEVSATDADSG-PNSQLHYSILPDPSARGIFSINPDSGQIRVNTVLDREQREHYDFHVVAVDKGIPS---LKGTAS---VVITVLDRNDNDPKFM 621          

HSP 3 Score: 130.954 bits (328), Expect = 5.257e-30
Identity = 163/605 (26.94%), Postives = 261/605 (43.14%), Query Frame = 3
Query:  384 TPTDPGTFFILIKILDQNDKAPQFSSIKRPFFKIPENVEVGKVIDLPMAVDSDSE-----KYSVRRYS--LSYIYHLDQTHDFRLHVTNDNPPRPQLIVNSKLDYEKINKYVFRLFAYDFDEKSIGNSCSTTIEIEIEDLNDNVP-----KFNQLTYN---ANIDENKRDDKLIKFT-VSDPDSGRNGIVTVNIV-DKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFT--LLATDQGTPSLSSSAQVKIHLKNLNDNGPKI--KFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDADTHSN-MIHCKLVDYNDLFYLDSPSKFNTL-LNYKPFNLKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPII-VTDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAP------RFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLRTRKPLDRE--TLESISIKVTAKN-PNKYSSHFVR 2099
            TP    +  + I ILD ND AP+F  +     ++PEN  +G  +    A DSD        YS  + S  +  + HLD++                + V   +D E +    F + A   D+ +   +  T + I I D NDN P      F  +T+    ANI E+   +  +    VSD D G N  VT  +  D   +L +        + ++FL+   +LDYE+   + E+T  ++A D G P LSS+  +K+ + ++NDN P       ++ F  +N +        + LV+EV  TDAD+  N  +H  +        L  PS      +N     ++    +DRE        + ++     PS + T   S+ I + D NDN P F   +  G       N+    P  ++ V D D G N      +E      +S +F+I   +G I +  S D E ++ + F++ A+D G  P +S   +TINVLD NDNAP        S  +          V W    ++A D DT   N ++ YSI   G+    F I    G++   K + R+   L  + +KVT K  P+++ +  V 
Sbjct:  265 TPARASSALLRISILDTNDNAPKFEKMAYE-AELPENSPMGHSVLQVKANDSDQGVNAEIDYSFHQASDTVRRLLHLDRSTGL-------------ITVQGPIDREDVGTLKFSVVAK--DKGANPKTARTQVTITIRDTNDNKPVIEIRGFGLVTHQGGVANISEDVPVETPVALVQVSDIDEGVNAAVTCVVAGDVPFQLKQVSDTGSDSKKKYFLQTTTALDYES---VKEYTIEIVAVDSGNPPLSSTNSLKVQVTDVNDNAPVFSQSLMEVVFPENNDI--------NDLVMEVSATDADSGPNSQLHYSI--------LPDPSARGIFSINPDSGQIRVNTVLDREQREHYDFHV-VAVDKGIPSLKGTA--SVVITVLDRNDNDPKF---MLNGYNFSVMENMPRLSPVGMVTVIDADKGENAHIHLSVE-----PESGEFVIQNGTGTILSSISFDREHQSTYTFRLKAVDGGDPPRSSYVGVTINVLDENDNAPVIVVPSNISYKYLTPQTHPGTPVNW----VRAEDMDTG-INAELDYSIA-SGNPFELFQISHNNGEVTLEKAIIRKHYGLHRLVVKVTDKGKPSRHGTALVH 817          
BLAST of Protocadherin Fat 1 vs. Ensembl Xenopus
Match: pcdh17 (protocadherin 17 [Source:Xenbase;Acc:XB-GENE-480220])

HSP 1 Score: 201.83 bits (512), Expect = 5.015e-52
Identity = 188/656 (28.66%), Postives = 299/656 (45.58%), Query Frame = 3
Query:  417 IKILDQNDKAPQFSSIKRPF--FKIPENVEVGKVIDLPMAVDSDSEKYSVRRYSLSYIYHLDQTHDFRLHVTND-NPPRPQLIVNSKLDYEKINKYVFRLFAYDFDEKSIGNSCSTTIEIEIEDLNDNVPKFNQLTYNANIDENK-RDDKLIKFTVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNS--VSIIEGLPAHSLVVEVRVTDADTHSNMIHCKLVDYNDLFYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPK---------PIIVTDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLRTRKPLDRETLESISIKVTAKNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAPKFIPRLNMKQKVEFIVEQFVDGNTCTELPYTVQDIDDGGINGQNCCYTILENDYNKLFSL 2339
            I+I+D ND  P F+S   P     IPEN  +G +  +P A D DS    V  Y L  I   +    F L V  D +  +PQLIV   LD E+ + Y   +   D    +   + S  + I I D NDN PKF ++ Y A + EN      +++   +D D G N  +  +    +D + +   +  + R+   + +   +D E D    +F+++A D+G    ++  QV I +++ NDN P I+ +  G         +I E +P  + V  V+V+D D   N     +V  +  F L   S   +    K F L+T   +D ES     + I    + + P   +++  SL +Q+ DVNDNAP+FSQ +             V FP+          +  TD DSG N +  + +    + S    F I+  SG+I     LD E +  + F ++A+DKG   L  ++++ I VLD NDN P+F  + Y F+V EN+     +G +  ID D   +N  I  S+EP+   S  F I   TG + +    DRE   + + ++ A +             S V V I V+D NDNAP  +   N+  K  ++  Q   G   T + +   +  D GIN +   Y+I   +  +LF +
Sbjct:  164 IEIMDINDNTPNFNS---PVITLSIPENTNIGMLFPIPAATDRDSGVNGVSSYEL--IVGPEAQDLFGLQVAEDQDEKQPQLIVMGMLDREQRDSYDLTIKVQDGGTPA--RASSALLRISILDTNDNAPKFEKMAYEAELPENSPMGHSVLQVKANDSDQGVNAEIDYSFHQASDTVRR---LLHLDRSTGLITVQGPIDRE-DVGTLKFSVVAKDKGANPKTARTQVTITIRDTNDNKPVIEIRGFGLVTHQGGVANISEDVPVETPVALVQVSDIDEGVNAAVTCVVAGDVPFQLKQVSDTGSDSKKKYF-LQTTTALDYESVKEYTIEIVAVDSGNPP---LSSTNSLKVQVTDVNDNAPVFSQSLM-----------EVVFPENNDINDLVMEVSATDADSGPNSQLHYSI--LPDPSARGIFSINPDSGQIRVNTVLDREQREHYDFHVVAVDKGIPSLKGTASVVITVLDRNDNDPKFMLNGYNFSVMENMPRLSPVGMVTVIDADKG-ENAHIHLSVEPE---SGEFVIQNGTGTILSSISFDREHQSTYTFRLKAVDGGDPPR------SSYVGVTINVLDENDNAPVIVVPSNISYK--YLTPQTHPG---TPVNWVRAEDMDTGINAE-LDYSIASGNPFELFQI 775          

HSP 2 Score: 131.339 bits (329), Expect = 3.597e-30
Identity = 144/487 (29.57%), Postives = 224/487 (46.00%), Query Frame = 3
Query:  762 EIEIEDLNDNVPKFNQLTYNANIDENKRDDKLIKF-TVSDPDSGRNGIVTVN-IVDKTDELSKRFKIFEIQ-RNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDADTHSNMIHCKLVDYNDLFYLDSPSKFNTLLNYKPFNLKTINK-IDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPM-----FSQQIYIGXXXXXXXXXXXXFPKPII-VTDRDSGLN--------GKFEFYLEDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLRTRKPLDRETLESISIKVTAKNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAPKFI 2168
            +IEI D+NDN P FN      +I EN     L      +D DSG NG+ +   IV    +     ++ E Q   +  L ++  LD E     ++ T+   D GTP+ +SSA ++I + + NDN P  KF+K+ +       + E  P    V++V+  D+D   N      +DY+  F+  S +    L   +   L T+   IDRE      L+ ++   D   + + T    + I I D NDN P+     F    + G V     +V V  P  ++ V+D D G+N        G   F L+   +    S     K    + T  +LDYE+  ++  +I+A+D G  PL+S++++ + V D+NDNAP FS+S       EN  +   +  + A D D+   N  + YSI P       F I+  +G +R    LDRE  E     V A +    S   ++ T S   V+I V+D NDN PKF+
Sbjct:  163 QIEIMDINDNTPNFNSPVITLSIPENTNIGMLFPIPAATDRDSGVNGVSSYELIVGPEAQDLFGLQVAEDQDEKQPQLIVMGMLDREQR-DSYDLTIKVQDGGTPARASSALLRISILDTNDNAP--KFEKMAY----EAELPENSPMGHSVLQVKANDSDQGVN----AEIDYS--FHQASDTVRRLLHLDRSTGLITVQGPIDREDV--GTLKFSVVAKDKGANPK-TARTQVTITIRDTNDNKPVIEIRGFGLVTHQGGVANISEDVPVETPVALVQVSDIDEGVNAAVTCVVAGDVPFQLKQVSDTGSDS-----KKKYFLQTTTALDYESVKEYTIEIVAVDSGNPPLSSTNSLKVQVTDVNDNAPVFSQSLMEVVFPENNDINDLVMEVSATDADSG-PNSQLHYSILPDPSARGIFSINPDSGQIRVNTVLDREQREHYDFHVVAVDKGIPS---LKGTAS---VVITVLDRNDNDPKFM 621          

HSP 3 Score: 131.339 bits (329), Expect = 4.053e-30
Identity = 163/605 (26.94%), Postives = 261/605 (43.14%), Query Frame = 3
Query:  384 TPTDPGTFFILIKILDQNDKAPQFSSIKRPFFKIPENVEVGKVIDLPMAVDSDSE-----KYSVRRYS--LSYIYHLDQTHDFRLHVTNDNPPRPQLIVNSKLDYEKINKYVFRLFAYDFDEKSIGNSCSTTIEIEIEDLNDNVP-----KFNQLTYN---ANIDENKRDDKLIKFT-VSDPDSGRNGIVTVNIV-DKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFT--LLATDQGTPSLSSSAQVKIHLKNLNDNGPKI--KFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDADTHSN-MIHCKLVDYNDLFYLDSPSKFNTL-LNYKPFNLKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPII-VTDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAP------RFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLRTRKPLDRE--TLESISIKVTAKN-PNKYSSHFVR 2099
            TP    +  + I ILD ND AP+F  +     ++PEN  +G  +    A DSD        YS  + S  +  + HLD++                + V   +D E +    F + A   D+ +   +  T + I I D NDN P      F  +T+    ANI E+   +  +    VSD D G N  VT  +  D   +L +        + ++FL+   +LDYE+   + E+T  ++A D G P LSS+  +K+ + ++NDN P       ++ F  +N +        + LV+EV  TDAD+  N  +H  +        L  PS      +N     ++    +DRE        + ++     PS + T   S+ I + D NDN P F   +  G       N+    P  ++ V D D G N      +E      +S +F+I   +G I +  S D E ++ + F++ A+D G  P +S   +TINVLD NDNAP        S  +          V W    ++A D DT   N ++ YSI   G+    F I    G++   K + R+   L  + +KVT K  P+++ +  V 
Sbjct:  265 TPARASSALLRISILDTNDNAPKFEKMAYE-AELPENSPMGHSVLQVKANDSDQGVNAEIDYSFHQASDTVRRLLHLDRSTGL-------------ITVQGPIDREDVGTLKFSVVAK--DKGANPKTARTQVTITIRDTNDNKPVIEIRGFGLVTHQGGVANISEDVPVETPVALVQVSDIDEGVNAAVTCVVAGDVPFQLKQVSDTGSDSKKKYFLQTTTALDYES---VKEYTIEIVAVDSGNPPLSSTNSLKVQVTDVNDNAPVFSQSLMEVVFPENNDI--------NDLVMEVSATDADSGPNSQLHYSI--------LPDPSARGIFSINPDSGQIRVNTVLDREQREHYDFHV-VAVDKGIPSLKGTA--SVVITVLDRNDNDPKF---MLNGYNFSVMENMPRLSPVGMVTVIDADKGENAHIHLSVE-----PESGEFVIQNGTGTILSSISFDREHQSTYTFRLKAVDGGDPPRSSYVGVTINVLDENDNAPVIVVPSNISYKYLTPQTHPGTPVNW----VRAEDMDTG-INAELDYSIA-SGNPFELFQISHNNGEVTLEKAIIRKHYGLHRLVVKVTDKGKPSRHGTALVH 817          
BLAST of Protocadherin Fat 1 vs. Ensembl Xenopus
Match: pcdh17 (protocadherin 17 [Source:Xenbase;Acc:XB-GENE-480220])

HSP 1 Score: 201.83 bits (512), Expect = 5.344e-52
Identity = 188/656 (28.66%), Postives = 299/656 (45.58%), Query Frame = 3
Query:  417 IKILDQNDKAPQFSSIKRPF--FKIPENVEVGKVIDLPMAVDSDSEKYSVRRYSLSYIYHLDQTHDFRLHVTND-NPPRPQLIVNSKLDYEKINKYVFRLFAYDFDEKSIGNSCSTTIEIEIEDLNDNVPKFNQLTYNANIDENK-RDDKLIKFTVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNS--VSIIEGLPAHSLVVEVRVTDADTHSNMIHCKLVDYNDLFYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPK---------PIIVTDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLRTRKPLDRETLESISIKVTAKNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAPKFIPRLNMKQKVEFIVEQFVDGNTCTELPYTVQDIDDGGINGQNCCYTILENDYNKLFSL 2339
            I+I+D ND  P F+S   P     IPEN  +G +  +P A D DS    V  Y L  I   +    F L V  D +  +PQLIV   LD E+ + Y   +   D    +   + S  + I I D NDN PKF ++ Y A + EN      +++   +D D G N  +  +    +D + +   +  + R+   + +   +D E D    +F+++A D+G    ++  QV I +++ NDN P I+ +  G         +I E +P  + V  V+V+D D   N     +V  +  F L   S   +    K F L+T   +D ES     + I    + + P   +++  SL +Q+ DVNDNAP+FSQ +             V FP+          +  TD DSG N +  + +    + S    F I+  SG+I     LD E +  + F ++A+DKG   L  ++++ I VLD NDN P+F  + Y F+V EN+     +G +  ID D   +N  I  S+EP+   S  F I   TG + +    DRE   + + ++ A +             S V V I V+D NDNAP  +   N+  K  ++  Q   G   T + +   +  D GIN +   Y+I   +  +LF +
Sbjct:  156 IEIMDINDNTPNFNS---PVITLSIPENTNIGMLFPIPAATDRDSGVNGVSSYEL--IVGPEAQDLFGLQVAEDQDEKQPQLIVMGMLDREQRDSYDLTIKVQDGGTPA--RASSALLRISILDTNDNAPKFEKMAYEAELPENSPMGHSVLQVKANDSDQGVNAEIDYSFHQASDTVRR---LLHLDRSTGLITVQGPIDRE-DVGTLKFSVVAKDKGANPKTARTQVTITIRDTNDNKPVIEIRGFGLVTHQGGVANISEDVPVETPVALVQVSDIDEGVNAAVTCVVAGDVPFQLKQVSDTGSDSKKKYF-LQTTTALDYESVKEYTIEIVAVDSGNPP---LSSTNSLKVQVTDVNDNAPVFSQSLM-----------EVVFPENNDINDLVMEVSATDADSGPNSQLHYSI--LPDPSARGIFSINPDSGQIRVNTVLDREQREHYDFHVVAVDKGIPSLKGTASVVITVLDRNDNDPKFMLNGYNFSVMENMPRLSPVGMVTVIDADKG-ENAHIHLSVEPE---SGEFVIQNGTGTILSSISFDREHQSTYTFRLKAVDGGDPPR------SSYVGVTINVLDENDNAPVIVVPSNISYK--YLTPQTHPG---TPVNWVRAEDMDTGINAE-LDYSIASGNPFELFQI 767          

HSP 2 Score: 131.339 bits (329), Expect = 3.428e-30
Identity = 144/487 (29.57%), Postives = 224/487 (46.00%), Query Frame = 3
Query:  762 EIEIEDLNDNVPKFNQLTYNANIDENKRDDKLIKF-TVSDPDSGRNGIVTVN-IVDKTDELSKRFKIFEIQ-RNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDADTHSNMIHCKLVDYNDLFYLDSPSKFNTLLNYKPFNLKTINK-IDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPM-----FSQQIYIGXXXXXXXXXXXXFPKPII-VTDRDSGLN--------GKFEFYLEDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLRTRKPLDRETLESISIKVTAKNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAPKFI 2168
            +IEI D+NDN P FN      +I EN     L      +D DSG NG+ +   IV    +     ++ E Q   +  L ++  LD E     ++ T+   D GTP+ +SSA ++I + + NDN P  KF+K+ +       + E  P    V++V+  D+D   N      +DY+  F+  S +    L   +   L T+   IDRE      L+ ++   D   + + T    + I I D NDN P+     F    + G V     +V V  P  ++ V+D D G+N        G   F L+   +    S     K    + T  +LDYE+  ++  +I+A+D G  PL+S++++ + V D+NDNAP FS+S       EN  +   +  + A D D+   N  + YSI P       F I+  +G +R    LDRE  E     V A +    S   ++ T S   V+I V+D NDN PKF+
Sbjct:  155 QIEIMDINDNTPNFNSPVITLSIPENTNIGMLFPIPAATDRDSGVNGVSSYELIVGPEAQDLFGLQVAEDQDEKQPQLIVMGMLDREQR-DSYDLTIKVQDGGTPARASSALLRISILDTNDNAP--KFEKMAY----EAELPENSPMGHSVLQVKANDSDQGVN----AEIDYS--FHQASDTVRRLLHLDRSTGLITVQGPIDREDV--GTLKFSVVAKDKGANPK-TARTQVTITIRDTNDNKPVIEIRGFGLVTHQGGVANISEDVPVETPVALVQVSDIDEGVNAAVTCVVAGDVPFQLKQVSDTGSDS-----KKKYFLQTTTALDYESVKEYTIEIVAVDSGNPPLSSTNSLKVQVTDVNDNAPVFSQSLMEVVFPENNDINDLVMEVSATDADSG-PNSQLHYSILPDPSARGIFSINPDSGQIRVNTVLDREQREHYDFHVVAVDKGIPS---LKGTAS---VVITVLDRNDNDPKFM 613          

HSP 3 Score: 130.954 bits (328), Expect = 4.503e-30
Identity = 163/605 (26.94%), Postives = 261/605 (43.14%), Query Frame = 3
Query:  384 TPTDPGTFFILIKILDQNDKAPQFSSIKRPFFKIPENVEVGKVIDLPMAVDSDSE-----KYSVRRYS--LSYIYHLDQTHDFRLHVTNDNPPRPQLIVNSKLDYEKINKYVFRLFAYDFDEKSIGNSCSTTIEIEIEDLNDNVP-----KFNQLTYN---ANIDENKRDDKLIKFT-VSDPDSGRNGIVTVNIV-DKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFT--LLATDQGTPSLSSSAQVKIHLKNLNDNGPKI--KFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDADTHSN-MIHCKLVDYNDLFYLDSPSKFNTL-LNYKPFNLKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPII-VTDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAP------RFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLRTRKPLDRE--TLESISIKVTAKN-PNKYSSHFVR 2099
            TP    +  + I ILD ND AP+F  +     ++PEN  +G  +    A DSD        YS  + S  +  + HLD++                + V   +D E +    F + A   D+ +   +  T + I I D NDN P      F  +T+    ANI E+   +  +    VSD D G N  VT  +  D   +L +        + ++FL+   +LDYE+   + E+T  ++A D G P LSS+  +K+ + ++NDN P       ++ F  +N +        + LV+EV  TDAD+  N  +H  +        L  PS      +N     ++    +DRE        + ++     PS + T   S+ I + D NDN P F   +  G       N+    P  ++ V D D G N      +E      +S +F+I   +G I +  S D E ++ + F++ A+D G  P +S   +TINVLD NDNAP        S  +          V W    ++A D DT   N ++ YSI   G+    F I    G++   K + R+   L  + +KVT K  P+++ +  V 
Sbjct:  257 TPARASSALLRISILDTNDNAPKFEKMAYE-AELPENSPMGHSVLQVKANDSDQGVNAEIDYSFHQASDTVRRLLHLDRSTGL-------------ITVQGPIDREDVGTLKFSVVAK--DKGANPKTARTQVTITIRDTNDNKPVIEIRGFGLVTHQGGVANISEDVPVETPVALVQVSDIDEGVNAAVTCVVAGDVPFQLKQVSDTGSDSKKKYFLQTTTALDYES---VKEYTIEIVAVDSGNPPLSSTNSLKVQVTDVNDNAPVFSQSLMEVVFPENNDI--------NDLVMEVSATDADSGPNSQLHYSI--------LPDPSARGIFSINPDSGQIRVNTVLDREQREHYDFHV-VAVDKGIPSLKGTA--SVVITVLDRNDNDPKF---MLNGYNFSVMENMPRLSPVGMVTVIDADKGENAHIHLSVE-----PESGEFVIQNGTGTILSSISFDREHQSTYTFRLKAVDGGDPPRSSYVGVTINVLDENDNAPVIVVPSNISYKYLTPQTHPGTPVNW----VRAEDMDTG-INAELDYSIA-SGNPFELFQISHNNGEVTLEKAIIRKHYGLHRLVVKVTDKGKPSRHGTALVH 809          
BLAST of Protocadherin Fat 1 vs. Ensembl Xenopus
Match: pcdh17 (protocadherin 17 [Source:Xenbase;Acc:XB-GENE-480220])

HSP 1 Score: 200.675 bits (509), Expect = 6.951e-52
Identity = 188/656 (28.66%), Postives = 299/656 (45.58%), Query Frame = 3
Query:  417 IKILDQNDKAPQFSSIKRPF--FKIPENVEVGKVIDLPMAVDSDSEKYSVRRYSLSYIYHLDQTHDFRLHVTND-NPPRPQLIVNSKLDYEKINKYVFRLFAYDFDEKSIGNSCSTTIEIEIEDLNDNVPKFNQLTYNANIDENK-RDDKLIKFTVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNS--VSIIEGLPAHSLVVEVRVTDADTHSNMIHCKLVDYNDLFYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPK---------PIIVTDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLRTRKPLDRETLESISIKVTAKNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAPKFIPRLNMKQKVEFIVEQFVDGNTCTELPYTVQDIDDGGINGQNCCYTILENDYNKLFSL 2339
            I+I+D ND  P F+S   P     IPEN  +G +  +P A D DS    V  Y L  I   +    F L V  D +  +PQLIV   LD E+ + Y   +   D    +   + S  + I I D NDN PKF ++ Y A + EN      +++   +D D G N  +  +    +D + +   +  + R+   + +   +D E D    +F+++A D+G    ++  QV I +++ NDN P I+ +  G         +I E +P  + V  V+V+D D   N     +V  +  F L   S   +    K F L+T   +D ES     + I    + + P   +++  SL +Q+ DVNDNAP+FSQ +             V FP+          +  TD DSG N +  + +    + S    F I+  SG+I     LD E +  + F ++A+DKG   L  ++++ I VLD NDN P+F  + Y F+V EN+     +G +  ID D   +N  I  S+EP+   S  F I   TG + +    DRE   + + ++ A +             S V V I V+D NDNAP  +   N+  K  ++  Q   G   T + +   +  D GIN +   Y+I   +  +LF +
Sbjct:  164 IEIMDINDNTPNFNS---PVITLSIPENTNIGMLFPIPAATDRDSGVNGVSSYEL--IVGPEAQDLFGLQVAEDQDEKQPQLIVMGMLDREQRDSYDLTIKVQDGGTPA--RASSALLRISILDTNDNAPKFEKMAYEAELPENSPMGHSVLQVKANDSDQGVNAEIDYSFHQASDTVRR---LLHLDRSTGLITVQGPIDRE-DVGTLKFSVVAKDKGANPKTARTQVTITIRDTNDNKPVIEIRGFGLVTHQGGVANISEDVPVETPVALVQVSDIDEGVNAAVTCVVAGDVPFQLKQVSDTGSDSKKKYF-LQTTTALDYESVKEYTIEIVAVDSGNPP---LSSTNSLKVQVTDVNDNAPVFSQSLM-----------EVVFPENNDINDLVMEVSATDADSGPNSQLHYSI--LPDPSARGIFSINPDSGQIRVNTVLDREQREHYDFHVVAVDKGIPSLKGTASVVITVLDRNDNDPKFMLNGYNFSVMENMPRLSPVGMVTVIDADKG-ENAHIHLSVEPE---SGEFVIQNGTGTILSSISFDREHQSTYTFRLKAVDGGDPPR------SSYVGVTINVLDENDNAPVIVVPSNISYK--YLTPQTHPG---TPVNWVRAEDMDTGINAE-LDYSIASGNPFELFQI 775          

HSP 2 Score: 130.954 bits (328), Expect = 4.307e-30
Identity = 144/487 (29.57%), Postives = 224/487 (46.00%), Query Frame = 3
Query:  762 EIEIEDLNDNVPKFNQLTYNANIDENKRDDKLIKF-TVSDPDSGRNGIVTVN-IVDKTDELSKRFKIFEIQ-RNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDADTHSNMIHCKLVDYNDLFYLDSPSKFNTLLNYKPFNLKTINK-IDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPM-----FSQQIYIGXXXXXXXXXXXXFPKPII-VTDRDSGLN--------GKFEFYLEDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLRTRKPLDRETLESISIKVTAKNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAPKFI 2168
            +IEI D+NDN P FN      +I EN     L      +D DSG NG+ +   IV    +     ++ E Q   +  L ++  LD E     ++ T+   D GTP+ +SSA ++I + + NDN P  KF+K+ +       + E  P    V++V+  D+D   N      +DY+  F+  S +    L   +   L T+   IDRE      L+ ++   D   + + T    + I I D NDN P+     F    + G V     +V V  P  ++ V+D D G+N        G   F L+   +    S     K    + T  +LDYE+  ++  +I+A+D G  PL+S++++ + V D+NDNAP FS+S       EN  +   +  + A D D+   N  + YSI P       F I+  +G +R    LDRE  E     V A +    S   ++ T S   V+I V+D NDN PKF+
Sbjct:  163 QIEIMDINDNTPNFNSPVITLSIPENTNIGMLFPIPAATDRDSGVNGVSSYELIVGPEAQDLFGLQVAEDQDEKQPQLIVMGMLDREQRDS-YDLTIKVQDGGTPARASSALLRISILDTNDNAP--KFEKMAY----EAELPENSPMGHSVLQVKANDSDQGVN----AEIDYS--FHQASDTVRRLLHLDRSTGLITVQGPIDREDV--GTLKFSVVAKDKGANPK-TARTQVTITIRDTNDNKPVIEIRGFGLVTHQGGVANISEDVPVETPVALVQVSDIDEGVNAAVTCVVAGDVPFQLKQVSDTGSDS-----KKKYFLQTTTALDYESVKEYTIEIVAVDSGNPPLSSTNSLKVQVTDVNDNAPVFSQSLMEVVFPENNDINDLVMEVSATDADSG-PNSQLHYSILPDPSARGIFSINPDSGQIRVNTVLDREQREHYDFHVVAVDKGIPS---LKGTAS---VVITVLDRNDNDPKFM 621          

HSP 3 Score: 130.183 bits (326), Expect = 8.326e-30
Identity = 163/605 (26.94%), Postives = 261/605 (43.14%), Query Frame = 3
Query:  384 TPTDPGTFFILIKILDQNDKAPQFSSIKRPFFKIPENVEVGKVIDLPMAVDSDSE-----KYSVRRYS--LSYIYHLDQTHDFRLHVTNDNPPRPQLIVNSKLDYEKINKYVFRLFAYDFDEKSIGNSCSTTIEIEIEDLNDNVP-----KFNQLTYN---ANIDENKRDDKLIKFT-VSDPDSGRNGIVTVNIV-DKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFT--LLATDQGTPSLSSSAQVKIHLKNLNDNGPKI--KFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDADTHSN-MIHCKLVDYNDLFYLDSPSKFNTL-LNYKPFNLKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPII-VTDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAP------RFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLRTRKPLDRE--TLESISIKVTAKN-PNKYSSHFVR 2099
            TP    +  + I ILD ND AP+F  +     ++PEN  +G  +    A DSD        YS  + S  +  + HLD++                + V   +D E +    F + A   D+ +   +  T + I I D NDN P      F  +T+    ANI E+   +  +    VSD D G N  VT  +  D   +L +        + ++FL+   +LDYE+   + E+T  ++A D G P LSS+  +K+ + ++NDN P       ++ F  +N +        + LV+EV  TDAD+  N  +H  +        L  PS      +N     ++    +DRE        + ++     PS + T   S+ I + D NDN P F   +  G       N+    P  ++ V D D G N      +E      +S +F+I   +G I +  S D E ++ + F++ A+D G  P +S   +TINVLD NDNAP        S  +          V W    ++A D DT   N ++ YSI   G+    F I    G++   K + R+   L  + +KVT K  P+++ +  V 
Sbjct:  265 TPARASSALLRISILDTNDNAPKFEKMAYE-AELPENSPMGHSVLQVKANDSDQGVNAEIDYSFHQASDTVRRLLHLDRSTGL-------------ITVQGPIDREDVGTLKFSVVAK--DKGANPKTARTQVTITIRDTNDNKPVIEIRGFGLVTHQGGVANISEDVPVETPVALVQVSDIDEGVNAAVTCVVAGDVPFQLKQVSDTGSDSKKKYFLQTTTALDYES---VKEYTIEIVAVDSGNPPLSSTNSLKVQVTDVNDNAPVFSQSLMEVVFPENNDI--------NDLVMEVSATDADSGPNSQLHYSI--------LPDPSARGIFSINPDSGQIRVNTVLDREQREHYDFHV-VAVDKGIPSLKGTA--SVVITVLDRNDNDPKF---MLNGYNFSVMENMPRLSPVGMVTVIDADKGENAHIHLSVE-----PESGEFVIQNGTGTILSSISFDREHQSTYTFRLKAVDGGDPPRSSYVGVTINVLDENDNAPVIVVPSNISYKYLTPQTHPGTPVNW----VRAEDMDTG-INAELDYSIA-SGNPFELFQISHNNGEVTLEKAIIRKHYGLHRLVVKVTDKGKPSRHGTALVH 817          
BLAST of Protocadherin Fat 1 vs. Ensembl Xenopus
Match: pcdh17 (protocadherin 17 [Source:Xenbase;Acc:XB-GENE-480220])

HSP 1 Score: 200.675 bits (509), Expect = 7.104e-52
Identity = 188/656 (28.66%), Postives = 299/656 (45.58%), Query Frame = 3
Query:  417 IKILDQNDKAPQFSSIKRPF--FKIPENVEVGKVIDLPMAVDSDSEKYSVRRYSLSYIYHLDQTHDFRLHVTND-NPPRPQLIVNSKLDYEKINKYVFRLFAYDFDEKSIGNSCSTTIEIEIEDLNDNVPKFNQLTYNANIDENK-RDDKLIKFTVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNS--VSIIEGLPAHSLVVEVRVTDADTHSNMIHCKLVDYNDLFYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPK---------PIIVTDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLRTRKPLDRETLESISIKVTAKNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAPKFIPRLNMKQKVEFIVEQFVDGNTCTELPYTVQDIDDGGINGQNCCYTILENDYNKLFSL 2339
            I+I+D ND  P F+S   P     IPEN  +G +  +P A D DS    V  Y L  I   +    F L V  D +  +PQLIV   LD E+ + Y   +   D    +   + S  + I I D NDN PKF ++ Y A + EN      +++   +D D G N  +  +    +D + +   +  + R+   + +   +D E D    +F+++A D+G    ++  QV I +++ NDN P I+ +  G         +I E +P  + V  V+V+D D   N     +V  +  F L   S   +    K F L+T   +D ES     + I    + + P   +++  SL +Q+ DVNDNAP+FSQ +             V FP+          +  TD DSG N +  + +    + S    F I+  SG+I     LD E +  + F ++A+DKG   L  ++++ I VLD NDN P+F  + Y F+V EN+     +G +  ID D   +N  I  S+EP+   S  F I   TG + +    DRE   + + ++ A +             S V V I V+D NDNAP  +   N+  K  ++  Q   G   T + +   +  D GIN +   Y+I   +  +LF +
Sbjct:  164 IEIMDINDNTPNFNS---PVITLSIPENTNIGMLFPIPAATDRDSGVNGVSSYEL--IVGPEAQDLFGLQVAEDQDEKQPQLIVMGMLDREQRDSYDLTIKVQDGGTPA--RASSALLRISILDTNDNAPKFEKMAYEAELPENSPMGHSVLQVKANDSDQGVNAEIDYSFHQASDTVRR---LLHLDRSTGLITVQGPIDRE-DVGTLKFSVVAKDKGANPKTARTQVTITIRDTNDNKPVIEIRGFGLVTHQGGVANISEDVPVETPVALVQVSDIDEGVNAAVTCVVAGDVPFQLKQVSDTGSDSKKKYF-LQTTTALDYESVKEYTIEIVAVDSGNPP---LSSTNSLKVQVTDVNDNAPVFSQSLM-----------EVVFPENNDINDLVMEVSATDADSGPNSQLHYSI--LPDPSARGIFSINPDSGQIRVNTVLDREQREHYDFHVVAVDKGIPSLKGTASVVITVLDRNDNDPKFMLNGYNFSVMENMPRLSPVGMVTVIDADKG-ENAHIHLSVEPE---SGEFVIQNGTGTILSSISFDREHQSTYTFRLKAVDGGDPPR------SSYVGVTINVLDENDNAPVIVVPSNISYK--YLTPQTHPG---TPVNWVRAEDMDTGINAE-LDYSIASGNPFELFQI 775          

HSP 2 Score: 130.568 bits (327), Expect = 5.210e-30
Identity = 145/489 (29.65%), Postives = 224/489 (45.81%), Query Frame = 3
Query:  762 EIEIEDLNDNVPKFNQLTYNANIDENKRDDKLIKF-TVSDPDSGRNGIVTVN-IVDKTDELSKRFKIFEIQ-RNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDADTHSNMIHCKLVDYNDLFYLDSPSKFNTLLNYKPFNLKTINK-IDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPM-----FSQQIYIGXXXXXXXXXXXXFPKPII-VTDRDSGLN--------GKFEFYLEDFRNFSDSSDFLIDKISGKIFTQ--RSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLRTRKPLDRETLESISIKVTAKNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAPKFI 2168
            +IEI D+NDN P FN      +I EN     L      +D DSG NG+ +   IV    +     ++ E Q   +  L ++  LD E     ++ T+   D GTP+ +SSA ++I + + NDN P  KF+K+ +       + E  P    V++V+  D+D   N      +DY+  F+  S +    L   +   L T+   IDRE      L+ ++   D   + + T    + I I D NDN P+     F    + G V     +V V  P  ++ V+D D G+N        G   F L+   +    S         K F Q   +LDYE+  ++  +I+A+D G  PL+S++++ + V D+NDNAP FS+S       EN  +   +  + A D D+   N  + YSI P       F I+  +G +R    LDRE  E     V A +    S   ++ T S   V+I V+D NDN PKF+
Sbjct:  163 QIEIMDINDNTPNFNSPVITLSIPENTNIGMLFPIPAATDRDSGVNGVSSYELIVGPEAQDLFGLQVAEDQDEKQPQLIVMGMLDREQRDS-YDLTIKVQDGGTPARASSALLRISILDTNDNAP--KFEKMAY----EAELPENSPMGHSVLQVKANDSDQGVN----AEIDYS--FHQASDTVRRLLHLDRSTGLITVQGPIDREDV--GTLKFSVVAKDKGANPK-TARTQVTITIRDTNDNKPVIEIRGFGLVTHQGGVANISEDVPVETPVALVQVSDIDEGVNAAVTCVVAGDVPFQLKQVSDTGSDS-------KKKYFLQTTTALDYESVKEYTIEIVAVDSGNPPLSSTNSLKVQVTDVNDNAPVFSQSLMEVVFPENNDINDLVMEVSATDADSG-PNSQLHYSILPDPSARGIFSINPDSGQIRVNTVLDREQREHYDFHVVAVDKGIPS---LKGTAS---VVITVLDRNDNDPKFM 621          

HSP 3 Score: 129.798 bits (325), Expect = 1.024e-29
Identity = 163/604 (26.99%), Postives = 261/604 (43.21%), Query Frame = 3
Query:  384 TPTDPGTFFILIKILDQNDKAPQFSSIKRPFFKIPENVEVGKVIDLPMAVDSDSE-----KYSVRRYS--LSYIYHLDQTHDFRLHVTNDNPPRPQLIVNSKLDYEKINKYVFRLFAYDFDEKSIGNSCSTTIEIEIEDLNDNVP-----KFNQLTYN---ANIDENKRDDKLIKFT-VSDPDSGRNGIVTVNIV-DKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFT--LLATDQGTPSLSSSAQVKIHLKNLNDNGPKI--KFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDADTHSN-MIHCKLVDYNDLFYLDSPSKFNTL-LNYKPFNLKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPII-VTDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAP------RFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLRTRKPLDRE--TLESISIKVTAKN-PNKYSSHFV 2096
            TP    +  + I ILD ND AP+F  +     ++PEN  +G  +    A DSD        YS  + S  +  + HLD++                + V   +D E +    F + A   D+ +   +  T + I I D NDN P      F  +T+    ANI E+   +  +    VSD D G N  VT  +  D   +L +        + ++FL+   +LDYE+   + E+T  ++A D G P LSS+  +K+ + ++NDN P       ++ F  +N +        + LV+EV  TDAD+  N  +H  +        L  PS      +N     ++    +DRE        + ++     PS + T   S+ I + D NDN P F   +  G       N+    P  ++ V D D G N      +E      +S +F+I   +G I +  S D E ++ + F++ A+D G  P +S   +TINVLD NDNAP        S  +          V W    ++A D DT   N ++ YSI   G+    F I    G++   K + R+   L  + +KVT K  P+++ +  V
Sbjct:  265 TPARASSALLRISILDTNDNAPKFEKMAYE-AELPENSPMGHSVLQVKANDSDQGVNAEIDYSFHQASDTVRRLLHLDRSTGL-------------ITVQGPIDREDVGTLKFSVVAK--DKGANPKTARTQVTITIRDTNDNKPVIEIRGFGLVTHQGGVANISEDVPVETPVALVQVSDIDEGVNAAVTCVVAGDVPFQLKQVSDTGSDSKKKYFLQTTTALDYES---VKEYTIEIVAVDSGNPPLSSTNSLKVQVTDVNDNAPVFSQSLMEVVFPENNDI--------NDLVMEVSATDADSGPNSQLHYSI--------LPDPSARGIFSINPDSGQIRVNTVLDREQREHYDFHV-VAVDKGIPSLKGTA--SVVITVLDRNDNDPKF---MLNGYNFSVMENMPRLSPVGMVTVIDADKGENAHIHLSVE-----PESGEFVIQNGTGTILSSISFDREHQSTYTFRLKAVDGGDPPRSSYVGVTINVLDENDNAPVIVVPSNISYKYLTPQTHPGTPVNW----VRAEDMDTG-INAELDYSIA-SGNPFELFQISHNNGEVTLEKAIIRKHYGLHRLVVKVTDKGKPSRHGTALV 816          
BLAST of Protocadherin Fat 1 vs. Ensembl Mouse
Match: Pcdh1 (protocadherin 1 [Source:MGI Symbol;Acc:MGI:104692])

HSP 1 Score: 216.083 bits (549), Expect = 7.131e-57
Identity = 197/691 (28.51%), Postives = 313/691 (45.30%), Query Frame = 3
Query:  417 IKILDQNDKAPQFSSIKRPF--FKIPENVEVGKVIDLPMAVDSDSEKYSVRRYSLSYIYHLDQTHDFRLHVTNDNPPR-PQLIVNSKLDYEKINKYVFRLFAYDFDEKSIGNSCSTTIEIEIEDLNDNVPKFNQLTYNANIDENKR-DDKLIKFTVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNS--VSIIEGLPAHSLVVEVRVTDADTHSNMIHCKLVDYNDLFYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFP---KP------IIVTDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEP-KGDHSSYFDIDRYTGDLRTRKPLDRETLESISIKVTAKNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAPKFIPRLNMKQKVEFIVEQFVDGNTCTELPYTVQDIDDGGINGQNCCYTILENDYNKLFSLMTDTPSYIC---LQRKPEKYQSYTVTLIARDRPP 2432
            I++ D ND  P F+S   P     IPEN  +G +  +P+A D D+    V  Y L       +   F L V  D   + PQLIV   LD E+ + Y   +   D        + S  + + + D NDN PKF + TY A + EN      +I+   +D D G N  +      +  E+ +R  +  + RN   + +   +D E D     F++LA D+G    S+ AQV + +K++NDN P I+ + +G         +I E +   + V  V+V+D D   N     +V  +  F L   S+  +    K F L+T   +D E      + I    + + P   +++  SL +Q+ DVNDNAP+F+Q I             V FP   KP      +  +D DSG N +  + LE     +    F I   +G+I  + SLD E ++ +  K++A D+G   L  ++T+ +NVLD NDN P+F  S Y F+V EN+     +G +  ID D   +N  +  S+E   GD    F I   TG + +    DRE   + + ++ A +        V    + V V I V+D NDNAP      N   +   +  Q   G T +++  T +DID  GIN +   Y+I   +   LF + + + +      ++R+        V +  R +PP
Sbjct:  134 IEVQDINDNTPNFAS---PVITLAIPENTNIGSLFPIPLATDRDAGPNGVASYELQAGPEAQEL--FGLQVAEDQEEKQPQLIVMGNLDRERWDSYDLTIKVQDGGNPP--RASSALLRVTVLDTNDNAPKFERPTYEAELSENSPIGHSVIQVKANDSDQGANAEIDYTF-HQAPEVVRR--LLRLDRNTGLITVQGPVDRE-DLSTLRFSVLAKDRGATPKSARAQVVVTVKDMNDNAPTIEIRGIGLVTHQDGMANISEDVAEETAVALVQVSDRDEGENAAVTCVVAGDVPFQLRQASETGSDSKKKYF-LQTTTPLDYEKVKDYTIEIVAVDSGNPP---LSSTNSLKVQVVDVNDNAPVFTQSI-----------TEVAFPENNKPGEVVAEVTASDADSGSNAELVYSLEP--EPAAQGLFTISPENGEIRVKTSLDREQRDSYELKVVAADRGSPSLQGTATVLVNVLDCNDNDPKFMLSGYNFSVMENMPALSPVGMVTVIDGDKG-ENARVQLSVEQDNGD----FVIQNGTGTILSSLSFDREQQSTYTFQLKAVDGG------VPPRSAYVGVTINVLDENDNAPFITAPSNTSHR--LLTPQTRLGETVSQV--TAEDIDS-GINAE-LTYSIAGGNPYGLFQIGSHSGAITLEKEIERRHHGLHRLVVKVSDRGKPP 779          

HSP 2 Score: 144.821 bits (364), Expect = 1.425e-34
Identity = 156/593 (26.31%), Postives = 262/593 (44.18%), Query Frame = 3
Query:  387 PTDPGTFFILIKILDQNDKAPQFSSIKRPFF--KIPENVEVGKVIDLPMAVDSDSEKYSVRRYSLSYIYHLDQTHDFRLHVTNDNPPRPQLIVNSKLDYEKINKYVFRLFAYDFDEKSIGNSCSTTIEIEIEDLNDNVP-----KFNQLTYN---ANIDENKRDDKLIKFT-VSDPDSGRNGIVTVNIV-DKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVS-NSVSIIEGLPAHSLVVEVRVTDADTHSNMIHCKLVDYNDLFYLDSPSKFNTLLNYKPFN--LKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPII-VTDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSE----SHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLRTRKPLDR--ETLESISIKVTAKN-PNKYSSHFV 2096
            P    +  + + +LD ND AP+F   +RP +  ++ EN  +G  +    A DSD    +     + Y +H       RL   + N     + V   +D E ++   F + A   D  +   S    + + ++D+NDN P         +T+    ANI E+  ++  +    VSD D G N  VT  +  D   +L +  +     + ++FL+    LDYE     +   ++A D G P LSS+  +K+ + ++NDN P        F+ S   V+  E      +V EV  +DAD+ SN    +LV     + L+       L    P N  ++    +DRE      L++ ++     PS Q T    +N+   D NDN P F   +  G       N+    P  ++ V D D G N + +  +E      D+ DF+I   +G I +  S D E ++ + F++ A+D G  P ++   +TINVLD NDNAP  +     SH +        +G  +  + A D D+   N ++ YSI   G+    F I  ++G +   K ++R    L  + +KV+ +  P +Y +  V
Sbjct:  236 PPRASSALLRVTVLDTNDNAPKF---ERPTYEAELSENSPIGHSVIQVKANDSDQGANA----EIDYTFHQAPEVVRRLLRLDRN--TGLITVQGPVDREDLSTLRFSVLAK--DRGATPKSARAQVVVTVKDMNDNAPTIEIRGIGLVTHQDGMANISEDVAEETAVALVQVSDRDEGENAAVTCVVAGDVPFQLRQASETGSDSKKKYFLQTTTPLDYEKVKD-YTIEIVAVDSGNPPLSSTNSLKVQVVDVNDNAPV-------FTQSITEVAFPENNKPGEVVAEVTASDADSGSN---AELV-----YSLEPEPAAQGLFTISPENGEIRVKTSLDREQRDSYELKV-VAADRGSPSLQGTATVLVNVL--DCNDNDPKF---MLSGYNFSVMENMPALSPVGMVTVIDGDKGENARVQLSVE-----QDNGDFVIQNGTGTILSSLSFDREQQSTYTFQLKAVDGGVPPRSAYVGVTINVLDENDNAPFITAPSNTSHRLLT--PQTRLGETVSQVTAEDIDSG-INAELTYSIA-GGNPYGLFQIGSHSGAITLEKEIERRHHGLHRLVVKVSDRGKPPRYGTALV 786          

HSP 3 Score: 134.42 bits (337), Expect = 2.931e-31
Identity = 137/492 (27.85%), Postives = 230/492 (46.75%), Query Frame = 3
Query:  762 EIEIEDLNDNVPKFNQLTYNANIDENKRDDKLIKFTVS-DPDSGRNGIVTVNIVDKTDELSKRF--KIFEIQRN-EFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDADTHSNMIHCKLVDYNDLFYLDSPSKFNTLLNY-KPFNLKTI-NKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFS-QQIYI-----GXXXXXXXXXXXXFPKPIIVTDRDSGLN--------GKFEFYL-EDFRNFSDSSDFLIDKISGKIFTQRS--LDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLRTRKPLDRETLESISIKVTAKNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAPKFI 2168
            +IE++D+NDN P F        I EN     L    ++ D D+G NG+ +  +     E  + F  ++ E Q   +  L ++ +LD E     ++ T+   D G P  +SSA +++ + + NDN PK +       +S +  I      HS V++V+  D+D  +N      +DY    +  +P     LL   +   L T+   +DRE    S LR ++   D   + + +    + + ++D+NDNAP    + I +     G  + ++          + V+DRD G N        G   F L +     SDS          K F Q +  LDYE    +  +I+A+D G  PL+S++++ + V+D+NDNAP F++S       EN   G  +  + A D D+   N ++ YS+EP+      F I    G++R +  LDRE  +S  +KV A +     S  ++ T +   V++ V+D NDN PKF+
Sbjct:  133 QIEVQDINDNTPNFASPVITLAIPENTNIGSLFPIPLATDRDAGPNGVASYEL-QAGPEAQELFGLQVAEDQEEKQPQLIVMGNLDRERW-DSYDLTIKVQDGGNPPRASSALLRVTVLDTNDNAPKFERPTYEAELSENSPI-----GHS-VIQVKANDSDQGANA----EIDYT---FHQAPEVVRRLLRLDRNTGLITVQGPVDREDL--STLRFSVLAKDRGATPK-SARAQVVVTVKDMNDNAPTIEIRGIGLVTHQDGMANISEDVAEETAVALVQVSDRDEGENAAVTCVVAGDVPFQLRQASETGSDSKK--------KYFLQTTTPLDYEKVKDYTIEIVAVDSGNPPLSSTNSLKVQVVDVNDNAPVFTQSITEVAFPENNKPGEVVAEVTASDADSG-SNAELVYSLEPEPAAQGLFTISPENGEIRVKTSLDREQRDSYELKVVAAD---RGSPSLQGTAT---VLVNVLDCNDNDPKFM 591          
BLAST of Protocadherin Fat 1 vs. Ensembl Mouse
Match: Pcdh1 (protocadherin 1 [Source:MGI Symbol;Acc:MGI:104692])

HSP 1 Score: 216.083 bits (549), Expect = 7.131e-57
Identity = 197/691 (28.51%), Postives = 313/691 (45.30%), Query Frame = 3
Query:  417 IKILDQNDKAPQFSSIKRPF--FKIPENVEVGKVIDLPMAVDSDSEKYSVRRYSLSYIYHLDQTHDFRLHVTNDNPPR-PQLIVNSKLDYEKINKYVFRLFAYDFDEKSIGNSCSTTIEIEIEDLNDNVPKFNQLTYNANIDENKR-DDKLIKFTVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNS--VSIIEGLPAHSLVVEVRVTDADTHSNMIHCKLVDYNDLFYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFP---KP------IIVTDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEP-KGDHSSYFDIDRYTGDLRTRKPLDRETLESISIKVTAKNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAPKFIPRLNMKQKVEFIVEQFVDGNTCTELPYTVQDIDDGGINGQNCCYTILENDYNKLFSLMTDTPSYIC---LQRKPEKYQSYTVTLIARDRPP 2432
            I++ D ND  P F+S   P     IPEN  +G +  +P+A D D+    V  Y L       +   F L V  D   + PQLIV   LD E+ + Y   +   D        + S  + + + D NDN PKF + TY A + EN      +I+   +D D G N  +      +  E+ +R  +  + RN   + +   +D E D     F++LA D+G    S+ AQV + +K++NDN P I+ + +G         +I E +   + V  V+V+D D   N     +V  +  F L   S+  +    K F L+T   +D E      + I    + + P   +++  SL +Q+ DVNDNAP+F+Q I             V FP   KP      +  +D DSG N +  + LE     +    F I   +G+I  + SLD E ++ +  K++A D+G   L  ++T+ +NVLD NDN P+F  S Y F+V EN+     +G +  ID D   +N  +  S+E   GD    F I   TG + +    DRE   + + ++ A +        V    + V V I V+D NDNAP      N   +   +  Q   G T +++  T +DID  GIN +   Y+I   +   LF + + + +      ++R+        V +  R +PP
Sbjct:  134 IEVQDINDNTPNFAS---PVITLAIPENTNIGSLFPIPLATDRDAGPNGVASYELQAGPEAQEL--FGLQVAEDQEEKQPQLIVMGNLDRERWDSYDLTIKVQDGGNPP--RASSALLRVTVLDTNDNAPKFERPTYEAELSENSPIGHSVIQVKANDSDQGANAEIDYTF-HQAPEVVRR--LLRLDRNTGLITVQGPVDRE-DLSTLRFSVLAKDRGATPKSARAQVVVTVKDMNDNAPTIEIRGIGLVTHQDGMANISEDVAEETAVALVQVSDRDEGENAAVTCVVAGDVPFQLRQASETGSDSKKKYF-LQTTTPLDYEKVKDYTIEIVAVDSGNPP---LSSTNSLKVQVVDVNDNAPVFTQSI-----------TEVAFPENNKPGEVVAEVTASDADSGSNAELVYSLEP--EPAAQGLFTISPENGEIRVKTSLDREQRDSYELKVVAADRGSPSLQGTATVLVNVLDCNDNDPKFMLSGYNFSVMENMPALSPVGMVTVIDGDKG-ENARVQLSVEQDNGD----FVIQNGTGTILSSLSFDREQQSTYTFQLKAVDGG------VPPRSAYVGVTINVLDENDNAPFITAPSNTSHR--LLTPQTRLGETVSQV--TAEDIDS-GINAE-LTYSIAGGNPYGLFQIGSHSGAITLEKEIERRHHGLHRLVVKVSDRGKPP 779          

HSP 2 Score: 144.821 bits (364), Expect = 1.425e-34
Identity = 156/593 (26.31%), Postives = 262/593 (44.18%), Query Frame = 3
Query:  387 PTDPGTFFILIKILDQNDKAPQFSSIKRPFF--KIPENVEVGKVIDLPMAVDSDSEKYSVRRYSLSYIYHLDQTHDFRLHVTNDNPPRPQLIVNSKLDYEKINKYVFRLFAYDFDEKSIGNSCSTTIEIEIEDLNDNVP-----KFNQLTYN---ANIDENKRDDKLIKFT-VSDPDSGRNGIVTVNIV-DKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVS-NSVSIIEGLPAHSLVVEVRVTDADTHSNMIHCKLVDYNDLFYLDSPSKFNTLLNYKPFN--LKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPII-VTDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSE----SHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLRTRKPLDR--ETLESISIKVTAKN-PNKYSSHFV 2096
            P    +  + + +LD ND AP+F   +RP +  ++ EN  +G  +    A DSD    +     + Y +H       RL   + N     + V   +D E ++   F + A   D  +   S    + + ++D+NDN P         +T+    ANI E+  ++  +    VSD D G N  VT  +  D   +L +  +     + ++FL+    LDYE     +   ++A D G P LSS+  +K+ + ++NDN P        F+ S   V+  E      +V EV  +DAD+ SN    +LV     + L+       L    P N  ++    +DRE      L++ ++     PS Q T    +N+   D NDN P F   +  G       N+    P  ++ V D D G N + +  +E      D+ DF+I   +G I +  S D E ++ + F++ A+D G  P ++   +TINVLD NDNAP  +     SH +        +G  +  + A D D+   N ++ YSI   G+    F I  ++G +   K ++R    L  + +KV+ +  P +Y +  V
Sbjct:  236 PPRASSALLRVTVLDTNDNAPKF---ERPTYEAELSENSPIGHSVIQVKANDSDQGANA----EIDYTFHQAPEVVRRLLRLDRN--TGLITVQGPVDREDLSTLRFSVLAK--DRGATPKSARAQVVVTVKDMNDNAPTIEIRGIGLVTHQDGMANISEDVAEETAVALVQVSDRDEGENAAVTCVVAGDVPFQLRQASETGSDSKKKYFLQTTTPLDYEKVKD-YTIEIVAVDSGNPPLSSTNSLKVQVVDVNDNAPV-------FTQSITEVAFPENNKPGEVVAEVTASDADSGSN---AELV-----YSLEPEPAAQGLFTISPENGEIRVKTSLDREQRDSYELKV-VAADRGSPSLQGTATVLVNVL--DCNDNDPKF---MLSGYNFSVMENMPALSPVGMVTVIDGDKGENARVQLSVE-----QDNGDFVIQNGTGTILSSLSFDREQQSTYTFQLKAVDGGVPPRSAYVGVTINVLDENDNAPFITAPSNTSHRLLT--PQTRLGETVSQVTAEDIDSG-INAELTYSIA-GGNPYGLFQIGSHSGAITLEKEIERRHHGLHRLVVKVSDRGKPPRYGTALV 786          

HSP 3 Score: 134.42 bits (337), Expect = 2.931e-31
Identity = 137/492 (27.85%), Postives = 230/492 (46.75%), Query Frame = 3
Query:  762 EIEIEDLNDNVPKFNQLTYNANIDENKRDDKLIKFTVS-DPDSGRNGIVTVNIVDKTDELSKRF--KIFEIQRN-EFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDADTHSNMIHCKLVDYNDLFYLDSPSKFNTLLNY-KPFNLKTI-NKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFS-QQIYI-----GXXXXXXXXXXXXFPKPIIVTDRDSGLN--------GKFEFYL-EDFRNFSDSSDFLIDKISGKIFTQRS--LDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLRTRKPLDRETLESISIKVTAKNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAPKFI 2168
            +IE++D+NDN P F        I EN     L    ++ D D+G NG+ +  +     E  + F  ++ E Q   +  L ++ +LD E     ++ T+   D G P  +SSA +++ + + NDN PK +       +S +  I      HS V++V+  D+D  +N      +DY    +  +P     LL   +   L T+   +DRE    S LR ++   D   + + +    + + ++D+NDNAP    + I +     G  + ++          + V+DRD G N        G   F L +     SDS          K F Q +  LDYE    +  +I+A+D G  PL+S++++ + V+D+NDNAP F++S       EN   G  +  + A D D+   N ++ YS+EP+      F I    G++R +  LDRE  +S  +KV A +     S  ++ T +   V++ V+D NDN PKF+
Sbjct:  133 QIEVQDINDNTPNFASPVITLAIPENTNIGSLFPIPLATDRDAGPNGVASYEL-QAGPEAQELFGLQVAEDQEEKQPQLIVMGNLDRERW-DSYDLTIKVQDGGNPPRASSALLRVTVLDTNDNAPKFERPTYEAELSENSPI-----GHS-VIQVKANDSDQGANA----EIDYT---FHQAPEVVRRLLRLDRNTGLITVQGPVDREDL--STLRFSVLAKDRGATPK-SARAQVVVTVKDMNDNAPTIEIRGIGLVTHQDGMANISEDVAEETAVALVQVSDRDEGENAAVTCVVAGDVPFQLRQASETGSDSKK--------KYFLQTTTPLDYEKVKDYTIEIVAVDSGNPPLSSTNSLKVQVVDVNDNAPVFTQSITEVAFPENNKPGEVVAEVTASDADSG-SNAELVYSLEPEPAAQGLFTISPENGEIRVKTSLDREQRDSYELKVVAAD---RGSPSLQGTAT---VLVNVLDCNDNDPKFM 591          
BLAST of Protocadherin Fat 1 vs. Ensembl Mouse
Match: Pcdh1 (protocadherin 1 [Source:MGI Symbol;Acc:MGI:104692])

HSP 1 Score: 212.616 bits (540), Expect = 1.084e-55
Identity = 195/685 (28.47%), Postives = 309/685 (45.11%), Query Frame = 3
Query:  435 NDKAPQFSSIKRPF--FKIPENVEVGKVIDLPMAVDSDSEKYSVRRYSLSYIYHLDQTHDFRLHVTNDNPPR-PQLIVNSKLDYEKINKYVFRLFAYDFDEKSIGNSCSTTIEIEIEDLNDNVPKFNQLTYNANIDENKR-DDKLIKFTVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNS--VSIIEGLPAHSLVVEVRVTDADTHSNMIHCKLVDYNDLFYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFP---KP------IIVTDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEP-KGDHSSYFDIDRYTGDLRTRKPLDRETLESISIKVTAKNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAPKFIPRLNMKQKVEFIVEQFVDGNTCTELPYTVQDIDDGGINGQNCCYTILENDYNKLFSLMTDTPSYIC---LQRKPEKYQSYTVTLIARDRPP 2432
            ND  P F+S   P     IPEN  +G +  +P+A D D+    V  Y L       +   F L V  D   + PQLIV   LD E+ + Y   +   D        + S  + + + D NDN PKF + TY A + EN      +I+   +D D G N  +      +  E+ +R  +  + RN   + +   +D E D     F++LA D+G    S+ AQV + +K++NDN P I+ + +G         +I E +   + V  V+V+D D   N     +V  +  F L   S+  +    K F L+T   +D E      + I    + + P   +++  SL +Q+ DVNDNAP+F+Q I             V FP   KP      +  +D DSG N +  + LE     +    F I   +G+I  + SLD E ++ +  K++A D+G   L  ++T+ +NVLD NDN P+F  S Y F+V EN+     +G +  ID D   +N  +  S+E   GD    F I   TG + +    DRE   + + ++ A +        V    + V V I V+D NDNAP      N   +   +  Q   G T +++  T +DID  GIN +   Y+I   +   LF + + + +      ++R+        V +  R +PP
Sbjct:    1 NDNTPNFAS---PVITLAIPENTNIGSLFPIPLATDRDAGPNGVASYELQAGPEAQEL--FGLQVAEDQEEKQPQLIVMGNLDRERWDSYDLTIKVQDGGNPP--RASSALLRVTVLDTNDNAPKFERPTYEAELSENSPIGHSVIQVKANDSDQGANAEIDYTF-HQAPEVVRR--LLRLDRNTGLITVQGPVDRE-DLSTLRFSVLAKDRGATPKSARAQVVVTVKDMNDNAPTIEIRGIGLVTHQDGMANISEDVAEETAVALVQVSDRDEGENAAVTCVVAGDVPFQLRQASETGSDSKKKYF-LQTTTPLDYEKVKDYTIEIVAVDSGNPP---LSSTNSLKVQVVDVNDNAPVFTQSI-----------TEVAFPENNKPGEVVAEVTASDADSGSNAELVYSLEP--EPAAQGLFTISPENGEIRVKTSLDREQRDSYELKVVAADRGSPSLQGTATVLVNVLDCNDNDPKFMLSGYNFSVMENMPALSPVGMVTVIDGDKG-ENARVQLSVEQDNGD----FVIQNGTGTILSSLSFDREQQSTYTFQLKAVDGG------VPPRSAYVGVTINVLDENDNAPFITAPSNTSHR--LLTPQTRLGETVSQV--TAEDIDS-GINAE-LTYSIAGGNPYGLFQIGSHSGAITLEKEIERRHHGLHRLVVKVSDRGKPP 640          

HSP 2 Score: 144.436 bits (363), Expect = 1.983e-34
Identity = 156/593 (26.31%), Postives = 262/593 (44.18%), Query Frame = 3
Query:  387 PTDPGTFFILIKILDQNDKAPQFSSIKRPFF--KIPENVEVGKVIDLPMAVDSDSEKYSVRRYSLSYIYHLDQTHDFRLHVTNDNPPRPQLIVNSKLDYEKINKYVFRLFAYDFDEKSIGNSCSTTIEIEIEDLNDNVP-----KFNQLTYN---ANIDENKRDDKLIKFT-VSDPDSGRNGIVTVNIV-DKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVS-NSVSIIEGLPAHSLVVEVRVTDADTHSNMIHCKLVDYNDLFYLDSPSKFNTLLNYKPFN--LKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPII-VTDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSE----SHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLRTRKPLDR--ETLESISIKVTAKN-PNKYSSHFV 2096
            P    +  + + +LD ND AP+F   +RP +  ++ EN  +G  +    A DSD    +     + Y +H       RL   + N     + V   +D E ++   F + A   D  +   S    + + ++D+NDN P         +T+    ANI E+  ++  +    VSD D G N  VT  +  D   +L +  +     + ++FL+    LDYE     +   ++A D G P LSS+  +K+ + ++NDN P        F+ S   V+  E      +V EV  +DAD+ SN    +LV     + L+       L    P N  ++    +DRE      L++ ++     PS Q T    +N+   D NDN P F   +  G       N+    P  ++ V D D G N + +  +E      D+ DF+I   +G I +  S D E ++ + F++ A+D G  P ++   +TINVLD NDNAP  +     SH +        +G  +  + A D D+   N ++ YSI   G+    F I  ++G +   K ++R    L  + +KV+ +  P +Y +  V
Sbjct:   97 PPRASSALLRVTVLDTNDNAPKF---ERPTYEAELSENSPIGHSVIQVKANDSDQGANA----EIDYTFHQAPEVVRRLLRLDRN--TGLITVQGPVDREDLSTLRFSVLAK--DRGATPKSARAQVVVTVKDMNDNAPTIEIRGIGLVTHQDGMANISEDVAEETAVALVQVSDRDEGENAAVTCVVAGDVPFQLRQASETGSDSKKKYFLQTTTPLDYEKVKD-YTIEIVAVDSGNPPLSSTNSLKVQVVDVNDNAPV-------FTQSITEVAFPENNKPGEVVAEVTASDADSGSN---AELV-----YSLEPEPAAQGLFTISPENGEIRVKTSLDREQRDSYELKV-VAADRGSPSLQGTATVLVNVL--DCNDNDPKF---MLSGYNFSVMENMPALSPVGMVTVIDGDKGENARVQLSVE-----QDNGDFVIQNGTGTILSSLSFDREQQSTYTFQLKAVDGGVPPRSAYVGVTINVLDENDNAPFITAPSNTSHRLLT--PQTRLGETVSQVTAEDIDSG-INAELTYSIA-GGNPYGLFQIGSHSGAITLEKEIERRHHGLHRLVVKVSDRGKPPRYGTALV 647          
BLAST of Protocadherin Fat 1 vs. Ensembl Mouse
Match: Dchs1 (dachsous cadherin related 1 [Source:MGI Symbol;Acc:MGI:2685011])

HSP 1 Score: 193.356 bits (490), Expect = 4.145e-49
Identity = 181/618 (29.29%), Postives = 279/618 (45.15%), Query Frame = 3
Query:  372 FQYLTPTDPGTFFILIKILDQNDKAPQFSSIKRPFFKIPENVEVGKVIDLPMAVDSDSEKYSVRRYSLSYIYHLDQTHDFRLHVTNDNP---PRPQLIVNSKLDYEKINKYVFRLFAYDFDEKSIGNSCSTTIEIEIEDLNDNVPKFNQLTYNANIDEN-KRDDKLIKFTVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDAD----THSNMI------HCKLVDYNDLFYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPIIVTDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEP--KGDHSSYFDIDRYTGDLRTRKPLDRET-LESISIKVTAKNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAPKFIPR 2174
            F  +TP D  T  + +++ D ND AP F    R   +IPE+  +G    L  A D+D+ +   + Y+LS          FRL  T   P   P P+L++  +LD E  + Y+ +L AYD    S        +++ + D+ND+ P FNQ  Y+A + E+      +++   SD D+G NG VT  I  +  E    F    I  +  FL L   LD+E    + E  + A D G      SA V +H+++ NDN P +    +  S   S  + E  P   LV  + V+D D     H N+       H  L   + + YL   ++                ++DRE      LR+T + + S P R      +  + + DVNDNAP F +Q+Y       +V +  +F   +   D D G NG+  + L      + +  F ID  SG I T  +LDYE + + +  ++A D G  PL SS+T+++ + D+NDN P+F  + Y  ++ E    G     + A D D+      + YS+        S  F ID ++GD+ T + LDR+    S    VTA +             S V V + V D NDN P+F PR
Sbjct:  111 FTAVTP-DGATVEVTVRVADINDHAPAFPQ-ARAALQIPEHTALGTRYPLEPARDADAGRLGTQGYALS---GDGAGETFRLE-TRPGPGGAPVPELVIAGELDRENRSHYMLQLEAYD--GGSPPRRAQALLDVTLLDINDHAPAFNQSRYHAVVSESLAPGSPVLQVFASDADAGANGAVTYEINRRQSEGDGPF---SIDAHTGFLRLERPLDFEQR-RVHELVVQARDGGAHPELGSAFVTVHVRDANDNQPSMTV--IFLSADGSPRVSEAAPPGQLVARISVSDPDDGDFAHVNVSLEGGEGHFALSTQDSVIYLVCVAR----------------RLDREERDVYNLRVTATDSGSPPLR---AEAAFVLHVTDVNDNAPAFDRQLY-RPEPLPEVALPGSFVVRVTARDPDQGTNGQITYSLAPG---THTHWFSIDPTSGIITTAATLDYELEPQPQLIVVATDGGLPPLVSSATVSVALQDVNDNEPQFQRTFYNASLPEGTQPGTCFLQVTATDADSGPFGL-LSYSLGAGLGASGSPPFRIDAHSGDVCTTRTLDRDQGPSSFDFTVTAIDGG--------GLKSMVYVKVFVADENDNPPQFYPR 682          

HSP 2 Score: 124.79 bits (312), Expect = 4.423e-28
Identity = 148/600 (24.67%), Postives = 246/600 (41.00%), Query Frame = 3
Query:  411 ILIKILDQNDKAPQFSSIKRPF-FKIPENVEVGKVIDLPMAVDSDSEKYSVRRYSLSYIYHLDQTHDFRLHVTNDNPPRPQLIVNSK---------LDYEKINKYVFRLFAYDFDEKSIGNSCSTTIEIE-IEDLNDNVPKFNQLTYNANIDENKRDDKLIKFTVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDADTHSNMIHCKLVDYNDLFYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPIIV---TDRDSGLNGKFEFYLEDFRNFSDSSD-FLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLRTRKPLDRETLESISIKVTAKNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAPKF 2165
            + +++ D+N+ AP F+  + P    +PEN + G  +    A D+D                     + R  +    PP P L ++++         LD E     +  + A D    +     +       + D NDN P F   +     ++       +     DPD G    V+  +    D        F +      L ++  LD E        T++A D G+P  SS+  + + + ++ND  P    ++       +V + E  P  + ++ ++ TD D  +N      V Y  +    S   F+  L+     L T+  +DRE     +L +        P   + T+ ++ + +ED ND+ P F      GN   +        P+ +     +D D GLNG+ ++ + D     DSS  F +D  SG+  T R LD E +  F+ +I A D G   L+++  +T+ VLD ND+AP F    Y   V E+  VG  +  LQA D D D  N  + Y +      +  F ++  +G+L T   LDRE   S +  VTA +             + V + I V DVND+AP F
Sbjct: 1415 VQVRVQDENEHAPTFA--RDPLALALPENPDPGATLYTFRASDADGP---------------GPNSEVRYRLLRQEPPVPALRLDARTGALSAPRGLDRETTPALLLLVEATDRPANASRRRAARVSARVFVTDENDNAPVFASPSRVRLPEDQPPGPAALHVVARDPDLGEAARVSYRLAAGGD------GHFRLHATTGALSVVRPLDREQRAEHV-LTVVALDHGSPPRSSTQLLTVSVVDVNDEAPAFPQQEY------NVILRENSPPGTSLLTLKATDPDLGAN----GQVTYGGV----SGESFS--LDPNTGVLTTLRALDREEQEEIYLTVYARDRGLPP---LLTHITVRVTVEDENDHTPTF------GNTHLSLEVPEGQDPQTLTTLRASDPDGGLNGQLQYRILD----GDSSGAFALDLTSGEFGTMRPLDREVEPAFQLQIEARDGGQPALSATLLVTVTVLDANDHAPVFPVPSYSVEVPEDAPVGTLLLQLQAHDPD-DGDNGRVMYYL--GAGTAGAFLLEPTSGELSTATALDREHCASYAFSVTAVDGAAAGP-----LSTTVPITITVRDVNDHAPAF 1953          

HSP 3 Score: 120.553 bits (301), Expect = 9.458e-27
Identity = 145/544 (26.65%), Postives = 233/544 (42.83%), Query Frame = 3
Query:  423 ILDQNDKAPQFSSIKRPFFKIPENVEVGKVIDLPMAVDSDSEKYSVRRYSLSYIYHLDQTHDFRLHVTNDNPPRPQLIVNSKLDYEKINKYVFRLFAYDFDEKSIGNSCSTTIEIEIEDLNDNVPKFNQLTYNANIDENKR-DDKLIKFTVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDADTHSN-MIHCKLVDYNDLFYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTDS-EPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPIIVTDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQ-PLTSSSTITINVLDLNDNAPRFSESHYIFNV------FENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLR-TRKPL 2021
            + D+ND AP F+S  R   ++PE+   G      +A D D  + +   Y L+          FRLH T        L V   LD E+  ++V  + A   D  S   S +  + + + D+ND  P F Q  YN  + EN      L+    +DPD G NG VT   V            F +  N   L  + +LD E    ++  T+ A D+G P L +   V++ +++ ND+ P      L      S+ + EG    +L   +R +D D   N  +  +++D       DS   F   L    F   T+  +DRE       ++ I   D  +P+  ++    + + + D ND+AP+F    Y  +V+  +   V      +   D D G NG+  +YL        +  FL++  SG++ T  +LD E    + F + A+D     PL+++  ITI V D+ND+AP F  S     +          ++   + TL+A D D    N  I Y +   G       +D YTG++R  R P+
Sbjct: 1529 VTDENDNAPVFASPSR--VRLPEDQPPGPAALHVVARDPDLGEAARVSYRLA----AGGDGHFRLHATTG-----ALSVVRPLDREQRAEHVLTVVA--LDHGSPPRSSTQLLTVSVVDVNDEAPAFPQQEYNVILRENSPPGTSLLTLKATDPDLGANGQVTYGGVSGES--------FSLDPNTGVLTTLRALDREEQEEIY-LTVYARDRGLPPLLTHITVRVTVEDENDHTPTFGNTHL------SLEVPEGQDPQTLTT-LRASDPDGGLNGQLQYRILDG------DSSGAFALDLTSGEFG--TMRPLDREVEPA--FQLQIEARDGGQPA--LSATLLVTVTVLDANDHAPVFPVPSY--SVEVPEDAPVGTLLLQLQAHDPDDGDNGRVMYYL----GAGTAGAFLLEPTSGELSTATALDREHCASYAFSVTAVDGAAAGPLSTTVPITITVRDVNDHAPAFPTSPLRLRLPRPGPSLNKPTLA--LATLRAEDRDAG-ANASILYRL--AGTPPPGTTVDSYTGEIRVARSPV 2020          

HSP 4 Score: 120.168 bits (300), Expect = 1.111e-26
Identity = 149/610 (24.43%), Postives = 254/610 (41.64%), Query Frame = 3
Query:  384 TPTDPGTFFILIKILDQNDKAPQFSSIKRPF-FKIPENVEVGKVIDLPMAVDSDSEKYSVRRYSLSYIYHLDQTHDFRLHVTNDNPPRPQ-----------LIVNSKLDYEKINKYVFRLFAYDFDEKSIGNSCSTTIEIEIEDLNDNVPKFNQLTYNANIDENKR-DDKLIKFTVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDAD---THSNMIHCKLVDYN-------DLFYLD------------SPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTD-SEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPIIVTDRDSGLNGKFEFYLEDFRNFSDSSD----FLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIE--PKGDHSSYFDIDRYTGDLRTRKPLDRETLESISIKVTAKNPNKYSS 2087
            +P   G+  + + ++D ND  P   +I +P+  ++ E+  +G  I      D DS    V  Y LS                   P  PQ           + +   LD+E+ + Y  +L A+D   +   N     + + +ED+NDNVP F+Q  Y   + E+      ++  + +D DSG NG ++ ++       ++ F++       F      +L +E  P + +  L A D G P  ++ A V + LK+ ND+ P         +VS      E LP  S ++ +  TDAD   TH+       VDY+        +F L+             P     L+  +P + +++ + +          +T++  D  +P R  ++   + + + DVNDN P+F++  Y   V E+           +  +D D G +G   F L        S D    F +D+ SG +   R LD ET+ + +  + A D       S   +T+ V D+ND+ P F  S    ++ EN   G  + TL AID D     +  +  +E  P  +    F ++  TG+LR R P D E   S  + V A +    S+
Sbjct: 2247 SPALVGSATLTVMVIDTNDNRP---TIPQPWELRVSEDALLGSEIAQVTGNDVDSG--PVLWYVLS-------------------PSGPQDPFSIGRYGGRVSLTGPLDFEQCDHYHLQLLAHDGPHEGHAN-----LTVLVEDVNDNVPTFSQSLYQVMMLEHTPPGSAILSVSATDRDSGANGHISYHLASP----AEGFRVDPNNGTLFTTVGAMALGHE-GPGVVDVVLEARDHGAPGRTAQATVHVQLKDQNDHAPSFTLPHYRVAVS------EDLPPGSTLLTLEATDADGSRTHAT------VDYSIISGNRGRVFQLEPRLAEVGDGVGPGPQALGCLVLLEPLDFESLTQYN----------LTVAAADRGQPPR--SSAVPVTVTVLDVNDNPPVFTRASYRVTVPEDMPVGAELLH--VEASDADPGPHGLVHFTLS-------SGDPLGLFELDENSGALRLSRPLDCETQAQHQLVVQAADPAGTHF-SLVPVTVEVQDVNDHGPAFPLSLLSTSLAENQPPGTLVTTLHAIDGDAGTFGRLRYSLLEAVPGPEGREAFSLNSSTGELRARVPFDYEHTGSFRLLVGAADAGNLSA 2788          

HSP 5 Score: 114.005 bits (284), Expect = 8.574e-25
Identity = 136/601 (22.63%), Postives = 251/601 (41.76%), Query Frame = 3
Query:  399 GTFFILIKILDQNDKAPQFSSI-----KRPFFKIPENVEVGKVIDLPMAVDSDSEKYSVRRYSLSYIYHLDQTHDFRLHVTNDNPPRPQLIVNSKLDYEKINKYVFRLFAYDFDEKSIGNSCSTTIEIEIEDLNDNVPKFNQLTYNAN-IDENKRDDK-LIKFTVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDADTHSNMIHCKLVDYNDLFYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPIIVTDRDSGLNGKFEFYLEDFRNFSDSSD--FLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLRTRKPLDRETLESI---SIKVTAKNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAPKF 2165
            G+ F+ + + D ND  P  + I       P  ++ E    G+++      D D   ++    SL       +  +    ++  +     + V  +LD E+ + Y  R+ A D     +         + + D+NDN P F++  Y    + E       +++ T  DPD G NG +T ++   T         F I      +    +LDYE +P   +  ++ATD G P L SSA V + L+++NDN P+  F++  ++ S    + EG    +  ++V  TDAD+        L+ Y+    L +       ++    ++ T   +DR+    SF   T++  D    + +     + + + D NDN P F  + Y  ++              +   D D G +G+  +++      + +S   F +D  SG +     L     +  + +I A D G       + + I+++      P F +  Y+F+V E+V+ G  +G +QA +         +  S    GD    F +D  +G L+T +PLDRE L  +    ++  +  P  ++   +R         + + DVNDN+P F
Sbjct:  338 GSAFVTVHVRDANDNQPSMTVIFLSADGSP--RVSEAAPPGQLVARISVSDPDDGDFAHVNVSL-------EGGEGHFALSTQDSVIYLVCVARRLDREERDVYNLRVTATDSGSPPL--RAEAAFVLHVTDVNDNAPAFDRQLYRPEPLPEVALPGSFVVRVTARDPDQGTNGQITYSLAPGTHT-----HWFSIDPTSGIITTAATLDYELEPQP-QLIVVATDGGLPPLVSSATVSVALQDVNDNEPQ--FQRTFYNAS----LPEGTQPGTCFLQVTATDADSGP----FGLLSYSLGAGLGASGSPPFRIDAHSGDVCTTRTLDRDQGPSSF-DFTVTAIDGGGLKSMVY---VKVFVADENDNPPQFYPREYAASLSAQSTPGTAVLR--VHAHDPDQGPHGRLSYHI-----LAGNSPPLFALDAHSGLLTVAWPLGRRANSVVQLEIGAQDGGGLQAEPIARVNISIVPGTPTPPIFEQLQYVFSVPEDVAPGTSVGIIQAHNPPGRLGPVTLTLS---GGDPRGLFSLDSPSGLLKTLRPLDRELLGPVLELEVRAGSGTPPVFAVARIR---------VLLDDVNDNSPAF 888          

HSP 6 Score: 111.694 bits (278), Expect = 4.571e-24
Identity = 124/491 (25.25%), Postives = 207/491 (42.16%), Query Frame = 3
Query:  753 TTIEIEIEDLNDNVPKFNQLTYNANIDENKR-DDKLIKFTVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDADTHSNMIHCKLVDYNDLFYLDSPSKFNTLLNYKPFN--LKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPIIVTDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFTQ---RSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDID--------------RYTGDLRTRKPLDRETLESISIKVTAKNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAPKF 2165
            + + + ++D NDN P+F +  Y A + E++  +  L++    D D G  G ++ ++            +F +      +     LD E         L+ATD+G+P+L  SA + + + + NDN P I  +     VS    +   +         +VT  D  S  +         L+Y+ SPS      +   +   +     +D E      L++       E       + +L + +EDVNDN P FSQ +Y   + E+           +  TDRDSG NG   ++L      S +  F +D  +G +FT     +L +E        + A D G    T+ +T+ + + D ND+AP F+  HY   V E++  G  + TL+A D D  R +  + YSI   G+    F ++              +  G L   +PLD E+L   ++ V A +  +          S V V + V+DVNDN P F
Sbjct: 2148 SVLTLTLQDANDNAPRFLRPHYVAFLPESRPLEGPLLQVEADDLDQGSGGQISYSLAASQPARG----LFHVDPATGTITTTAILDREIWAET-RLVLMATDRGSPALVGSATLTVMVIDTNDNRPTIP-QPWELRVSEDALLGSEI--------AQVTGNDVDSGPV---------LWYVLSPSGPQDPFSIGRYGGRVSLTGPLDFEQCDHYHLQLLAHDGPHE------GHANLTVLVEDVNDNVPTFSQSLYQVMMLEHTPPGSAILS--VSATDRDSGANGHISYHLA-----SPAEGFRVDPNNGTLFTTVGAMALGHEGPGVVDVVLEARDHGAPGRTAQATVHVQLKDQNDHAPSFTLPHYRVAVSEDLPPGSTLLTLEATDADGSRTHATVDYSI-ISGNRGRVFQLEPRLAEVGDGVGPGPQALGCLVLLEPLDFESLTQYNLTVAAADRGQPPR------SSAVPVTVTVLDVNDNPPVF 2595          

HSP 7 Score: 102.449 bits (254), Expect = 2.810e-21
Identity = 111/434 (25.58%), Postives = 192/434 (44.24%), Query Frame = 3
Query:  759 IEIEIEDLNDNVPKFNQLTYNANIDENKRDDKLI-KFTVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDADTHSNMIHCKLVDYNDLFYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRI-TISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQ---IYIGXXXXXXXXXXXXFPKPIIVTDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESH------YIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLRTRKPLDR 2027
            I + ++D+NDN P F        + +N      I      DPDSG N  +T N++   D L      F +      + L+  L         E  + A D G+P  +S  ++++ +++L  +G   +F     S +  V +  G    + +++V+    D      H      +  F L+S S +          L     +DRES     L++  +S + +E  +Q T   ++ + I + ND++P  S++   + +        +V   F      TDRDSG NG+  + L+      DS  F I   +G++ T ++LD E ++ F+  +   D G  P +++ T+ + VLDLNDN+P F ++           V + V  G  + TLQA D D + +N  I Y++   G  S  F +  +TG+L T   L R
Sbjct:  874 IRVLLDDVNDNSPAFPAPEDTVLLPQNTAPGTPIYTLRALDPDSGANSRITFNLLAGGDGL------FTVDPTTGHVRLMGPLG-PPGGPAHELEVEARDGGSPPRTSHFRLRVVIQDLGIHGLAPRFD----SPTYRVDLPSGTTTGTQILQVQAQAPDGSPVTYHLAADGASSPFGLESQSGW----------LWVRTALDRESQELYTLKVMAVSGSKAELGQQ-TGTATVRVIILNQNDHSPRLSEEPTFLAVAENQPPGTSVGRVF-----ATDRDSGPNGRLTYSLQQLS--EDSKAFRIHPQTGEVTTLQTLDREQQSSFQLLVQVQDGGSPPRSATGTVHVAVLDLNDNSPTFLQASGAAGGGLPIQVPDRVPPGTLVTTLQAKDPD-EGENGTILYTLTGPG--SELFSLHPHTGELHTAASLVR 1275          

HSP 8 Score: 100.523 bits (249), Expect = 1.191e-20
Identity = 147/609 (24.14%), Postives = 247/609 (40.56%), Query Frame = 3
Query:  411 ILIKILDQNDKAPQFSSIKRPFFK--IPENVEVGKVIDLPMAVDSDSEKYSVRRYSLSYIYHLDQTHDFRLHVTNDNPPRPQLIVNSKLDYEKINKYVFRLFAYDFDEKSIGNSCSTTIEIEIEDLNDNVPKFNQLTYNANIDENKR-DDKLIKFTVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVS-NSVSIIEGLPAHSLVVEVRVTDADTHSNMIHCKLVDYNDLFYLDSPSKFNTLLNYKPFN---LKTINKIDRESNHGSFLRITISCTD-SEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPIIVTDRDSGLNGKFEFYLEDFRNFSDSSDFLID----------------KISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLRTRKPLDRETLESISIKVTAKNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAPKF 2165
            + + + D ND AP+F    RP +   +PE+  +   +    A D D        YSL+      Q      HV   +P    +   + LD E   +    L A D    ++  S   T+ + + D NDN P   Q  +   + E+     ++ + T +D DSG      ++     D        F I R    + L   LD+E   H +   LLA D         A + + ++++NDN P        FS S   V ++E  P  S ++ V  TD D+ +N  H         ++L SP++        P N     T+  +         + + +   D   P R  T   ++++Q++D ND+AP F+   Y               P   ++T   +  +G       D+   S +   +                  +  G +     LD+E+  ++   + A D+G  P +S+  +T+ VLD+NDN P F+ + Y   V E++ VG ++  ++A   D D     + +     GD    F++D  +G LR  +PLD ET     + V A +P    +HF     S V V ++V DVND+ P F
Sbjct: 2150 LTLTLQDANDNAPRFL---RPHYVAFLPESRPLEGPLLQVEADDLDQGSGGQISYSLA----ASQPARGLFHV---DPATGTITTTAILDREIWAETRLVLMATDRGSPALVGS--ATLTVMVIDTNDNRPTIPQ-PWELRVSEDALLGSEIAQVTGNDVDSGPVLWYVLSPSGPQDP-------FSIGRYGGRVSLTGPLDFEQCDH-YHLQLLAHDG---PHEGHANLTVLVEDVNDNVPT-------FSQSLYQVMMLEHTPPGSAILSVSATDRDSGANG-HIS-------YHLASPAEG---FRVDPNNGTLFTTVGAMALGHEGPGVVDVVLEARDHGAPGR--TAQATVHVQLKDQNDHAPSFTLPHY------RVAVSEDLPPGSTLLTLEATDADGSRTHATVDYSIISGNRGRVFQLEPRLAEVGDGVGPGPQALGCLVLLEPLDFESLTQYNLTVAAADRGQPPRSSAVPVTVTVLDVNDNPPVFTRASYRVTVPEDMPVGAELLHVEA--SDADPGPHGLVHFTLSSGDPLGLFELDENSGALRLSRPLDCETQAQHQLVVQAADPA--GTHF-----SLVPVTVEVQDVNDHGPAF 2699          

HSP 9 Score: 92.0485 bits (227), Expect = 4.319e-18
Identity = 156/677 (23.04%), Postives = 265/677 (39.14%), Query Frame = 3
Query:  384 TPTDPGTFFILIKILDQNDKAPQFSSIKRPF-----FKIPENVEVGKVIDLPMAVDSDSEKYSVRRYSLSYIYHLDQTHDFRLHVTNDNPPRPQLIVNSKLDYEKINKYVFRLFAYDFDEKSIGNSCSTTIEIEI--------------EDLNDNVPKFNQLTYNANIDENKRDDKLIKFTVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDAD--THSNMIHCKLVDYNDLFYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKP----IIVTDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLRTRKPLDRETLESISIKVTAKNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAPKFIPRLNMKQKVEFIVEQFVDGNTCTELPYTVQDIDDGGINGQNCCYTILENDYNKLFSL 2339
            +P    T  + + +LD ND +P F             ++P+ V  G ++    A D D  +     Y+L+       +  F LH     P   +L   + L   +   YV  L A+  D+ S   S S  + +++               D    VP    +       E  R   L+  +V+  +    G++T  +V   D        F +      L L   LD+E  P     T+ A   G    +   +V++ +++ N++ P      L  ++  +       P  +L    R +DAD    ++ +  +L+          P      L+ +   L     +DRE+     L +  +   +  SR+     S  + + D NDNAP+F+    +   ++         P P    ++  D D G   +  + L           F +   +G +   R LD E + +    ++A+D G  P +S+  +T++V+D+ND AP F +  Y   + EN   G  + TL+A D D    N  + Y     G     F +D  TG L T + LDRE  E I + V A++        +    + + V + V D ND+ P F    N    +E  V +  D  T T L  +     DGG+NGQ   Y IL+ D +  F+L
Sbjct: 1182 SPPRSATGTVHVAVLDLNDNSPTFLQASGAAGGGLPIQVPDRVPPGTLVTTLQAKDPDEGENGTILYTLTG----PGSELFSLH-----PHTGELHTAASLVRAERPHYVLTLSAH--DQGSPPRSASLQLLVQVLPSTRVVESPDLIEADSAATVP----VVLTVTAAEGLRPGSLLG-SVAPQEPASVGVLTYTLVGGADPEGT----FALDSASGRLYLARPLDFEAGPAWRALTVRAEGPGGAG-ARLLRVQVRVQDENEHAPTFARDPLALALPENPD-----PGATLYT-FRASDADGPGPNSEVRYRLLR-------QEPPVPALRLDARTGALSAPRGLDRETTPALLLLVEATDRPANASRRRAARVSARVFVTDENDNAPVFASPSRVRLPEDQP-------PGPAALHVVARDPDLGEAARVSYRLAA----GGDGHFRLHATTGALSVVRPLDREQRAEHVLTVVALDHGSPPRSSTQLLTVSVVDVNDEAPAFPQQEYNVILRENSPPGTSLLTLKATDPDLG-ANGQVTYG----GVSGESFSLDPNTGVLTTLRALDREEQEEIYLTVYARDRG------LPPLLTHITVRVTVEDENDHTPTF---GNTHLSLE--VPEGQDPQTLTTLRASDP---DGGLNGQ-LQYRILDGDSSGAFAL 1793          

HSP 10 Score: 88.5817 bits (218), Expect = 5.296e-17
Identity = 140/612 (22.88%), Postives = 241/612 (39.38%), Query Frame = 3
Query:  387 PTDPGTFFILIKILDQNDKAPQFSSIKRPFFKIPENVEVGKVIDLPMAVDSDSEKYSVRRYSLSYIYHLDQTHDFRLHVTNDNPPRPQLIVNSKLDYEKINKYVFRLFAYDFDEKSIGNSCSTT--IEIEIEDLNDNVPKFNQLTYNANIDE-----NKRDDKLIKFTVSDPDSGRNGIVTVNIV------DKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSII-EGLPAHSLVVEVRVTDADTHSNMIHCKLVDYND--LFYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPII---VTDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLRTRKPLDRETLESISIKVTAKNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAPKF 2165
            P    T  + + +LD ND AP F  +     ++PE+  VG ++    A D D        Y L           F L      P   +L   + LD E    Y F + A D    +     STT  I I + D+ND+ P F        +       NK    L      D D+G N  +   +          D  +   ++    R+   L          D  LF   ++ATD G P+ S++  V + ++   + GP+       F  ++S +++ E  P  + V+  +   +   +  I   ++  N+  +F +   +   T+ + +  + +T  +          LR+ +       S        L + ++D NDNAP F +  Y+  + E++         P++     D D G  G+  + L   +       F +D  +G I T   LD E   + R  ++A D+G   L  S+T+T+ V+D NDN P   +  +   V E+  +G +I  +   D D+      ++Y + P G     F I RY G +    PLD E  +   +++ A +      H     +   ++ + V DVNDN P F
Sbjct: 1826 PALSATLLVTVTVLDANDHAPVFP-VPSYSVEVPEDAPVGTLLLQLQAHDPDDGDNGRVMYYLG----AGTAGAFLLE-----PTSGELSTATALDREHCASYAFSVTAVD---GAAAGPLSTTVPITITVRDVNDHAPAFPTSPLRLRLPRPGPSLNKPTLALATLRAEDRDAGANASILYRLAGTPPPGTTVDSYTGEIRV---ARSPVALG-------PQDRVLF---IVATDLGRPARSATGVVVVGIQGEPERGPR-------FPRTSSEAVLRENAPPGTPVISPKAVHSGGSNGPITYSILSGNERGIFSIQPSTGAITVRSAEGLDFETSPR----------LRLVLQAE----SGGAFAFSVLTLTLQDANDNAPRFLRPHYVAFLPESRP-----LEGPLLQVEADDLDQGSGGQISYSLAASQ--PARGLFHVDPATGTITTTAILDREIWAETRLVLMATDRGSPALVGSATLTVMVIDTNDNRPTIPQP-WELRVSEDALLGSEIAQVTGNDVDS---GPVLWYVLSPSGPQDP-FSIGRYGGRVSLTGPLDFEQCDHYHLQLLAHD----GPH-----EGHANLTVLVEDVNDNVPTF 2369          

HSP 11 Score: 87.4261 bits (215), Expect = 1.103e-16
Identity = 170/704 (24.15%), Postives = 268/704 (38.07%), Query Frame = 3
Query:  399 GTFFILIKILDQNDKAPQFSSIKRPFFKIPENVEVGKVIDLPMAVDSDSEKYSVRRYSLSYIYHLDQTHDFRLHVTNDNPPRPQLIVNSKLDYEKINKYVFRLFAYDFDEKSIGNSCSTTIEIEIEDLNDNVPKFNQLTYNAN-------IDENKRDDKLIKFTVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHL---KNLNDNGPKIKFKKLG-FSVSNSVSIIEGLPAHSLVVEVRVTDADTHSNMIHCKL--VDYNDLFYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPIIVTDRDSGLNG---KFEFYLEDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITIN---VLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLRTRKPLDRETLESISIKVTA---KNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAPKFIPRLNMKQKVEFIV-EQFVDGNTCTELPYTVQDIDDGGINGQNCCYTILENDYNKLFSLMTDTPSYICLQR-KPEKYQSYTVTLIARDR--PP 2432
            GT  + + IL+QND +P+ S  +  F  + EN   G  +    A D DS       YSL  +   + +  FR+H     P   ++     LD E+  +  F+L     D  S   S + T+ + + DLNDN P F Q +  A         D       +      DPD G NG +   +     EL      F +  +   L    SL     PH +  TL A DQG+P  S+S Q+ + +     + ++   I+        V  +V+  EGL   SL+  V   +  +   + +  +   D    F LDS S    L   +P + +           G   R  ++     P         + ++++D N++AP F++                  P   + T R S  +G     E      R         +D  +G +   R LD ET       + A D+        +        V D NDNAP F+    +  + E+   G     + A D D     + + Y +   GD   +F +   TG L   +PLDRE      + V A    +P + S+           + + V+DVND AP F      +Q+   I+ E    G +   L  T  D+   G NGQ   Y  +  +    FSL  +T     L+    E+ +   +T+ ARDR  PP
Sbjct: 1081 GTATVRVIILNQNDHSPRLSE-EPTFLAVAENQPPGTSVGRVFATDRDSGPNGRLTYSLQQLS--EDSKAFRIH-----PQTGEVTTLQTLDREQ--QSSFQLLVQVQDGGSPPRSATGTVHVAVLDLNDNSPTFLQASGAAGGGLPIQVPDRVPPGTLVTTLQAKDPDEGENGTILYTLTGPGSEL------FSLHPHTGELHTAASLVRAERPH-YVLTLSAHDQGSPPRSASLQLLVQVLPSTRVVESPDLIEADSAATVPVVLTVTAAEGLRPGSLLGSVAPQEPASVGVLTYTLVGGADPEGTFALDSAS--GRLYLARPLDFEA----------GPAWR-ALTVRAEGPGGAGARLLRVQVRVQDENEHAPTFARD------PLALALPENPDPGATLYTFRASDADGPGPNSEVRYRLLRQEPPVPALRLDARTGALSAPRGLDRETTPALLLLVEATDRPANASRRRAARVSARVFVTDENDNAPVFASPSRV-RLPEDQPPGPAALHVVARDPDLGEAAR-VSYRLAAGGD--GHFRLHATTGALSVVRPLDREQRAEHVLTVVALDHGSPPRSSTQL---------LTVSVVDVNDEAPAF-----PQQEYNVILRENSPPGTSLLTLKATDPDL---GANGQ-VTYGGVSGES---FSLDPNTGVLTTLRALDREEQEEIYLTVYARDRGLPP 1723          

HSP 12 Score: 84.3445 bits (207), Expect = 8.575e-16
Identity = 107/468 (22.86%), Postives = 196/468 (41.88%), Query Frame = 3
Query:  795 PKFNQLTYNANIDENKRDDKLIKFTVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDADTHSN--MIHCKLVDYNDLFYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIED--VNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPIIVTDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPL---TSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLRTRKPLDRETLESISIKVTAKN---PNKYSSHFVRNTDSEVDVMIKVMDVNDNAPKFI 2168
            P F QL Y  ++ E+      +    +    GR G VT+ +            +F +      L+ +  LD E    + E  + A   GTP + + A++++ L ++NDN P   F     +V    +   G P ++L    R  D D+ +N  +    L   + LF +D  +    L+          ++++ E+  G             P R  T++  L + I+D  ++  AP F    Y        +         I+     +       ++L        SS F ++  SG ++ + +LD E++  +  K++A+      L   T ++T+ + +L+ ND++PR SE      V EN   G  +G + A D D+   N  + YS++   + S  F I   TG++ T + LDRE   S  + V  ++   P + ++  V          + V+D+NDN+P F+
Sbjct:  782 PIFEQLQYVFSVPEDVAPGTSVGIIQAHNPPGRLGPVTLTLSGGDPR-----GLFSLDSPSGLLKTLRPLDRELLGPVLELEVRA-GSGTPPVFAVARIRVLLDDVNDNSPA--FPAPEDTVLLPQNTAPGTPIYTL----RALDPDSGANSRITFNLLAGGDGLFTVDPTTGHVRLMGPLGPPGGPAHELEVEARDGG-----------SPPR--TSHFRLRVVIQDLGIHGLAPRFDSPTY-----RVDLPSGTTTGTQILQVQAQAPDGSPVTYHLA---ADGASSPFGLESQSGWLWVRTALDRESQELYTLKVMAVSGSKAELGQQTGTATVRVIILNQNDHSPRLSEEPTFLAVAENQPPGTSVGRVFATDRDSG-PNGRLTYSLQQLSEDSKAFRIHPQTGEVTTLQTLDREQQSSFQLLVQVQDGGSPPRSATGTVH---------VAVLDLNDNSPTFL 1206          

HSP 13 Score: 63.929 bits (154), Expect = 1.568e-9
Identity = 118/552 (21.38%), Postives = 215/552 (38.95%), Query Frame = 3
Query:  705 LFAYDFDEKSIGNSCSTTIEIEIEDLNDNVPKFNQLTYNANIDENKRDDKLIKFTVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINS--LDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSII-EGLPAHSLVVEVRVTDADTHSNMIHCKLVDYNDLFYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPIIVTDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLRTR---KPLDRETLESISIKVTAKNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAPKF-IPRLNMKQKVEFIVEQFVDGNTCTELPYTVQDIDDGGINGQNCCYTILENDYNKLFSL 2339
            LF    D      S +  + + I+   +  P+F + +  A + EN      +    +    G NG +T +I+   +       IF IQ +   + + ++  LD+ET P L    L A   G  + S    + + L++ NDN P+       F   + V+ + E  P    +++V   D D  S       + Y+    L +      L +  P           +    +  R+ +  TD   S  +  + +L + + D NDN P   Q   +   ++  +   +     +   D DSG      +Y+       D   F I +  G++     LD+E  + +  +++A D    P    + +T+ V D+NDN P FS+S Y   + E+   G  I ++ A D D+       ++   P    +  F +D   G L T      L  E    + + + A++      H      ++  V +++ D ND+AP F +P   +      + E    G+T   L  T     DG        Y+I+  +  ++F L
Sbjct: 2029 LFIVATDLGRPARSATGVVVVGIQGEPERGPRFPRTSSEAVLRENAPPGTPVISPKAVHSGGSNGPITYSILSGNER-----GIFSIQPSTGAITVRSAEGLDFETSPRL-RLVLQAESGGAFAFSV---LTLTLQDANDNAPR-------FLRPHYVAFLPESRPLEGPLLQVEADDLDQGSG----GQISYS----LAASQPARGLFHVDPATGTITTTAILDREIWAETRLVLMATD-RGSPALVGSATLTVMVIDTNDNRPTIPQPWELRVSEDALLGSEI---AQVTGNDVDSG---PVLWYVLSPSGPQDP--FSIGRYGGRVSLTGPLDFEQCDHYHLQLLAHDG---PHEGHANLTVLVEDVNDNVPTFSQSLYQVMMLEHTPPGSAILSVSATDRDSGANGHISYHLASP----AEGFRVDPNNGTLFTTVGAMALGHEGPGVVDVVLEARD------HGAPGRTAQATVHVQLKDQNDHAPSFTLPHYRVA-----VSEDLPPGSTLLTLEATDA---DGSRTHATVDYSIISGNRGRVFQL 2526          
BLAST of Protocadherin Fat 1 vs. Ensembl Mouse
Match: Pcdh11x (protocadherin 11 X-linked [Source:MGI Symbol;Acc:MGI:2442849])

HSP 1 Score: 182.185 bits (461), Expect = 7.018e-46
Identity = 194/695 (27.91%), Postives = 310/695 (44.60%), Query Frame = 3
Query:  330 RKFCKADLCCKLIGFQYLTPTDPGTFFILIKIL----DQNDKAPQFSSIKRPFFKIPENVEVGKVIDLPMAVDSDSEKYSVRRYSLSYIYHLDQTHDFRLHV--TNDNPPRPQLIVNSKLDYEKINKYVFRLFAYD--FDEKSIGNSCSTTIEIEIEDLNDNVPKFNQLTYNANIDENKR-DDKLIKFTVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDADT-HSNMIHCKLVDYNDLFYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPIIVTDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLRTRKPLDRETLESISIKVTAKNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAPKFI-PRLNMKQKVEFIVEQFVDGNTCTELPYTVQDIDDG-GINGQNCCYTILENDYNKLFSLMTDTPSYICLQRK 2378
             K C   +      ++      P   F L+KI     D ND AP F +       IPEN  +     LP A+D D     V+ Y L     +   + F L V  T +    PQLIV  +LD E+ + YV ++   D  F ++S     +  +++ + D NDN P F +     +I EN      + +   +D D G N  +     +    ++KR  +F +      + +   LD E  P   +  +LATD G  S  + A V +++ ++NDN P I  + +    + +V + E  P ++ +  + V D D+ H+  + C   D+   F L  P   N  L      L+T   +D ES     +++  +     P  Q   +  L I+++D NDNAP+F+Q  +I        +      K I  TD DSG N +  + L     F    +F +D+ +G +   + LD E + K+ F ++A D G  PL S++T+ + VLD NDN+P F+ + Y F V E++     +G +   D D   +N  +  SI    D +  F ID  +G +R     DRE  ES +  V A++  + S        S   V I V+DVNDN P FI P  N     E+++     G       + V  IDD  G+N +   Y+I+  +   LF ++  T   I L+ K
Sbjct:   94 EKLCAGIVLDARCFYEVEVAVLPDEIFRLVKIRFLIEDINDNAPLFPTTVI-NISIPENSAINSRYSLPAAIDPDIGINGVQNYQL-----IKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRS----STAILQVSVADTNDNHPIFIEKEIEVSIPENAPIGSSVTQLHATDADIGENARIHFYFSNLVSNIAKR--LFHLNTTTGLITVKEPLDREESPS-HKLLVLATDGG--STPARATVLVNVTDINDNVPSIDIRYIVNPTNGTVLLSENAPLNTKIALITVMDKDSEHNGRVTC-FTDHEVPFRL-RPVFSNQFL------LETAAFLDFESTREYAIKLLAADAGKPPLNQ---SSMLLIKVKDENDNAPVFTQS-FISLSVPENNSPGAQLTK-ISATDADSGQNAEISYML----GFDAPPEFNLDQRTGILTAVKKLDREKQEKYYFTVLAQDNGIPPLMSNATVFVTVLDQNDNSPIFTHNEYNFYVPESLPKHGTVGLITVTDPDYG-ENSAVTLSIL---DVNDQFTIDPQSGVIRPNISFDRERQESYTFYVKAEDGGRVSR------SSTARVTINVVDVNDNKPIFIDPPSNY--SFEWVLPSTNPGTVV----FKVVAIDDDIGMNAE-VLYSIVGGNTKGLF-MIEQTSGNITLKEK 738          
BLAST of Protocadherin Fat 1 vs. UniProt/SwissProt
Match: sp|Q08174|PCDH1_HUMAN (Protocadherin-1 OS=Homo sapiens OX=9606 GN=PCDH1 PE=1 SV=2)

HSP 1 Score: 214.157 bits (544), Expect = 2.265e-55
Identity = 196/691 (28.36%), Postives = 312/691 (45.15%), Query Frame = 3
Query:  417 IKILDQNDKAPQFSSIKRPF--FKIPENVEVGKVIDLPMAVDSDSEKYSVRRYSLSYIYHLDQTHDFRLHVTNDNPPR-PQLIVNSKLDYEKINKYVFRLFAYDFDEKSIGNSCSTTIEIEIEDLNDNVPKFNQLTYNANIDENKR-DDKLIKFTVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSV--SNSVSIIEGLPAHSLVVEVRVTDADTHSNMIHCKLVDYNDLFYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFP---KP------IIVTDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEP-KGDHSSYFDIDRYTGDLRTRKPLDRETLESISIKVTAKNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAPKFIPRLNMKQKVEFIVEQFVDGNTCTELPYTVQDIDDGGINGQNCCYTILENDYNKLFSLMTDTPSYIC---LQRKPEKYQSYTVTLIARDRPP 2432
            I++ D ND  P F+S   P     IPEN  +G +  +P+A D D+    V  Y L       +   F L V  D   + PQLIV   LD E+ + Y   +   D    S   + S  + + + D NDN PKF + +Y A + EN      +I+   +D D G N  +      +  E+ +R  +  + RN   + +   +D E D     F++LA D+GT   S+ AQV + +K++NDN P I+ + +G         +I E +   + V  V+V+D D   N     +V  +  F L   S+  +    K F L+T   +D E      + I    + + P   +++  SL +Q+ DVNDNAP+F+Q +             V FP   KP      I  +D DSG N +  + LE     +    F I   +G+I  + SLD E +  +  K++A D+G   L  ++T+ +NVLD NDN P+F  S Y F+V EN+     +G +  ID D   +N  +  S+E   GD    F I   TG + +    DRE   + + ++ A +        V    + V V I V+D NDNAP      N   K   +  Q   G T +++    +D D  G+N +   Y+I   +   LF + + + +      ++R+        V +  R +PP
Sbjct:  156 IEVQDINDNTPNFAS---PVITLAIPENTNIGSLFPIPLASDRDAGPNGVASYELQAGPEAQEL--FGLQVAEDQEEKQPQLIVMGNLDRERWDSYDLTIKVQDG--GSPPRASSALLRVTVLDTNDNAPKFERPSYEAELSENSPIGHSVIQVKANDSDQGANAEIEYTF-HQAPEVVRR--LLRLDRNTGLITVQGPVDRE-DLSTLRFSVLAKDRGTNPKSARAQVVVTVKDMNDNAPTIEIRGIGLVTHQDGMANISEDVAEETAVALVQVSDRDEGENAAVTCVVAGDVPFQLRQASETGSDSKKKYF-LQTTTPLDYEKVKDYTIEIVAVDSGNPP---LSSTNSLKVQVVDVNDNAPVFTQSV-----------TEVAFPENNKPGEVIAEITASDADSGSNAELVYSLEP--EPAAKGLFTISPETGEIQVKTSLDREQRESYELKVVAADRGSPSLQGTATVLVNVLDCNDNDPKFMLSGYNFSVMENMPALSPVGMVTVIDGDKG-ENAQVQLSVEQDNGD----FVIQNGTGTILSSLSFDREQQSTYTFQLKAVDGG------VPPRSAYVGVTINVLDENDNAPYITAPSNTSHK--LLTPQTRLGETVSQV--AAEDFDS-GVNAE-LIYSIAGGNPYGLFQIGSHSGAITLEKEIERRHHGLHRLVVKVSDRGKPP 801          

HSP 2 Score: 142.51 bits (358), Expect = 5.305e-33
Identity = 153/594 (25.76%), Postives = 261/594 (43.94%), Query Frame = 3
Query:  384 TPTDPGTFFILIKILDQNDKAPQFSSIKRPFF--KIPENVEVGKVIDLPMAVDSDSEKYSVRRYSLSYIYHLDQTHDFRLHVTNDNPPRPQLIVNSKLDYEKINKYVFRLFAYDFDEKSIGNSCSTTIEIEIEDLNDNVP-----KFNQLTYN---ANIDENKRDDKLIKFT-VSDPDSGRNGIVTVNIV-DKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVS-NSVSIIEGLPAHSLVVEVRVTDADTHSNMIHCKLVDYNDLFYLDSPSKFNTLLNYKP--FNLKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPII-VTDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSE----SHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLRTRKPLDR--ETLESISIKVTAKN-PNKYSSHFV 2096
            +P    +  + + +LD ND AP+F   +RP +  ++ EN  +G  +    A DSD    +     + Y +H       RL   + N     + V   +D E ++   F + A D        S    + + ++D+NDN P         +T+    ANI E+  ++  +    VSD D G N  VT  +  D   +L +  +     + ++FL+    LDYE     +   ++A D G P LSS+  +K+ + ++NDN P        F+ S   V+  E      ++ E+  +DAD+ SN    +LV     + L+       L    P    ++    +DRE      L++ ++     PS Q T    +N+   D NDN P F   +  G       N+    P  ++ V D D G N + +  +E      D+ DF+I   +G I +  S D E ++ + F++ A+D G  P ++   +TINVLD NDNAP  +     SH +        +G  +  + A D D+   N ++ YSI   G+    F I  ++G +   K ++R    L  + +KV+ +  P +Y +  V
Sbjct:  257 SPPRASSALLRVTVLDTNDNAPKF---ERPSYEAELSENSPIGHSVIQVKANDSDQGANA----EIEYTFHQAPEVVRRLLRLDRN--TGLITVQGPVDREDLSTLRFSVLAKDRGTNP--KSARAQVVVTVKDMNDNAPTIEIRGIGLVTHQDGMANISEDVAEETAVALVQVSDRDEGENAAVTCVVAGDVPFQLRQASETGSDSKKKYFLQTTTPLDYEKVKD-YTIEIVAVDSGNPPLSSTNSLKVQVVDVNDNAPV-------FTQSVTEVAFPENNKPGEVIAEITASDADSGSN---AELV-----YSLEPEPAAKGLFTISPETGEIQVKTSLDREQRESYELKV-VAADRGSPSLQGTATVLVNVL--DCNDNDPKF---MLSGYNFSVMENMPALSPVGMVTVIDGDKGENAQVQLSVE-----QDNGDFVIQNGTGTILSSLSFDREQQSTYTFQLKAVDGGVPPRSAYVGVTINVLDENDNAPYITAPSNTSHKLLT--PQTRLGETVSQVAAEDFDSG-VNAELIYSIA-GGNPYGLFQIGSHSGAITLEKEIERRHHGLHRLVVKVSDRGKPPRYGTALV 808          

HSP 3 Score: 136.732 bits (343), Expect = 4.136e-31
Identity = 139/492 (28.25%), Postives = 232/492 (47.15%), Query Frame = 3
Query:  762 EIEIEDLNDNVPKFNQLTYNANIDENKRDDKLIKFTV-SDPDSGRNGIVTVNIVDKTDELSKRF--KIFEIQRN-EFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDADTHSNMIHCKLVDYNDLFYLDSPSKFNTLLNY-KPFNLKTI-NKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFS-QQIYI-----GXXXXXXXXXXXXFPKPIIVTDRDSGLN--------GKFEFYL-EDFRNFSDSSDFLIDKISGKIFTQRS--LDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLRTRKPLDRETLESISIKVTAKNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAPKFI 2168
            +IE++D+NDN P F        I EN     L    + SD D+G NG+ +  +     E  + F  ++ E Q   +  L ++ +LD E     ++ T+   D G+P  +SSA +++ + + NDN P  KF++  +    S    E  P    V++V+  D+D  +N      ++Y    +  +P     LL   +   L T+   +DRE    S LR ++   D   + + +    + + ++D+NDNAP    + I +     G  + ++          + V+DRD G N        G   F L +     SDS          K F Q +  LDYE    +  +I+A+D G  PL+S++++ + V+D+NDNAP F++S       EN   G  I  + A D D+   N ++ YS+EP+      F I   TG+++ +  LDRE  ES  +KV A +     S  ++ T +   V++ V+D NDN PKF+
Sbjct:  155 QIEVQDINDNTPNFASPVITLAIPENTNIGSLFPIPLASDRDAGPNGVASYEL-QAGPEAQELFGLQVAEDQEEKQPQLIVMGNLDRERW-DSYDLTIKVQDGGSPPRASSALLRVTVLDTNDNAP--KFERPSYEAELS----ENSPIGHSVIQVKANDSDQGANA----EIEYT---FHQAPEVVRRLLRLDRNTGLITVQGPVDREDL--STLRFSVLAKDRGTNPK-SARAQVVVTVKDMNDNAPTIEIRGIGLVTHQDGMANISEDVAEETAVALVQVSDRDEGENAAVTCVVAGDVPFQLRQASETGSDSKK--------KYFLQTTTPLDYEKVKDYTIEIVAVDSGNPPLSSTNSLKVQVVDVNDNAPVFTQSVTEVAFPENNKPGEVIAEITASDADSG-SNAELVYSLEPEPAAKGLFTISPETGEIQVKTSLDREQRESYELKVVAAD---RGSPSLQGTAT---VLVNVLDCNDNDPKFM 613          
BLAST of Protocadherin Fat 1 vs. UniProt/SwissProt
Match: sp|Q96JQ0|PCD16_HUMAN (Protocadherin-16 OS=Homo sapiens OX=9606 GN=DCHS1 PE=1 SV=1)

HSP 1 Score: 194.897 bits (494), Expect = 8.440e-49
Identity = 179/617 (29.01%), Postives = 277/617 (44.89%), Query Frame = 3
Query:  372 FQYLTPTDPGTFFILIKILDQNDKAPQFSSIKRPFFKIPENVEVGKVIDLPMAVDSDSEKYSVRRYSLSYIYHLDQTHDFRLHVTN--DNPPRPQLIVNSKLDYEKINKYVFRLFAYDFDEKSIGNSCSTTIEIEIEDLNDNVPKFNQLTYNANIDEN-KRDDKLIKFTVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDAD----THSNMI------HCKLVDYNDLFYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPIIVTDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEP--KGDHSSYFDIDRYTGDLRTRKPLDRET-LESISIKVTAKNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAPKFIPR 2174
            F  +TP D  T  + +++ D ND AP F    R   ++PE+   G    L  A D+D+ +   + Y+LS          FRL      D  P P+L+V  +LD E  + Y+ +L AYD    S        +++ + D+ND+ P FNQ  Y+A + E+      +++   SD D+G NG VT  I  +  E    F    I  +   L+L   LD+E    + E  + A D G      SA V +H+++ NDN P +    +  S   S  + E  P   LV  + V+D D     H N+       H  L   + + YL   ++                ++DRE      LR+T + + S P R      +  + + DVNDNAP F +Q+Y       +V +  +F   +   D D G NG+  + L      + +  F ID  SG I T  SLDYE + + +  ++A D G  PL SS+T+++ + D+NDN P+F  + Y  ++ E    G     + A D D+      + YS+        S  F ID ++GD+ T + LDR+    S    VTA +             S V V + + D NDN P+F PR
Sbjct:  117 FTAVTP-DGATVEVTVRVADINDHAPAFPQ-ARAALQVPEHTAFGTRYPLEPARDADAGRLGTQGYALS---GDGAGETFRLETRPGPDGTPVPELVVTGELDRENRSHYMLQLEAYD--GGSPPRRAQALLDVTLLDINDHAPAFNQSRYHAVVSESLAPGSPVLQVFASDADAGVNGAVTYEINRRQSEGDGPF---SIDAHTGLLQLERPLDFEQR-RVHELVVQARDGGAHPELGSAFVTVHVRDANDNQPSMTV--IFLSADGSPQVSEAAPPGQLVARISVSDPDDGDFAHVNVSLEGGEGHFALSTQDSVIYLVCVAR----------------RLDREERDAYNLRVTATDSGSPPLR---AEAAFVLHVTDVNDNAPAFDRQLY-RPEPLPEVALPGSFVVRVTARDPDQGTNGQVTYSLAPG---AHTHWFSIDPTSGIITTAASLDYELEPQPQLIVVATDGGLPPLASSATVSVALQDVNDNEPQFQRTFYNASLPEGTQPGTCFLQVTATDADSGPFGL-LSYSLGAGLGSSGSPPFRIDAHSGDVCTTRTLDRDQGPSSFDFTVTAVDGG--------GLKSMVYVKVFLSDENDNPPQFYPR 688          

HSP 2 Score: 135.191 bits (339), Expect = 2.301e-30
Identity = 148/599 (24.71%), Postives = 249/599 (41.57%), Query Frame = 3
Query:  411 ILIKILDQNDKAPQFSSIKRPF-FKIPENVEVGKVIDLPMAVDSDSEKYSVRRYSLSYIYHLDQTHDFRLHVTNDNPPRPQLIVNSK---------LDYEKINKYVFRLFAYDFDEKSIGNSCSTTIEIE-IEDLNDNVPKFNQLTYNANIDENKRDDKLIKFTVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDADTHSNMIHCKLVDYNDLFYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPIIV---TDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLRTRKPLDRETLESISIKVTAKNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAPKF 2165
            + +++ D+N+ AP F+  + P    +PEN E G  +    A D+D                     D R  +    PP P L ++++         LD E     +  + A D    +     +       + D NDN P F   +     ++       +     DPD G    V+  +    D        F +  +   L ++  LD E        T++A+D G+P  S++  + + + ++ND  P  + ++       SV + E  P  + ++ +R TD D  +N      V Y  +    S   F+  L+     L T+  +DRE      + +T+   D     Q+T + ++ + +ED ND+AP F      G+   +        P+ + +   +D D G NG+ ++ + D      S  F++D  SG+  T R LD E +  F+ +I A D G   L+++  +T+ VLD ND+AP F    Y   V E+V  G  +  LQA D D        +Y        +  F ++  +G+LRT   LDRE   S +  V+A +             + V V I V DVND+AP F
Sbjct: 1422 VQVQVQDENEHAPAFA--RDPLALALPENPEPGAALYTFRASDADGP---------------GPNSDVRYRLLRQEPPVPALRLDARTGALSAPRGLDRETTPALLLLVEATDRPANASRRRAARVSARVFVTDENDNAPVFASPSRVRLPEDQPPGPAALHVVARDPDLGEAARVSYRLASGGD------GHFRLHSSTGALSVVRPLDREQRAEHV-LTVVASDHGSPPRSATQVLTVSVADVNDEAPTFQQQEY------SVLLRENNPPGTSLLTLRATDPDVGAN----GQVTYGGV----SSESFS--LDPDTGVLTTLRALDREEQEE--INLTVYAQDRGSPPQLT-HVTVRVAVEDENDHAPTF------GSAHLSLEVPEGQDPQTLTMLRASDPDVGANGQLQYRILDG---DPSGAFVLDLASGEFGTMRPLDREVEPAFQLRIEARDGGQPALSATLLLTVTVLDANDHAPAFPVPAYSVEVPEDVPAGTLLLQLQAHDPDAGANGHVTYYL---GAGTAGAFLLEPSSGELRTAAALDREQCPSYTFSVSAVDGAAAGP-----LSTTVSVTITVRDVNDHAPTF 1960          

HSP 3 Score: 122.479 bits (306), Expect = 1.695e-26
Identity = 140/543 (25.78%), Postives = 233/543 (42.91%), Query Frame = 3
Query:  423 ILDQNDKAPQFSSIKRPFFKIPENVEVGKVIDLPMAVDSDSEKYSVRRYSLSYIYHLDQTHDFRLHVTNDNPPRPQLIVNSKLDYEKINKYVFRLFAYDFDEKSIGNSCSTTIEIEIEDLNDNVPKFNQLTYNANIDENKR-DDKLIKFTVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDADTHSN-MIHCKLVDYNDLFYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPIIVTDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQ-PLTSSSTITINVLDLNDNAPRFSESHYIFNV------FENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLR-TRKPL 2021
            + D+ND AP F+S  R   ++PE+   G      +A D D  + +   Y L+          FRLH +        L V   LD E+  ++V  + A D    S   S +  + + + D+ND  P F Q  Y+  + EN      L+    +DPD G NG VT   V            F +  +   L  + +LD E    +   T+ A D+G+P   +   V++ +++ ND+ P      L      S+ + EG    +L + +R +D D  +N  +  +++D       D    F  +L+       T+  +DRE      LRI       +P+  ++    L + + D ND+AP F    Y  +V+  +          +   D D+G NG   +YL        +  FL++  SG++ T  +LD E    + F + A+D     PL+++ ++TI V D+ND+AP F  S     +      F   ++   + TL+A D D    N  I Y +   G       +D YTG++R  R P+
Sbjct: 1536 VTDENDNAPVFASPSR--VRLPEDQPPGPAALHVVARDPDLGEAARVSYRLAS----GGDGHFRLHSSTG-----ALSVVRPLDREQRAEHVLTVVASD--HGSPPRSATQVLTVSVADVNDEAPTFQQQEYSVLLRENNPPGTSLLTLRATDPDVGANGQVTYGGVSSES--------FSLDPDTGVLTTLRALDREEQEEI-NLTVYAQDRGSPPQLTHVTVRVAVEDENDHAPTFGSAHL------SLEVPEGQDPQTLTM-LRASDPDVGANGQLQYRILDG------DPSGAF--VLDLASGEFGTMRPLDREVEPAFQLRIEAR-DGGQPA--LSATLLLTVTVLDANDHAPAFPVPAY--SVEVPEDVPAGTLLLQLQAHDPDAGANGHVTYYL----GAGTAGAFLLEPSSGELRTAAALDREQCPSYTFSVSAVDGAAAGPLSTTVSVTITVRDVNDHAPTFPTSPLRLRLPRPGPSFSTPTLA--LATLRAEDRDAG-ANASILYRL--AGTPPPGTTVDSYTGEIRVARSPV 2027          

HSP 4 Score: 120.168 bits (300), Expect = 9.127e-26
Identity = 140/599 (23.37%), Postives = 254/599 (42.40%), Query Frame = 3
Query:  399 GTFFILIKILDQNDKAPQFSSIKRPFFKIPENVEV---GKVIDLPMAVDSDSEKYSVRRYSLSYIYHLDQTHDFRLHVTNDNPPRPQLIVNSKLDYEKINKYVFRLFAYDFDEKSIGNSCSTTIEIEIEDLNDNVPKFNQLTYNAN-IDENKRDDK-LIKFTVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDADTHSNMIHCKLVDYNDLFYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPIIVTDRDSGLNGKFEFYLEDFRNFSDSSD--FLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLRTRKPLDRETLESI---SIKVTAKNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAPKF 2165
            G+ F+ + + D ND  P  + I       P+  E    G+++      D D   ++    SL       +  +    ++  +     + V  +LD E+ + Y  R+ A D     +         + + D+NDN P F++  Y    + E       +++ T  DPD G NG VT ++             F I      +    SLDYE +P   +  ++ATD G P L+SSA V + L+++NDN P+  F++  ++ S    + EG    +  ++V  TDAD+        L+ Y+    L S       ++    ++ T   +DR+    SF   T++  D    + +     + + + D NDN P F  + Y  ++              +   D D G +G+  +++      + +S   F +D+ SG +     L     +  + +I A D G      S+ + I+++      P F +  Y+F+V E+V+ G  +G +QA   +   +   +  S+   GD    F +D  +G L+T +PLDRE L  +    ++  +  P  ++   VR         + + DVNDN+P F
Sbjct:  344 GSAFVTVHVRDANDNQPSMTVIFLSADGSPQVSEAAPPGQLVARISVSDPDDGDFAHVNVSL-------EGGEGHFALSTQDSVIYLVCVARRLDREERDAYNLRVTATDSGSPPL--RAEAAFVLHVTDVNDNAPAFDRQLYRPEPLPEVALPGSFVVRVTARDPDQGTNGQVTYSLAP-----GAHTHWFSIDPTSGIITTAASLDYELEPQP-QLIVVATDGGLPPLASSATVSVALQDVNDNEPQ--FQRTFYNAS----LPEGTQPGTCFLQVTATDADSGP----FGLLSYSLGAGLGSSGSPPFRIDAHSGDVCTTRTLDRDQGPSSF-DFTVTAVDGGGLKSMVY---VKVFLSDENDNPPQFYPREYAASISAQSPPGTAVLR--LRAHDPDQGSHGRLSYHI-----LAGNSPPLFTLDEQSGLLTVAWPLARRANSVVQLEIGAEDGGGLQAEPSARVDISIVPGTPTPPIFEQLQYVFSVPEDVAPGTSVGIVQA--HNPPGRLAPVTLSLS-GGDPRGLFSLDAVSGLLQTLRPLDRELLGPVLELEVRAGSGVPPAFAVARVR---------VLLDDVNDNSPAF 894          

HSP 5 Score: 113.235 bits (282), Expect = 1.075e-23
Identity = 144/619 (23.26%), Postives = 251/619 (40.55%), Query Frame = 3
Query:  342 KADLCCKLIGFQYLTPTDPGTFFILIKILDQNDKAPQFSSIKRPFFKIPENVEVGKVIDLPMAVDSDSEKYSVRRYSLSYIYHLDQTHDFRLHVTNDNPPRPQLIVNSKLDYEKINKYVFRLFAYDFDEKSIGNSCSTTIEIEIEDLNDNVPKFNQLTYNANIDENKRDDKLIKFTVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSV-SNSVSIIEGLPAHSLVVEVRVTDADTHSNMIHCKLVDYNDLFYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPIIV------TDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFTQRS-LDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDL--RTRKPLDRETLESISIKVTAKNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAPKFI 2168
            +A+    ++   + +P    T  + + + D ND+AP F   +     + EN   G  +    A D D              Y    +  F L     +P    L     LD E+  +    L  Y  D  S       T+ + +ED ND+ P F     +  + E +    L     SDPD G NG +   I+D   + S  F + ++   EF    +  LD E +P  F+  + A D G P+LS++  + + + + ND+ P        F V + SV + E +PA +L+++++  D D  +N         +  +YL + +    LL      L+T   +DRE         ++S  D   +  ++T  S+ I + DVND+AP F        +         +F  P +        DRD+G N    + L      +      +D  +G+I   RS +    +++  F I+A D G    +++  I + +    +  PRF  +     + EN   G  I + +A+       N  I YSI   G+    F I   TG +  R+ + LD E    + + + A++   ++   +          + + D NDNAP+F+
Sbjct: 1612 RAEHVLTVVASDHGSPPRSATQVLTVSVADVNDEAPTFQQQEYSVL-LRENNPPGTSLLTLRATDPDVGANG------QVTYGGVSSESFSL-----DPDTGVLTTLRALDREEQEE--INLTVYAQDRGSPPQLTHVTVRVAVEDENDHAPTFGSAHLSLEVPEGQDPQTLTMLRASDPDVGANGQLQYRILD--GDPSGAF-VLDLASGEF--GTMRPLDREVEP-AFQLRIEARDGGQPALSATLLLTVTVLDANDHAP-------AFPVPAYSVEVPEDVPAGTLLLQLQAHDPDAGANG--------HVTYYLGAGTAGAFLLEPSSGELRTAAALDREQCPS--YTFSVSAVDGAAAGPLSTTVSVTITVRDVNDHAPTFPTS----PLRLRLPRPGPSFSTPTLALATLRAEDRDAGANASILYRLAG----TPPPGTTVDSYTGEIRVARSPVALGPRDRVLF-IVATDLGRPARSATGVIIVGLQGEAERGPRFPRASSEATIRENAPPGTPIVSPRAVH--AGGTNGPITYSIL-SGNEKGTFSIQPSTGAITVRSAEGLDFEVSPRLRLVLQAESGGAFAFTVL---------TLTLQDANDNAPRFL 2172          

HSP 6 Score: 113.235 bits (282), Expect = 1.075e-23
Identity = 140/601 (23.29%), Postives = 256/601 (42.60%), Query Frame = 3
Query:  384 TPTDPGTFFILIKILDQNDKAPQFSSIKRPF-FKIPENVEVGKVIDLPMAVDSDSEKYSVRRYSLSYIYHLDQTHDFRLHVTNDNPPRPQ-----------LIVNSKLDYEKINKYVFRLFAYDFDEKSIGNSCSTTIEIEIEDLNDNVPKFNQLTYNANIDENKR-DDKLIKFTVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINSLDYETD-PHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSN-SVSIIEGLPAHSLVVEVRVTDAD---THSNMIHCKLV-DYNDLFYLD------------SPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPIIVTDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIE--PKGDHSSYFDIDRYTGDLRTRKPLDRETLESISIKVTAKNPNKYSS 2087
            +P   G+  + + ++D ND  P   +I +P+  ++ E+  +G  I      D DS    V  Y LS                   P  PQ           + +   LD+E+ ++Y  +L A+D   +   N     + + +ED+NDN P F+Q  Y   + E+      ++  + +D DSG NG ++ ++    D  S          N     ++ ++    D     +  L A D G P  ++ A V + L++ ND+ P        F++S+  V++ E LP  S ++ +  TDAD   +H+ + +  +  ++  +F L+             P     L+  +P + +++ + +          +T++  D     Q ++   + + + DVNDN P+F++  Y   V E+           +  +D D G +G   F +    +   S  F +D+ SG +    +LD ET+ + +  + A D       + + +TI V D+ND+ P F  +    +V EN   G  + TL AID D     +  +  +E  P  +    F ++  TG+LR R P D E  ES  + V A +    S+
Sbjct: 2254 SPALVGSATLTVMVIDTNDNRP---TIPQPWELRVSEDALLGSEIAQVTGNDVDSG--PVLWYVLS-------------------PSGPQDPFSVGRYGGRVSLTGPLDFEQCDRYQLQLLAHDGPHEGRAN-----LTVLVEDVNDNAPAFSQSLYQVMLLEHTPPGSAILSVSATDRDSGANGHISYHLASPADGFSVD------PNNGTLFTIVGTVALGHDGSGAVDVVLEARDHGAPGRAARATVHVQLQDQNDHAPS-------FTLSHYRVAVTEDLPPGSTLLTLEATDADGSRSHAAVDYSIISGNWGRVFQLEPRLAEAGESAGPGPRALGCLVLLEPLDFESLTQYN----------LTVAAADRGQPPQ-SSVVPVTVTVLDVNDNPPVFTRASYRVTVPEDTPVGAELLH--VEASDADPGPHGLVRFTVS---SGDPSGLFELDESSGTLRLAHALDCETQARHQLVVQAADPAGAHF-ALAPVTIEVQDVNDHGPAFPLNLLSTSVAENQPPGTLVTTLHAIDGDAGAFGRLRYSLLEAGPGPEGREAFALNSSTGELRARVPFDYEHTESFRLLVGAADAGNLSA 2795          

HSP 7 Score: 100.908 bits (250), Expect = 6.636e-20
Identity = 117/467 (25.05%), Postives = 198/467 (42.40%), Query Frame = 3
Query:  753 TTIEIEIEDLNDNVPKFNQLTYNANIDENKR-DDKLIKFTVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDADTHSNMIHCKLVDYNDLFYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTDSEPSR---QITTNE-------SLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPIIVTDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFT---QRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDID--------------RYTGDLRTRKPLDRETLESISIKVTAKN 2069
            T + + ++D NDN P+F +  Y A + E++  +  L++    D D G  G ++ ++            +F +      +     LD E         L+ATD+G+P+L  SA + + + + NDN P I  +     VS    +   +         +VT  D  S  +         L+Y+ SPS         PF++           +G  + +T      +  R   Q+  ++       +L + +EDVNDNAP FSQ +Y   + E+           +  TDRDSG NG   ++L      S +  F +D  +G +FT     +L ++        + A D G     + +T+ + + D ND+AP F+ SHY   V E++  G  + TL+A D D  R +  + YSI   G+    F ++              R  G L   +PLD E+L   ++ V A +
Sbjct: 2155 TVLTLTLQDANDNAPRFLRPHYVAFLPESRPLEGPLLQVEADDLDQGSGGQISYSLAASQPARG----LFHVDPTTGTITTTAILDREIWAET-RLVLMATDRGSPALVGSATLTVMVIDTNDNRPTIP-QPWELRVSEDALLGSEI--------AQVTGNDVDSGPV---------LWYVLSPSG-----PQDPFSV---------GRYGGRVSLTGPLDFEQCDRYQLQLLAHDGPHEGRANLTVLVEDVNDNAPAFSQSLYQVMLLEHTPPGSAILS--VSATDRDSGANGHISYHLA-----SPADGFSVDPNNGTLFTIVGTVALGHDGSGAVDVVLEARDHGAPGRAARATVHVQLQDQNDHAPSFTLSHYRVAVTEDLPPGSTLLTLEATDADGSRSHAAVDYSI-ISGNWGRVFQLEPRLAEAGESAGPGPRALGCLVLLEPLDFESLTQYNLTVAAAD 2576          

HSP 8 Score: 98.2117 bits (243), Expect = 3.747e-19
Identity = 108/434 (24.88%), Postives = 189/434 (43.55%), Query Frame = 3
Query:  759 IEIEIEDLNDNVPKFNQLTYNANIDENKRDDKLI-KFTVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDADTHSNMIHCKLVDYNDLFYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRI-TISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQ---IYIGXXXXXXXXXXXXFPKPIIVTDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESH------YIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLRTRKPLDR 2027
            + + ++D+NDN P F        +  N      I      DPDSG N  VT  +      L+     F +      + L+  L     P   E  L A D G+P  +S  ++++ ++++   G   +F     S +  V +  G  A + V++V+    D      H      +  F L+  S +          L     +DRE+     L++  +S + +E  +Q T   ++ + I + N+++P  S+    + +        +V   F      TDRDSG NG+  + L+      DS  F I   +G++ T ++LD E ++ ++  +   D G  P +++ T+ + VLDLNDN+P F ++           V + V  G  + TLQA D D + +N  I Y++   G  S  F +  ++G+L T  PL R
Sbjct:  880 VRVLLDDVNDNSPAFPAPEDTVLLPPNTAPGTPIYTLRALDPDSGVNSRVTFTL------LAGGGGAFTVDPTTGHVRLMRPLGPSGGP-AHELELEARDGGSPPRTSHFRLRVVVQDVGTRGLAPRFN----SPTYRVDLPSGTTAGTQVLQVQAQAPDGGPITYHLAAEGASSPFGLEPQSGW----------LWVRAALDREAQELYILKVMAVSGSKAELGQQ-TGTATVRVSILNQNEHSPRLSEDPTFLAVAENQPPGTSVGRVF-----ATDRDSGPNGRLTYSLQQLS--EDSKAFRIHPQTGEVTTLQTLDREQQSSYQLLVQVQDGGSPPRSTTGTVHVAVLDLNDNSPTFLQASGAAGGGLPIQVPDRVPPGTLVTTLQAKDPD-EGENGTILYTLTGPG--SELFSLHPHSGELLTAAPLIR 1281          

HSP 9 Score: 92.4337 bits (228), Expect = 2.346e-17
Identity = 139/609 (22.82%), Postives = 242/609 (39.74%), Query Frame = 3
Query:  387 PTDPGTFFILIKILDQNDKAPQFSSIKRPFFKIPENVEVGKVIDLPMAVDSDSEKYSVRRYSLSYIYHLDQTHDFRLHVTNDNPPRPQLIVNSKLDYEKINKYVFRLFAYDFDEKSIGNSCSTTIEIEI--EDLNDNVPKFNQLTYNANIDE-----NKRDDKLIKFTVSDPDSGRNGIVTVNIV------DKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDADTHSNMIHCKLVDYNDLFYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPII---VTDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLRTRKPLDRETLESISIKVTAKNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAPKF 2165
            P    T  + + +LD ND AP F  +     ++PE+V  G ++    A D D+         ++Y         F L      P   +L   + LD E+   Y F + A D    +     STT+ + I   D+ND+ P F        +       +     L      D D+G N  +   +          D  +   ++    R+   L          D  LF   ++ATD G P+ S++  + + L+   + GP+          S+  +I E  P  + +V  R   A   +  I   ++  N+         F+   +     +++   +D E +    LR+ +   +S  +   T    L + ++D NDNAP F +  Y+  + E++         P++     D D G  G+  + L   +       F +D  +G I T   LD E   + R  ++A D+G   L  S+T+T+ V+D NDN P   +  +   V E+  +G +I  +   D D+      ++Y + P G     F + RY G +    PLD E  +   +++ A +      H     +   ++ + V DVNDNAP F
Sbjct: 1833 PALSATLLLTVTVLDANDHAPAFP-VPAYSVEVPEDVPAGTLLLQLQAHDPDAGANG----HVTYYLGAGTAGAFLLE-----PSSGELRTAAALDREQCPSYTFSVSAVD---GAAAGPLSTTVSVTITVRDVNDHAPTFPTSPLRLRLPRPGPSFSTPTLALATLRAEDRDAGANASILYRLAGTPPPGTTVDSYTGEIRV---ARSPVALG-------PRDRVLF---IVATDLGRPARSATGVIIVGLQGEAERGPRFP------RASSEATIRENAPPGTPIVSPRAVHAGGTNGPITYSILSGNE------KGTFSIQPSTGAITVRSAEGLDFEVS--PRLRLVLQ-AESGGAFAFTV---LTLTLQDANDNAPRFLRPHYVAFLPESRP-----LEGPLLQVEADDLDQGSGGQISYSLAASQ--PARGLFHVDPTTGTITTTAILDREIWAETRLVLMATDRGSPALVGSATLTVMVIDTNDNRPTIPQP-WELRVSEDALLGSEIAQVTGNDVDS---GPVLWYVLSPSGPQDP-FSVGRYGGRVSLTGPLDFEQCDRYQLQLLAHD----GPH-----EGRANLTVLVEDVNDNAPAF 2376          

HSP 10 Score: 88.9669 bits (219), Expect = 2.828e-16
Identity = 171/708 (24.15%), Postives = 265/708 (37.43%), Query Frame = 3
Query:  399 GTFFILIKILDQNDKAPQFSSIKRPFFKIPENVEVGKVIDLPMAVDSDSEKYSVRRYSLSYIYHLDQTHDFRLHVTNDNPPRPQLIVNSKLDYEKINKYVFRLFAYDFDEKSIGNSCSTTIEIEIEDLNDNVPKFNQLTYNAN-------IDENKRDDKLIKFTVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHL---KNLNDNGPKIKFKKLG--FSVSNSVSIIEGLPAHSLVVEVRVTDADTHSNMIHCKL--VDYNDLFYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPIIVTDRDS-----GLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITIN---VLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLRTRKPLDRETLESISIKVTAKNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAPKFIPRLNMKQKVEFIV---EQFVDGNTCTELPYTVQDIDDGGINGQNCCYTILENDYNKLFSLMTDTPSYICLQR-KPEKYQSYTVTLIARDR--PPNV 2438
            GT  + + IL+QN+ +P+ S     F  + EN   G  +    A D DS       YSL  +   + +  FR+H     P   ++     LD E+ + Y  +L     D  S   S + T+ + + DLNDN P F Q +  A         D       +      DPD G NG +   +     EL      F +  +   L     L     PH +  TL A DQG+P  S+S Q+ + +     L +  P +  +       V  +V+  EGL   SL+  V   +      + +  +   D    F LD+ S    L   +P + +           G   R  ++     P         + +Q++D N++AP F++                  P   + T R S     G N    + L   R         +D  +G +   R LD ET       + A D+        +        V D NDNAP F+    +  + E+   G     + A D D     + + Y +   GD   +F +   TG L   +PLDRE      + V A      S H      +   + + V DVND AP F       Q+ E+ V   E    G +   L  T  D+   G NGQ   Y  + ++    FSL  DT     L+    E+ +   +T+ A+DR  PP +
Sbjct: 1087 GTATVRVSILNQNEHSPRLSE-DPTFLAVAENQPPGTSVGRVFATDRDSGPNGRLTYSLQQLS--EDSKAFRIH-----PQTGEVTTLQTLDREQQSSY--QLLVQVQDGGSPPRSTTGTVHVAVLDLNDNSPTFLQASGAAGGGLPIQVPDRVPPGTLVTTLQAKDPDEGENGTILYTLTGPGSEL------FSLHPHSGELLTAAPLIRAERPH-YVLTLSAHDQGSPPRSASLQLLVQVLPSARLAEPPPDLAERDPAAPVPVVLTVTAAEGLRPGSLLGSVAAPEPAGVGALTYTLVGGADPEGTFALDAAS--GRLYLARPLDFEA----------GPPWR-ALTVRAEGPGGAGARLLRVQVQVQDENEHAPAFARD------PLALALPENPEPGAALYTFRASDADGPGPNSDVRYRL--LRQEPPVPALRLDARTGALSAPRGLDRETTPALLLLVEATDRPANASRRRAARVSARVFVTDENDNAPVFASPSRV-RLPEDQPPGPAALHVVARDPDLGEAAR-VSYRLASGGD--GHFRLHSSTGALSVVRPLDREQRAEHVLTVVA------SDHGSPPRSATQVLTVSVADVNDEAPTF-------QQQEYSVLLRENNPPGTSLLTLRATDPDV---GANGQ-VTYGGVSSES---FSLDPDTGVLTTLRALDREEQEEINLTVYAQDRGSPPQL 1732          

HSP 11 Score: 80.4925 bits (197), Expect = 9.307e-14
Identity = 150/604 (24.83%), Postives = 244/604 (40.40%), Query Frame = 3
Query:  411 ILIKILDQNDKAPQFSSIKRPFFK--IPENVEVGKVIDLPMAVDSDSEKYSVRRYSLSYIYHLDQTHDFRLHVTNDNPPRPQLIVNSKLDYEKINKYVFRLFAYDFDEKSIGNSCSTTIEIEIEDLNDNVPKFNQLTYNANIDENKR-DDKLIKFTVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVS-NSVSIIEGLPAHSLVVEVRVTDADTHSN-MIHCKLVDYNDLFYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTD-SEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPIIVTDRD-------------SGLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLRTRKPLDRETLESISIKVTAKNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAPKF 2165
            + + + D ND AP+F    RP +   +PE+  +   +    A D D        YSL+      Q      HV   +P    +   + LD E   +    L A D    ++  S   T+ + + D NDN P   Q  +   + E+     ++ + T +D DSG      ++     D        F + R    + L   LD+E     ++  LLA D         A + + ++++NDN P        FS S   V ++E  P  S ++ V  TD D+ +N  I   L    D F +D  +   TL          +  +    +    + + +   D   P R      ++++Q++D ND+AP F+   Y   V E+           +  TD D             SG  G+  F LE     +  S     +  G +     LD+E+  ++   + A D+G  P +S   +T+ VLD+NDN P F+ + Y   V E+  VG ++  ++A   D D     +       GD S  F++D  +G LR    LD ET     + V A +P    +HF     +   V I+V DVND+ P F
Sbjct: 2157 LTLTLQDANDNAPRFL---RPHYVAFLPESRPLEGPLLQVEADDLDQGSGGQISYSLA----ASQPARGLFHV---DPTTGTITTTAILDREIWAETRLVLMATDRGSPALVGS--ATLTVMVIDTNDNRPTIPQ-PWELRVSEDALLGSEIAQVTGNDVDSGPVLWYVLSPSGPQDP-------FSVGRYGGRVSLTGPLDFEQCDR-YQLQLLAHDG---PHEGRANLTVLVEDVNDNAP-------AFSQSLYQVMLLEHTPPGSAILSVSATDRDSGANGHISYHLASPADGFSVDPNN--GTLFT-------IVGTVALGHDGSGAVDVVLEARDHGAPGR--AARATVHVQLQDQNDHAPSFTLSHYRVAVTEDLPPGSTLLT--LEATDADGSRSHAAVDYSIISGNWGRV-FQLEPRLAEAGESAGPGPRALGCLVLLEPLDFESLTQYNLTVAAADRGQPPQSSVVPVTVTVLDVNDNPPVFTRASYRVTVPEDTPVGAELLHVEA--SDADPGPHGLVRFTVSSGDPSGLFELDESSGTLRLAHALDCETQARHQLVVQAADPA--GAHF-----ALAPVTIEVQDVNDHGPAF 2706          

HSP 12 Score: 79.337 bits (194), Expect = 2.295e-13
Identity = 109/480 (22.71%), Postives = 198/480 (41.25%), Query Frame = 3
Query:  750 STTIEIEIEDLNDNVPKFNQLTYNANIDENKRDDKLIKFTVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDADT--HSNMIHCKLVDYNDLFYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDN--APMFSQQIYIGXXXXXXXXXXXXFPKPIIVTDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPL---TSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLRTRKPLDRETLESISIKVTAKNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAPKFI 2168
            S  ++I I       P F QL Y  ++ E+      +    +    GR   VT+++            +F +      L+ +  LD E    + E  + A   G P   + A+V++ L ++NDN P   F     +V    +   G P ++L    R  D D+  +S +    L      F +D  +    L+     +    ++++ E+  G             P R  T++  L + ++DV     AP F+   Y        +         ++     +   G   ++L        SS F ++  SG ++ + +LD E +  +  K++A+      L   T ++T+ +++L+ N+++PR SE      V EN   G  +G + A D D+   N  + YS++   + S  F I   TG++ T + LDRE   S  + V  ++         R+T   V V   V+D+NDN+P F+
Sbjct:  773 SARVDISIVPGTPTPPIFEQLQYVFSVPEDVAPGTSVGIVQAHNPPGRLAPVTLSLSGGDPR-----GLFSLDAVSGLLQTLRPLDRELLGPVLELEVRA-GSGVPPAFAVARVRVLLDDVNDNSPA--FPAPEDTVLLPPNTAPGTPIYTL----RALDPDSGVNSRVTFTLLAGGGGAFTVDPTTGHVRLMRPLGPSGGPAHELELEARDGG-----------SPPR--TSHFRLRVVVQDVGTRGLAPRFNSPTY-----RVDLPSGTTAGTQVLQVQAQAPDGGPITYHLA---AEGASSPFGLEPQSGWLWVRAALDREAQELYILKVMAVSGSKAELGQQTGTATVRVSILNQNEHSPRLSEDPTFLAVAENQPPGTSVGRVFATDRDSG-PNGRLTYSLQQLSEDSKAFRIHPQTGEVTTLQTLDREQQSSYQLLVQVQDGGSPP----RSTTGTVHV--AVLDLNDNSPTFL 1212          

HSP 13 Score: 66.2402 bits (160), Expect = 2.103e-9
Identity = 121/553 (21.88%), Postives = 222/553 (40.14%), Query Frame = 3
Query:  705 LFAYDFDEKSIGNSCSTTIEIEIEDLNDNVPKFNQLTYNANIDENKRDDKLIKFTVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINS--LDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSII-EGLPAHSLVVEVRVTDADTHSNMIHCKLVDYNDLFYLDSPSKFNTLLNYKPFNLKTINK--IDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPIIVTDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLRT---RKPLDRETLESISIKVTAKNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAPKFIPRLNMKQKVEFIVEQFVDGNTCTELPYTVQDIDDGGINGQNCCYTILENDYNKLFSL 2339
            LF    D      S +  I + ++   +  P+F + +  A I EN      I    +    G NG +T +I+   ++ +     F IQ +   + + ++  LD+E  P L    L A   G  + +    + + L++ NDN P+       F   + V+ + E  P    +++V   D D  S       + Y+    L +      L +  P          +DRE    +  R+ +  TD   S  +  + +L + + D NDN P   Q   +   ++  +   +     +   D DSG      +Y+       D   F + +  G++     LD+E  ++++ +++A D    P    + +T+ V D+NDNAP FS+S Y   + E+   G  I ++ A D D+   N  I Y +    D    F +D   G L T      L  +   ++ + + A++      H      +   V +++ D ND+AP F     +      + E    G+T   L  T     DG  +     Y+I+  ++ ++F L
Sbjct: 2036 LFIVATDLGRPARSATGVIIVGLQGEAERGPRFPRASSEATIRENAPPGTPIVSPRAVHAGGTNGPITYSILSGNEKGT-----FSIQPSTGAITVRSAEGLDFEVSPRL-RLVLQAESGGAFAFTV---LTLTLQDANDNAPR-------FLRPHYVAFLPESRPLEGPLLQVEADDLDQGSG----GQISYS----LAASQPARGLFHVDPTTGTITTTAILDREI--WAETRLVLMATD-RGSPALVGSATLTVMVIDTNDNRPTIPQPWELRVSEDALLGSEI---AQVTGNDVDSG---PVLWYVLSPSGPQDP--FSVGRYGGRVSLTGPLDFEQCDRYQLQLLAHDG---PHEGRANLTVLVEDVNDNAPAFSQSLYQVMLLEHTPPGSAILSVSATDRDSG-ANGHISYHLASPADG---FSVDPNNGTLFTIVGTVALGHDGSGAVDVVLEARD------HGAPGRAARATVHVQLQDQNDHAPSF----TLSHYRVAVTEDLPPGSTLLTLEATDA---DGSRSHAAVDYSIISGNWGRVFQL 2533          
BLAST of Protocadherin Fat 1 vs. UniProt/SwissProt
Match: sp|E9PVD3|PCD16_MOUSE (Protocadherin-16 OS=Mus musculus OX=10090 GN=Dchs1 PE=1 SV=1)

HSP 1 Score: 193.356 bits (490), Expect = 2.899e-48
Identity = 181/618 (29.29%), Postives = 279/618 (45.15%), Query Frame = 3
Query:  372 FQYLTPTDPGTFFILIKILDQNDKAPQFSSIKRPFFKIPENVEVGKVIDLPMAVDSDSEKYSVRRYSLSYIYHLDQTHDFRLHVTNDNP---PRPQLIVNSKLDYEKINKYVFRLFAYDFDEKSIGNSCSTTIEIEIEDLNDNVPKFNQLTYNANIDEN-KRDDKLIKFTVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDAD----THSNMI------HCKLVDYNDLFYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPIIVTDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEP--KGDHSSYFDIDRYTGDLRTRKPLDRET-LESISIKVTAKNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAPKFIPR 2174
            F  +TP D  T  + +++ D ND AP F    R   +IPE+  +G    L  A D+D+ +   + Y+LS          FRL  T   P   P P+L++  +LD E  + Y+ +L AYD    S        +++ + D+ND+ P FNQ  Y+A + E+      +++   SD D+G NG VT  I  +  E    F    I  +  FL L   LD+E    + E  + A D G      SA V +H+++ NDN P +    +  S   S  + E  P   LV  + V+D D     H N+       H  L   + + YL   ++                ++DRE      LR+T + + S P R      +  + + DVNDNAP F +Q+Y       +V +  +F   +   D D G NG+  + L      + +  F ID  SG I T  +LDYE + + +  ++A D G  PL SS+T+++ + D+NDN P+F  + Y  ++ E    G     + A D D+      + YS+        S  F ID ++GD+ T + LDR+    S    VTA +             S V V + V D NDN P+F PR
Sbjct:  111 FTAVTP-DGATVEVTVRVADINDHAPAFPQ-ARAALQIPEHTALGTRYPLEPARDADAGRLGTQGYALS---GDGAGETFRLE-TRPGPGGAPVPELVIAGELDRENRSHYMLQLEAYD--GGSPPRRAQALLDVTLLDINDHAPAFNQSRYHAVVSESLAPGSPVLQVFASDADAGANGAVTYEINRRQSEGDGPF---SIDAHTGFLRLERPLDFEQR-RVHELVVQARDGGAHPELGSAFVTVHVRDANDNQPSMTV--IFLSADGSPRVSEAAPPGQLVARISVSDPDDGDFAHVNVSLEGGEGHFALSTQDSVIYLVCVAR----------------RLDREERDVYNLRVTATDSGSPPLR---AEAAFVLHVTDVNDNAPAFDRQLY-RPEPLPEVALPGSFVVRVTARDPDQGTNGQITYSLAPG---THTHWFSIDPTSGIITTAATLDYELEPQPQLIVVATDGGLPPLVSSATVSVALQDVNDNEPQFQRTFYNASLPEGTQPGTCFLQVTATDADSGPFGL-LSYSLGAGLGASGSPPFRIDAHSGDVCTTRTLDRDQGPSSFDFTVTAIDGG--------GLKSMVYVKVFVADENDNPPQFYPR 682          

HSP 2 Score: 124.79 bits (312), Expect = 3.094e-27
Identity = 148/600 (24.67%), Postives = 246/600 (41.00%), Query Frame = 3
Query:  411 ILIKILDQNDKAPQFSSIKRPF-FKIPENVEVGKVIDLPMAVDSDSEKYSVRRYSLSYIYHLDQTHDFRLHVTNDNPPRPQLIVNSK---------LDYEKINKYVFRLFAYDFDEKSIGNSCSTTIEIE-IEDLNDNVPKFNQLTYNANIDENKRDDKLIKFTVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDADTHSNMIHCKLVDYNDLFYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPIIV---TDRDSGLNGKFEFYLEDFRNFSDSSD-FLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLRTRKPLDRETLESISIKVTAKNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAPKF 2165
            + +++ D+N+ AP F+  + P    +PEN + G  +    A D+D                     + R  +    PP P L ++++         LD E     +  + A D    +     +       + D NDN P F   +     ++       +     DPD G    V+  +    D        F +      L ++  LD E        T++A D G+P  SS+  + + + ++ND  P    ++       +V + E  P  + ++ ++ TD D  +N      V Y  +    S   F+  L+     L T+  +DRE     +L +        P   + T+ ++ + +ED ND+ P F      GN   +        P+ +     +D D GLNG+ ++ + D     DSS  F +D  SG+  T R LD E +  F+ +I A D G   L+++  +T+ VLD ND+AP F    Y   V E+  VG  +  LQA D D D  N  + Y +      +  F ++  +G+L T   LDRE   S +  VTA +             + V + I V DVND+AP F
Sbjct: 1415 VQVRVQDENEHAPTFA--RDPLALALPENPDPGATLYTFRASDADGP---------------GPNSEVRYRLLRQEPPVPALRLDARTGALSAPRGLDRETTPALLLLVEATDRPANASRRRAARVSARVFVTDENDNAPVFASPSRVRLPEDQPPGPAALHVVARDPDLGEAARVSYRLAAGGD------GHFRLHATTGALSVVRPLDREQRAEHV-LTVVALDHGSPPRSSTQLLTVSVVDVNDEAPAFPQQEY------NVILRENSPPGTSLLTLKATDPDLGAN----GQVTYGGV----SGESFS--LDPNTGVLTTLRALDREEQEEIYLTVYARDRGLPP---LLTHITVRVTVEDENDHTPTF------GNTHLSLEVPEGQDPQTLTTLRASDPDGGLNGQLQYRILD----GDSSGAFALDLTSGEFGTMRPLDREVEPAFQLQIEARDGGQPALSATLLVTVTVLDANDHAPVFPVPSYSVEVPEDAPVGTLLLQLQAHDPD-DGDNGRVMYYL--GAGTAGAFLLEPTSGELSTATALDREHCASYAFSVTAVDGAAAGP-----LSTTVPITITVRDVNDHAPAF 1953          

HSP 3 Score: 120.553 bits (301), Expect = 6.616e-26
Identity = 145/544 (26.65%), Postives = 233/544 (42.83%), Query Frame = 3
Query:  423 ILDQNDKAPQFSSIKRPFFKIPENVEVGKVIDLPMAVDSDSEKYSVRRYSLSYIYHLDQTHDFRLHVTNDNPPRPQLIVNSKLDYEKINKYVFRLFAYDFDEKSIGNSCSTTIEIEIEDLNDNVPKFNQLTYNANIDENKR-DDKLIKFTVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDADTHSN-MIHCKLVDYNDLFYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTDS-EPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPIIVTDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQ-PLTSSSTITINVLDLNDNAPRFSESHYIFNV------FENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLR-TRKPL 2021
            + D+ND AP F+S  R   ++PE+   G      +A D D  + +   Y L+          FRLH T        L V   LD E+  ++V  + A   D  S   S +  + + + D+ND  P F Q  YN  + EN      L+    +DPD G NG VT   V            F +  N   L  + +LD E    ++  T+ A D+G P L +   V++ +++ ND+ P      L      S+ + EG    +L   +R +D D   N  +  +++D       DS   F   L    F   T+  +DRE       ++ I   D  +P+  ++    + + + D ND+AP+F    Y  +V+  +   V      +   D D G NG+  +YL        +  FL++  SG++ T  +LD E    + F + A+D     PL+++  ITI V D+ND+AP F  S     +          ++   + TL+A D D    N  I Y +   G       +D YTG++R  R P+
Sbjct: 1529 VTDENDNAPVFASPSR--VRLPEDQPPGPAALHVVARDPDLGEAARVSYRLA----AGGDGHFRLHATTG-----ALSVVRPLDREQRAEHVLTVVA--LDHGSPPRSSTQLLTVSVVDVNDEAPAFPQQEYNVILRENSPPGTSLLTLKATDPDLGANGQVTYGGVSGES--------FSLDPNTGVLTTLRALDREEQEEIY-LTVYARDRGLPPLLTHITVRVTVEDENDHTPTFGNTHL------SLEVPEGQDPQTLTT-LRASDPDGGLNGQLQYRILDG------DSSGAFALDLTSGEFG--TMRPLDREVEPA--FQLQIEARDGGQPA--LSATLLVTVTVLDANDHAPVFPVPSY--SVEVPEDAPVGTLLLQLQAHDPDDGDNGRVMYYL----GAGTAGAFLLEPTSGELSTATALDREHCASYAFSVTAVDGAAAGPLSTTVPITITVRDVNDHAPAFPTSPLRLRLPRPGPSLNKPTLA--LATLRAEDRDAG-ANASILYRL--AGTPPPGTTVDSYTGEIRVARSPV 2020          

HSP 4 Score: 120.168 bits (300), Expect = 7.769e-26
Identity = 149/610 (24.43%), Postives = 254/610 (41.64%), Query Frame = 3
Query:  384 TPTDPGTFFILIKILDQNDKAPQFSSIKRPF-FKIPENVEVGKVIDLPMAVDSDSEKYSVRRYSLSYIYHLDQTHDFRLHVTNDNPPRPQ-----------LIVNSKLDYEKINKYVFRLFAYDFDEKSIGNSCSTTIEIEIEDLNDNVPKFNQLTYNANIDENKR-DDKLIKFTVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDAD---THSNMIHCKLVDYN-------DLFYLD------------SPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTD-SEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPIIVTDRDSGLNGKFEFYLEDFRNFSDSSD----FLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIE--PKGDHSSYFDIDRYTGDLRTRKPLDRETLESISIKVTAKNPNKYSS 2087
            +P   G+  + + ++D ND  P   +I +P+  ++ E+  +G  I      D DS    V  Y LS                   P  PQ           + +   LD+E+ + Y  +L A+D   +   N     + + +ED+NDNVP F+Q  Y   + E+      ++  + +D DSG NG ++ ++       ++ F++       F      +L +E  P + +  L A D G P  ++ A V + LK+ ND+ P         +VS      E LP  S ++ +  TDAD   TH+       VDY+        +F L+             P     L+  +P + +++ + +          +T++  D  +P R  ++   + + + DVNDN P+F++  Y   V E+           +  +D D G +G   F L        S D    F +D+ SG +   R LD ET+ + +  + A D       S   +T+ V D+ND+ P F  S    ++ EN   G  + TL AID D     +  +  +E  P  +    F ++  TG+LR R P D E   S  + V A +    S+
Sbjct: 2247 SPALVGSATLTVMVIDTNDNRP---TIPQPWELRVSEDALLGSEIAQVTGNDVDSG--PVLWYVLS-------------------PSGPQDPFSIGRYGGRVSLTGPLDFEQCDHYHLQLLAHDGPHEGHAN-----LTVLVEDVNDNVPTFSQSLYQVMMLEHTPPGSAILSVSATDRDSGANGHISYHLASP----AEGFRVDPNNGTLFTTVGAMALGHE-GPGVVDVVLEARDHGAPGRTAQATVHVQLKDQNDHAPSFTLPHYRVAVS------EDLPPGSTLLTLEATDADGSRTHAT------VDYSIISGNRGRVFQLEPRLAEVGDGVGPGPQALGCLVLLEPLDFESLTQYN----------LTVAAADRGQPPR--SSAVPVTVTVLDVNDNPPVFTRASYRVTVPEDMPVGAELLH--VEASDADPGPHGLVHFTLS-------SGDPLGLFELDENSGALRLSRPLDCETQAQHQLVVQAADPAGTHF-SLVPVTVEVQDVNDHGPAFPLSLLSTSLAENQPPGTLVTTLHAIDGDAGTFGRLRYSLLEAVPGPEGREAFSLNSSTGELRARVPFDYEHTGSFRLLVGAADAGNLSA 2788          

HSP 5 Score: 114.005 bits (284), Expect = 5.997e-24
Identity = 136/601 (22.63%), Postives = 251/601 (41.76%), Query Frame = 3
Query:  399 GTFFILIKILDQNDKAPQFSSI-----KRPFFKIPENVEVGKVIDLPMAVDSDSEKYSVRRYSLSYIYHLDQTHDFRLHVTNDNPPRPQLIVNSKLDYEKINKYVFRLFAYDFDEKSIGNSCSTTIEIEIEDLNDNVPKFNQLTYNAN-IDENKRDDK-LIKFTVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDADTHSNMIHCKLVDYNDLFYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPIIVTDRDSGLNGKFEFYLEDFRNFSDSSD--FLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLRTRKPLDRETLESI---SIKVTAKNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAPKF 2165
            G+ F+ + + D ND  P  + I       P  ++ E    G+++      D D   ++    SL       +  +    ++  +     + V  +LD E+ + Y  R+ A D     +         + + D+NDN P F++  Y    + E       +++ T  DPD G NG +T ++   T         F I      +    +LDYE +P   +  ++ATD G P L SSA V + L+++NDN P+  F++  ++ S    + EG    +  ++V  TDAD+        L+ Y+    L +       ++    ++ T   +DR+    SF   T++  D    + +     + + + D NDN P F  + Y  ++              +   D D G +G+  +++      + +S   F +D  SG +     L     +  + +I A D G       + + I+++      P F +  Y+F+V E+V+ G  +G +QA +         +  S    GD    F +D  +G L+T +PLDRE L  +    ++  +  P  ++   +R         + + DVNDN+P F
Sbjct:  338 GSAFVTVHVRDANDNQPSMTVIFLSADGSP--RVSEAAPPGQLVARISVSDPDDGDFAHVNVSL-------EGGEGHFALSTQDSVIYLVCVARRLDREERDVYNLRVTATDSGSPPL--RAEAAFVLHVTDVNDNAPAFDRQLYRPEPLPEVALPGSFVVRVTARDPDQGTNGQITYSLAPGTHT-----HWFSIDPTSGIITTAATLDYELEPQP-QLIVVATDGGLPPLVSSATVSVALQDVNDNEPQ--FQRTFYNAS----LPEGTQPGTCFLQVTATDADSGP----FGLLSYSLGAGLGASGSPPFRIDAHSGDVCTTRTLDRDQGPSSF-DFTVTAIDGGGLKSMVY---VKVFVADENDNPPQFYPREYAASLSAQSTPGTAVLR--VHAHDPDQGPHGRLSYHI-----LAGNSPPLFALDAHSGLLTVAWPLGRRANSVVQLEIGAQDGGGLQAEPIARVNISIVPGTPTPPIFEQLQYVFSVPEDVAPGTSVGIIQAHNPPGRLGPVTLTLS---GGDPRGLFSLDSPSGLLKTLRPLDRELLGPVLELEVRAGSGTPPVFAVARIR---------VLLDDVNDNSPAF 888          

HSP 6 Score: 111.694 bits (278), Expect = 3.197e-23
Identity = 124/491 (25.25%), Postives = 207/491 (42.16%), Query Frame = 3
Query:  753 TTIEIEIEDLNDNVPKFNQLTYNANIDENKR-DDKLIKFTVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDADTHSNMIHCKLVDYNDLFYLDSPSKFNTLLNYKPFN--LKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPIIVTDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFTQ---RSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDID--------------RYTGDLRTRKPLDRETLESISIKVTAKNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAPKF 2165
            + + + ++D NDN P+F +  Y A + E++  +  L++    D D G  G ++ ++            +F +      +     LD E         L+ATD+G+P+L  SA + + + + NDN P I  +     VS    +   +         +VT  D  S  +         L+Y+ SPS      +   +   +     +D E      L++       E       + +L + +EDVNDN P FSQ +Y   + E+           +  TDRDSG NG   ++L      S +  F +D  +G +FT     +L +E        + A D G    T+ +T+ + + D ND+AP F+  HY   V E++  G  + TL+A D D  R +  + YSI   G+    F ++              +  G L   +PLD E+L   ++ V A +  +          S V V + V+DVNDN P F
Sbjct: 2148 SVLTLTLQDANDNAPRFLRPHYVAFLPESRPLEGPLLQVEADDLDQGSGGQISYSLAASQPARG----LFHVDPATGTITTTAILDREIWAET-RLVLMATDRGSPALVGSATLTVMVIDTNDNRPTIP-QPWELRVSEDALLGSEI--------AQVTGNDVDSGPV---------LWYVLSPSGPQDPFSIGRYGGRVSLTGPLDFEQCDHYHLQLLAHDGPHE------GHANLTVLVEDVNDNVPTFSQSLYQVMMLEHTPPGSAILS--VSATDRDSGANGHISYHLA-----SPAEGFRVDPNNGTLFTTVGAMALGHEGPGVVDVVLEARDHGAPGRTAQATVHVQLKDQNDHAPSFTLPHYRVAVSEDLPPGSTLLTLEATDADGSRTHATVDYSI-ISGNRGRVFQLEPRLAEVGDGVGPGPQALGCLVLLEPLDFESLTQYNLTVAAADRGQPPR------SSAVPVTVTVLDVNDNPPVF 2595          

HSP 7 Score: 102.449 bits (254), Expect = 1.966e-20
Identity = 111/434 (25.58%), Postives = 192/434 (44.24%), Query Frame = 3
Query:  759 IEIEIEDLNDNVPKFNQLTYNANIDENKRDDKLI-KFTVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDADTHSNMIHCKLVDYNDLFYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRI-TISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQ---IYIGXXXXXXXXXXXXFPKPIIVTDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESH------YIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLRTRKPLDR 2027
            I + ++D+NDN P F        + +N      I      DPDSG N  +T N++   D L      F +      + L+  L         E  + A D G+P  +S  ++++ +++L  +G   +F     S +  V +  G    + +++V+    D      H      +  F L+S S +          L     +DRES     L++  +S + +E  +Q T   ++ + I + ND++P  S++   + +        +V   F      TDRDSG NG+  + L+      DS  F I   +G++ T ++LD E ++ F+  +   D G  P +++ T+ + VLDLNDN+P F ++           V + V  G  + TLQA D D + +N  I Y++   G  S  F +  +TG+L T   L R
Sbjct:  874 IRVLLDDVNDNSPAFPAPEDTVLLPQNTAPGTPIYTLRALDPDSGANSRITFNLLAGGDGL------FTVDPTTGHVRLMGPLG-PPGGPAHELEVEARDGGSPPRTSHFRLRVVIQDLGIHGLAPRFD----SPTYRVDLPSGTTTGTQILQVQAQAPDGSPVTYHLAADGASSPFGLESQSGW----------LWVRTALDRESQELYTLKVMAVSGSKAELGQQ-TGTATVRVIILNQNDHSPRLSEEPTFLAVAENQPPGTSVGRVF-----ATDRDSGPNGRLTYSLQQLS--EDSKAFRIHPQTGEVTTLQTLDREQQSSFQLLVQVQDGGSPPRSATGTVHVAVLDLNDNSPTFLQASGAAGGGLPIQVPDRVPPGTLVTTLQAKDPD-EGENGTILYTLTGPG--SELFSLHPHTGELHTAASLVR 1275          

HSP 8 Score: 100.523 bits (249), Expect = 8.333e-20
Identity = 147/609 (24.14%), Postives = 247/609 (40.56%), Query Frame = 3
Query:  411 ILIKILDQNDKAPQFSSIKRPFFK--IPENVEVGKVIDLPMAVDSDSEKYSVRRYSLSYIYHLDQTHDFRLHVTNDNPPRPQLIVNSKLDYEKINKYVFRLFAYDFDEKSIGNSCSTTIEIEIEDLNDNVPKFNQLTYNANIDENKR-DDKLIKFTVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVS-NSVSIIEGLPAHSLVVEVRVTDADTHSNMIHCKLVDYNDLFYLDSPSKFNTLLNYKPFN---LKTINKIDRESNHGSFLRITISCTD-SEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPIIVTDRDSGLNGKFEFYLEDFRNFSDSSDFLID----------------KISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLRTRKPLDRETLESISIKVTAKNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAPKF 2165
            + + + D ND AP+F    RP +   +PE+  +   +    A D D        YSL+      Q      HV   +P    +   + LD E   +    L A D    ++  S   T+ + + D NDN P   Q  +   + E+     ++ + T +D DSG      ++     D        F I R    + L   LD+E   H +   LLA D         A + + ++++NDN P        FS S   V ++E  P  S ++ V  TD D+ +N  H         ++L SP++        P N     T+  +         + + +   D   P R  T   ++++Q++D ND+AP F+   Y               P   ++T   +  +G       D+   S +   +                  +  G +     LD+E+  ++   + A D+G  P +S+  +T+ VLD+NDN P F+ + Y   V E++ VG ++  ++A   D D     + +     GD    F++D  +G LR  +PLD ET     + V A +P    +HF     S V V ++V DVND+ P F
Sbjct: 2150 LTLTLQDANDNAPRFL---RPHYVAFLPESRPLEGPLLQVEADDLDQGSGGQISYSLA----ASQPARGLFHV---DPATGTITTTAILDREIWAETRLVLMATDRGSPALVGS--ATLTVMVIDTNDNRPTIPQ-PWELRVSEDALLGSEIAQVTGNDVDSGPVLWYVLSPSGPQDP-------FSIGRYGGRVSLTGPLDFEQCDH-YHLQLLAHDG---PHEGHANLTVLVEDVNDNVPT-------FSQSLYQVMMLEHTPPGSAILSVSATDRDSGANG-HIS-------YHLASPAEG---FRVDPNNGTLFTTVGAMALGHEGPGVVDVVLEARDHGAPGR--TAQATVHVQLKDQNDHAPSFTLPHY------RVAVSEDLPPGSTLLTLEATDADGSRTHATVDYSIISGNRGRVFQLEPRLAEVGDGVGPGPQALGCLVLLEPLDFESLTQYNLTVAAADRGQPPRSSAVPVTVTVLDVNDNPPVFTRASYRVTVPEDMPVGAELLHVEA--SDADPGPHGLVHFTLSSGDPLGLFELDENSGALRLSRPLDCETQAQHQLVVQAADPA--GTHF-----SLVPVTVEVQDVNDHGPAF 2699          

HSP 9 Score: 92.0485 bits (227), Expect = 3.021e-17
Identity = 156/677 (23.04%), Postives = 265/677 (39.14%), Query Frame = 3
Query:  384 TPTDPGTFFILIKILDQNDKAPQFSSIKRPF-----FKIPENVEVGKVIDLPMAVDSDSEKYSVRRYSLSYIYHLDQTHDFRLHVTNDNPPRPQLIVNSKLDYEKINKYVFRLFAYDFDEKSIGNSCSTTIEIEI--------------EDLNDNVPKFNQLTYNANIDENKRDDKLIKFTVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDAD--THSNMIHCKLVDYNDLFYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKP----IIVTDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLRTRKPLDRETLESISIKVTAKNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAPKFIPRLNMKQKVEFIVEQFVDGNTCTELPYTVQDIDDGGINGQNCCYTILENDYNKLFSL 2339
            +P    T  + + +LD ND +P F             ++P+ V  G ++    A D D  +     Y+L+       +  F LH     P   +L   + L   +   YV  L A+  D+ S   S S  + +++               D    VP    +       E  R   L+  +V+  +    G++T  +V   D        F +      L L   LD+E  P     T+ A   G    +   +V++ +++ N++ P      L  ++  +       P  +L    R +DAD    ++ +  +L+          P      L+ +   L     +DRE+     L +  +   +  SR+     S  + + D NDNAP+F+    +   ++         P P    ++  D D G   +  + L           F +   +G +   R LD E + +    ++A+D G  P +S+  +T++V+D+ND AP F +  Y   + EN   G  + TL+A D D    N  + Y     G     F +D  TG L T + LDRE  E I + V A++        +    + + V + V D ND+ P F    N    +E  V +  D  T T L  +     DGG+NGQ   Y IL+ D +  F+L
Sbjct: 1182 SPPRSATGTVHVAVLDLNDNSPTFLQASGAAGGGLPIQVPDRVPPGTLVTTLQAKDPDEGENGTILYTLTG----PGSELFSLH-----PHTGELHTAASLVRAERPHYVLTLSAH--DQGSPPRSASLQLLVQVLPSTRVVESPDLIEADSAATVP----VVLTVTAAEGLRPGSLLG-SVAPQEPASVGVLTYTLVGGADPEGT----FALDSASGRLYLARPLDFEAGPAWRALTVRAEGPGGAG-ARLLRVQVRVQDENEHAPTFARDPLALALPENPD-----PGATLYT-FRASDADGPGPNSEVRYRLLR-------QEPPVPALRLDARTGALSAPRGLDRETTPALLLLVEATDRPANASRRRAARVSARVFVTDENDNAPVFASPSRVRLPEDQP-------PGPAALHVVARDPDLGEAARVSYRLAA----GGDGHFRLHATTGALSVVRPLDREQRAEHVLTVVALDHGSPPRSSTQLLTVSVVDVNDEAPAFPQQEYNVILRENSPPGTSLLTLKATDPDLG-ANGQVTYG----GVSGESFSLDPNTGVLTTLRALDREEQEEIYLTVYARDRG------LPPLLTHITVRVTVEDENDHTPTF---GNTHLSLE--VPEGQDPQTLTTLRASDP---DGGLNGQ-LQYRILDGDSSGAFAL 1793          

HSP 10 Score: 88.5817 bits (218), Expect = 3.704e-16
Identity = 140/612 (22.88%), Postives = 241/612 (39.38%), Query Frame = 3
Query:  387 PTDPGTFFILIKILDQNDKAPQFSSIKRPFFKIPENVEVGKVIDLPMAVDSDSEKYSVRRYSLSYIYHLDQTHDFRLHVTNDNPPRPQLIVNSKLDYEKINKYVFRLFAYDFDEKSIGNSCSTT--IEIEIEDLNDNVPKFNQLTYNANIDE-----NKRDDKLIKFTVSDPDSGRNGIVTVNIV------DKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSII-EGLPAHSLVVEVRVTDADTHSNMIHCKLVDYND--LFYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPII---VTDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLRTRKPLDRETLESISIKVTAKNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAPKF 2165
            P    T  + + +LD ND AP F  +     ++PE+  VG ++    A D D        Y L           F L      P   +L   + LD E    Y F + A D    +     STT  I I + D+ND+ P F        +       NK    L      D D+G N  +   +          D  +   ++    R+   L          D  LF   ++ATD G P+ S++  V + ++   + GP+       F  ++S +++ E  P  + V+  +   +   +  I   ++  N+  +F +   +   T+ + +  + +T  +          LR+ +       S        L + ++D NDNAP F +  Y+  + E++         P++     D D G  G+  + L   +       F +D  +G I T   LD E   + R  ++A D+G   L  S+T+T+ V+D NDN P   +  +   V E+  +G +I  +   D D+      ++Y + P G     F I RY G +    PLD E  +   +++ A +      H     +   ++ + V DVNDN P F
Sbjct: 1826 PALSATLLVTVTVLDANDHAPVFP-VPSYSVEVPEDAPVGTLLLQLQAHDPDDGDNGRVMYYLG----AGTAGAFLLE-----PTSGELSTATALDREHCASYAFSVTAVD---GAAAGPLSTTVPITITVRDVNDHAPAFPTSPLRLRLPRPGPSLNKPTLALATLRAEDRDAGANASILYRLAGTPPPGTTVDSYTGEIRV---ARSPVALG-------PQDRVLF---IVATDLGRPARSATGVVVVGIQGEPERGPR-------FPRTSSEAVLRENAPPGTPVISPKAVHSGGSNGPITYSILSGNERGIFSIQPSTGAITVRSAEGLDFETSPR----------LRLVLQAE----SGGAFAFSVLTLTLQDANDNAPRFLRPHYVAFLPESRP-----LEGPLLQVEADDLDQGSGGQISYSLAASQ--PARGLFHVDPATGTITTTAILDREIWAETRLVLMATDRGSPALVGSATLTVMVIDTNDNRPTIPQP-WELRVSEDALLGSEIAQVTGNDVDS---GPVLWYVLSPSGPQDP-FSIGRYGGRVSLTGPLDFEQCDHYHLQLLAHD----GPH-----EGHANLTVLVEDVNDNVPTF 2369          

HSP 11 Score: 87.4261 bits (215), Expect = 7.719e-16
Identity = 170/704 (24.15%), Postives = 268/704 (38.07%), Query Frame = 3
Query:  399 GTFFILIKILDQNDKAPQFSSIKRPFFKIPENVEVGKVIDLPMAVDSDSEKYSVRRYSLSYIYHLDQTHDFRLHVTNDNPPRPQLIVNSKLDYEKINKYVFRLFAYDFDEKSIGNSCSTTIEIEIEDLNDNVPKFNQLTYNAN-------IDENKRDDKLIKFTVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHL---KNLNDNGPKIKFKKLG-FSVSNSVSIIEGLPAHSLVVEVRVTDADTHSNMIHCKL--VDYNDLFYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPIIVTDRDSGLNG---KFEFYLEDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITIN---VLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLRTRKPLDRETLESISIKVTA---KNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAPKFIPRLNMKQKVEFIV-EQFVDGNTCTELPYTVQDIDDGGINGQNCCYTILENDYNKLFSLMTDTPSYICLQR-KPEKYQSYTVTLIARDR--PP 2432
            GT  + + IL+QND +P+ S  +  F  + EN   G  +    A D DS       YSL  +   + +  FR+H     P   ++     LD E+  +  F+L     D  S   S + T+ + + DLNDN P F Q +  A         D       +      DPD G NG +   +     EL      F +  +   L    SL     PH +  TL A DQG+P  S+S Q+ + +     + ++   I+        V  +V+  EGL   SL+  V   +  +   + +  +   D    F LDS S    L   +P + +           G   R  ++     P         + ++++D N++AP F++                  P   + T R S  +G     E      R         +D  +G +   R LD ET       + A D+        +        V D NDNAP F+    +  + E+   G     + A D D     + + Y +   GD   +F +   TG L   +PLDRE      + V A    +P + S+           + + V+DVND AP F      +Q+   I+ E    G +   L  T  D+   G NGQ   Y  +  +    FSL  +T     L+    E+ +   +T+ ARDR  PP
Sbjct: 1081 GTATVRVIILNQNDHSPRLSE-EPTFLAVAENQPPGTSVGRVFATDRDSGPNGRLTYSLQQLS--EDSKAFRIH-----PQTGEVTTLQTLDREQ--QSSFQLLVQVQDGGSPPRSATGTVHVAVLDLNDNSPTFLQASGAAGGGLPIQVPDRVPPGTLVTTLQAKDPDEGENGTILYTLTGPGSEL------FSLHPHTGELHTAASLVRAERPH-YVLTLSAHDQGSPPRSASLQLLVQVLPSTRVVESPDLIEADSAATVPVVLTVTAAEGLRPGSLLGSVAPQEPASVGVLTYTLVGGADPEGTFALDSAS--GRLYLARPLDFEA----------GPAWR-ALTVRAEGPGGAGARLLRVQVRVQDENEHAPTFARD------PLALALPENPDPGATLYTFRASDADGPGPNSEVRYRLLRQEPPVPALRLDARTGALSAPRGLDRETTPALLLLVEATDRPANASRRRAARVSARVFVTDENDNAPVFASPSRV-RLPEDQPPGPAALHVVARDPDLGEAAR-VSYRLAAGGD--GHFRLHATTGALSVVRPLDREQRAEHVLTVVALDHGSPPRSSTQL---------LTVSVVDVNDEAPAF-----PQQEYNVILRENSPPGTSLLTLKATDPDL---GANGQ-VTYGGVSGES---FSLDPNTGVLTTLRALDREEQEEIYLTVYARDRGLPP 1723          

HSP 12 Score: 84.3445 bits (207), Expect = 5.998e-15
Identity = 107/468 (22.86%), Postives = 196/468 (41.88%), Query Frame = 3
Query:  795 PKFNQLTYNANIDENKRDDKLIKFTVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDADTHSN--MIHCKLVDYNDLFYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIED--VNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPIIVTDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPL---TSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLRTRKPLDRETLESISIKVTAKN---PNKYSSHFVRNTDSEVDVMIKVMDVNDNAPKFI 2168
            P F QL Y  ++ E+      +    +    GR G VT+ +            +F +      L+ +  LD E    + E  + A   GTP + + A++++ L ++NDN P   F     +V    +   G P ++L    R  D D+ +N  +    L   + LF +D  +    L+          ++++ E+  G             P R  T++  L + I+D  ++  AP F    Y        +         I+     +       ++L        SS F ++  SG ++ + +LD E++  +  K++A+      L   T ++T+ + +L+ ND++PR SE      V EN   G  +G + A D D+   N  + YS++   + S  F I   TG++ T + LDRE   S  + V  ++   P + ++  V          + V+D+NDN+P F+
Sbjct:  782 PIFEQLQYVFSVPEDVAPGTSVGIIQAHNPPGRLGPVTLTLSGGDPR-----GLFSLDSPSGLLKTLRPLDRELLGPVLELEVRA-GSGTPPVFAVARIRVLLDDVNDNSPA--FPAPEDTVLLPQNTAPGTPIYTL----RALDPDSGANSRITFNLLAGGDGLFTVDPTTGHVRLMGPLGPPGGPAHELEVEARDGG-----------SPPR--TSHFRLRVVIQDLGIHGLAPRFDSPTY-----RVDLPSGTTTGTQILQVQAQAPDGSPVTYHLA---ADGASSPFGLESQSGWLWVRTALDRESQELYTLKVMAVSGSKAELGQQTGTATVRVIILNQNDHSPRLSEEPTFLAVAENQPPGTSVGRVFATDRDSG-PNGRLTYSLQQLSEDSKAFRIHPQTGEVTTLQTLDREQQSSFQLLVQVQDGGSPPRSATGTVH---------VAVLDLNDNSPTFL 1206          

HSP 13 Score: 63.929 bits (154), Expect = 1.097e-8
Identity = 118/552 (21.38%), Postives = 215/552 (38.95%), Query Frame = 3
Query:  705 LFAYDFDEKSIGNSCSTTIEIEIEDLNDNVPKFNQLTYNANIDENKRDDKLIKFTVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINS--LDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSII-EGLPAHSLVVEVRVTDADTHSNMIHCKLVDYNDLFYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPIIVTDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLRTR---KPLDRETLESISIKVTAKNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAPKF-IPRLNMKQKVEFIVEQFVDGNTCTELPYTVQDIDDGGINGQNCCYTILENDYNKLFSL 2339
            LF    D      S +  + + I+   +  P+F + +  A + EN      +    +    G NG +T +I+   +       IF IQ +   + + ++  LD+ET P L    L A   G  + S    + + L++ NDN P+       F   + V+ + E  P    +++V   D D  S       + Y+    L +      L +  P           +    +  R+ +  TD   S  +  + +L + + D NDN P   Q   +   ++  +   +     +   D DSG      +Y+       D   F I +  G++     LD+E  + +  +++A D    P    + +T+ V D+NDN P FS+S Y   + E+   G  I ++ A D D+       ++   P    +  F +D   G L T      L  E    + + + A++      H      ++  V +++ D ND+AP F +P   +      + E    G+T   L  T     DG        Y+I+  +  ++F L
Sbjct: 2029 LFIVATDLGRPARSATGVVVVGIQGEPERGPRFPRTSSEAVLRENAPPGTPVISPKAVHSGGSNGPITYSILSGNER-----GIFSIQPSTGAITVRSAEGLDFETSPRL-RLVLQAESGGAFAFSV---LTLTLQDANDNAPR-------FLRPHYVAFLPESRPLEGPLLQVEADDLDQGSG----GQISYS----LAASQPARGLFHVDPATGTITTTAILDREIWAETRLVLMATD-RGSPALVGSATLTVMVIDTNDNRPTIPQPWELRVSEDALLGSEI---AQVTGNDVDSG---PVLWYVLSPSGPQDP--FSIGRYGGRVSLTGPLDFEQCDHYHLQLLAHDG---PHEGHANLTVLVEDVNDNVPTFSQSLYQVMMLEHTPPGSAILSVSATDRDSGANGHISYHLASP----AEGFRVDPNNGTLFTTVGAMALGHEGPGVVDVVLEARD------HGAPGRTAQATVHVQLKDQNDHAPSFTLPHYRVA-----VSEDLPPGSTLLTLEATDA---DGSRTHATVDYSIISGNRGRVFQL 2526          
BLAST of Protocadherin Fat 1 vs. UniProt/SwissProt
Match: sp|D4ACX8|PCD16_RAT (Protocadherin-16 OS=Rattus norvegicus OX=10116 GN=Dchs1 PE=3 SV=2)

HSP 1 Score: 190.66 bits (483), Expect = 1.768e-47
Identity = 180/618 (29.13%), Postives = 280/618 (45.31%), Query Frame = 3
Query:  372 FQYLTPTDPGTFFILIKILDQNDKAPQFSSIKRPFFKIPENVEVGKVIDLPMAVDSDSEKYSVRRYSLSYIYHLDQTHDFRLHVTNDNP---PRPQLIVNSKLDYEKINKYVFRLFAYDFDEKSIGNSCSTTIEIEIEDLNDNVPKFNQLTYNANIDEN-KRDDKLIKFTVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDAD----THSNMI------HCKLVDYNDLFYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPIIVTDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEP--KGDHSSYFDIDRYTGDLRTRKPLDRET-LESISIKVTAKNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAPKFIPR 2174
            F  +TP D  T  + +++ D ND AP F    R   +IPE+  +G    L  A D+D+ +   + Y+LS          FRL  T   P   P P+L++  +LD E  + Y+ +L AYD    S        +++ + D+ND+ P FNQ  Y+A + E+      +++   SD D+G NG VT  I  +  E    F    I  +  FL+L   LD+E    + E  + A D G      SA V +H+++ NDN P +    +  S   S  + E  P   LV  + V+D D     H N+       H  L   + + YL   ++                ++DRE      LR+T + + S P R      +  + + DVNDNAP F +Q+Y       +V +  +F   +   D D G NG+  + L      + +  F ID  SG I T  +LDYE + + +  ++A D G  PL SS+T+++ + D+NDN P+F  + Y  ++ E    G     + A D D+      + YS+        S  F ID ++G++ T + LDR+    S    VTA +             S V V + V D NDN P+F PR
Sbjct:  111 FTAVTP-DGATVEVTVRVADINDHAPAFPQ-ARAALQIPEHTALGTRYPLEPAHDADAGRLGTQGYALS---GDGAGETFRLE-TRPGPGGAPVPELVIAGELDRENRSHYMLQLEAYD--GGSPPRRAQALLDVTLLDINDHAPAFNQSRYHAVVSESLAPGSPVLQVFASDADAGANGAVTYEINRRQSEGDGPF---SIDAHTGFLKLERPLDFEQR-RVHELVVQARDGGAHPELGSAFVTVHVRDANDNQPSMTV--IFLSADGSPRVSEAAPPGQLVARISVSDPDDGDFAHVNVSLEGGEGHFALSTQDSVIYLVCVAR----------------RLDREERDVYNLRVTATDSGSPPLR---AEAAFVLHVTDVNDNAPAFDRQLY-RPEPLPEVALPGSFVVRVTARDPDQGTNGQVTYSLAPG---THTHWFSIDPTSGIITTAATLDYELEPQPQLIVVATDGGLPPLVSSATVSVALQDVNDNEPQFQRTFYNASLPEGTQPGTCFLQVTATDADSGPFGL-LSYSLGAGLGASGSPPFRIDAHSGEVCTTRILDRDQGPSSFDFTVTAIDGG--------GLKSMVYVKVFVADENDNPPQFYPR 682          

HSP 2 Score: 127.487 bits (319), Expect = 4.648e-28
Identity = 146/603 (24.21%), Postives = 244/603 (40.46%), Query Frame = 3
Query:  411 ILIKILDQNDKAPQFSSIKRPF-FKIPENVEVGKVIDLPMAVDSDSEKYSVRRYSLSYIYHLDQTHDFRLHVTNDNPPRPQLIVNSK---------LDYEKINKYVFRLFAYDFD-EKSIGNSCSTTIEIEIEDLNDNVPKFNQLTYNANIDENKRDDKLIKFTVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDADTHSNMIHCKLVDYNDL----FYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPIIV---TDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLRTRKPLDRETLESISIKVTAKNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAPKF 2165
            + +++ D+N+ AP F+  + P    +PEN E G  +    A D+D                     D R  +    PP P L ++++         LD E     +  + A D     S   +   +  + + D NDN P F   +     ++       +     DPD G    V+  +    D        F +      L ++  LD E        T++A+D G+P  SS+  + + + ++ND  P    ++       +V + E  P  + ++ ++ TD D  +N      V Y  +    F LD  S            L T+  +DRE      L +        P   + T+ ++ + +ED ND++P F      GN   +        P+ +     +D D GLNG+ ++ +        S  F +D  SG+  T R LD E +  F+ +I A D G   L+++  +T+ VLD ND+AP F    Y   V E+  VG  +  LQA D D     + ++Y        +  F ++  +G+L T   LDRE   S +  VTA +             + V + + V DVND+AP F
Sbjct: 1415 VQVRVQDENEHAPAFA--RDPLALALPENPEPGATLYTFRASDADGP---------------GPNSDVRYRLLRQEPPVPALRLDARTGALSAPRGLDRETTPALLLIVEATDRPANASRRKATRVSARVFVTDENDNAPVFASPSRMRLPEDQPPGPAALHVVARDPDLGEAARVSYRLAAGGD------GHFRLHATTGALSVVRPLDREQRAEHV-LTVVASDHGSPPRSSTQLLTVSVVDVNDEAPAFPQQEY------NVILRENSPPGTSLLTLKATDPDLGAN----GQVTYGGVSGESFSLDPNSGV----------LTTLRALDREEQEEINLTVYARDRGLPP---LLTHITVRVTVEDENDHSPTF------GNTHLSLEVPEGQDPQTLTTLRASDPDGGLNGQLQYRI---LGGDPSGAFALDLTSGEFGTTRPLDREVEPAFQLQIEARDGGQPALSATLLVTVTVLDANDHAPAFPVPSYSVEVPEDAPVGTLLLQLQAHDPDEGDNGRVMYYL---GAGTAGAFLLEPTSGELSTATALDREHCASYAFSVTAVDGAAAGP-----LSTTVPITVTVRDVNDHAPAF 1953          

HSP 3 Score: 116.701 bits (291), Expect = 8.086e-25
Identity = 126/491 (25.66%), Postives = 210/491 (42.77%), Query Frame = 3
Query:  753 TTIEIEIEDLNDNVPKFNQLTYNANIDENKR-DDKLIKFTVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDADTHSNMIHCKLVDYNDLFYLDSPSKFNTLLNYKPFN--LKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPIIVTDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFTQ---RSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDID--------------RYTGDLRTRKPLDRETLESISIKVTAKNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAPKF 2165
            + + + ++D NDN P+F Q  Y A + E++  +  L++    D D G  G ++ ++            +F +      +     LD E         L+ATD+G+P+L  SA + + + + NDN P I  +     VS    +   +         +VT  D  S  +         L+Y+ SPS      +   +   +     +D E      L++       E       + +L + +EDVNDN P+FSQ +Y   + E+           +  TDRDSG NG   ++L      S +  F +D  +G +FT     +L +E        + A D G    ++ +T+ + + D ND+AP F+  HY   V E++  G  + TL+AID D  R +  + YSI   G+    F ++              +  G L   +PLD E+L   ++ VTA +  +          S V V + V+DVNDN P F
Sbjct: 2148 SVLTLTLQDANDNAPRFLQPHYVAFLPESRPLEGPLLQVEADDLDQGSGGQISYSLAASQPARG----LFHVDPATGTITTTAILDREIWAET-RLVLMATDRGSPALVGSATLTVMVIDTNDNRPTIP-QPWELRVSEDALLGSEI--------AQVTGNDVDSGPV---------LWYVLSPSGPQDPFSIGRYGGRVSLTGPLDFEQCDHYHLQLLAHDGPHE------GHANLTVLVEDVNDNVPIFSQSLYQVMMLEHTPPGSAILS--VSATDRDSGANGHISYHLA-----SPAEGFSVDTNNGTLFTTVGAMALGHEGPGVVDVVLEARDHGAPGRSAQATVHVQLKDQNDHAPSFTLPHYRVAVSEDLPPGSTLLTLEAIDADGSRSHATVDYSI-ISGNRGRVFQLEPRLAEVGDGVGPGPQALGCLVLLEPLDFESLTQYNLTVTAADRGQPPR------SSAVPVTVTVLDVNDNPPVF 2595          

HSP 4 Score: 115.931 bits (289), Expect = 1.659e-24
Identity = 138/601 (22.96%), Postives = 251/601 (41.76%), Query Frame = 3
Query:  399 GTFFILIKILDQNDKAPQFSSI-----KRPFFKIPENVEVGKVIDLPMAVDSDSEKYSVRRYSLSYIYHLDQTHDFRLHVTNDNPPRPQLIVNSKLDYEKINKYVFRLFAYDFDEKSIGNSCSTTIEIEIEDLNDNVPKFNQLTYNAN-IDENKRDDK-LIKFTVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDADTHSNMIHCKLVDYNDLFYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPIIVTDRDSGLNGKFEFYLEDFRNFSDSSD--FLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLRTRKPLDRETLESI---SIKVTAKNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAPKF 2165
            G+ F+ + + D ND  P  + I       P  ++ E    G+++      D D   ++    SL       +  +    ++  +     + V  +LD E+ + Y  R+ A D     +         + + D+NDN P F++  Y    + E       +++ T  DPD G NG VT ++   T         F I      +    +LDYE +P   +  ++ATD G P L SSA V + L+++NDN P+  F++  ++ S    + EG    +  ++V  TDAD+        L+ Y+    L +       ++     + T   +DR+    SF   T++  D    + +     + + + D NDN P F  + Y  ++              +   D D G +G+  +++      + +S   F +D  SG +     L     +  + +I A D G       + + I+++      P F +  Y+F+V E+V+ G  +G +QA +         +  S    GD    F +D  +G L+T +PLDRE L  +    ++  +  P  +S+  +R         + + DVNDN+P F
Sbjct:  338 GSAFVTVHVRDANDNQPSMTVIFLSADGSP--RVSEAAPPGQLVARISVSDPDDGDFAHVNVSL-------EGGEGHFALSTQDSVIYLVCVARRLDREERDVYNLRVTATDSGSPPL--RAEAAFVLHVTDVNDNAPAFDRQLYRPEPLPEVALPGSFVVRVTARDPDQGTNGQVTYSLAPGTHT-----HWFSIDPTSGIITTAATLDYELEPQP-QLIVVATDGGLPPLVSSATVSVALQDVNDNEPQ--FQRTFYNAS----LPEGTQPGTCFLQVTATDADSGP----FGLLSYSLGAGLGASGSPPFRIDAHSGEVCTTRILDRDQGPSSF-DFTVTAIDGGGLKSMVY---VKVFVADENDNPPQFYPREYAASLSAQSTPGTAVLR--VHAHDPDQGPHGRLSYHI-----LAGNSPPLFALDAHSGLLTVAWPLGRRANSVVQLEIGAQDGGGLQAEPIARVNISIVPGTPTPPIFEQLQYVFSVPEDVAPGTSVGVVQAHNPPGRLGPVTLTLS---GGDPRGLFSLDSASGLLKTLRPLDRELLGPVLELEVRAGSGTPPVFSAARIR---------VLLDDVNDNSPAF 888          

HSP 5 Score: 114.775 bits (286), Expect = 4.031e-24
Identity = 165/661 (24.96%), Postives = 268/661 (40.54%), Query Frame = 3
Query:  423 ILDQNDKAPQFSSIKRPFFKIPENVEVGKVIDLPMAVDSDSEKYSVRRYSLSYIYHLDQTHDFRLHVTNDNPPRPQLIVNSKLDYEKINKYVFRLFAYDFDEKSIGNSCSTTIEIEIEDLNDNVPKFNQLTYNANIDENKR-DDKLIKFTVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDADTHSN-MIHCKLV--DYNDLFYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTDS-EPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPIIVTDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQ-PLTSSSTITINVLDLNDNAPRFSESHYIFNV------FENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLRTRK------PLDRETLESISIKVTAKNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAPKFIPRLNMKQKVEFIVEQFVDGNTCTELPYTVQDIDDGGINGQNCCYTILENDYNKLFSLMTDT 2351
            + D+ND AP F+S  R   ++PE+   G      +A D D  + +   Y L+          FRLH T        L V   LD E+  ++V  + A D    S   S +  + + + D+ND  P F Q  YN  + EN      L+    +DPD G NG VT   V            F +  N   L  + +LD E    +   T+ A D+G P L +   V++ +++ ND+ P      L      S+ + EG    +L   +R +D D   N  +  +++  D +  F LD  S              T   +DRE       ++ I   D  +P+  ++    + + + D ND+AP F    Y  +V+  +   V      +   D D G NG+  +YL        +  FL++  SG++ T  +LD E    + F + A+D     PL+++  IT+ V D+ND+AP F  S     +          ++   + TL+A D D    N  I Y +   G       +D YTG++R  +      P DR       +      P + ++           V++ +    +  P+F PR N     E ++ +     T    P  V     GG NG    Y+IL  +   +FS+   T
Sbjct: 1529 VTDENDNAPVFASPSR--MRLPEDQPPGPAALHVVARDPDLGEAARVSYRLA----AGGDGHFRLHATTG-----ALSVVRPLDREQRAEHVLTVVASD--HGSPPRSSTQLLTVSVVDVNDEAPAFPQQEYNVILRENSPPGTSLLTLKATDPDLGANGQVTYGGVSGES--------FSLDPNSGVLTTLRALDREEQEEI-NLTVYARDRGLPPLLTHITVRVTVEDENDHSPTFGNTHL------SLEVPEGQDPQTLTT-LRASDPDGGLNGQLQYRILGGDPSGAFALDLTSG----------EFGTTRPLDREVEPA--FQLQIEARDGGQPA--LSATLLVTVTVLDANDHAPAFPVPSY--SVEVPEDAPVGTLLLQLQAHDPDEGDNGRVMYYL----GAGTAGAFLLEPTSGELSTATALDREHCASYAFSVTAVDGAAAGPLSTTVPITVTVRDVNDHAPAFPTSPLRLRLPRPGPSLNKPTLA--LATLRAEDRDAG-ANASILYRL--AGTPPPGTTVDSYTGEIRVARSPAALGPRDRVLF---IVATDLGRPARSATGV---------VIVGIQGEPERGPRF-PRANN----EAVLRENAPPGTPVISPKAVH---SGGSNGP-ITYSILSGNERGIFSIQPST 2114          

HSP 6 Score: 112.464 bits (280), Expect = 1.626e-23
Identity = 145/611 (23.73%), Postives = 251/611 (41.08%), Query Frame = 3
Query:  384 TPTDPGTFFILIKILDQNDKAPQFSSIKRPF-FKIPENVEVGKVIDLPMAVDSDSEKYSVRRYSLSYIYHLDQTHDFRLHVTNDNPPRPQ-----------LIVNSKLDYEKINKYVFRLFAYDFDEKSIGNSCSTTIEIEIEDLNDNVPKFNQLTYNANIDENKR-DDKLIKFTVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLEL-INSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDAD---THSNMIHCKLVDYN-------DLFYLD------------SPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTD-SEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPIIVTDRDSGLNGKFEFYLEDFRNFSDSSD----FLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIE--PKGDHSSYFDIDRYTGDLRTRKPLDRETLESISIKVTAKNPNKYSS 2087
            +P   G+  + + ++D ND  P   +I +P+  ++ E+  +G  I      D DS    V  Y LS                   P  PQ           + +   LD+E+ + Y  +L A+D   +   N     + + +ED+NDNVP F+Q  Y   + E+      ++  + +D DSG NG ++ ++    +  S      +      F  +   +L +E  P + +  L A D G P  S+ A V + LK+ ND+ P         +VS      E LP  S ++ +   DAD   +H+       VDY+        +F L+             P     L+  +P + +++ + +          +T++  D  +P R  ++   + + + DVNDN P+F++  Y   V E+           +  +D D G +G   F L        S D    F +D+ SG +     LD ET+ + +  + A D       +   +T+ V D+ND+ P F  S    ++ EN   G  + TL A+D D     +  +  +E  P  +    F ++  TG+LR R P D E   S  + V A +    S+
Sbjct: 2247 SPALVGSATLTVMVIDTNDNRP---TIPQPWELRVSEDALLGSEIAQVTGNDVDSG--PVLWYVLS-------------------PSGPQDPFSIGRYGGRVSLTGPLDFEQCDHYHLQLLAHDGPHEGHAN-----LTVLVEDVNDNVPIFSQSLYQVMMLEHTPPGSAILSVSATDRDSGANGHISYHLASPAEGFS-----VDTNNGTLFTTVGAMALGHE-GPGVVDVVLEARDHGAPGRSAQATVHVQLKDQNDHAPSFTLPHYRVAVS------EDLPPGSTLLTLEAIDADGSRSHAT------VDYSIISGNRGRVFQLEPRLAEVGDGVGPGPQALGCLVLLEPLDFESLTQYN----------LTVTAADRGQPPR--SSAVPVTVTVLDVNDNPPVFTRASYRVTVPEDMPVGAELL--HVEASDADPGPHGLVHFTLS-------SGDPLGLFELDENSGALRLAHPLDCETQAQHQLVVQAADPAGTHF-ALVPVTVEVQDVNDHGPAFPLSLLSTSLAENQPPGTLVTTLHAMDGDAGTFGRLRYTLLEAVPGPEGREAFSLNSSTGELRARVPFDYEHTGSFRLLVGAADAGNLSA 2788          

HSP 7 Score: 100.138 bits (248), Expect = 9.458e-20
Identity = 109/434 (25.12%), Postives = 193/434 (44.47%), Query Frame = 3
Query:  759 IEIEIEDLNDNVPKFNQLTYNANIDENKRDDKLI-KFTVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDADTHSNMIHCKLVDYNDLFYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRI-TISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQ---IYIGXXXXXXXXXXXXFPKPIIVTDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESH------YIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLRTRKPLDR 2027
            I + ++D+NDN P F        + +N      +      DPDSG N  VT +++   D L      F +      + L+  L         E  + A D G+P  +S  ++++ +++L  +G   +F     S +  V +  G    + +++V+    D      H      ++ F L+S S +          L     +DRES     L++  +S + +E  +Q T   ++ + I + ND++P  S++   + +        +V   F      TD+DSG NG+  + L+      DS  F I   +G++ T ++LD E ++ F+  +   D G  P +++ T+ + VLDLNDN+P F ++           V + V  G  + TLQA D D + +N  I Y++   G  S  F +  +TG+L T   L R
Sbjct:  874 IRVLLDDVNDNSPAFPAPEDTVLLPQNTAPGTPVYTLRALDPDSGANSRVTFSLLAGGDGL------FTVDPTTGHVRLMGPLG-PPGGPPHELEVEAQDGGSPPRTSHFRLRVVIQDLGIHGLAPRFD----SPTYRVDLPSGTTTGTQILQVQAQAPDGSPVTYHLAADGASNPFGLESQSGW----------LWVRAALDRESQELYTLKVMAVSGSKAELGQQ-TGTATVRVVILNQNDHSPRLSEEPTFLAVAENQPPGTSVGRVF-----ATDKDSGPNGRLTYSLQQLS--EDSKAFRIHPQTGEVTTLQTLDREQQSSFQLLVQVQDAGSPPRSATGTVHVAVLDLNDNSPTFLQASGAAGGGLPIQVPDRVPPGTLVTTLQAKDPD-EGENGTILYTL--TGSGSELFSLHPHTGELHTAASLIR 1275          

HSP 8 Score: 99.3673 bits (246), Expect = 1.557e-19
Identity = 153/669 (22.87%), Postives = 258/669 (38.57%), Query Frame = 3
Query:  384 TPTDPGTFFILIKILDQNDKAPQFSSIKRPF-----FKIPENVEVGKVIDLPMAVDSDSEKYSVRRYSLSYIYHLDQTHDFRLHVTNDNPPRPQLIVNSKLDYEKINKYVFRLFAYDFDEKSIGNSCSTTIEIEIEDLNDNVPKFNQLTYNANID--------ENKRDDKLIKFTVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDADTHSNMIHCKLVDYNDLFYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKP----IIVTDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLRTRKPLDRETLESISIKVTAKNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAPKFIPRLNMKQKVEFIVEQFVDGNTCTELPYTVQDIDDGGINGQNCCYTILENDYNKLFSL 2339
            +P    T  + + +LD ND +P F             ++P+ V  G ++    A D D  +     Y+L+       +  F LH     P   +L   + L   +   YV  L A+D        S    +++         P   +    A +         E  R   L+  +V+  +    G++T  +V   D        F +      L L   LD+E+ P     T+ A   G    +   +V++ +++ N++ P      L  ++  +       P  +L    R +DAD           D         P      L+ +   L     +DRE+     L +  +   +  SR+  T  S  + + D NDNAP+F+    +   ++         P P    ++  D D G   +  + L           F +   +G +   R LD E + +    ++A D G  P +S+  +T++V+D+ND AP F +  Y   + EN   G  + TL+A D D    N  + Y     G     F +D  +G L T + LDRE  E I++ V A++        +    + + V + V D ND++P F    N    +E  V +  D  T T L  +     DGG+NGQ   Y IL  D +  F+L
Sbjct: 1182 SPPRSATGTVHVAVLDLNDNSPTFLQASGAAGGGLPIQVPDRVPPGTLVTTLQAKDPDEGENGTILYTLTG----SGSELFSLH-----PHTGELHTAASLIRAERPHYVLTLSAHDQGSPPRSASLQLLVQVLPSTRMVESPDLVEADSAATVPVVLTVTAAEGLRPGSLLG-SVAPQEPASMGVLTYTLVGGADPEGT----FALDSASGRLYLARVLDFESGPAWRALTVRAEGPGGAG-ARLMRVQVRVQDENEHAPAFARDPLALALPENPE-----PGATLYT-FRASDADGPGPN-----SDVRYRLLRQEPPVPALRLDARTGALSAPRGLDRETTPALLLIVEATDRPANASRRKATRVSARVFVTDENDNAPVFASPSRMRLPEDQP-------PGPAALHVVARDPDLGEAARVSYRLAA----GGDGHFRLHATTGALSVVRPLDREQRAEHVLTVVASDHGSPPRSSTQLLTVSVVDVNDEAPAFPQQEYNVILRENSPPGTSLLTLKATDPDLG-ANGQVTYG----GVSGESFSLDPNSGVLTTLRALDREEQEEINLTVYARDRG------LPPLLTHITVRVTVEDENDHSPTF---GNTHLSLE--VPEGQDPQTLTTLRASDP---DGGLNGQ-LQYRILGGDPSGAFAL 1793          

HSP 9 Score: 95.5153 bits (236), Expect = 2.568e-18
Identity = 121/507 (23.87%), Postives = 207/507 (40.83%), Query Frame = 3
Query:  702 RLFAYDFDEKSIGNSCSTTIEIEIEDLNDNVPKFNQLTYNANIDENKR-DDKLIKFTVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVS-NSVSIIEGLPAHSLVVEVRVTDADTHSNMIHCKLVDYNDLFYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTD-SEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPIIVTDRDSGLNGKFEFYLEDFRNFSDSSDFLID----------------KISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLRTRKPLDRETLESISIKVTAKNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAPKF 2165
            RL     D  S     S T+ + + D NDN P   Q  +   + E+     ++ + T +D DSG      ++     D        F I R    + L   LD+E   H +   LLA D         A + + ++++NDN P        FS S   V ++E  P  S ++ V  TD D+ +N  H         ++L SP++  ++         T+  +         + + +   D   P R  +   ++++Q++D ND+AP F+   Y               P   ++T      +G       D+   S +   +                  +  G +     LD+E+  ++   + A D+G  P +S+  +T+ VLD+NDN P F+ + Y   V E++ VG ++  ++A   D D     + +     GD    F++D  +G LR   PLD ET     + V A +P    +HF     + V V ++V DVND+ P F
Sbjct: 2237 RLVLMATDRGSPALVGSATLTVMVIDTNDNRPTIPQ-PWELRVSEDALLGSEIAQVTGNDVDSGPVLWYVLSPSGPQDP-------FSIGRYGGRVSLTGPLDFEQCDH-YHLQLLAHDG---PHEGHANLTVLVEDVNDNVPI-------FSQSLYQVMMLEHTPPGSAILSVSATDRDSGANG-HIS-------YHLASPAEGFSVDTNNGTLFTTVGAMALGHEGPGVVDVVLEARDHGAPGR--SAQATVHVQLKDQNDHAPSFTLPHY------RVAVSEDLPPGSTLLTLEAIDADGSRSHATVDYSIISGNRGRVFQLEPRLAEVGDGVGPGPQALGCLVLLEPLDFESLTQYNLTVTAADRGQPPRSSAVPVTVTVLDVNDNPPVFTRASYRVTVPEDMPVGAELLHVEA--SDADPGPHGLVHFTLSSGDPLGLFELDENSGALRLAHPLDCETQAQHQLVVQAADPA--GTHF-----ALVPVTVEVQDVNDHGPAF 2699          

HSP 10 Score: 91.2781 bits (225), Expect = 5.786e-17
Identity = 173/703 (24.61%), Postives = 269/703 (38.26%), Query Frame = 3
Query:  399 GTFFILIKILDQNDKAPQFSSIKRPFFKIPENVEVGKVIDLPMAVDSDSEKYSVRRYSLSYIYHLDQTHDFRLHVTNDNPPRPQLIVNSKLDYEKINKYVFRLFAYDFDEKSIGNSCSTTIEIEIEDLNDNVPKFNQLTYNAN-------IDENKRDDKLIKFTVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHL---KNLNDNGPKIKFKKLG-FSVSNSVSIIEGLPAHSLVVEVRVTDADTHSNMIHCKL--VDYNDLFYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPIIVTDRDS-----GLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSST---ITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLRTRKPLDRETLESISIKVTAKNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAPKFIPRLNMKQKVEFIV-EQFVDGNTCTELPYTVQDIDDGGINGQNCCYTILENDYNKLFSLMTDTPSYICLQR-KPEKYQSYTVTLIARDR--PP 2432
            GT  + + IL+QND +P+ S  +  F  + EN   G  +    A D DS       YSL  +   + +  FR+H     P   ++     LD E+  +  F+L     D  S   S + T+ + + DLNDN P F Q +  A         D       +      DPD G NG +   +     EL      F +  +   L    SL     PH +  TL A DQG+P  S+S Q+ + +     + ++   ++        V  +V+  EGL   SL+  V   +  +   + +  +   D    F LDS S            L     +D ES  G   R  ++     P         + ++++D N++AP F++                  P   + T R S     G N    + L   R         +D  +G +   R LD ET       + A D+        +T     + V D NDNAP F+    +  + E+   G     + A D D     + + Y +   GD   +F +   TG L   +PLDRE      + V A      S H      S   + + V+DVND AP F      +Q+   I+ E    G +   L  T  D+   G NGQ   Y  +  +    FSL  ++     L+    E+ +   +T+ ARDR  PP
Sbjct: 1081 GTATVRVVILNQNDHSPRLSE-EPTFLAVAENQPPGTSVGRVFATDKDSGPNGRLTYSLQQLS--EDSKAFRIH-----PQTGEVTTLQTLDREQ--QSSFQLLVQVQDAGSPPRSATGTVHVAVLDLNDNSPTFLQASGAAGGGLPIQVPDRVPPGTLVTTLQAKDPDEGENGTILYTLTGSGSEL------FSLHPHTGELHTAASLIRAERPH-YVLTLSAHDQGSPPRSASLQLLVQVLPSTRMVESPDLVEADSAATVPVVLTVTAAEGLRPGSLLGSVAPQEPASMGVLTYTLVGGADPEGTFALDSASG----------RLYLARVLDFES--GPAWR-ALTVRAEGPGGAGARLMRVQVRVQDENEHAPAFARD------PLALALPENPEPGATLYTFRASDADGPGPNSDVRYRL--LRQEPPVPALRLDARTGALSAPRGLDRETTPALLLIVEATDRPANASRRKATRVSARVFVTDENDNAPVFASPSRM-RLPEDQPPGPAALHVVARDPDLGEAAR-VSYRLAAGGD--GHFRLHATTGALSVVRPLDREQRAEHVLTVVA------SDHGSPPRSSTQLLTVSVVDVNDEAPAF-----PQQEYNVILRENSPPGTSLLTLKATDPDL---GANGQ-VTYGGVSGES---FSLDPNSGVLTTLRALDREEQEEINLTVYARDRGLPP 1723          

HSP 11 Score: 90.5077 bits (223), Expect = 7.774e-17
Identity = 140/609 (22.99%), Postives = 235/609 (38.59%), Query Frame = 3
Query:  387 PTDPGTFFILIKILDQNDKAPQFSSIKRPFFKIPENVEVGKVIDLPMAVDSDSEKYSVRRYSLSYIYHLDQTHDFRLHVTNDNPPRPQLIVNSKLDYEKINKYVFRLFAYDFDEKSIGNSCSTT--IEIEIEDLNDNVPKFNQLTYNANIDE-----NKRDDKLIKFTVSDPDSGRNGIVTVNIV------DKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDADTHSNMIHCKLVDYNDLFYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPII---VTDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLRTRKPLDRETLESISIKVTAKNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAPKF 2165
            P    T  + + +LD ND AP F  +     ++PE+  VG ++    A D D        Y L           F L      P   +L   + LD E    Y F + A D    +     STT  I + + D+ND+ P F        +       NK    L      D D+G N  +   +          D  +   ++    R+   L          D  LF   ++ATD G P+ S++  V + ++   + GP+          +N   + E  P  + V+  +   +   +  I   ++  N+           T+       +++   +D E+N    LR+ +       S        L + ++D NDNAP F Q  Y+  + E++         P++     D D G  G+  + L   +       F +D  +G I T   LD E   + R  ++A D+G   L  S+T+T+ V+D NDN P   +  +   V E+  +G +I  +   D D+      ++Y + P G     F I RY G +    PLD E  +   +++ A +      H     +   ++ + V DVNDN P F
Sbjct: 1826 PALSATLLVTVTVLDANDHAPAFP-VPSYSVEVPEDAPVGTLLLQLQAHDPDEGDNGRVMYYLG----AGTAGAFLLE-----PTSGELSTATALDREHCASYAFSVTAVD---GAAAGPLSTTVPITVTVRDVNDHAPAFPTSPLRLRLPRPGPSLNKPTLALATLRAEDRDAGANASILYRLAGTPPPGTTVDSYTGEIRV---ARSPAALG-------PRDRVLF---IVATDLGRPARSATGVVIVGIQGEPERGPRFP------RANNEAVLRENAPPGTPVISPKAVHSGGSNGPITYSILSGNERGIFSIQPSTGTI------TVQSAEGLDFETN--PRLRLVLQAE----SGGAFAFSVLTLTLQDANDNAPRFLQPHYVAFLPESRP-----LEGPLLQVEADDLDQGSGGQISYSLAASQ--PARGLFHVDPATGTITTTAILDREIWAETRLVLMATDRGSPALVGSATLTVMVIDTNDNRPTIPQP-WELRVSEDALLGSEIAQVTGNDVDS---GPVLWYVLSPSGPQDP-FSIGRYGGRVSLTGPLDFEQCDHYHLQLLAHD----GPH-----EGHANLTVLVEDVNDNVPIF 2369          

HSP 12 Score: 87.4261 bits (215), Expect = 7.463e-16
Identity = 105/468 (22.44%), Postives = 197/468 (42.09%), Query Frame = 3
Query:  795 PKFNQLTYNANIDENKRDDKLIKFTVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDADTHSN--MIHCKLVDYNDLFYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIED--VNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPIIVTDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPL---TSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLRTRKPLDRETLESISIKVT---AKNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAPKFI 2168
            P F QL Y  ++ E+      +    +    GR G VT+ +            +F +      L+ +  LD E    + E  + A   GTP + S+A++++ L ++NDN P         +  ++V + +     + V  +R  D D+ +N  +    L   + LF +D  +    L+          ++++ E+  G             P R  T++  L + I+D  ++  AP F    Y        +         I+     +       ++L        S+ F ++  SG ++ + +LD E++  +  K++A+      L   T ++T+ + +L+ ND++PR SE      V EN   G  +G + A D D+   N  + YS++   + S  F I   TG++ T + LDRE   S  + V    A +P + ++  V          + V+D+NDN+P F+
Sbjct:  782 PIFEQLQYVFSVPEDVAPGTSVGVVQAHNPPGRLGPVTLTLSGGDPR-----GLFSLDSASGLLKTLRPLDRELLGPVLELEVRA-GSGTPPVFSAARIRVLLDDVNDNSPAFP------APEDTVLLPQNTAPGTPVYTLRALDPDSGANSRVTFSLLAGGDGLFTVDPTTGHVRLMGPLGPPGGPPHELEVEAQDGG-----------SPPR--TSHFRLRVVIQDLGIHGLAPRFDSPTY-----RVDLPSGTTTGTQILQVQAQAPDGSPVTYHLA---ADGASNPFGLESQSGWLWVRAALDRESQELYTLKVMAVSGSKAELGQQTGTATVRVVILNQNDHSPRLSEEPTFLAVAENQPPGTSVGRVFATDKDSG-PNGRLTYSLQQLSEDSKAFRIHPQTGEVTTLQTLDREQQSSFQLLVQVQDAGSPPRSATGTVH---------VAVLDLNDNSPTFL 1206          

HSP 13 Score: 65.855 bits (159), Expect = 2.872e-9
Identity = 119/553 (21.52%), Postives = 217/553 (39.24%), Query Frame = 3
Query:  705 LFAYDFDEKSIGNSCSTTIEIEIEDLNDNVPKFNQLTYNANIDENKRDDKLIKFTVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNE--FFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSII-EGLPAHSLVVEVRVTDADTHSNMIHCKLVDYNDLFYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPIIVTDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLRTR---KPLDRETLESISIKVTAKNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAPKF-IPRLNMKQKVEFIVEQFVDGNTCTELPYTVQDID-DGGINGQNCCYTILENDYNKLFSL 2339
            LF    D      S +  + + I+   +  P+F +    A + EN      +    +    G NG +T +I+   +       IF IQ +     ++    LD+ET+P L    L A   G  + S    + + L++ NDN P+       F   + V+ + E  P    +++V   D D  S       + Y+    L +      L +  P           +    +  R+ +  TD   S  +  + +L + + D NDN P   Q   +   ++  +   +     +   D DSG      +Y+       D   F I +  G++     LD+E  + +  +++A D    P    + +T+ V D+NDN P FS+S Y   + E+   G  I ++ A D D+       ++   P    +  F +D   G L T      L  E    + + + A++      H      ++  V +++ D ND+AP F +P   +      + E    G+T      T++ ID DG  +     Y+I+  +  ++F L
Sbjct: 2029 LFIVATDLGRPARSATGVVIVGIQGEPERGPRFPRANNEAVLRENAPPGTPVISPKAVHSGGSNGPITYSILSGNER-----GIFSIQPSTGTITVQSAEGLDFETNPRL-RLVLQAESGGAFAFSV---LTLTLQDANDNAPR-------FLQPHYVAFLPESRPLEGPLLQVEADDLDQGSG----GQISYS----LAASQPARGLFHVDPATGTITTTAILDREIWAETRLVLMATD-RGSPALVGSATLTVMVIDTNDNRPTIPQPWELRVSEDALLGSEI---AQVTGNDVDSG---PVLWYVLSPSGPQDP--FSIGRYGGRVSLTGPLDFEQCDHYHLQLLAHDG---PHEGHANLTVLVEDVNDNVPIFSQSLYQVMMLEHTPPGSAILSVSATDRDSGANGHISYHLASP----AEGFSVDTNNGTLFTTVGAMALGHEGPGVVDVVLEARD------HGAPGRSAQATVHVQLKDQNDHAPSFTLPHYRVA-----VSEDLPPGSTL----LTLEAIDADGSRSHATVDYSIISGNRGRVFQL 2526          
BLAST of Protocadherin Fat 1 vs. UniProt/SwissProt
Match: sp|Q6WYY1|PC11X_PANPA (Protocadherin-11 X-linked OS=Pan paniscus OX=9597 GN=PCDH11X PE=3 SV=1)

HSP 1 Score: 186.037 bits (471), Expect = 2.540e-46
Identity = 187/672 (27.83%), Postives = 311/672 (46.28%), Query Frame = 3
Query:  396 PGTFFILIKIL----DQNDKAPQFSSIKRPFFKIPENVEVGKVIDLPMAVDSDSEKYSVRRYSLSYIYHLDQTHDFRLHV--TNDNPPRPQLIVNSKLDYEKINKYVFRLFAYD--FDEKSIGNSCSTTIEIEIEDLNDNVPKFNQLTYNANIDENKR-DDKLIKFTVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDADT-HSNMIHCKLVDYNDLFYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPIIVTDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLRTRKPLDRETLESISIKVTAKNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAPKFI-PRLNMKQKVEFIVEQFVDGNTCTELPYTVQDID-DGGINGQNCCYTILENDYNKLFSLMTDTPSYICLQR 2375
            P   F L+KI     D ND AP F +       IPEN  +     LP AVD D     V+ Y L     +   + F L V  T +    PQLIV  +LD E+ + YV ++   D  F ++S     +  +++ + D NDN P F +     +I EN      + +   +D D G N  +  +  +    +++R  +F +      + +   LD E  P+  +  +LA+D G   + + A V +++ ++NDN P I  + +   V+++V + E +P ++ +  + VTD D  H+  + C   D+   F L  P   N  L      L+T   +D ES     +++  +     P  Q   +  L I+++D NDNAP+F+Q  ++        +  +   K +  TD DSG N +  + L          +F +D+ +G +   + LD E ++K+ F I+A D G  PLTS+ T+ ++++D NDN+P F+ + Y F V EN+     +G +   D D    N  +  SI    D +  F ID  TG +R     DRE  ES +  V A++  + S        S   V I V+DVNDN P FI P  N     E ++     G       + V  +D D G+N +   Y+I+  +   LF++  +T +   +++
Sbjct:  116 PDEIFRLVKIRFLIEDINDNAPLFPATVI-NISIPENSAINSKYTLPAAVDPDVGTNGVQNYEL-----IKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRS----STAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARR--LFHLNATTGLITIKEPLDREETPN-HKLLVLASDGGL--MPARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTC-FTDHEIPFRL-RPVFSNQFL------LETAAYLDYESTKEYAIKLLAADAGKPPLNQ---SAMLFIKVKDENDNAPVFTQS-FVTVSIPENNSPGIQLTK-VSATDADSGPNAEINYLL----GPDAPPEFSLDRRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYNFYVPENLPRHGTVGLITVTDPDYG-DNSAVTLSIL---DENDDFTIDSQTGVIRPNISFDREKQESYTFYVKAEDGGRVSR------SSSAKVTINVVDVNDNKPVFIVPPSNY--SYELVLPSTNPGTVV----FQVMAVDNDTGMNAE-VRYSIVGGNTRDLFAIDQETGNITLMEK 738          
BLAST of Protocadherin Fat 1 vs. TrEMBL
Match: A0A4E0RII8 (Protocadherin Fat 1 OS=Fasciola hepatica OX=6192 GN=D915_001865 PE=4 SV=1)

HSP 1 Score: 384.8 bits (987), Expect = 1.465e-109
Identity = 305/981 (31.09%), Postives = 459/981 (46.79%), Query Frame = 3
Query:   87 SEVLKTITITENDMSIQVLANLTEILA--SKTNLP---HSFLSKVEIVSLLENDLPPFKLQLNQLIQPNNGVNREAVCRDNPGE----------------KVRKFCKADLCCKLIGFQYL-TPTD-PGTFFILIKILDQNDKAPQFSSIKRPFFKIPENVEVGKVIDLPMAVDSDSEKYSVRRYSLSYIYHLDQTHDFRLHVTNDNP----------------------------PRPQLIVNSKLDYEKINKYVFRLFAYDFDEKSI--------GNSCSTTIEIEIEDLNDNVPKFNQLTYNANIDENKRDDKLIKFTVSDPDSGRNGIVTVNIVDKTDELSKRFKI----------------FEIQRNEF---FLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVS-NSVSIIEG-LPAHSLVVEVRVTDADTHSNMIHCKLVDYNDLFYLDS------PSKFNTLL------------NYKPFNLKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPIIVTDRDSGLNGKFEFYLEDFRNFSDSSD--------FLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSS-STITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLRTRKPLDRETLESISIKVTAKN-------PNKYSSHFVRNTD------SEVDVMIKVMDVNDNAPKFIPRLNMKQKVEFIVEQF--VDGN-----------------------------------------------TCTELPYTVQDIDDGGINGQNCCYTILENDYNKLFSLMTDTPSYICLQRKPEKYQSYTVTLIARDRPPNVEGGLTSKISFPVLIINDP---HSKISTS 2513
             ++L+ IT+ EN     V+ +L   L    +  LP    ++ S+ E          PF L+ + +I+    ++REA+C+    E                +    C  + CC+L+    L +PT  P TF++ + + D ND APQF  +  P+  + E+V + + I LP AVD DS +YSV  Y +    H + +H F + V+N+N                              RP L     LD E  + Y F L A D  ++ +          + S  I I+I D NDN P FN   Y   I EN     +++F V+D D G NG + V I D +    + F++                       F   FL+L++ LD E  P +  F L+ATD G PSLSS A V IH+ N+NDN P I F   G  ++ N +S+ E   P  SLVV V VTDAD+  + I C++    ++F L+       PS  N  +            +Y+ F L+T +++DRE+   S   +T++CTD + S+ ++ N SL++ + DVND+ P F ++ Y G V EN  +  V+   P+ VTD D G N    F L D +N ++ SD        F  D  SG+I+T   LD E KNK+R  +   D G     SS + I + V D NDNAP F+ +HY+F V EN   G +IG ++A+D D    N+ ++YS+  + +      IDR TG LRTR+P+DRE+  SIS+ VTA+N        N  S     NT       +E  +++ +++VNDN P+F      +  + FI EQ   V G+                                                C  LP+ V D D    N   CC   L +D++ LF+LM + P+ +C  R+P + +SY +TLIA+D   N    L+S++ F V+I +DP   HS+  TS
Sbjct:   30 GQLLERITVLENSPVNTVILDLRSALVRHGEGQLPPNATAYASQQET-------FWPFVLE-DFIIKLGRPLDREAICKRQKSELRSETEVGMNDHLFFGQSSDGCLPETCCQLLHVNILPSPTALPKTFYVQVAVQDVNDNAPQFPPVHSPYTTVLEDVGIDEKIWLPQAVDPDSSRYSVTDYRIESWVHGNASH-FHMGVSNENGLSEPNFSRESHFPLQISGEGIHGRAFSLGRPFLKPTGPLDRESCDLYAFTLIAIDGGDQIVSDKYAENRAQTGSVNIVIKIADKNDNKPIFNSALYEVKIVENVMASTVLEFEVTDNDIGDNGRIAVTIQDPSGHAQRLFRVGLHPITNTNTHSISAAASSSTGSFYKGFLQLVSHLDAERHPAILRFALVATDFGQPSLSSHASVHIHIVNVNDNAPHIAFFSRGRRLTDNRISLPENDTPPLSLVVLVHVTDADSPVSQIRCRITHEAEVFSLEEANGSGYPSHRNDAMFEPVVESRGIVASYRQFALRTKSELDRETK--SNYMVTVACTDDDGSQSLSRNASLHVTVTDVNDHIPTFDRKFYSGRVAENLASAEVHLSSPMRVTDADLGANALLTFSLRDVKNGTELSDPGRNESLYFRTDARSGRIWTVIPLDCEIKNKYRLLLFVHDSGSPVSHSSSALIEVTVEDSNDNAPEFTSAHYLFEVPENSPGGSEIGRVEAVDHDVTEVNRKLYYSLRGRPEDLHLISIDRNTGVLRTRRPIDRESRSSISLLVTAENELPVRVVTNPGSGVSGSNTQTGQRLSAEASLVVTILNVNDNKPEFTLIEPHRSHITFIWEQLGVVPGSNETGPNQSFNETTETSKISNSGSEYEEKLSTTDQSRSQKLFVLNPSPVCERLPHRVTDKDISPENNFECCILELLDDFDGLFALMPEAPNVLCAMRRPPRPKSYKLTLIAKDGLTN--DSLSSQVHFTVVIRSDPNLRHSEAHTS 997          
BLAST of Protocadherin Fat 1 vs. TrEMBL
Match: A0A183A7P0 (Uncharacterized protein OS=Echinostoma caproni OX=27848 GN=ECPE_LOCUS2975 PE=4 SV=1)

HSP 1 Score: 375.17 bits (962), Expect = 4.358e-109
Identity = 290/950 (30.53%), Postives = 450/950 (47.37%), Query Frame = 3
Query:   87 SEVLKTITITENDMSIQVLANLTEILA--SKTNLP---HSFLSKVEIVSLLENDLPPFKLQLNQLIQPNNGVNREAVCRDNPGE-----------------KVRKFCKADLCCKLIGFQYL-TPTD-PGTFFILIKILDQNDKAPQFSSIKRPFFKIPENVEVGKVIDLPMAVDSDSEKYSVRRYSLSYIYHLDQTHDFRLHVTNDNP----------------------------PRPQLIVNSKLDYEKINKYVFRLFAYD-----FDEKSIGNSCST---TIEIEIEDLNDNVPKFNQLTYNANIDENKRDDKLIKFTVSDPDSGRNGIVTVNIVDKTDELSKRFKI-----------------FEIQRNEF--FLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVS-NSVSIIE-GLPAHSLVVEVRVTDADTHSNMIHCKLVDYNDLFYLDSPSKFN------------------TLLNYKPFNLKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPIIVTDRDSGLNGKFEFYLEDFRNFSDSSD--------FLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPL--TSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLRTRKPLDRETLESISIKVTAKN---------PNKYSSHFVRNT----DSEVDVMIKVMDVNDNAPKFIPRLNMKQKVEFIVEQF---------------VDGNTCTE----------------------------------LPYTVQDIDDGGINGQNCCYTILENDYNKLFSLMTDTPSYICLQRKPEKYQSYTVTLIARD 2423
            S++L+ IT+ EN     V+ +L   L    +  LP    ++ S+ E          PF L+ + +I+    ++REA+C+    +                 +    C  + CC+L+    L +PT  P  F+I + + D ND APQF  I  P+  + E+V + + I LP AVD DS +YSV  Y      H + +H F+L +  +N                              RP +     LD E  + Y F L A D       EK   N   T    + I+I D+NDN P F+   Y   + EN     +++F V+D D+G NG + VNI D      + F++                 F  + + +  FL+LI+ +D E  P    F+L+A+D G PSLSS A V+IH+ N+NDN P+I F   G  ++ N +S+ E   P  SLVV V VTDAD+    I C++   +++F L+  +                      + +Y+ F L+T  ++DRE+   S   +TI+CTD E S+ ++ N SL++ I DVND++P+F +++Y G V EN  +  V    P+ VTD D G N    F L D +N ++S D        F  D  SG+I+T   LD ET++K+   ++  D G  P+  +SS+ I + V D NDNAP FS +HY+F + EN   G +IG ++A+D D    N+ + Y +  + +      IDR TG LRTR+P+DRE+  SIS+ VTA+N         P+  S++    T     +E  +++ +++VNDN P+FI     +  + FI EQ                +D    +E                                  LP+ V D D    N  +CC   L +D++ LF+LM + P+ +C  R+P + +SY +TLIARD
Sbjct:   14 SQLLERITVIENSPLNTVILDLRSALVRHGEGQLPPNATAYASQQEA-------FWPFVLE-DFVIKLGRPLDREAICQRQKADMRSSDAQTGIRDHLSYGRPSDSCLPEACCQLLHVNILPSPTALPKAFYIEVAVQDINDNAPQFPPIHSPYTMVREDVGLDEKIWLPQAVDLDSPRYSVIDYRTENWVHGNASH-FQLGIAEENGLSDTIYLETENLPITLSSSMIQTRMPSVGRPFIKPTGPLDREACDTYAFTLIAVDGGDQMISEKHTENRVQTGTVNVVIKIADINDNRPVFDNTFYEVKVVENIVTSSVLEFEVTDNDTGDNGRIAVNIHDPAGHAQRLFRVGLHPITKSSTHSAPADMFSSKGSYYKGFLQLISHIDAERYPATLRFSLVASDMGQPSLSSRANVQIHIINVNDNAPQIAFFSRGRRLADNRISLPEIDTPPLSLVVLVHVTDADSPVAQIRCRITHESEMFSLEEATGSGYSNVRHEALYEPVIEPRGIVASYRQFALRTKAELDRETK--SHYTVTIACTDEEGSQSLSRNASLHVTITDVNDHSPVFDRKVYSGRVAENMASAEVYLSSPMRVTDADLGANALLTFSLLDVQNGTESIDPSRNESLFFRTDSRSGRIWTVIPLDCETRSKYTLMLVVCDSG-SPVARSSSALIHVTVEDSNDNAPEFSSAHYLFEIPENSPGGTEIGRVEAVDHDVTEVNRKLHYILRGRPEDLHLISIDRNTGVLRTRRPIDRESRSSISLLVTAENEVPIRLITTPDSSSTNSAAQTTHRLSAEASLVVTILNVNDNRPEFILIEPHRSHITFIWEQLGVVPEPNETAQNRSDIDIARTSESSVSEAKSIEQTLSSDQSRARKLFAQNPSPVCERLPHRVTDKDMTPENNFDCCILELLDDHDGLFALMPEAPNVLCAMRRPPRPKSYKLTLIARD 951          
BLAST of Protocadherin Fat 1 vs. TrEMBL
Match: A0A5J4NYA9 (Protocadherin delta 1 OS=Paragonimus westermani OX=34504 GN=DEA37_0003620 PE=4 SV=1)

HSP 1 Score: 374.015 bits (959), Expect = 8.251e-106
Identity = 297/942 (31.53%), Postives = 447/942 (47.45%), Query Frame = 3
Query:  240 PFKLQLNQLIQPNNGVNREAVCRDNPG--EKVRKF------------------CKADLCCKLIGFQYL-TPTD-PGTFFILIKILDQNDKAPQFSSIKRPFFKIPENVEVGKVIDLPMAVDSDSEKYSVRRYSLSYIYHLDQTHDFRLHVTNDNPP--------------------RPQLIVNSKLDYEKINKYVFRLFAYDFDEKSIGN--------SCSTTIEIEIEDLNDNVPKFNQLTYNANIDENKRDDKLIKFTVSDPDSGRNGIVTVNIVDKTDELSKRFKIF--EIQRN----------------------EFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIK-FKKLGFSVSNSVSIIE-GLPAHSLVVEVRVTDADTHSNMIHCKLVDYNDLFYLD-----------SPSKFNTLL-------NYKPFNLKTINKIDRESNH----GSF-----------LRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPIIVTDRDSGLNGKFEFY---LEDFRNFSDSSD--------FLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGY-QPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLRTRKPLDRETLESISIKVTAKN------PNKYSSHFVRNTDSEVD----------------VMIKVMDVNDNAPKFIPRLNMKQKVEFIVEQF---------------------------------------------VDGN-TCTELPYTVQDIDDGGINGQNCCYTILENDYNKLFSLMTDTPSYICLQRKPEKYQSYTVTLIARDRPPNVEGGLTSKISFPVLIINDPHS 2498
            PF L  N +I+ +  ++REA+CR N      +R+                   C    CC+L+    + +PT  P +FF+ I + D ND  P+F S+  PF  + E++++ + I LP A D DS ++SV  Y      H +QTH F L V ++ P                     +P L V   LD E  + Y F L A D  +++           + S  I I +ED+NDN P F+   Y A + EN     +I+FTV D D G NG VTV+I D +    + F+I    IQ++                        +L+LIN +D E  P    F+ +A D G PSLSS A+V+I + N+NDN P I  F K    +   +S+ E   P  ++VV V VTD D+    I C++   +D F L+           S + F T L       NY+ F ++TI ++DRE+N     G+F            ++T+ CTD+E    +T N SL I + DVND++P F +  Y G V EN     V+   P+ VTD DSG N    F    L+D  N +DSS         F ID  SG+I+T   LD E+K+++   +IA D G   P + S+T+ I V D NDNAP F+ SHY+F + EN   G ++G ++AID D    N+ + +S+  + +      IDR +G +RTR+P+DRE+  SIS+ VTA+N      P+  SS    +T   V+                ++I +++VNDN P+F      +  + FI EQ                                              +D +  C  L + V D D    +  +CC   L +D++ LF+LM + P+ +C+ +KP K +SY +TLIA+D P N    L+S++ F V+I +DP+S
Sbjct:   77 PFVLD-NFVIKLSRPLDREAICRQNQQVYTNLRRLNIPVNIPVSYQQAGGENGCMPGACCQLLHVNIVPSPTALPKSFFVQIVVQDVNDNPPRFPSVHSPFTVLREDIDLEQRIWLPQASDPDSPQFSVTEYRTENWIHGNQTH-FMLGVADELPTGSDSDLLPTTALVGLSPGMGKPYLTVTGPLDRETCDIYAFTLVAVDGGDRNTATPNLPNRALTGSVNIVIHLEDVNDNRPVFDSAQYKAKVIENSMTVNVIEFTVVDKDVGENGRVTVSIQDPSGYAQRLFRIGLQPIQKHFTQPSSSTSRAGPSNLKAESIYRGYLQLINHIDAERSPATLRFSFVANDFGQPSLSSRAEVQIQVVNVNDNAPNIAYFSKGKRLIDGRISLPEVNTPPRAIVVLVHVTDEDSPVTPIRCQMAQESDTFSLEEASGSLIQPFRSEAMFETALESRGIVANYRQFAIRTIKELDRETNSHYVVGAFYPKGRVDFNYRFKVTVECTDAEGVNSLTQNASLYITVTDVNDHSPTFDKSAYNGRVAENSPTAEVHLSSPMRVTDADSGTNALVTFSIFDLDDEDNTTDSSVQLENSSRLFRIDPRSGRIWTAIPLDCESKSQYALLVIATDSGSPNPRSGSATVYITVEDENDNAPEFTTSHYMFQLAENSPGGTEVGRVEAIDRDVTEANRKLRFSLRGRVEDVHLISIDRASGIIRTRRPIDRESRSSISLMVTAENEMPVHLPSVPSSVVPLSTHESVNPNIDSASNNQFSAHASMVINILNVNDNRPEFTLIEAHRSHLTFIWEQLGMTSNVMNTSLSESDNAQDASQKEGEKRIEKVTDTKSTERTRPFGLDSHPVCERLLHKVTDKDVEPDSNADCCILELLDDFDGLFALMPEAPNVLCVMKKPPKPKSYKLTLIAKDGPTN--ESLSSQVHFTVVIRSDPNS 1014          
BLAST of Protocadherin Fat 1 vs. TrEMBL
Match: G4VRE5 (Putative cadherin OS=Schistosoma mansoni OX=6183 GN=Smp_145210 PE=4 SV=1)

HSP 1 Score: 367.081 bits (941), Expect = 2.713e-104
Identity = 272/857 (31.74%), Postives = 425/857 (49.59%), Query Frame = 3
Query:  291 REAVCRDNPG----EKVRKFCKADLCCKLIGFQYLT-PTD-PGTFFILIKILDQNDKAPQFSSIKRPFFKIPENVEVGKVIDLPMAVDSDSEKYSVRRYSLSYIYHLDQTHDFRLHVTNDNP----------------------PRPQLIVNSKLDYEKINKYVFRLFAYDFD---------EKSIGNSCSTTIEIEIEDLNDNVPKFNQLTYNANIDENKRDDKLIKFTVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNS-VSIIE-GLPAHSLVVEVRVTDADTHSNMIHCKLVDYNDLFYLDSPSKFNTLLN-------------------YKPFNLKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPIIVTDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQ-PLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLRTRKPLDRETLESISIKVTAKN-------PNKYSSHF---VRNTDSEVDVMIKVMDVNDNAPKFIPRLNMKQKVEFIVEQF----------VDGNT--------------------------------CTELPYTVQDIDDGGINGQNCCYTILENDYNKLFSLMTDTPSYICLQRKPEKYQSYTVTLIARDRPPNVEGGLTSKISFPVLIINDPHSKISTSGFSNH 2528
            R +V R++P         + C    CCKL+    +T PT+ P  F+I + + D ND  P+F  +  P+  I E++++ + I LP A D+DS++++V  Y      H +Q+H FRL V++ N                        +P L +   LD E I+ Y F L A D           + +   + S +I I+I D+NDN P F Q  Y A + EN  +  +I+F + D D G NG VT+ I D T +    F+ +     +  L++I+ LD E   +L  F L+A D G P LSS  +++I + N+NDN PKI F   G  +S+  +S+ E   P  ++V  V VTD D+    I C L+  +D+F  +     N L +                   YK + ++T    DRE  H  F  +T+ C D E    ++ N SL+I I D+N++ P+F++ I+ G V ENQ++  V+   PI  TD D G+N    + L    N  D++ F ID I+GK++T +SLD E ++++   +IA D G   PL+SS+ I I V D NDN P F  +HY+F V EN   G +IG ++AID D    N+ + Y++    +      IDR +G LRTR+P+DRE+  SIS+ V A+N       P+  + +F   + +  +E  V+I ++++NDN P+F+     +  V F  EQ           ++  T                                C  LP+ V D D    +  +CC   L ++YN LF+L+   PS +C   +P   Q+Y +TLIA+D   N    L+S++ F V+I +DP+ +IS    +NH
Sbjct:   61 RHSVNRNDPSIASYSDTSQVCLPGACCKLLHVNIITSPTELPTPFYIQVAVQDINDNPPRFPPLHTPYIVIREDIKLDEKIWLPQASDADSDQFNVAEYRAINWIHGNQSH-FRLGVSDSNDLNNDFIGDVHEIPSSINLNSHLGKPYLTITEGLDRELIDLYSFTLIAIDGGGNIPVSNTPDMNKALTGSVSIIIKISDVNDNHPTFEQNAYRAEVAENSVNSPIIEFVLIDRDIGDNGRVTIVIDDPTGQAQHLFRTYY----KGSLQIISPLDAERHLNLLRFHLVANDHGQPILSSRCEIQIRIINVNDNPPKIVFLNNGKRLSDGRISLPEVETPQRAIVALVHVTDDDSPIEQIRCHLIKEDDMFSFEETGSTNFLTHQQTQQSYNLFNEAIGIHSTYKQYVIRTRKIPDREEKH--FYTVTVECIDDEGQYALSRNASLHITITDINEHKPIFTKSIFTGQVIENQLHAEVHMLTPIHATDLDVGVNALITYSL---VNPYDTAFFRIDPITGKLWTIQSLDCENRSEYHLVVIARDSGSPVPLSSSANIVITVEDTNDNVPEFLNTHYLFEVAENAPGGTEIGVVEAIDKDVTIINQRVRYNLRGNNEDLKLITIDRNSGTLRTRRPIDRESRSSISLIVEAENEVPIHRSPSARNDNFNTIMNHIGTEASVVITILNLNDNRPEFMLIEPHRSHVTFTWEQLNPLIIPKQNQLNATTVHLKSDNQFGKKEKPIKEENQELSSLENANPVCEPLPHRVIDRDMESDSMLDCCILELLDNYNGLFALIPQAPSVLCAMYRPPSPQTYKLTLIAKDGLTN--DSLSSQVHFTVIIRSDPNLRISERKNNNH 905          
BLAST of Protocadherin Fat 1 vs. TrEMBL
Match: A0A3R7D3G0 (Protocadherin Fat 1 OS=Clonorchis sinensis OX=79923 GN=FAT1 PE=4 SV=1)

HSP 1 Score: 360.147 bits (923), Expect = 8.943e-101
Identity = 271/922 (29.39%), Postives = 425/922 (46.10%), Query Frame = 3
Query:  240 PFKLQ--LNQLIQPNNGVNREAVCRDN----------PGEK-------VRKFCKADLCCKLIGFQYL-TPTD-PGTFFILIKILDQNDKAPQFSSIKRPFFKIPENVEVGKVIDLPMAVDSDSEKYSVRRYSLSYIYHLDQTHDFRLHVTNDNPP--------------------------RPQLIVNSKLDYEKINKYVFRLFAYDFDEKSI--------GNSCSTTIEIEIEDLNDNVPKFNQLTYNANIDENKRDDKLIKFTVSDPDSGRNGIVTVNIVD--KTDELSKRFKIFEIQRNEF----------------------FLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGL--PAHSLVVEVRVTDADTHSNMIHCKLVDYNDLFYLDSPSKFN------------------TLLNYKPFNLKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPIIVTDRDSGLNGKFEFYLEDFRNFSDSSD--------------FLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGY-QPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLRTRKPLDRETLESISIKVTAKN-----------PNK--YSSHFVRNTDSEVDVMIKVMDVNDNAPKFIPRLNMKQKVEFIVEQF--------VDGNT------------------------------------CTELPYTVQDIDDGGINGQNCCYTILENDYNKLFSLMTDTPSYICLQRKPEKYQSYTVTLIARDRPPNVEGGLTSKISFPVLIINDP 2492
            PF L   + +L++P   ++RE VC+ +          PG+            C A  CC+L+    L TPT  P  FFI + + D ND AP+F  I  P+  + E+  + + I LP A+D DS +YSV  Y      H +Q+H F++ V  +                             RP LI  + LD E  + Y F L A D  +++           + S  + I++ D+NDN P F++  Y A I EN     +  F V D D G NG V+++I D  +T E + R  +  +    +                      +++LI+ +D E  P   +F+L+A+D G PSLSSSA V+I + N+NDN P I F   G  +++   ++  +  P  SLVV V VTD D+  +   C++V   ++F LD  S                      + +Y+ + ++T  ++DRE+   S+  +T+ CTD+E    +  N SL+I + D ND+ P+F +  Y G V EN     V F  PI VTD D G N    F + D  N ++ +               F ID  SG+I+T  +LD E KN++   ++  D G  +  +S++ + ++V D+NDN P FS +HY F V EN   G +IG ++A D D    N+ + Y +  + D      I+R TG LRTR+P+DRE+  SI++  TA+N           PN+    +     T +  ++++ V++VNDN P+F      +  V FI EQ         VD  +                                    C  LP+ V D D        CC   L+ D++ LF+LM + P+ +C+ R+P    SY + LIA+D   N    L++++ F V+I +DP
Sbjct:   77 PFALDNFVLRLVRP---LDREVVCQLHQQKFHRLDKPPGQNPPLSASLANDGCLAGACCQLLHVNILPTPTALPKAFFIQVVVQDVNDNAPRFPVIHSPYTVVHEDSGLEERIWLPQAIDPDSPQYSVTEYRTENWVHGNQSH-FQIGVDEERATSVTPKDQYSQLYGVPVVQRMATTASGRPYLIPTAPLDRELCDLYAFTLIAVDGGDRNAIDVTAPNRALTGSVYVVIKVADVNDNRPTFDRSHYEAKIVENFMPANVFTFDVVDKDIGENGRVSISIQDTSRTAEQTFRVSLQAVHSPTYQSSGSHHTKQHQTLTGGSHYRGYVQLISRIDAERFPPFLQFSLVASDFGKPSLSSSADVQIQIININDNAPNIAFFSRGKRLTDGRILLPEVTTPPRSLVVLVHVTDEDSPISQFRCQIVSETEMFSLDEASSHGFPSYHSDVTFESPLESRGIVASYRQYAIRTKKELDRETK--SYYVVTVECTDAEGVNSLARNASLHITVTDENDHNPVFDKLNYHGRVQENSPAAEVQFSSPIKVTDADIGPNALLTFLISDLDNTTEQAADFSKLAISRNGSQYFRIDPRSGRIWTTVALDCEVKNQYDLLVVVHDSGLPESRSSTANLIVSVEDVNDNVPEFSSAHYTFEVAENAPPGTEIGRVEATDKDATEPNRKLRYGLTGRADDLHLVSINRNTGVLRTRRPIDRESRSSITLTATAENELPVRASLSLSPNRPLGPTELAAETIARTNIVLNVLNVNDNRPEFTLIEPHRSHVTFIWEQLSSLPNTTNVDSKSLKNGRQESLSVKKNGMGTQTEAKDMLSVNAINVSPVCERLPHRVTDKDVEQDGNSECCVLQLQEDFDGLFALMPEAPTVLCMTRRPPVPTSYKLVLIAKDGTAN--DSLSAQVQFTVVIRSDP 990          
BLAST of Protocadherin Fat 1 vs. Ensembl Cavefish
Match: pcdh1a (protocadherin 1a [Source:ZFIN;Acc:ZDB-GENE-091116-32])

HSP 1 Score: 209.534 bits (532), Expect = 1.299e-54
Identity = 186/633 (29.38%), Postives = 296/633 (46.76%), Query Frame = 3
Query:  417 IKILDQNDKAPQFSSIKRPFF--KIPENVEVGKVIDLPMAVDSDSEKYSVRRYSLSYIYHLDQTHDFRLHVTNDNPPR-PQLIVNSKLDYEKINKYVFRLFAYDFDEKSIGNSCSTTIEIEIEDLNDNVPKFNQLTYNANIDENKRDD-KLIKFTVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSV-SNSVS-IIEGLPAHSLVVEVRVTDADTHSNMIHCKLVDYNDLFYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPIIVTDRDSGLNGKFEFYLEDFRNFSDSSD---FLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLRTRKPLDRETLESISIKVTAKNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAP-----------KFIPRLNMKQKVEFIVEQFVDGNTCTELPYTV 2255
            I++ D ND  PQF S   P     + EN  +G    +P A D D+E+  V +Y LS     + +  F L + ND   + PQLIV   LD E  + Y   + A D    S     S  + + I D NDN P+F + +Y A + EN      +++   +D D G NG +   I   +D + K   + +I+R+   + +   LD E +   F+F ++A D+G    SS+  V I + + NDN P ++ + +G    S+ V+ I E +P  + V  V+V+D D   N +   +V  +  F L  P+  +++ N K + L+T   +D E       R+ I   DS      +TN SL +Q+ D NDN+P+FS  ++     E            +I  D DSG N +  + +      +DSS    F ID  SG++  +  LD E K ++ F++ A DKG      ++T+ I VLD NDN P+F  S Y F+V EN+     +G +  +D D   +N  +  S+EP   +   F +   TG + +    DRE   S + ++ A +  +          S V V I V+D NDNAP           +  P       VE +  + +D  +  EL Y++
Sbjct:  155 IEVQDINDNTPQFPS---PVLTLSVQENAHMGATFAIPQATDRDTERNGVLKYDLSA--GPEASALFSLQMANDRGEKLPQLIVLGNLDRELKDSYDLTINAVDGGTPS--RYSSALLRVVITDANDNAPQFEKSSYEAEVSENSPVGYSVLQVKANDSDLGPNGEIEYTIHQASDPVPK---MLQIERSTGIISVKGPLDRE-EISSFKFHVIARDKGPSPKSSTTYVSIEVTDQNDNAPAVEIRGIGLRTHSDGVANISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDVPFQL-RPAGDSSVDNKKKYFLQTTTPLDYERIRD--YRVEIVAVDSGNPALSSTN-SLRVQVTDTNDNSPIFSPPLFEVEFAEENQPGEKVLD--VIALDADSGTNAELVYSI-----IADSSTRGLFEIDPSSGEVRARSPLDREHKERYEFRVTAADKGVPSHRGTATVVIKVLDRNDNDPKFMLSSYSFSVLENMPPLSPVGMVTVLDMDKG-ENAQVQLSVEPDVGN---FVVQNGTGTILSSISFDREKESSYTFRLKAVDGGEPPR------SSYVGVTINVLDENDNAPVVTKPSNSSFRRLSPLAAPDSVVEVVEAEDIDYGSNAELVYSI 755          

HSP 2 Score: 120.168 bits (300), Expect = 5.892e-27
Identity = 155/602 (25.75%), Postives = 264/602 (43.85%), Query Frame = 3
Query:  384 TPTDPGTFFILIKILDQNDKAPQF--SSIKRPFFKIPENVEVGKVIDLPMAVDSDSEKYSVRRYSLSYIYHLDQTHDFRLHVTNDNPPRPQLI----------VNSKLDYEKINKYVFRLFAYDFDEKSIGNSCSTTIEIEIEDLNDNVPK-----FNQLTYN---ANIDENKRDDKLIKFT-VSDPDSGRNGIVTVNIV-DKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDADTHSN--MIHCKLVDYN--DLFYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPII-VTDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSE-SHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLRTRKPLDRE--TLESISIKVTAKN-PNKYSSHFV 2096
            TP+   +  + + I D ND APQF  SS +    ++ EN  VG  +    A DSD                 +   ++ +H  +D  P P+++          V   LD E+I+ + F + A D        S +T + IE+ D NDN P          T++   ANI E+      +    VSD D G N +VT  +  D   +L          + ++FL+    LDYE     +   ++A D G P+LSS+  +++ + + NDN P   F    F V  +    E  P    V++V   DAD+ +N  +++  + D +   LF +D  S            ++  + +DRE       R+T +     PS + T   ++ I++ D NDN P F    Y         N+    P  ++ V D D G N + +  +E      D  +F++   +G I +  S D E ++ + F++ A+D G  P +S   +TINVLD NDNAP  ++ S+  F     ++    +  +   +D     N ++ YSI     H  ++ I    G+++  K L R+   L  + +KV+ +  P++++   V
Sbjct:  256 TPSRYSSALLRVVITDANDNAPQFEKSSYE---AEVSENSPVGYSVLQVKANDSD--------------LGPNGEIEYTIHQASD--PVPKMLQIERSTGIISVKGPLDREEISSFKFHVIARDKGPSP--KSSTTYVSIEVTDQNDNAPAVEIRGIGLRTHSDGVANISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDVPFQLRPAGDSSVDNKKKYFLQTTTPLDYERI-RDYRVEIVAVDSGNPALSSTNSLRVQVTDTNDNSP--IFSPPLFEVEFAE---ENQPGEK-VLDVIALDADSGTNAELVYSIIADSSTRGLFEIDPSSG----------EVRARSPLDREHKERYEFRVT-AADKGVPSHRGTA--TVVIKVLDRNDNDPKFMLSSY---SFSVLENMPPLSPVGMVTVLDMDKGENAQVQLSVE-----PDVGNFVVQNGTGTILSSISFDREKESSYTFRLKAVDGGEPPRSSYVGVTINVLDENDNAPVVTKPSNSSFRRLSPLAAPDSVVEVVEAEDIDYGSNAELVYSIAGGNPHELFY-ISPSDGEIKLTKELTRKHGGLHRLVVKVSDRGKPSRHAIALV 807          
BLAST of Protocadherin Fat 1 vs. Ensembl Cavefish
Match: pcdh1a (protocadherin 1a [Source:ZFIN;Acc:ZDB-GENE-091116-32])

HSP 1 Score: 207.994 bits (528), Expect = 1.855e-54
Identity = 186/633 (29.38%), Postives = 296/633 (46.76%), Query Frame = 3
Query:  417 IKILDQNDKAPQFSSIKRPFF--KIPENVEVGKVIDLPMAVDSDSEKYSVRRYSLSYIYHLDQTHDFRLHVTNDNPPR-PQLIVNSKLDYEKINKYVFRLFAYDFDEKSIGNSCSTTIEIEIEDLNDNVPKFNQLTYNANIDENKRDD-KLIKFTVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSV-SNSVS-IIEGLPAHSLVVEVRVTDADTHSNMIHCKLVDYNDLFYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPIIVTDRDSGLNGKFEFYLEDFRNFSDSSD---FLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLRTRKPLDRETLESISIKVTAKNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAP-----------KFIPRLNMKQKVEFIVEQFVDGNTCTELPYTV 2255
            I++ D ND  PQF S   P     + EN  +G    +P A D D+E+  V +Y LS     + +  F L + ND   + PQLIV   LD E  + Y   + A D    S     S  + + I D NDN P+F + +Y A + EN      +++   +D D G NG +   I   +D + K   + +I+R+   + +   LD E +   F+F ++A D+G    SS+  V I + + NDN P ++ + +G    S+ V+ I E +P  + V  V+V+D D   N +   +V  +  F L  P+  +++ N K + L+T   +D E       R+ I   DS      +TN SL +Q+ D NDN+P+FS  ++     E            +I  D DSG N +  + +      +DSS    F ID  SG++  +  LD E K ++ F++ A DKG      ++T+ I VLD NDN P+F  S Y F+V EN+     +G +  +D D   +N  +  S+EP   +   F +   TG + +    DRE   S + ++ A +  +          S V V I V+D NDNAP           +  P       VE +  + +D  +  EL Y++
Sbjct:  119 IEVQDINDNTPQFPS---PVLTLSVQENAHMGATFAIPQATDRDTERNGVLKYDLSA--GPEASALFSLQMANDRGEKLPQLIVLGNLDRELKDSYDLTINAVDGGTPS--RYSSALLRVVITDANDNAPQFEKSSYEAEVSENSPVGYSVLQVKANDSDLGPNGEIEYTIHQASDPVPK---MLQIERSTGIISVKGPLDRE-EISSFKFHVIARDKGPSPKSSTTYVSIEVTDQNDNAPAVEIRGIGLRTHSDGVANISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDVPFQL-RPAGDSSVDNKKKYFLQTTTPLDYERIRD--YRVEIVAVDSGNPALSSTN-SLRVQVTDTNDNSPIFSPPLFEVEFAEENQPGEKVLD--VIALDADSGTNAELVYSI-----IADSSTRGLFEIDPSSGEVRARSPLDREHKERYEFRVTAADKGVPSHRGTATVVIKVLDRNDNDPKFMLSSYSFSVLENMPPLSPVGMVTVLDMDKG-ENAQVQLSVEPDVGN---FVVQNGTGTILSSISFDREKESSYTFRLKAVDGGEPPR------SSYVGVTINVLDENDNAPVVTKPSNSSFRRLSPLAAPDSVVEVVEAEDIDYGSNAELVYSI 719          

HSP 2 Score: 119.013 bits (297), Expect = 1.054e-26
Identity = 155/601 (25.79%), Postives = 262/601 (43.59%), Query Frame = 3
Query:  384 TPTDPGTFFILIKILDQNDKAPQFSSIKRPF-FKIPENVEVGKVIDLPMAVDSDSEKYSVRRYSLSYIYHLDQTHDFRLHVTNDNPPRPQLI----------VNSKLDYEKINKYVFRLFAYDFDEKSIGNSCSTTIEIEIEDLNDNVPK-----FNQLTYN---ANIDENKRDDKLIKFT-VSDPDSGRNGIVTVNIV-DKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDADTHSN--MIHCKLVDYN--DLFYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPII-VTDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSE-SHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLRTRKPLDRE--TLESISIKVTAKN-PNKYSSHFV 2096
            TP+   +  + + I D ND APQF   K  +  ++ EN  VG  +    A DSD        Y+              +H  +D  P P+++          V   LD E+I+ + F + A D        S +T + IE+ D NDN P          T++   ANI E+      +    VSD D G N +VT  +  D   +L          + ++FL+    LDYE     +   ++A D G P+LSS+  +++ + + NDN P   F    F V  +    E  P    V++V   DAD+ +N  +++  + D +   LF +D  S            ++  + +DRE       R+T +     PS + T   ++ I++ D NDN P F    Y         N+    P  ++ V D D G N + +  +E      D  +F++   +G I +  S D E ++ + F++ A+D G  P +S   +TINVLD NDNAP  ++ S+  F     ++    +  +   +D     N ++ YSI     H  ++ I    G+++  K L R+   L  + +KV+ +  P++++   V
Sbjct:  220 TPSRYSSALLRVVITDANDNAPQFE--KSSYEAEVSENSPVGYSVLQVKANDSDLGPNGEIEYT--------------IHQASD--PVPKMLQIERSTGIISVKGPLDREEISSFKFHVIARDKGPSP--KSSTTYVSIEVTDQNDNAPAVEIRGIGLRTHSDGVANISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDVPFQLRPAGDSSVDNKKKYFLQTTTPLDYERI-RDYRVEIVAVDSGNPALSSTNSLRVQVTDTNDNSP--IFSPPLFEVEFAE---ENQPGEK-VLDVIALDADSGTNAELVYSIIADSSTRGLFEIDPSSG----------EVRARSPLDREHKERYEFRVT-AADKGVPSHRGTA--TVVIKVLDRNDNDPKFMLSSY---SFSVLENMPPLSPVGMVTVLDMDKGENAQVQLSVE-----PDVGNFVVQNGTGTILSSISFDREKESSYTFRLKAVDGGEPPRSSYVGVTINVLDENDNAPVVTKPSNSSFRRLSPLAAPDSVVEVVEAEDIDYGSNAELVYSIAGGNPHELFY-ISPSDGEIKLTKELTRKHGGLHRLVVKVSDRGKPSRHAIALV 771          
BLAST of Protocadherin Fat 1 vs. Ensembl Cavefish
Match: pcdh1b (protocadherin 1b [Source:ZFIN;Acc:ZDB-GENE-091015-2])

HSP 1 Score: 205.682 bits (522), Expect = 9.397e-54
Identity = 190/636 (29.87%), Postives = 297/636 (46.70%), Query Frame = 3
Query:  417 IKILDQNDKAPQFSSIKRPFFK--IPENVEVGKVIDLPMAVDSDSEKYSVRRYSLSYIYHLDQTHDFRLHVTNDNPPR-PQLIVNSKLDYEKINKYVFRLFAYDFDEKSIGNSCSTTIEIEIEDLNDNVPKFNQLTYNANIDENKR-DDKLIKFTVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNS--VSIIEGLPAHSLVVEVRVTDADTHSNMIHCKLVDYNDLFYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPIIVTDRDSGLNGKFEFYLEDFRNFSDSSD---FLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLRTRKPLDRETLESISIKVTA---KNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAP----------KFI-PRLNMKQKVEFIVEQFVDGNTCTELPYTV 2255
            I+I D+ND  PQF S   P  +  IPEN  VG    +P+A+D D+    +  Y L+     D  + F L V ++   + PQLIV   LD E+ + Y   +     D  +     S  + I I D NDNVPKF +  Y   + EN      +++   +D D G NG VT +    +  + +   +  I  N   +++  S+D E  P L +F++ A D G  + SS A V I +K+ NDN P I+ +  G         ++ E +P  + V  V V+D D   N +   +V  +  F L S S  ++    K F L+T   +D E       RI I   DS      +TN SL +Q+ D+NDNAP+FS  +Y  +  E            ++ TD DSG N +  + +      +DS+    F I+  +G++     LD E K ++ F + A DKG   L  ++T+ + VLD NDN P+F  + Y F+V EN+     +G +  ID D   +N  +  S+EP+   +  F I   TG + +    DRE   + + ++ A    +P +          S V + I V+D NDNAP          KF+ P  +   +VE +  + +D     EL Y++
Sbjct:  131 IEIQDENDNTPQFPS---PILELAIPENTYVGAHYSIPVAMDKDAGSNGIADYKLNS--GSDAMNLFSLQVADNTDEKVPQLIVLGNLDREQRDTYDLSIKV--IDGGTPPRYSSALLRITITDTNDNVPKFERSHYEGEMAENTPVGQSVLQVKANDDDLGANGQVTYSFHQPSPNVQR---LLHIDHNTGIIQVKGSVDREEVP-LLKFSVQARDNGPQAKSSKAMVTITVKDRNDNAPSIRIRGFGLVAHEDGIANVSEDMPVGTPVALVEVSDKDEGENAVVTCVVAGDVPFQLRSASASDSTSKRKYF-LQTTTPLDYE--RIKEYRIEIVAVDSGNPALSSTN-SLKVQVTDMNDNAPVFSPSLYEVDFAEENQPGDKVLD--VVATDADSGTNAELLYSI-----ITDSATKGLFDINPNTGEVRVMNQLDREYKERYEFHVEAADKGVPSLKGTATVVVRVLDRNDNDPKFMLNGYSFSVLENMPPLSPVGMVTVIDADKG-ENAHVQLSVEPE---NGKFVIQNGTGTILSSISFDREKESTYTFRLKAVDGGDPPR---------SSYVGITINVLDENDNAPYVTKPSNSSYKFLQPLTSPDTRVEKVDAEDIDTGLNAELVYSI 731          

HSP 2 Score: 118.242 bits (295), Expect = 2.168e-26
Identity = 162/607 (26.69%), Postives = 265/607 (43.66%), Query Frame = 3
Query:  348 DLCCKLIGFQYLTPTDPGTFFILIKILDQNDKAPQFSSIKRPFF--KIPENVEVGKVIDLPMAVDSDSEKYSVRRYSLSYIYHLDQTHDFRLHVTNDNPPRPQLIVNSKLDYEKINKYVFRLFAYDFDEKSIGNSCSTTIEIEIEDLNDNVPK-----FNQLTYN---ANIDENKRDDKLIKFT-VSDPDSGRNGIVTVNIV-DKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVS-NSVSIIEGLPAHSLVVEVRVTDADTHSNMIHCKLVDYNDLFY---LDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPII-VTDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAP---RFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLRTRKPLDRE--TLESISIKVTAKN-PNKYSSHFVR 2099
            DL  K+I     TP    +  + I I D ND  P+F   +R  +  ++ EN  VG+ +    A D D          ++Y +H    +  RL   + N    Q  V   +D E++    F + A D   ++   S    + I ++D NDN P      F  + +    AN+ E+      +    VSD D G N +VT  +  D   +L          + ++FL+    LDYE     +   ++A D G P+LSS+  +K+ + ++NDN P        FS S   V   E       V++V  TDAD+ +N          +L Y    DS +K    +N     ++ +N++DRE        +  +     PS + T   ++ +++ D NDN P F   +  G       N+    P  ++ V D D G N   +  +E      ++  F+I   +G I +  S D E ++ + F++ A+D G  P +S   ITINVLD NDNAP   + S S Y F +    S   ++  + A D DT   N ++ YSI   G+    F I    G++   K   R+   L  + +KV+ K  P+++++  V 
Sbjct:  222 DLSIKVIDGG--TPPRYSSALLRITITDTNDNVPKF---ERSHYEGEMAENTPVGQSVLQVKANDDDLGANG----QVTYSFHQPSPNVQRLLHIDHNTGIIQ--VKGSVDREEVPLLKFSVQARDNGPQA--KSSKAMVTITVKDRNDNAPSIRIRGFGLVAHEDGIANVSEDMPVGTPVALVEVSDKDEGENAVVTCVVAGDVPFQLRSASASDSTSKRKYFLQTTTPLDYERIKE-YRIEIVAVDSGNPALSSTNSLKVQVTDMNDNAPV-------FSPSLYEVDFAEENQPGDKVLDVVATDADSGTNA---------ELLYSIITDSATKGLFDINPNTGEVRVMNQLDREYKERYEFHVE-AADKGVPSLKGTA--TVVVRVLDRNDNDPKF---MLNGYSFSVLENMPPLSPVGMVTVIDADKGENAHVQLSVE-----PENGKFVIQNGTGTILSSISFDREKESTYTFRLKAVDGGDPPRSSYVGITINVLDENDNAPYVTKPSNSSYKF-LQPLTSPDTRVEKVDAEDIDTGL-NAELVYSIT-GGNPHGLFRISSTDGEITLAKEFTRKHNGLHRLVVKVSDKGKPSRHTTALVH 784          

HSP 3 Score: 86.6557 bits (213), Expect = 1.201e-16
Identity = 81/268 (30.22%), Postives = 119/268 (44.40%), Query Frame = 3
Query: 1386 FLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIY-IGXXXXXXXXXXXXFPKPIIVTDRDSGLNGKFEFYL---EDFRN-FSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSI-EPKGDHSSYFDIDRYTGDLRTRKPLDRETLESISIKVTAKN--PNKYSSHFVRNTDSEVDVMIKVMDVNDNAPKF 2165
            FL   +S TD          E   I+I+D NDN P F   I  +   +   V    + P   +  D+D+G NG  ++ L    D  N FS       D+   ++    +LD E ++ +   I  ID G  P  SS+ + I + D NDN P+F  SHY   + EN  VG  +  ++A DDD    N  + YS  +P  +      ID  TG ++ +  +DRE +  +   V A++  P   SS  +        V I V D NDNAP  
Sbjct:  108 FLEFEVSITDLMKGSGPRLIEG-RIEIQDENDNTPQFPSPILELAIPENTYVGAHYSIP---VAMDKDAGSNGIADYKLNSGSDAMNLFSLQVADNTDEKVPQLIVLGNLDREQRDTYDLSIKVIDGGTPPRYSSALLRITITDTNDNVPKFERSHYEGEMAENTPVGQSVLQVKANDDDLG-ANGQVTYSFHQPSPNVQRLLHIDHNTGIIQVKGSVDREEVPLLKFSVQARDNGPQAKSSKAM--------VTITVKDRNDNAPSI 362          
BLAST of Protocadherin Fat 1 vs. Ensembl Cavefish
Match: dchs1b (dachsous cadherin-related 1b [Source:ZFIN;Acc:ZDB-GENE-050208-41])

HSP 1 Score: 195.282 bits (495), Expect = 9.226e-50
Identity = 204/698 (29.23%), Postives = 301/698 (43.12%), Query Frame = 3
Query:  402 TFFILIKILDQNDKAPQFSSIKRPFFKIPENVEVGKVIDLPMAVDSDSEKYSVRRYSLSYIYHLDQTHDFRLHV--TNDNPPRPQLIVNSKLDYEKINKYVFRLFAYDFDEKSIGNSCSTTIEIEIEDLNDNVPKFNQLTYNANIDEN-KRDDKLIKFTVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDAD--THSNMIHCKLVDYNDLFYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPIIVTDRDSGLNGKFEF-YLEDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHS--SYFDIDRYTGDLRTRKPLDR-ETLESISIKVTAKNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAPKFIPRLNMKQKVEFIVEQFVDGNTCTELPYTVQDIDDGGINGQNCCYTILENDYNKLFSLMTDTPSYICLQRKPEKYQSYTVTLI--ARDRPPNVEGGLTSKI 2462
            T  + I + D ND AP F   K+   KIPE   VG    L  A D+D ++ + + Y    I   +    FRL      +      L+VN  LD EK   Y   L A  FD  S   +   T+++ ++D+ND+ P FNQ  Y A I E+  +   +++   SD D G NG+V   I  +    S   + F I      + L   LDYE    + E  + A D  +    ++A V IH+++ NDN P +    +  S   S  I EG      V  + V+D D   +SN ++  L   +  F L +      L+            +DRE      LR+  + + + P R      S  IQ+ DVNDN P+F QQ Y       +V    +F   +   D+D G NG   +  L D    SD   F ID ++G I T   LDYET      K++A D G  PL+S++ + I++ D+NDN P F  S Y  ++ EN + G     + A D D       + YS+      S  + F I++ TG + T   LDR E  +S    VTA +    SS  V        V + + D+NDN P F P       V + V         T +        DGG NG+   Y  +    +  F+L  DT   I L R      +  + ++  A+D      GGLT+ +
Sbjct:  127 TVEVSITVNDINDHAPVFPK-KKASLKIPEQTAVGTKFSLEPATDADKDQLTTQGY---LIKEGNVGQVFRLETKRATNKVLYLDLVVNGVLDREKRASYSLLLEA--FDGGSPKKTGQMTLDVTVQDINDHAPIFNQSRYRAIISESLPQGSNILQVFASDADEGDNGLVLYEINRRQ---SDPDRYFVIDPRSGIITLNKPLDYEVR-KVHELVVQARDNASHPEITNAFVTIHVRDFNDNQPTMTI--IFLSEDGSPRISEGAQPGQYVARISVSDPDYGEYSN-VNVSLEGGDGKFALTTKDSIIYLIYVD-------QVLDREERDSYELRVMATDSGTPPLR---AESSFTIQVTDVNDNPPLFDQQAY--KQTIPEVVYPGSFVLQVTARDKDHGPNGDVLYSILPDRGTHSDW--FTIDPVTGIITTATQLDYETYPNPSVKVVATDGGKPPLSSTALVEISLQDINDNEPVFGSSVYNVSIKENTAAGTCFLEVTASDADGGSFGA-VAYSLGSGAGSSPPTRFSINKETGQICTSAALDRDEGADSFEFTVTAADGGGLSSSAV--------VKVSLQDINDNRPTFYP-------VNYAVSLSSQSAPGTSVIRVTAHDPDGGENGK-VTYRTVPGGGSNFFTLNKDT-GVISLSRSLHGKANSVIAMVITAQD-----GGGLTAPV 774          

HSP 2 Score: 177.563 bits (449), Expect = 2.346e-44
Identity = 183/603 (30.35%), Postives = 286/603 (47.43%), Query Frame = 3
Query:  396 PGTFFIL--IKILDQNDKAPQFSSIKRPF-FKIPENVEVGKVIDLPMAVDSD-SEKYSVRRYSLSYIYHLDQTHDFRLHVTNDNPPRPQLIVNSKLDYEKINKYVFRL----FAYDFDEKSIGNSCSTTIEIEIEDLNDNVPKFNQLTYNANIDENKRDDKLIKFTVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDADTHSNMIHCKLVDYNDLFYLDSPSKFNTLLNYKPFNLKTINKI-DRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPIIVTDRDSGLNGKFEFYLEDFRNFSD-SSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFY--SIEPKGDHSSYFDIDRYTGDLRTRKPLDRETLESISIKVTAKNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAPKFI 2168
            P T+ I   I + D ND AP+F   + P    +PEN++ G  I    A D D S   S  RYS+ + Y  D++    L     +P    L +   LD+E+ +     +     A D +++  G   S T  I + D NDN P F+  T  + +++      L+     D D G NG V+  I  +T     RF +     N   L ++ ++D E +   +  T++A D GTP  S++  + + + ++ND  P   F+K  + V     + E  PA + V+ V  TD D  +N      V Y D+         +  +      + ++ K+ DRE        +T+   D           +++I + D NDNAP+F +  Y   + EN   V +     I  TD+DSG +G  E+ +       D   DF +D  SG + T R LD E ++ +  +++A D+G   L+S++T+ I VLD+NDN+P F+ S Y  +V E+ +VG  +  + A D D + +N  I Y  S E +GD    F +D  TG + T  PLDRE   S S +V A +    S    RNT ++V V I  +DVNDNAP FI
Sbjct: 1410 PSTYMIQLDITVQDSNDHAPEFP--EDPVTIVVPENMQPGSSIYTFQAADKDGSGPNSEVRYSIQHRYP-DRSDLLTL-----DPISGVLTLGQALDHEETSSLFLVVRGTDSAVDPNQRRWG---SVTARIFVTDENDNAPIFSSPTAVSVMEDQPVGFVLLYVMARDADQGENGRVSYRI--QTGNAGGRFSL---NPNTGSLSILKAMDRE-EQDSYNLTIIAEDHGTPQHSTTQVLSVQVIDVNDEAPW--FEKSEYEVQ----VRENQPAGTTVLTVSATDRDQGTN----GRVTYGDV-------TVDGFIIAPETGVISLTKVLDREQQ--DHYTVTVYAKDGGMPPNFA-KATVHITVLDENDNAPVFGRLQYSLELPENLEPVELFI---IKATDQDSGDSGHLEYRI----TVGDPDGDFQLDSSSGALSTSRPLDRERRDSYSLEVVAQDRGTPSLSSTATVEITVLDVNDNSPTFTSSSYTVDVSEDAAVGSSLLDVTAKDAD-EGQNGQILYFLSSEARGD----FTVDPDTGRIVTAAPLDREKRASYSFQVCAVD---LSPATPRNTTAQVTVTI--LDVNDNAPFFI 1958          

HSP 3 Score: 162.925 bits (411), Expect = 8.326e-40
Identity = 183/656 (27.90%), Postives = 286/656 (43.60%), Query Frame = 3
Query:  408 FILIKILDQNDKAPQFSSIKRPFF------KIPENVEVGKVIDLPMAVDSDSEKYSVRRYSLSYIYHLDQTHDFRLHVTNDNPPRPQLIVNSKLDYEKINKYVFRLFAYDFDEKSIGNSCSTTIEIEIEDLNDNVPKFNQLTYNANIDENKRDDKLI-KFTVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDADTHSNMIHCKLVDYNDLFYLDS--PSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPIIVTDRDSGLNGKFEFYL--EDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLRTRKPLDRETLESISIKVTAKNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAPKFIPRLNMKQKVEFIVEQFVDGNTCTELPYTVQDID-DGGINGQNCCYTILENDYNKLFSL 2339
            F+ I + D ND  P  + I   F       +I E  + G+ +      D D  +YS    SL       +  D +  +T  +     + V+  LD E+ + Y  R+ A D     +    S TI++   D+NDN P F+Q  Y   I E       + + T  D D G NG V  +I+      S  F I  +      +     LDYET P+     ++ATD G P LSS+A V+I L+++NDN P       G SV N VSI E   A +  +EV  +DAD  S       V Y+      S  P++F+  +N +   + T   +DR+    SF   T++  D      ++++  + + ++D+NDN P F    Y  ++              +   D D G NGK  +        NF     F ++K +G I   RSL  +  +     I A D G      ++ + I+V+  +   P F ++ Y F V E+V  G ++G ++A  +      KDI Y+I   GD   YF +D  TG LRT  PLD E   S+ ++V A + +  +    R       V I + DVNDN P F+P  +    +  + +          + Y VQ  D D G NG+   + +L +   + FS+
Sbjct:  348 FVTIHVRDFNDNQPTMTII---FLSEDGSPRISEGAQPGQYVARISVSDPDYGEYSNVNVSL-------EGGDGKFALTTKDSIIYLIYVDQVLDREERDSYELRVMATDSGTPPLRAESSFTIQVT--DVNDNPPLFDQQAYKQTIPEVVYPGSFVLQVTARDKDHGPNGDVLYSILPDRGTHSDWFTIDPVTG---IITTATQLDYETYPNP-SVKVVATDGGKPPLSSTALVEISLQDINDNEPV-----FGSSVYN-VSIKENTAAGTCFLEVTASDADGGS----FGAVAYSLGSGAGSSPPTRFS--INKETGQICTSAALDRDEGADSF-EFTVTAADGG---GLSSSAVVKVSLQDINDNRPTFYPVNYAVSLSSQSAPGTSVIR--VTAHDPDGGENGKVTYRTVPGGGSNF-----FTLNKDTGVISLSRSLHGKANSVIAMVITAQDGGGLTAPVNARVNISVVAGSVAPPVFEQAQYFFTVSEDVLRGTEVGVVRA--NSRSLATKDISYTIS-SGDPDGYFTVDSETGALRTSLPLDHEARPSLELEVQASSGSPPAFGQTR-------VTITIGDVNDNTPAFLPSYSESLLLPEVTK-------IGSVVYRVQAEDRDSGQNGR-ISFHLLASGGQRAFSV 946          

HSP 4 Score: 142.895 bits (359), Expect = 1.101e-33
Identity = 199/758 (26.25%), Postives = 325/758 (42.88%), Query Frame = 3
Query:  267 IQPNNGVNREAVCRDNPGEKVRKFCKADLCCKLIGFQYLTPTDPGTFFILIKILDQNDKAPQFSSIKRPFFKIPENVEVGKVIDLPMAVDSDSEKYSVRRYSLSYIY--HLDQTHDFRL-HVTNDNPPRPQLIVNSKLDYEKINKYVFRLFAYDFDEKSIGNSCSTTIEIEIEDLNDNVPKFNQLTYNANIDENKRDDKLI-KFTVSDPD-SGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGT---PSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDADTHSNMIHCKLVDYNDLFYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPIIVTDRDSGLNGKFEFYLEDFRNFSDSS--DFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSI---EPKGDHSSYFDIDRYTGDLRTRKPLDRETLESISIKVTAKNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAPKFIPRLNMKQKVEFIVEQFVDGNTCTEL-PYTVQDIDDGGINGQNCCYTILENDYNKLFSLMTDTPSYIC---LQRKPEKYQSYTVTLIARDRPPNVEGGLTSKISFPVLIIND 2489
            + PN G  R +         +R+  K++    +       P    +  + I+IL  +  AP+ +++      + E  + G VI    +V S   +  V    ++Y+     D+   F +  +T D      + +  +LDYEK   Y   +   DF  K+  ++    ++I ++D ND+ P+F +      + EN +    I  F  +D D SG N  V  +I  +  + S    +  I      L L  +LD+E    LF   +  TD           S   +I + + NDN P        FS   +VS++E  P   +++ V   DAD   N      V Y  +   ++  +F+  LN    +L  +  +DRE      L I     +   + Q +T + L++Q+ DVND AP F +  Y   V ENQ          +  TDRD G NG+          + D +   F+I   +G I   + LD E ++ +   + A D G  P  + +T+ I VLD NDNAP F    Y   + EN+    ++  ++A D D+      + Y I   +P GD    F +D  +G L T +PLDRE  +S S++V A++    S        S   V I V+DVNDN+P F           + V+   D    + L   T +D D+G  NGQ   +  L ++    F++  DT   +    L R  EK  SY+  + A D  P      T++++  +L +ND
Sbjct: 1268 LNPNTGELRSS-------SPLRRAEKSEYSITVSASDRGAPPQSSSCVLRIQILGSSRAAPKPNTLSMTLNSV-EGAKPGSVIG---SVRSHDHRDVVLDGQVTYLVVGGTDKDGTFMVDRLTGD------VYLARELDYEKGALYTLNIEVEDF-SKAYPSTYMIQLDITVQDSNDHAPEFPEDPVTIVVPENMQPGSSIYTFQAADKDGSGPNSEVRYSIQHRYPDRSDLLTLDPISG---VLTLGQALDHEETSSLF-LVVRGTDSAVDPNQRRWGSVTARIFVTDENDNAPI-------FSSPTAVSVMEDQPVGFVLLYVMARDADQGEN----GRVSYR-IQTGNAGGRFS--LNPNTGSLSILKAMDREEQDSYNLTI---IAEDHGTPQHSTTQVLSVQVIDVNDEAPWFEKSEYEVQVRENQPAGTTVLT--VSATDRDQGTNGRV--------TYGDVTVDGFIIAPETGVISLTKVLDREQQDHYTVTVYAKDGGMPPNFAKATVHITVLDENDNAPVFGRLQYSLELPENLEP-VELFIIKATDQDSGDSGH-LEYRITVGDPDGD----FQLDSSSGALSTSRPLDRERRDSYSLEVVAQDRGTPS------LSSTATVEITVLDVNDNSPTFT-------SSSYTVDVSEDAAVGSSLLDVTAKDADEGQ-NGQILYF--LSSEARGDFTVDPDTGRIVTAAPLDR--EKRASYSFQVCAVDLSPATPRNTTAQVTVTILDVND 1952          

HSP 5 Score: 139.428 bits (350), Expect = 1.067e-32
Identity = 179/709 (25.25%), Postives = 302/709 (42.60%), Query Frame = 3
Query:  384 TPTDPGTFFILIKILDQNDKAPQFSSIKRPFFKIPENVEVGKVIDLPMAVDSDSEKYSVRRYSLSYIYHLDQTHDFRLHVTNDNPPRPQLIVNSK--LDYEKINKYVFRLFAYDFDEKSIGNSCSTTIEIEIEDLNDNVPKFNQLTYNANIDENKR-DDKLIKFTVSDPDSGRNGIVTVNIVD-------KTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDADTHSNMIHCKLVDYNDLF----YLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPIIVTDRDSGLNGKFEFYLEDFRNFSDSSD-FLIDKISGKIFTQRSLDYETKN-KFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDID-----------RYTGDLRTRKPLDRETLESISIKVTAKNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAPKFIPRLNMKQKVEFIVEQFVDGNTCTELPYTVQDIDDGGINGQNCCYTILENDYNKLFSLMTDTPSYICLQR--KPEKYQSYTVTLIARD 2423
            +P       ++I + +Q+ +  +FS   R    I EN   G  +    A   D  +  +  YS   I+  ++   FR+  +       ++ V+S   LD+E   +   RL       ++  +S    + + ++D+NDN+P+F    Y A + E +  D  +I+    D D G NG VT +I         K D LS       I   E +++              +  + ATD+G+P L+ SA + + + +LNDN P I   +        V +    P +SL+         T   M+    VD   +      LD+PS+    ++     +     +D E    S+  +T+  +DS+   +     ++ + + D+NDN P F+Q +Y   V   + +   +    +  TDRDSG NG+  +     R  S S + F ID  +G +F  + ++++ +       I A D+G  PL+S +T+ I + D+NDNAP F +S Y   V E+   G  I TL+A+D D  ++N    ++I   G+  + F I+           +  G L   + LD E +   ++ +        S   V    S V  +I V+DVNDN P F    +  + V  + E    G     L  T QD            Y+I   D  +LFS+   T + + LQR    E   S+ V + A D
Sbjct: 2038 SPAQSSLGVVIIYVKEQDYQGIRFSRTTRDV-SIQENAAKGTAVAQAQAQYPDGTRGGIA-YS---IFSGNRQQSFRISSSTG-----EIWVHSSTGLDFEDTPR--LRLV---VKAETASSSSFMAVNLILQDVNDNLPRFQLQNYVAYMREARGYDSPIIQVVAEDVDQGPNGQVTYSIQSSGRSGLFKIDPLSGSITTAAIMDREIWMQT-------------KLVITATDRGSPKLAGSATLTVIIVDLNDNSPTIPLPR-------EVRV----PENSLI--------GTEITMVTGNDVDSGPVLSYSLRLDTPSQGKFGIHRYSGRVFLTAPLDFEER--SWYTLTVQASDSKHQSE----ANVTVLVGDMNDNVPTFTQDLY--QVTLPEHSPPGSAVVTVTATDRDSGENGRVTY-----RVLSSSREGFYIDPNNGTLFIGQKVEFDPERPSVSVVIEASDRGKPPLSSIATVQIQLTDVNDNAPMFHQSEYRATVSEDQLPGATILTLEAVDVDLSQENSGFDFAIA-SGNVGNAFQIESSVRFIEGHGFQTVGTLILAEQLDFELMSRYNLTIVV------SDRGVPQRSSSVPAVITVIDVNDNPPVF----SHAEYVVALSEGAAAGTEILRLSATDQD----SAPHAEIQYSISSGDEMELFSVDQWTGA-LRLQRPLDRETQPSHVVIIQASD 2670          

HSP 6 Score: 133.265 bits (334), Expect = 8.030e-31
Identity = 166/661 (25.11%), Postives = 275/661 (41.60%), Query Frame = 3
Query:  363 LIGFQYLTPTDPGTFFILIKILDQNDKAPQFSSIKRPFFKIPENVEVGKVIDLPMAVDSDSEKYSVRRYSLSYIYHLDQTHDFRLHVTNDNPPRPQLIVNSK-LDYEKINKYVFRLFAYDFDEKSIGNSCSTTIEIEIEDLNDNVPKFNQLTYNANIDENKRDDKLIKFTVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDADTHSNMIHCKLVDYNDLFYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPIIVTDRDSGLNGK-FEFYLEDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLRTRKPLDRETLESISIKVTAKNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAPKFIPRLNMKQKVEFIVEQFVDGNTCTELPYTVQDIDDGGINGQNCCYTILENDYNKLFSL 2339
            +I   + TP    T  + ++++D ND+AP F   +    ++ EN   G  +    A D D        Y        D T D  +       P   +I  +K LD E+ + Y   ++A D       N    T+ I + D NDN P F +L Y+  + EN    +L     +D DSG +G +   I      +      F++  +   L     LD E     +   ++A D+GTPSLSS+A V+I + ++NDN P         S S +V + E     S +++V   DAD   N           L++L S ++ +  ++     + T   +DRE    +     +   D  P+    T   + + I DVNDNAP F Q   I     ++     +    +   D+D G NG  F  +    R FS      I+ ++G+I T   L   T+++    + A+D+G    +S   + I V + +    RFS +    ++ EN + G  +   QA   D  R    I YSI   G+    F I   TG++        +  ++  +++  K     SS F+        V + + DVNDN    +PR  ++  V ++ E    G     +    +D+D  G NGQ   Y+I  +  + LF +
Sbjct: 1616 IIAEDHGTPQHSTTQVLSVQVIDVNDEAPWFEKSEYEV-QVRENQPAGTTVLTVSATDRDQGTNGRVTYG-------DVTVDGFIIA-----PETGVISLTKVLDREQQDHYTVTVYAKDGGMPP--NFAKATVHITVLDENDNAPVFGRLQYSLELPENLEPVELFIIKATDQDSGDSGHLEYRIT-----VGDPDGDFQLDSSSGALSTSRPLDRERRDS-YSLEVVAQDRGTPSLSSTATVEITVLDVNDNSPTFT------SSSYTVDVSEDAAVGSSLLDVTAKDADEGQNG--------QILYFLSSEARGDFTVDPDTGRIVTAAPLDREKR--ASYSFQVCAVDLSPATPRNTTAQVTVTILDVNDNAPFFIQDPLI-INVSSRSVATNHVVATMKAEDKDFGANGSVFYRFAMPVRGFS------INSLTGEIQTTELLSSLTQSQRTLIVEAMDQGSPAQSSLGVVIIYVKEQDYQGIRFSRTTRDVSIQENAAKGTAVAQAQAQYPDGTRGG--IAYSIF-SGNRQQSFRISSSTGEIWVHSSTGLDFEDTPRLRLVVKAETASSSSFMA-------VNLILQDVNDN----LPRFQLQNYVAYMRE--ARGYDSPIIQVVAEDVDQ-GPNGQ-VTYSIQSSGRSGLFKI 2214          

HSP 7 Score: 130.568 bits (327), Expect = 5.631e-30
Identity = 161/645 (24.96%), Postives = 278/645 (43.10%), Query Frame = 3
Query:  384 TPTDPGTFFILIKILDQNDKAPQFSSIKRPF-FKIPENVEVGKVIDLPMAVDSDSEKYSVRRYSLSYIYHLD--QTHDFRLHVTNDNPPRPQLIVNSKLDYEKINKYVFRLFAYDFDEKSIGNSCSTTIEIEIEDLNDNVPKFNQLTYNANIDENKR-DDKLIKFTVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHS-LVVEVRVTDADTHSNMIHCKLVDYN--DLFYLDSPSKFNTLLNYKPFN-LKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPIIVTDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDK-GYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLRTRKPLDRETLESISIKVTAKNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAPKFIPRLNMKQKVEFIV-EQFVDGNTCTELPYTVQDID-DGGING 2285
            +P   G+  + + I+D ND +P   +I  P   ++PEN  +G  I +    D DS         LSY   LD      F +H  +      ++ + + LD+E+ + Y   + A D   +S  N     + + + D+NDNVP F Q  Y   + E+      ++  T +D DSG NG VT  +      LS   + F I  N   L +   ++++ +       + A+D+G P LSS A V+I L ++NDN P     +   +VS      + LP  + L +E    D    ++     +   N  + F ++S  +F     ++    L    ++D E    S   +TI  +D    ++ ++  ++ I + DVNDN P+FS   Y+  + E            +  TD+DS  + + ++ +    +  +   F +D+ +G +  QR LD ET+      I A D  G+  L   + I + V D+NDN P F       ++ EN      +  L AID DT       ++ ++       +F +D+ TG++R+R+  D E + S      A +          N  + V V + +   ++  P F           F V E    G +  +    VQ +D DGG++G
Sbjct: 2246 SPKLAGSATLTVIIVDLNDNSP---TIPLPREVRVPENSLIGTEITMVTGNDVDSGPV------LSYSLRLDTPSQGKFGIHRYSG-----RVFLTAPLDFEERSWYTLTVQASDSKHQSEAN-----VTVLVGDMNDNVPTFTQDLYQVTLPEHSPPGSAVVTVTATDRDSGENGRVTYRV------LSSSREGFYIDPNNGTLFIGQKVEFDPERPSVSVVIEASDRGKPPLSSIATVQIQLTDVNDNAPMFHQSEYRATVSE-----DQLPGATILTLEAVDVDLSQENSGFDFAIASGNVGNAFQIESSVRFIEGHGFQTVGTLILAEQLDFELM--SRYNLTIVVSDRGVPQRSSSVPAV-ITVIDVNDNPPVFSHAEYVVALSEGAAAGTEILR--LSATDQDSAPHAEIQYSIS---SGDEMELFSVDQWTGALRLQRPLDRETQPSHVVIIQASDGHGHFAL---APINVEVKDINDNRPYFPIQTMTASIRENQPANSAVTVLHAIDQDTGMYGILKYFMVDRSSQGKEFFAVDQNTGEVRSRQAFDFEKVNSFHFMALAVDAG--------NNSATVTVQVYITGEDEYDPAF-----TSSAFSFEVPEGAKKGQSIGQ----VQAVDEDGGVDG 2832          

HSP 8 Score: 129.798 bits (325), Expect = 9.680e-30
Identity = 150/565 (26.55%), Postives = 247/565 (43.72%), Query Frame = 3
Query:  399 GTFFILIKILDQNDKAPQFSSIKRPFFKIPENVEVGKVIDLPMAVDSDSEKYSVRRYSLSYIYHLDQTHDFRLHVTNDNPPRPQLIVNSKLDYEKINKYVFRLFAYDFDEKSIGNSCSTTIEIEIEDLNDNVPKFNQLTYNANIDENK-RDDKLIKFTVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDADTH-SNMIHCKLV--DYNDLFYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPIIVTDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKG-YQPLTSSSTITINVLDLNDNAPRFSESHYIFNV-FENVSVGWKIGTLQAIDDDTDRKNKDIFY--SIEPKGDHSSYFDIDRYTGDLRTRKPLDRETLESISIKVTAKN 2069
            G+    I + D+ND AP FSS       + E+  VG V+   MA D+D  +     Y    I   +    F L     NP    L +   +D E+ + Y   + A D       +S +  + +++ D+ND  P F +  Y   + EN+     ++  + +D D G NG VT   V            F I      + L   LD E   H +  T+ A D G P   + A V I + + NDN P   F +L +S+     + E L    L + ++ TD D+  S  +  ++   D +  F LDS S            L T   +DRE      L + ++     PS  +++  ++ I + DVNDN+P F+   Y  +V E+           +   D D G NG+  ++L          DF +D  +G+I T   LD E +  + F++ A+D     P  +++ +T+ +LD+NDNAP F +   I NV   +V+    + T++A D D    N  +FY  ++  +G     F I+  TG+++T + L   T    ++ V A +
Sbjct: 1524 GSVTARIFVTDENDNAPIFSSPTA--VSVMEDQPVGFVLLYVMARDADQGENGRVSYR---IQTGNAGGRFSL-----NPNTGSLSILKAMDREEQDSYNLTIIAEDHGTPQ--HSTTQVLSVQVIDVNDEAPWFEKSEYEVQVRENQPAGTTVLTVSATDRDQGTNGRVTYGDV--------TVDGFIIAPETGVISLTKVLDREQQDH-YTVTVYAKDGGMPPNFAKATVHITVLDENDNAPV--FGRLQYSLE----LPENLEPVELFI-IKATDQDSGDSGHLEYRITVGDPDGDFQLDSSSG----------ALSTSRPLDRERRDSYSLEV-VAQDRGTPS--LSSTATVEITVLDVNDNSPTFTSSSYTVDVSEDAAVGSSLLD--VTAKDADEGQNGQILYFLSS----EARGDFTVDPDTGRIVTAAPLDREKRASYSFQVCAVDLSPATPRNTTAQVTVTILDVNDNAPFFIQDPLIINVSSRSVATNHVVATMKAEDKDFG-ANGSVFYRFAMPVRG-----FSINSLTGEIQTTELLSSLTQSQRTLIVEAMD 2035          

HSP 9 Score: 114.005 bits (284), Expect = 7.264e-25
Identity = 109/435 (25.06%), Postives = 198/435 (45.52%), Query Frame = 3
Query:  744 SCSTTIEIEIEDLNDNVPKFNQLTYNANIDENKRDDKLI------KFTVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELI--NSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDADT--HSNMIHC-KLVDYNDLFYLDSPSKFNTLLNYKPFNLKT----INKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPIIVTDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNA--PRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTG 1997
            S   T++I++ D+NDN P F+Q  Y A + E++     I         +S  +SG +  +    V    ++    +  E    +    LI    LD+E     +  T++ +D+G P  SSS    I + ++NDN P     +        V++ EG  A + ++ +  TD D+  H+ + +     D  +LF +D  +    L   +P + +T    +  I     HG F    I                 N++++D+NDN P F  Q    ++ ENQ          +   D+D+G+ G  ++++ D R+      F +D+ +G++ ++++ D+E  N F F  +A+D G     +S+T+T+ V    ++   P F+ S + F V E    G  IG +QA+D+D    +  + YS     + S YFD+++ TG
Sbjct: 2455 SSIATVQIQLTDVNDNAPMFHQSEYRATVSEDQLPGATILTLEAVDVDLSQENSGFDFAIASGNVGNAFQIESSVRFIEGHGFQTVGTLILAEQLDFELMSR-YNLTIVVSDRGVPQRSSSVPAVITVIDVNDNPPVFSHAEY------VVALSEGAAAGTEILRLSATDQDSAPHAEIQYSISSGDEMELFSVDQWT--GALRLQRPLDRETQPSHVVIIQASDGHGHFALAPI-----------------NVEVKDINDNRPYFPIQTMTASIRENQPANSAV--TVLHAIDQDTGMYGILKYFMVD-RSSQGKEFFAVDQNTGEVRSRQAFDFEKVNSFHFMALAVDAG----NNSATVTVQVYITGEDEYDPAFTSSAFSFEVPEGAKKGQSIGQVQAVDEDGG-VDGIVLYSFP---NTSPYFDVNKTTG 2852          

HSP 10 Score: 111.309 bits (277), Expect = 4.144e-24
Identity = 142/597 (23.79%), Postives = 247/597 (41.37%), Query Frame = 3
Query:  399 GTFFILIKILDQNDKAPQFSSIKRPFFKIPENVEVGKVIDLPMAVDSDSEKYSVRRYSLSYIYHLDQTHDFRLHVTNDNPPRPQLIVNSKLDYEKINKYVFRLFAYDFDEKSIGNSCSTTIEIEIEDLNDNVPKFNQLTYNANIDENK-RDDKLIKFTVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLAT-DQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDADTHSNMIHCKLVDYNDLFYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPIIVT-----DRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLRTRKPLDRETLESISIKVTAKNPNK-YSSHFVRNTDSEVDVMIKVMDVNDNAPKF 2165
            G   + I I D ND  P F         +PE  ++G V+    A D DS +    R S    +HL  +   R           +LI  S L Y+ + +Y  ++ A D        + +  + ++ ED  D  P F+ LTY   + EN   + + ++      D  +NG     ++            F I  +  +L + ++LD E    ++  T+LAT   G    + SA V++ + + NDN P++  +++  +V       E LP  +    V  TD D   N         + L Y    +  N  +N +   + T   +DRE +  S+  + +      P R  T   + +I + D NDNAP+FS  +      E  + V    P   ++      D D G N    + L   R    +  F ++  +G++ +   L    K+++   + A D+G  P +SS  + I +L  +  AP+ +      N  E    G  IG++++ D      +  + Y +    D    F +DR TGD+   + LD E     ++ +  ++ +K Y S ++   D      I V D ND+AP+F
Sbjct:  877 GQTRVTITIGDVNDNTPAFLPSYSESLLLPEVTKIGSVVYRVQAEDRDSGQNG--RIS----FHLLASGGQRAFSVERGSGEIRLI--SSLSYDSVPRYDLQVLARDGGVPQRSATFTLVVHVQAED--DQGPAFDTLTYRVELKENTPLNTRFLQVRALSRDQLKNGSSPAALLSYRLRPDGDAAGFGIVPDSGWLFVKSALDREAK-DIYLLTVLATSGSGRMKKTGSATVRVSVTDENDNSPRLSQERVFLAVR------ENLPTGTGFGRVSATDRDAGLN---------SRLTYRLLHTDRNFQINSQTGEVSTRAALDRE-HQSSYQLVVVVQDGGTPPRSATG--TAHITVLDENDNAPIFSHMM---PGKELLIQVQEGLPAGSLLGTLQAKDPDEGENSTIFYSLSGSR----AERFSLNPNTGELRSSSPLRRAEKSEYSITVSASDRGAPPQSSSCVLRIQILGSSRAAPKPNTLSMTLNSVEGAKPGSVIGSVRSHDHRDVVLDGQVTYLVVGGTDKDGTFMVDRLTGDVYLARELDYEKGALYTLNIEVEDFSKAYPSTYMIQLD------ITVQDSNDHAPEF 1431          

HSP 11 Score: 97.4413 bits (241), Expect = 8.547e-20
Identity = 150/597 (25.13%), Postives = 241/597 (40.37%), Query Frame = 3
Query:  417 IKILDQNDKAPQFSSIKRPFFK--IPENVEVGKVIDLPMAVDSDSEKYSVRRYSLSYIYHLDQTHDFRLHVTNDNPPRPQLIVNSKLDYEKINKYVFRLFAYDFDEKSIGNSCSTTIEIEIEDLNDNVPKFNQLTYNANIDENKRDDK-LIKFTVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDADTHSNMIHCKLVDYNDLFYLDSPSKFNTLLNYKPFNLKTINKIDRESNHG---SFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPIIVTDRDSGLNGKFEFYLEDFRNFSDSSD----FLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRF----SESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLRTRKPLDRETLESISIKVTAKNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAPKF 2165
            I++ D ND  P F    +  +K  IPE V  G  +    A D D        YS   I     TH     +   +P    +   ++LDYE       ++ A D  +  +  S +  +EI ++D+NDN P F    YN +I EN       ++ T SD D G  G V  ++   +   S     F I +    +    +LD +     FEFT+ A D G   LSSSA VK+ L+++NDN P   F  + ++VS S     G    + V+ V   D D   N           + Y   P   +   N+   N  T       S HG   S + + I+  D         N  +NI +   +   P+F Q  Y   V E+ +          +V      L  K      D      S D    F +D  +G + T   LD+E +     ++ A   G  P    + +TI + D+NDN P F    SES  +  V +  SV +++   QA D D+ +  +  F+ +   G  +  F ++R +G++R    L  +++    ++V A++        V    +   +++ V   +D  P F
Sbjct:  461 IQVTDVNDNPPLF---DQQAYKQTIPEVVYPGSFVLQVTARDKDHGPNGDVLYS---ILPDRGTHSDWFTI---DPVTGIITTATQLDYETYPNPSVKVVATDGGKPPL--SSTALVEISLQDINDNEPVFGSSVYNVSIKENTAAGTCFLEVTASDADGGSFGAVAYSL--GSGAGSSPPTRFSINKETGQICTSAALDRDEGADSFEFTVTAADGG--GLSSSAVVKVSLQDINDNRPT--FYPVNYAVSLSSQSAPG----TSVIRVTAHDPDGGEN---------GKVTYRTVPGGGS---NFFTLNKDTGVISLSRSLHGKANSVIAMVITAQDGG-GLTAPVNARVNISVVAGSVAPPVFEQAQYFFTVSEDVLRGTEVG----VVRANSRSLATK------DISYTISSGDPDGYFTVDSETGALRTSLPLDHEARPSLELEVQA-SSGSPPAFGQTRVTITIGDVNDNTPAFLPSYSESLLLPEVTKIGSVVYRV---QAEDRDSGQNGRISFHLLASGGQRA--FSVERGSGEIRLISSLSYDSVPRYDLQVLARDGG------VPQRSATFTLVVHVQAEDDQGPAF 1001          
BLAST of Protocadherin Fat 1 vs. Ensembl Cavefish
Match: ENSAMXT00000036438.1 (pep primary_assembly:Astyanax_mexicanus-2.0:20:10706414:10716598:1 gene:ENSAMXG00000034381.1 transcript:ENSAMXT00000036438.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 181.415 bits (459), Expect = 6.303e-47
Identity = 198/689 (28.74%), Postives = 309/689 (44.85%), Query Frame = 3
Query:  417 IKILDQNDKAPQFSSIKRPFFKIPENVEVGKVIDLPMAVDSDSEKYSVRRYSLSYIYHLDQTHDFRLHVTNDNPPRPQLIVNSKLDYEKINKYVFRLFAYDFDEKSIGNSCSTTIEIEIEDLNDNVPKFNQLTYNANIDENKRDDKLIKFTVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDADTHSN-MIHCKLVDYNDLFYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMF---SQQIYIGXXXXXXXXXXXXFPKPIIVTDRDSGLNGKFEFYLED--FRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSI-EPKGDHSSYFDIDRYTGDLRTRKPLDRETLESISIKVTAKNPNK--YSSHFVRNTDSEVDVMIKVMDVNDNAPKFIPRLNMKQKVEFIVEQFVDGNTCTELPYTVQDIDDGGINGQNCCYT------ILENDYNKLFSLMTDTPSYICLQRKPEKYQSYTVTLIARDR--PP 2432
            IKILD ND +P F   K    ++ E+  VG    L  A D D    S+  Y LS     +   +  +H   D  P  +L++   LD E+  +   RL     D      S +T I + + D NDN P F++  Y  ++ EN      +K++      G+ GI        +D  S  F   EI        LI  LDYE+    +E  + A D G+  L+S  +V + + ++NDN P+IK   L  SV       E     +++  + V D D   N  +HC  +  N  F L+S          K ++L     +DRE        ++I+  D E +  +++   + +++ DVNDN P F   S  +Y+    +        FP  +   D D G+N    + L    F N    +D      S ++   +SLD E +  FR  + A+D G  P + ++ I + VLD NDNAP FS+S Y   V E+V++G  +  L A D D +  N ++ YS  + +   S  F ID  TG++     LD E+  +  I+V A++      +SH          V+++V+DVNDNAP+    + +   ++ + E     +T   L  TVQD  DGG NG+  C        +LE+   K +SL+        L R  EK + Y V++ A D   PP
Sbjct:   35 IKILDTNDHSPVFPG-KSQTIRVAESALVGSKFPLLGADDPDIGINSISSYKLSQ----NAFFNLEVHTDADQGPSAELVLLKSLDRER--QATLRLVLTAVDGGRPPRSGTTEIHVVVLDANDNAPAFSKSVYKVSVPENTAIGTSVKYSFK---QGQKGI--------SDTFSIDFNTGEIS-------LIGELDYES-TGAYEIRVEARDGGSTPLASHCKVLVEVVDVNDNAPEIKLSSLLDSVP------EDSRKGTVIALITVQDKDGGKNGKVHC-FMSKNSPFVLESTQG-------KYYSLVLSGALDREEKQ--IYNVSITAID-EGTPPLSSTTVVTVRVSDVNDNPPRFPEASVNVYV----KENSPAGSKFPL-LGADDPDIGINSISSYKLSQNTFFNLEVHTD-ADQGPSAELVLLKSLDRERQATFRLVLTAVDGGRPPRSGTTEIHVVVLDANDNAPVFSKSLYKVLVSEDVALGTSVLKLNATDLD-EGINSELLYSFKQGQKGISDKFTIDPGTGEISVIGELDYESTSAYEIRVEARDGGSTPLASH--------CKVLVEVVDVNDNAPE----IKLSSLLDSVRED-ARKDTAIAL-ITVQD-KDGGKNGKVHCSMSKNSPFVLESTQEKYYSLVLSG----TLDR--EKNELYNVSITATDEGTPP 652          

HSP 2 Score: 149.443 bits (376), Expect = 1.413e-36
Identity = 168/617 (27.23%), Postives = 264/617 (42.79%), Query Frame = 3
Query:  342 KADLCCKLIGFQYLTPTDPGTFFILIKILDQNDKAPQFSSIKRPFFK--IPENVEVGKVIDLPMAVDSDSEKYSVR--RYSLSYIYHLDQTHDFRLHVTNDNPPRPQLIVNSKLDYEKINKYVFRLFAYDFDEKSIGNSCSTTIEIEIEDLNDNVPKFNQLTYNANIDENKRDDKLIKF-TVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDADTHSNMIHCKLVDYNDLFYLDSPSKFNTLLNYKP-FNLKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPIIVTDRDSGLNGKFEF-YLEDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLRTRKPLDRET--LESISIKVTAKNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAPKF 2165
            +A L   L       P   GT  I + +LD ND AP FS   +  +K  +PEN  +G            S KYS +  +  +S  + +D            N     LI   +LDYE    Y  R+ A D     + + C   + +E+ D+NDN P+    +   ++ E+ R   +I   TV D D G+NG V   +   +      F +   Q   + L L  +LD E +  ++  ++ A D+GTP LSS+  V + + ++NDN P+          S +V + E  PA S    +   D D   N I    +  N  F L+     +T  +  P   L  +  +DRE    +F  +  +     P R  TT   +++ + D NDNAP+FS+ +Y   V E+           +  TD D G+N +  + + +  +  SD   F ID  +G+I     LDYE+ + +  ++ A D G  PL S   + + V+D+NDNAP    S  + +V E+      I  +   D D   KN  +  S+            ++Y   L     LDRE   L ++SI  T +     S   V        + ++V DVNDN P F
Sbjct:  119 QATLRLVLTAVDGGRPPRSGTTEIHVVVLDANDNAPAFS---KSVYKVSVPENTAIGT-----------SVKYSFKQGQKGISDTFSIDF-----------NTGEISLI--GELDYESTGAYEIRVEARDGGSTPLASHCK--VLVEVVDVNDNAPEIKLSSLLDSVPEDSRKGTVIALITVQDKDGGKNGKVHCFMSKNS-----PFVLESTQGKYYSLVLSGALDRE-EKQIYNVSITAIDEGTPPLSSTTVVTVRVSDVNDNPPRFP------EASVNVYVKENSPAGSKFPLLGADDPDIGINSISSYKLSQNTFFNLE----VHTDADQGPSAELVLLKSLDRE-RQATFRLVLTAVDGGRPPRSGTTE--IHVVVLDANDNAPVFSKSLYKVLVSEDVALGTSVL--KLNATDLDEGINSELLYSFKQGQKGISDK--FTIDPGTGEISVIGELDYESTSAYEIRVEARDGGSTPLASHCKVLVEVVDVNDNAPEIKLSSLLDSVREDARKDTAIALITVQDKDGG-KNGKVHCSMSKNSPFVLESTQEKYYS-LVLSGTLDREKNELYNVSITATDEGTPPLSGTTV--------LTVRVSDVNDNPPLF 673          

HSP 3 Score: 103.219 bits (256), Expect = 6.221e-22
Identity = 122/489 (24.95%), Postives = 206/489 (42.13%), Query Frame = 3
Query:  411 ILIKILDQNDKAPQFSSIKRPFFKIPENVEVGKVIDLPMAVDSDSEKYSVRRYSLSYIYHLDQTHDFRLHVTNDNPPRPQLIVNSKLDYEKINKYVFRLFAYDFDEKSIGNSCSTTIEIEIEDLNDNVPKFNQLTYNANIDENK-RDDKLIKFTVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEI-----QRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDAD--THSNMIHC---KLVDYNDLFYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPIIVTDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFT---QRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSES 1835
            +L++++D ND AP+   +      +PE+   G VI L    D D  K       +S      +   F L  T        L+++  LD E+  K ++ +     DE +   S +T + + + D+NDN P+F + + N  + EN     K       DPD G N I +  +   T      F   E+     Q     L L+ SLD E     F   L A D G P  S + ++ + + + NDN P          VS  V++       + V+++  TD D   +S +++         +D F +D  +            +  I ++D ES     +R+      S P   + ++  + +++ DVNDNAP       + +V E+           I V D+D G NGK         + S +S F+++    K ++     +LD E    +   I A D+G  PL+ ++ +T+ V D+NDN P F E+
Sbjct:  233 VLVEVVDVNDNAPEIK-LSSLLDSVPEDSRKGTVIALITVQDKDGGKNGKVHCFMS------KNSPFVLESTQGK--YYSLVLSGALDREE--KQIYNVSITAIDEGTPPLSSTTVVTVRVSDVNDNPPRFPEASVNVYVKENSPAGSKFPLLGADDPDIGINSISSYKLSQNT------FFNLEVHTDADQGPSAELVLLKSLDRERQAT-FRLVLTAVDGGRPPRSGTTEIHVVVLDANDNAPVFSKSLYKVLVSEDVAL------GTSVLKLNATDLDEGINSELLYSFKQGQKGISDKFTIDPGTG----------EISVIGELDYESTSAYEIRVEARDGGSTP---LASHCKVLVEVVDVNDNAPEIKLSSLLDSVREDARKDTAI--ALITVQDKDGGKNGKVHC------SMSKNSPFVLESTQEKYYSLVLSGTLDREKNELYNVSITATDEGTPPLSGTTVLTVRVSDVNDNPPLFPEA 676          

HSP 4 Score: 101.679 bits (252), Expect = 1.609e-21
Identity = 99/375 (26.40%), Postives = 163/375 (43.47%), Query Frame = 3
Query:  384 TPTDPGTFFILIKILDQNDKAPQFSSIKRPFFKIPENVEVGKVIDLPMAVDSDSEKYSVRRYSLSYIYHLDQTHDFRLHVTNDNPPRPQLIVNSKLDYEKINKYVFRLFAYDFDEKSIGNSCSTTIEIEIEDLNDNVPKFNQLTYNANIDEN-KRDDKLIKFTVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDADTHSN-MIHCKLVDYNDLFYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQ 1502
            TP    T  + +++ D ND  P+F       + + EN   G    L  A D D    S+  Y LS     +   +  +H   D  P  +L++   LD E+  +  FRL     D      S +T I + + D NDN P F++  Y   + E+      ++K   +D D G N  +  +       +S +F    I      + +I  LDYE+    +E  + A D G+  L+S  +V + + ++NDN P+IK   L  SV       E     + +  + V D D   N  +HC +   N  F L+S  +       K ++L     +DRE N      ++I+ TD E +  ++    L +++ DVNDN P+F +
Sbjct:  329 TPPLSSTTVVTVRVSDVNDNPPRFPEASVNVY-VKENSPAGSKFPLLGADDPDIGINSISSYKLSQ----NTFFNLEVHTDADQGPSAELVLLKSLDRER--QATFRLVLTAVDGGRPPRSGTTEIHVVVLDANDNAPVFSKSLYKVLVSEDVALGTSVLKLNATDLDEGINSELLYSFKQGQKGISDKFT---IDPGTGEISVIGELDYES-TSAYEIRVEARDGGSTPLASHCKVLVEVVDVNDNAPEIKLSSLLDSVR------EDARKDTAIALITVQDKDGGKNGKVHCSM-SKNSPFVLESTQE-------KYYSLVLSGTLDREKNE--LYNVSITATD-EGTPPLSGTTVLTVRVSDVNDNPPLFPE 675          

HSP 5 Score: 93.9745 bits (232), Expect = 3.803e-19
Identity = 107/386 (27.72%), Postives = 173/386 (44.82%), Query Frame = 3
Query: 1449 SLNIQIEDVNDNAPMF---SQQIYIGXXXXXXXXXXXXFPKPIIVTDRDSGLNGKFEFYLED--FRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSI-EPKGDHSSYFDIDRYTGDLRTRKPLDRETLESISIKVTAKNPNK--YSSHFVRNTDSEVDVMIKVMDVNDNAPKFIPRLNMKQKVEFIVEQFVDGNTCTELPYTVQDIDDGGINGQNCCYT------ILENDYNKLFSLMTDTPSYICLQRKPEKYQSYTVTLIARDRPPNVEGGLTSKISFPVLIIND-----PHSKISTSGFSNHP-DSRFP 2546
            S+ I+I D ND++P+F   SQ I +         V   FP  +   D D G+N    + L    F N    +D      S ++   +SLD E +   R  + A+D G  P + ++ I + VLD NDNAP FS+S Y  +V EN ++G  +                  YS  + +   S  F ID  TG++     LD E+  +  I+V A++      +SH          V+++V+DVNDNAP+    + +   ++ + E    G     +  TVQD  DGG NG+  C+       +LE+   K +SL+        L R+ ++  + ++T I    PP      T+ ++  V  +ND     P + ++     N P  S+FP
Sbjct:   32 SVEIKILDTNDHSPVFPGKSQTIRVA----ESALVGSKFPL-LGADDPDIGINSISSYKLSQNAFFNLEVHTD-ADQGPSAELVLLKSLDRERQATLRLVLTAVDGGRPPRSGTTEIHVVVLDANDNAPAFSKSVYKVSVPENTAIGTSVK-----------------YSFKQGQKGISDTFSIDFNTGEISLIGELDYESTGAYEIRVEARDGGSTPLASH--------CKVLVEVVDVNDNAPE----IKLSSLLDSVPEDSRKGTVIALI--TVQD-KDGGKNGKVHCFMSKNSPFVLESTQGKYYSLVLSG----ALDREEKQIYNVSITAIDEGTPPLSS---TTVVTVRVSDVNDNPPRFPEASVNVYVKENSPAGSKFP 372          
BLAST of Protocadherin Fat 1 vs. Ensembl Sea Lamprey
Match: pcdh11 (protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-21])

HSP 1 Score: 186.422 bits (472), Expect = 2.291e-48
Identity = 210/732 (28.69%), Postives = 334/732 (45.63%), Query Frame = 3
Query:  210 IVSLLENDLPPF---KLQLNQLIQPNNGVNREAVCR-DNPGEKVRKFCKADLCCKLIGFQYLTPTDPGTFFILIKIL----DQNDKAPQFSSIKRPFF--KIPENVEVGKVIDLPMAVDSDSEKYSVRRYSLSYIYHLDQTHDFRLHVTN--DNPPRPQLIVNSKLDYEKINKYVFRLFAYDFDEKSIGNSCSTTIEIEIEDLNDNVPKFNQLTYNANIDENK-RDDKLIKFTVSDPDSGRNGIVTVNIVDKTDELSKRF---KIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDADTHSN-MIHCKLVDYNDLFYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPII---VTDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLRTRKPLDRETLESISIKVTAKNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAP-KFIPRLNMKQKVEFIVEQFVDGNTCTELPYTVQDID-DGGINGQNCCYTILENDYNKLFSL 2339
            ++S  E+  PP      +  +L      ++REA+C   +PG++    C  D+   ++      P  PG FF LI++     D ND AP F++   P     +PEN   GK   +  A D DSE   VRRY L           F L VT   +    P L+V   LD E+   Y   L A   D  S  +S S  + I + D NDN P F+Q   N  I EN      +++   SD D+G N  V   +   T          ++F + +N   + +   L+ E  P ++   +LATD+G   + ++A V + + ++NDN P I+ + +   V+  + I E    +  V  + V+D D  +N  + C +  YN     + P +   L     + L+T   +D E+ +   ++I  +      +  ++   S+ I++ D NDNAP+F++  Y     +  V       K +I    TDRD   N +  ++L         + F +D  +G I     LD E K  + F I+A D+G   L  ++T+ +NVLD+NDN PRFS + + F V ENV     +G +   D D + +N  +  SI    D+   F ID  +G +R+    DRE      ++V A +        VR+  S V V+I VMD+NDN+P   +P  N   K  F+V + + G   TE    V  +D D  IN +   Y I+  + + LF +
Sbjct:   74 MLSKAEDAAPPLVRVNPRTGELFAAGRKMDREALCGGQDPGDE----CHVDVQVGVL------PVQPGPFFKLIEVRINVEDINDNAPAFAA---PVLTVSVPENAPAGKRFPIQPANDPDSEANGVRRYEL-LPSDPATVSAFELSVTETANGEKVPYLVVRKSLDREERQLYEMNLRA--VDGGSPPHSGSAVLRINVTDTNDNSPVFDQAEVNVEIPENSPVGTHVVQLHASDRDAGSNAEVVYRLGTSTGGAGSGQGGKRLFRLDQNSGLVTVNGLLNREESP-VYRIIILATDKGPEPVPATATVTVTVTDVNDNSPTIEIRDIVAPVNGVIYISEASHVNLPVALITVSDPDIGANGAVTCYI--YNP----EVPFQLKKLTYPNQYLLETRETLDYETKNEYVVQIKAADAG---ATSLSRTMSVTIKLLDSNDNAPVFTEPTY-----KVSVPENNVIGKHLITVSATDRDMDKNAEMVYFL----GPDAPTMFHMDPETGIISLTEQLDREKKANYSFTILAKDQGIPVLEGNATVIVNVLDVNDNRPRFSLAEFDFYVNENVPKHSTVGMVTVADSD-EGENGRVRLSILGT-DNRQLFSIDPESGMIRSNVGFDREQRHYYVLEVQATD----GGEPVRS--STVKVVIHVMDINDNSPIVLMPPSNTTYK--FVVPRTLPGTIVTE----VSAVDNDAEINAE-LRYHIVGGNPHNLFHI 755          

HSP 2 Score: 145.591 bits (366), Expect = 1.223e-35
Identity = 176/615 (28.62%), Postives = 272/615 (44.23%), Query Frame = 3
Query:  759 IEIEIEDLNDNVPKFNQLTYNANIDENKRDDKLIKFT-VSDPDSGRNGIVTVNIV--DKTDELSKRFKIFEIQRNEF--FLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDADTHSNM-----------IHCKLVDYNDLFYLDSPSKFNTLLNYKPFNLKTINKI-DRESNHGSFLRITISCTDSEPSRQITTNE-----------SLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPII-VTDRDSGLNGKFEFYLED------FRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLRTRKPLDRETLESISIKVTAKNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAPKFIPRLNMKQKVEFIVEQFVDGNTCTELPYTVQDIDDGGINGQNCCYTILENDYNKLFSLMTDTP---SYICLQRKPEKYQSYTVTLIARDRPPNVEGGLTSKISFPVLIIND 2489
            + I +ED+NDN P F       ++ EN    K       +DPDS  NG+    ++  D     +    + E    E   +L +  SLD E +  L+E  L A D G+P  S SA ++I++ + NDN P     ++      +V I E  P  + VV++  +D D  SN                      LF LD  S            L T+N + +RE +     RI I  TD  P     T             S  I+I D+   AP+ +  IYI           VN P  +I V+D D G NG    Y+ +       +  +  + +L++       T+ +LDYETKN++  +I A D G   L+ + ++TI +LD NDNAP F+E  Y  +V EN  +G  + T+ A D D D KN ++ Y + P  D  + F +D  TG +   + LDRE   + S  + AK+        +   +    V++ V+DVNDN P+F        + +F V + V  ++   +  TV D D+G  NG+    +IL  D  +LFS+  ++    S +   R+   Y  Y + + A D    V    T K+   V+ IND
Sbjct:  139 VRINVEDINDNAPAFAAPVLTVSVPENAPAGKRFPIQPANDPDSEANGVRRYELLPSDPATVSAFELSVTETANGEKVPYLVVRKSLDRE-ERQLYEMNLRAVDGGSPPHSGSAVLRINVTDTNDNSPVFDQAEV------NVEIPENSPVGTHVVQLHASDRDAGSNAEVVYRLGTSTGGAGSGQGGKRLFRLDQNS-----------GLVTVNGLLNREES--PVYRIIILATDKGPEPVPATATVTVTVTDVNDNSPTIEIRDIV--APV-NGVIYI------SEASHVNLPVALITVSDPDIGANGAVTCYIYNPEVPFQLKKLTYPNQYLLE-------TRETLDYETKNEYVVQIKAADAGATSLSRTMSVTIKLLDSNDNAPVFTEPTYKVSVPENNVIGKHLITVSATDRDMD-KNAEMVYFLGP--DAPTMFHMDPETGIISLTEQLDREKKANYSFTILAKD------QGIPVLEGNATVIVNVLDVNDNRPRF-----SLAEFDFYVNENVPKHSTVGM-VTVADSDEGE-NGR-VRLSILGTDNRQLFSIDPESGMIRSNVGFDREQRHY--YVLEVQATDGGEPVRSS-TVKVVIHVMDIND 697          

HSP 3 Score: 100.138 bits (248), Expect = 1.369e-21
Identity = 151/580 (26.03%), Postives = 236/580 (40.69%), Query Frame = 3
Query:  384 TPTDPGTFFILIKILDQNDKAPQFSSIKRPFFKIPENVEVGKVIDLPMAVDSDSEKYSVRRYSLSY-------------IYHLDQTHDFRLHVTNDNPPRPQLIVNSKLDYEKINKYVFRLFAYD------------FDEKSIGNSCSTTIEIEIEDLNDNVPKFNQLTYNANIDENKRDDKLIKFTVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDADTHSNMIHCKLVDYNDLFYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQ---IYIGXXXXXXXXXXXXFPKPIIVTDRDSGLNGKFEFYL--EDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRF----SESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLRTRKPL 2021
            +P   G+  + I + D ND +P F   +    +IPEN  VG  +    A D D+   +   Y L               ++ LDQ                 + VN  L+ E+   Y   + A D                +  N  S TIEI      D V   N + Y +          LI  TVSDPD G NG VT  I +   E+  + K      N++ LE   +LDYET  + +   + A D G  SLS +  V I L + NDN P   F +  + VS   + + G   H + V     D D ++ M++    D   +F++D  +   +L            ++DRE    +    TI   D +    +  N ++ + + DVNDN P FS      Y+         V +     + V D D G NG+    +   D R       F ID  SG I +    D E ++ +  ++ A D G    +S+  + I+V+D+NDN+P      S + Y F V   +  G  +  + A+D+D +  N ++ Y I   G+  + F ID   G++   +PL
Sbjct:  244 SPPHSGSAVLRINVTDTNDNSPVFDQAEV-NVEIPENSPVGTHVVQLHASDRDAGSNAEVVYRLGTSTGGAGSGQGGKRLFRLDQNSGL-------------VTVNGLLNREESPVYRIIILATDKGPEPVPATATVTVTVTDVNDNSPTIEIR-----DIVAPVNGVIYISEASHVNLPVALI--TVSDPDIGANGAVTCYIYNP--EVPFQLKKLTYP-NQYLLETRETLDYETK-NEYVVQIKAADAGATSLSRTMSVTIKLLDSNDNAPV--FTEPTYKVSVPENNVIG--KHLITVSATDRDMDKNAEMVYFLGPDAPTMFHMDPETGIISL----------TEQLDREKK--ANYSFTILAKD-QGIPVLEGNATVIVNVLDVNDNRPRFSLAEFDFYVNENVPKHSTVGM-----VTVADSDEGENGRVRLSILGTDNRQL-----FSIDPESGMIRSNVGFDREQRHYYVLEVQATDGGEPVRSSTVKVVIHVMDINDNSPIVLMPPSNTTYKFVVPRTLP-GTIVTEVSAVDNDAE-INAELRYHIV-GGNPHNLFHIDPVIGNITLMEPL 768          
BLAST of Protocadherin Fat 1 vs. Ensembl Sea Lamprey
Match: si:ch211-199f5.1 (protocadherin 8 [Source:HGNC Symbol;Acc:HGNC:8660])

HSP 1 Score: 175.637 bits (444), Expect = 3.993e-45
Identity = 159/593 (26.81%), Postives = 269/593 (45.36%), Query Frame = 3
Query:  285 VNREAVCRDNPGEKVRKFCKADLCCKLIGFQYLTPTDPGTFFILI----KILDQNDKAPQFSSIKRPFFKIPENVEVGKVIDLPMAVDSDSEKYSVRRYSLSYIYHLDQTHDF--RLHVTNDNPPRPQLIVNSKLDYEKINKYVFRLFAYDFDEKSIGNSCSTTIEIEIEDLNDNVPKFNQLTYNANIDENKRDDK-LIKFTVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDADTHSN-MIHCKLVDYNDLFYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTDSEP---SRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPIIVTDRDSGLNGKFEFYL--EDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSE-----SHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLRT 2009
            ++RE  C   P   +R     D+ C L          P   F L+    ++LD ND AP F+  +    +I E+V +G  + L  A D D    ++R       YHLD+   F   L    D     +L+V S+LD E+  +Y  +L A+D  +     S +T + I + D NDN P F Q + N  + E+      L+    +D D G NG V  +     D   +R  +F++      L L   LD+E +   +E ++ A D G  S+ +  +V +H++++NDN P+IK   +  S  ++V + EG    S V  V V+D D+  N ++ C L  +           F  L     + + T + +DRE     FL +  S   + P   +RQ T      +++ D NDN P F +  Y       + N    +   +   D D+  NG   + +   +    S S+   I+  SG I+  R LDYE      F++ A D G  PL +++T+++ ++D NDNAP  +         +  +  +  +G+ +  ++A D D++  N ++ Y I  +G+  + F I+R  G++ T
Sbjct:   90 IDREQQCGQAPSCVIR----FDVLCTL----------PRGLFQLVHAEVELLDINDHAPDFARSEM-HVEISESVALGTRVPLEGARDLDVGGNALR------AYHLDENERFGLALRARTDGAKYAELVVKSRLDREQEGEYTLQLTAWDGGDPP--RSGTTLVRITVLDSNDNSPVFAQTSCNVTVREDATPGTVLLTLNATDVDEGPNGEVVYSFSSPVDAEVRR--LFQLDPKTGKLSLKGQLDHELNSE-YEISIQARDMGPSSIPAHCKVLVHVEDINDNAPEIKLDFIMQSRGDTVFVSEGAAYESFVGLVTVSDIDSAENGLVACHLRGH---------PHFKLLPYRDDYVVVTNSSLDREQMADYFLVLEASDGGTPPRVAARQFT------VRLLDENDNEPRFHRSTY--EASLLENNSPGAYVTTVTAWDADAEHNGMIAYNVVESEVAGASVSTYVSINPSSGAIYALRPLDYEAMTSLTFQVQARDDGVPPLVTNATVSVRIVDENDNAPVVTHPPLRNGTGVVRLPRDAGLGYLVTVVRARDSDSE-ANGELSYRI-VQGNERNLFRINRLGGEVFT 637          

HSP 2 Score: 111.309 bits (277), Expect = 4.426e-25
Identity = 130/479 (27.14%), Postives = 213/479 (44.47%), Query Frame = 3
Query:  762 EIEIEDLNDNVPKFNQLTYNANIDENKRDDKLIKF-TVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEF--FLELI--NSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDADTHSNMIHCKLVDYNDLFYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPM----FSQQIYIGXXXXXXXXXXXXFPKPIIVTDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSI---EPKGDH-SSYFDIDRYTGDLRTRKPLDRETLESISIKVTAKNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAP 2159
            E+E+ D+ND+ P F +   +  I E+      +      D D G N +   ++    DE ++RF +    R +   + EL+  + LD E +   +   L A D G P  S +  V+I + + NDN P           S +V++ E     ++++ +  TD D   N      V Y+    +D+  +    L+ K   L    ++D E N  S   I+I   D  PS  I  +  + + +ED+NDNAP     F  Q     V  ++     +F   + V+D DS  NG    +L    +F      L  +    + T  SLD E    +   + A D G  P  ++   T+ +LD NDN PRF  S Y  ++ EN S G  + T+ A D D +  N  I Y++   E  G   S+Y  I+  +G +   +PLD E + S++ +V A++        V    +   V ++++D NDNAP
Sbjct:  123 EVELLDINDHAPDFARSEMHVEISESVALGTRVPLEGARDLDVGGNALRAYHL----DE-NERFGLALRARTDGAKYAELVVKSRLDREQEGE-YTLQLTAWDGGDPPRSGTTLVRITVLDSNDNSPVFA------QTSCNVTVREDATPGTVLLTLNATDVDEGPN----GEVVYSFSSPVDAEVRRLFQLDPKTGKLSLKGQLDHELN--SEYEISIQARDMGPS-SIPAHCKVLVHVEDINDNAPEIKLDFIMQSRGDTVFVSEGAAYESFVGLVTVSDIDSAENGLVACHLRGHPHFK----LLPYRDDYVVVTNSSLDREQMADYFLVLEASDGGTPPRVAARQFTVRLLDENDNEPRFHRSTYEASLLENNSPGAYVTTVTAWDADAE-HNGMIAYNVVESEVAGASVSTYVSINPSSGAIYALRPLDYEAMTSLTFQVQARDDG------VPPLVTNATVSVRIVDENDNAP 571          

HSP 3 Score: 82.4185 bits (202), Expect = 4.288e-16
Identity = 90/364 (24.73%), Postives = 156/364 (42.86%), Query Frame = 3
Query: 1293 DSPSKFNTLLNYKPFNLKTINK----------IDRESNHGS----FLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQ-QIYIGXXXXXXXXXXXXFPKPIIVTDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKIS-GKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHS--SYFDIDRYTGDLRTRKPLDRETLESISIKVTAKN--PNKYSSHFVRNTDSEVDVMIKVMDVNDNAPKFIPRLNMKQKVEFIVEQFVDGNTCTELP--------YTVQDIDDGGINGQNCCY 2300
            + PS+   L+    F+L  + +          IDRE   G      +R  + CT      Q+   E   +++ D+ND+AP F++ ++++   +   +   V         D D G N    ++L++   F  +     D     ++  +  LD E + ++  ++ A D G  P + ++ + I VLD NDN+P F+++     V E+ + G  + TL A D D +  N ++ YS     D      F +D  TG L  +  LD E      I + A++  P+   +H          V++ V D+NDNAP+         K++FI++   D    +E           TV DID    NG   C+
Sbjct:   58 EHPSRHFRLMRRDDFSLVHVEEADGTVSAREVIDREQQCGQAPSCVIRFDVLCTLPRGLFQLVHAE---VELLDINDHAPDFARSEMHVEISESVALGTRVPLEG---ARDLDVGGNALRAYHLDENERFGLALRARTDGAKYAELVVKSRLDREQEGEYTLQLTAWDGGDPPRSGTTLVRITVLDSNDNSPVFAQTSCNVTVREDATPGTVLLTLNATDVD-EGPNGEVVYSFSSPVDAEVRRLFQLDPKTGKLSLKGQLDHELNSEYEISIQARDMGPSSIPAH--------CKVLVHVEDINDNAPEI--------KLDFIMQSRGDTVFVSEGAAYESFVGLVTVSDIDSAE-NGLVACH 397          

HSP 4 Score: 69.707 bits (169), Expect = 3.088e-12
Identity = 85/377 (22.55%), Postives = 154/377 (40.85%), Query Frame = 3
Query: 1086 QVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDADTHSNMIHCKLVDYNDLFYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPIIVT----DRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRF-------SESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGD--LRTRKPLDRETLESISIKVTAKN----PNKYSSHFVRNTDSEVDVMIKVMDVNDNAPKF 2165
              ++ L ++ND+ P     ++   +S SV++   +P           D D   N +    +D N+ F L   ++ +     K   L   +++DRE      L++T +    +P R  TT   + I + D NDN+P+F+Q         N        P  +++T    D D G NG+  +      +      F +D  +GK+  +  LD+E  +++   I A D G   + +   + ++V D+NDNAP         S    +F V E  +    +G +   D D+         +   +G    +F +  Y  D  + T   LDRE +    + + A +    P   +  F           ++++D NDN P+F
Sbjct:  121 HAEVELLDINDHAPDFARSEMHVEISESVALGTRVPLEG------ARDLDVGGNALRAYHLDENERFGLALRARTD---GAKYAELVVKSRLDREQEGEYTLQLT-AWDGGDPPRSGTT--LVRITVLDSNDNSPVFAQ------TSCNVTVREDATPGTVLLTLNATDVDEGPNGEVVYSFSSPVDAEVRRLFQLDPKTGKLSLKGQLDHELNSEYEISIQARDMGPSSIPAHCKVLVHVEDINDNAPEIKLDFIMQSRGDTVF-VSEGAAYESFVGLVTVSDIDSAENG---LVACHLRG--HPHFKLLPYRDDYVVVTNSSLDREQMADYFLVLEASDGGTPPRVAARQFT----------VRLLDENDNEPRF 463          

HSP 5 Score: 50.447 bits (119), Expect = 2.504e-6
Identity = 56/245 (22.86%), Postives = 97/245 (39.59%), Query Frame = 3
Query:  417 IKILDQNDKAPQFSSIKRPFFK--IPENVEVGKVIDLPMAVDSDSEKYSVRRYSLSYIYHLDQTHDFRLHVTNDNPPRPQLIVNSKLDYEKINKYVFRLFAYDFDEKSIGNSCSTTIEIEIEDLNDNVPKFNQ--LTYNANIDENKRDDKLIKFT----VSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQR--NEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDN 1121
            +++LD+ND  P+F    R  ++  + EN   G  +    A D+D+E   +  Y++        +    + +   NP    +     LDYE +    F++ A D     +    + T+ + I D NDN P      L     +    RD  L          D DS  NG ++  IV   +       +F I R   E F    +  D           ++  D+G+P+LS++A ++I +    D 
Sbjct:  451 VRLLDENDNEPRF---HRSTYEASLLENNSPGAYVTTVTAWDADAEHNGMIAYNVVESEVAGASVSTYVSI---NPSSGAIYALRPLDYEAMTSLTFQVQARDDGVPPL--VTNATVSVRIVDENDNAPVVTHPPLRNGTGVVRLPRDAGLGYLVTVVRARDSDSEANGELSYRIVQGNER-----NLFRINRLGGEVFTNAASVTDAAASATRHSLVVMVRDRGSPALSATAAIEIRVGAHGDG 682          
BLAST of Protocadherin Fat 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004043.1 (pep scaffold:Pmarinus_7.0:GL479143:9150:31231:-1 gene:ENSPMAG00000003698.1 transcript:ENSPMAT00000004043.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 170.629 bits (431), Expect = 6.633e-43
Identity = 168/605 (27.77%), Postives = 273/605 (45.12%), Query Frame = 3
Query:  585 YHLDQTHDFRLHVTNDNPPRPQLIVNSKLDYEKINKYVFRLFAYDFDEKSIGNSCSTTIEIEIEDLNDNVPKFNQLTYNANIDENKRDDKLIKFTVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDADTHSNM-IHCKLVDYNDLFYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKP---------IIVTDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFTQRSLDYETK---------NKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLRTRKPLDRETLESISIKVTAKNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAPKFI-PRLNMKQKVEFIVEQFVDGNTCTELPYTVQDIDDGGINGQNCCYTILENDYNKLFSL 2339
            YHL    +    V   +P   ++ V+  LD+E  + Y   + A D        S    +E+++ D+NDN P+F+   + A + EN     ++  T  D DSG NG V  +I+D          +F +  N   +  +++LD E +   +E T+ ATD+G+P+   + +V I + + NDN P+  F ++ FS         G P    V+ V   DAD   N  I   L+D +  F +  PS     ++          +++RE   G  +++  S    +P+  ++T+  + I ++DVNDNAP F Q  Y            + FP+P         +  +D D G NG+  F++      S + +F + + SG+I + R L Y            NK+ F + A+D+G  PL+S +T+TIN++  N NAPRF    Y   V   V  G +I  + A+D D D  N  I YS+   G+ S  FD+D   G L  R  L  +     S+ V A++  +          S    +I V + N  AP+F  P L +      + E    G++   +  T  D  D G+NG    Y+I   D + LF +
Sbjct:  267 YHLASGGNLG-DVFAVDPQSGEVSVHRALDHEYQHHYELVVEARDSGFPPF--SAYLKLEVDVLDINDNAPEFSSSRFWAKVPENTPPRTIVVLTAVDKDSGINGQVDYSIID-----GNIGNVFRVNPNSGEIRSVSTLDRE-NVASYELTVKATDRGSPTQHCTVKVLISVTDENDNSPR--FTQI-FSAHVREDAAVGFP----VLRVSTLDADEGPNAAITFSLLDPSLPFSIH-PSTGEITVS---------RRLNREDRSGYAVKVRAS----DPAWTVSTD--VTIVVDDVNDNAPRFGQTAYY-----------IEFPEPSEGEALVARVSASDADDGANGQVFFFMR-----SQTENFRVGRDSGEIHSVRPLRYRDPAGGGSGANLNKYSFVVTAMDRGRPPLSSDATVTINIVVPNANAPRFLRERYSTPVAATVRAGTRILDMSAVDPDRD-VNGQIAYSVV-GGNASRRFDVD-AGGFLHLRASLAGDAGSIFSVTVEARDRGRPP------LSSRATAIISVTEENQYAPRFAHPPLELS-----LPENHPAGSSLARV--TATDT-DAGVNGA-IVYSIASGDGSGLFDI 805          

HSP 2 Score: 151.754 bits (382), Expect = 3.760e-37
Identity = 170/697 (24.39%), Postives = 299/697 (42.90%), Query Frame = 3
Query:  384 TPTDPGTFFILIKILDQNDKAPQFSSIKRPFFKIPENVEVGKVIDLPMAVDSDSEKYSVRRYSLSYIYHLDQTHDFRLHVTNDNPPRPQLIVNSKLDYEKINKYVFRLFAYDFDEKSIGNSCSTTIEIEIEDLNDNVPKFNQLTYNANIDENKRDDKLI-KFTVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINSLDYETDP---------HLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDADTHSN-MIHCKLVDYNDLFYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTD-SEPSRQITTNESLNIQIEDVNDNAPMFSQ---QIYIGXXXXXXXXXXXXFPKPIIVTDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLRTRKPLDRETLESISIKVTAKN-PNKYSSHFVRNTDSEVDVMIKVMDVNDNAPKFIPRLNMKQKVEFIVEQFVDGNTCTELPYTVQDIDDGGINGQNCCYTILENDYNKLFSLMTDTPSYIC-LQRKPEKYQSYTVTLIARD 2423
            +PT   T  +LI + D+ND +P+F+ I     +  E+  VG  +     +D+D    +   +SL     LD +  F +H     P   ++ V+ +L+ E  + Y  ++ A D        + ST + I ++D+NDN P+F Q  Y     E    + L+ + + SD D G NG V   +  +T+        F + R+   +  +  L Y  DP         + + F + A D+G P LSS A V I++   N N P+   ++    V+ +V       A + ++++   D D   N  I   +V  N     D  +     L           +     + GS   +T+   D   P   +++  +  I + + N  AP F+    ++ +        ++       +  TD D+G+NG   + +    +   S  F I + SG +     LDYET+  +   + A D G+Q  T  S ++I+V D+NDN P  + S Y   + EN   G  +  + A+D D+   N    YS++     +  F +++ TG L T+  LD ET ++  + V A N P+ +  H+     S   V +++  VN+  P+F+ R     +  F+V +           +      D GI+G    Y +     +K FS+   T   I   Q   E+  S T+ +IA++
Sbjct:  417 SPTQHCTVKVLISVTDENDNSPRFTQIFSAHVR--EDAAVGFPVLRVSTLDADEGPNAAITFSL-----LDPSLPFSIH-----PSTGEITVSRRLNREDRSGYAVKVRASD-----PAWTVSTDVTIVVDDVNDNAPRFGQTAYYIEFPEPSEGEALVARVSASDADDGANGQVFFFMRSQTEN-------FRVGRDSGEIHSVRPLRYR-DPAGGGSGANLNKYSFVVTAMDRGRPPLSSDATVTINIVVPNANAPRFLRERYSTPVAATVR------AGTRILDMSAVDPDRDVNGQIAYSVVGGNASRRFDVDAGGFLHL-----------RASLAGDAGSIFSVTVEARDRGRP--PLSSRATAIISVTEENQYAPRFAHPPLELSLPENHPAGSSLAR-----VTATDTDAGVNGAIVYSIA---SGDGSGLFDISRASGDVLLVGELDYETEKLYNLSVCAADGGWQAKTECSGVSISVTDVNDNPPMLNASDYYPVIPENAPSGTTVLVMDAVDADSP-SNAVTMYSLDDG--EADLFVLNQKTGVLTTQGFLDYETKQTYELTVRAFNYPDTF--HY-----STAQVHVQITGVNEYFPRFVQR-----EYNFVVSESAPVGAPVGSVFATD--RDAGIDG-TVFYMLFGESRSKGFSVNEHTGEIIVSSQLDREREASATLRVIAKN 1043          

HSP 3 Score: 132.109 bits (331), Expect = 4.110e-31
Identity = 150/596 (25.17%), Postives = 250/596 (41.95%), Query Frame = 3
Query:  399 GTFFILIKILDQNDKAPQFSSIKRPFFKIPENVEVGKVIDLPMAVDSDSEKYSVRRYSLSYIYHLDQTHDFRLHVTNDNPPRPQLIVNSKLDYEKINKYVFRLFAYDFDEKSIGNSCSTTIEIEIEDLNDNVPKFNQLTYNANIDENK-RDDKLIKFTVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDADTHSNMIHCKLV---DYNDLFYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPIIV---TDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLRTRKPLDRETLESISIKVTAKNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAPKF 2165
            GT  + + + D+ND  P+F + +     +PE+  +G  + L  A D+D+   ++  Y L       +  D    V   NP   Q+I  + LD E    YV  + A D    + G S S T+ + + D+ND+ P+F    Y A    +      +   T  D D+G NG +  ++             F +      +    +L    D      T+  +D G P  S+   V +  +   D G   +F         S S  E  P  + +  V    +   +  +   L    +  D+F +D  S            +     +D E  H   L +    +   P    +    L + + D+NDNAP FS   +   V EN        P+ I+V    D+DSG+NG+ ++ + D  N  +   F ++  SG+I +  +LD E    +   + A D+G      +  + I+V D NDN+PRF++  +  +V E+ +VG+ +  +  +D D +  N  I +S+    D S  F I   TG++   + L+RE     ++KV A +P    S          DV I V DVNDNAP+F
Sbjct:    8 GTGTVTVLVEDENDNLPRFGAAEL-RAAVPEDAPIGSDVALVNATDADAGLNAIISYRL-------RGGDGHFSV---NPSTGQIITTASLDREGRESYVLEVTALD-GGPTPGLSSSATLVVAVTDVNDHTPRFLNAPYVAYAPSSAPAGTAVFAVTARDADAGPNGDLRFSLSGSAS------AGFSVDPRRGVIHAARALQGPRDD--LTLTVRVSDGGAPPRSAVTTVTVRFR---DAGEFPRFAP----GPRSFSFREDQPPGTTITVV-AARSSRRAGPVSYHLASGGNLGDVFAVDPQSG----------EVSVHRALDHEYQHHYELVVEARDSGFPP---FSAYLKLEVDVLDINDNAPEFSSSRFWAKVPENTP------PRTIVVLTAVDKDSGINGQVDYSIID-GNIGNV--FRVNPNSGEIRSVSTLDRENVASYELTVKATDRGSPTQHCTVKVLISVTDENDNSPRFTQI-FSAHVREDAAVGFPVLRVSTLDAD-EGPNAAITFSLL---DPSLPFSIHPSTGEITVSRRLNREDRSGYAVKVRASDPAWTVS---------TDVTIVVDDVNDNAPRF 539          

HSP 4 Score: 130.183 bits (326), Expect = 1.635e-30
Identity = 165/633 (26.07%), Postives = 270/633 (42.65%), Query Frame = 3
Query:  417 IKILDQNDKAPQFSSIKRPFFKIPENVEVGKVIDLPMAVDSDSEKYSVRRYSLSYIYHLDQTHDFRLHVTNDNPPRPQLIVNSKLDYEKINKYVFRLFAYDFDEKSIGNSCSTTIEIEIEDLNDNVPKFNQLTYNANIDENKRDDKLIKFTV-----SDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDADTHSN-MIHCKLVDYNDLFYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPIIVTDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLRTRKPLDRETLESISIKVTAKNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAPKF--------IPRLNMKQKVEFIVEQFVDGNTCTELPYTVQDIDDG 2273
            + +LD ND AP+FSS  R + K+PEN     ++ L  AVD DS       YS   I   +  + FR+     NP   ++   S LD E +  Y   + A   D  S    C+  + I + D NDN P+F Q+ ++A++    R+D  + F V      D D G N  +T +++D +         F I  +   + +   L+ E D   +   + A+D   P+ + S  V I + ++NDN P  +F +  +     +   E     +LV  V  +DAD  +N  +   +    + F +   S    + + +P   +        +N   +  +  +     P   ++++ ++ I I   N NAP F ++ Y   V               +  DRD  +NG+  + +      + S  F +D   G +  + SL  +  + F   + A D+G  PL+S +T  I+V + N  APRF+      ++ EN   G  +  + A D D    N  I YSI   GD S  FDI R +GD+     LD ET +  ++ V A +       +   T+    V I V DVNDN P          IP  N       +V   VD ++ +    T+  +DDG
Sbjct:  324 VDVLDINDNAPEFSS-SRFWAKVPENTPPRTIVVL-TAVDKDSGINGQVDYS---IIDGNIGNVFRV-----NPNSGEIRSVSTLDRENVASYELTVKAT--DRGSPTQHCTVKVLISVTDENDNSPRFTQI-FSAHV----REDAAVGFPVLRVSTLDADEGPNAAITFSLLDPS-------LPFSIHPSTGEITVSRRLNRE-DRSGYAVKVRASD---PAWTVSTDVTIVVDDVNDNAP--RFGQTAY----YIEFPEPSEGEALVARVSASDADDGANGQVFFFMRSQTENFRVGRDS--GEIHSVRPLRYRDPAGGGSGANLNKYSFVVTAMDRGRP--PLSSDATVTINIVVPNANAPRFLRERYSTPVAATVRAGTRILDMSAVDPDRD--VNGQIAYSVV---GGNASRRFDVDA-GGFLHLRASLAGDAGSIFSVTVEARDRGRPPLSSRATAIISVTEENQYAPRFAHPPLELSLPENHPAGSSLARVTATDTDAG-VNGAIVYSIA-SGDGSGLFDISRASGDVLLVGELDYETEKLYNLSVCAAD-----GGWQAKTECS-GVSISVTDVNDNPPMLNASDYYPVIPE-NAPSGTTVLVMDAVDADSPSNA-VTMYSLDDG 902          

HSP 5 Score: 115.546 bits (288), Expect = 5.001e-26
Identity = 124/476 (26.05%), Postives = 213/476 (44.75%), Query Frame = 3
Query:  744 SCSTTIEIEIEDLNDNVPKFNQLTYNANIDENK-RDDKLIKFTVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSII-EGLPAHSLVVEVRVTDADTHSNMIHCKLVDYNDLFYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPIIVTDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVL--DLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLRTRKPLDRETLESISIKVTAKNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAP 2159
            S   T  I + + N   P+F       ++ EN      L + T +D D+G NG +  +I            +F+I R    + L+  LDYET+  L+  ++ A D G  + +  + V I + ++NDN P +         S+   +I E  P+ + V+ +   DAD+ SN +         ++ LD       +LN K   L T   +D E+       +T+   +   +   +T + +++QI  VN+  P F Q+ Y  N   ++   V      +  TDRD+G++G   FY+      S S  F +++ +G+I     LD E +     ++IA + G         + +NV   D ND  P FS + Y   V E  SVG  +  + A D D+    +   + I+  G+    F I+ +TG +    PLDRE++   ++ V A +  +  +     T + V V++ + DVNDN P
Sbjct:  736 SSRATAIISVTEENQYAPRFAHPPLELSLPENHPAGSSLARVTATDTDAGVNGAIVYSIASGDGS-----GLFDISRASGDVLLVGELDYETE-KLYNLSVCAADGGWQAKTECSGVSISVTDVNDNPPMLN-------ASDYYPVIPENAPSGTTVLVMDAVDADSPSNAV--------TMYSLDDGEADLFVLNQKTGVLTTQGFLDYETKQ--TYELTVRAFNYPDTFHYSTAQ-VHVQITGVNEYFPRFVQREY--NFVVSESAPVGAPVGSVFATDRDAGIDGTV-FYM--LFGESRSKGFSVNEHTGEIIVSSQLDREREASATLRVIAKNAGSIRGFDVDEVLVNVAITDAND-PPVFSSALYHGRVSEAASVGTHVVGVSAHDFDSPPGWRTFSFLIQ-SGNAGRAFSINAHTGLIVVASPLDRESVPLYNLTVVAVDMGEPPA-----TGTTV-VVVALEDVNDNGP 1174          

HSP 6 Score: 108.997 bits (271), Expect = 4.100e-24
Identity = 118/480 (24.58%), Postives = 198/480 (41.25%), Query Frame = 3
Query: 1059 GTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDADTHSNMIHCKLVDYNDLFYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPIIVTDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLRTRKPLDRETLESISIKVTAKNPN--KYSSHFVRNTDSEVDVMIKVMDVNDNAPKFIPRLNMKQKVEFIVEQFVDGNTCTELPYTVQDID-DGGINGQNCCYTILENDYNKLFSLMTDTP---SYICLQRKPEKYQSYTVTLIARDRPPNVEGGLTSKISFPVLI 2480
            G P L+ +  V + +++ NDN P+    +L        ++ E  P  S V  V  TDAD   N I    +   D  +  +PS    +         T   +DRE      L +T    D  P+  ++++ +L + + DVND+ P F    Y+     +       F   +   D D+G NG   F L      S S+ F +D   G I   R+L    ++     +   D G  P ++ +T+T+   D  +  PRF+     F+  E+   G  I  + A    + R+   + Y +   G+    F +D  +G++   + LD E      + V A++     +S++          + + V+D+NDNAP+F           F  +  V  NT       +  +D D GINGQ   Y+I++ +   +F +  ++    S   L R  E   SY +T+ A DR     G  T   +  VLI
Sbjct:    2 GEPRLTGTGTVTVLVEDENDNLPRFGAAEL------RAAVPEDAPIGSDVALVNATDADAGLNAIISYRLRGGDGHFSVNPSTGQII---------TTASLDREGRESYVLEVTA--LDGGPTPGLSSSATLVVAVTDVNDHTPRFLNAPYVAYAPSSAPAGTAVF--AVTARDADAGPNGDLRFSLSG----SASAGFSVDPRRGVIHAARALQ-GPRDDLTLTVRVSDGGAPPRSAVTTVTVRFRDAGE-FPRFAPGPRSFSFREDQPPGTTITVVAA---RSSRRAGPVSYHLASGGNLGDVFAVDPQSGEVSVHRALDHEYQHHYELVVEARDSGFPPFSAYL--------KLEVDVLDINDNAPEF-------SSSRFWAK--VPENTPPRTIVVLTAVDKDSGINGQ-VDYSIIDGNIGNVFRVNPNSGEIRSVSTLDR--ENVASYELTVKATDR-----GSPTQHCTVKVLI 428          

HSP 7 Score: 108.612 bits (270), Expect = 6.640e-24
Identity = 145/585 (24.79%), Postives = 239/585 (40.85%), Query Frame = 3
Query:  414 LIKILDQNDKAPQFSSIKRPF-FKIPENVEVGKVIDLPMAVDSDSEKYSVRRYSLSYIYHLDQTHDFRLHVTNDNPPRPQLIVNSKLDYEKINKYVFRLFAYDFDEKSIGNSCSTTIEIEIEDLNDNVPKFNQLTYNANIDENK-RDDKLIKFTVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDADTHSNMIHCKLVDYNDLFYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESL-NIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPIIVTDRDSGLNGK-FEFYLEDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDT-DRKNKDIFYSIEPKGDHSSYFDIDRYTGDLRTRKPLDRETLESISIKVTAKNPNKYSSHFVRNTDSEVDVMIKVMDVNDN 2153
            +I + ++N  AP+F+    P    +PEN   G  +    A D+D+       YS   I   D +  F +   + +     +++  +LDYE    Y   + A D   ++    CS  + I + D+NDN P  N   Y   I EN      ++     D DS  N +   ++ D   +L      F + +    L     LDYET    +E T+ A +       S+AQV + +  +N+  P+   ++  F VS S  +  G P  S+    R  DA     + +        + + +S SK  ++ N     +   +++DRE    + LR+      S   R    +E L N+ I D ND  P+FS  +Y G V E            +   D DS    + F F ++   + +    F I+  +G I     LD E+   +   ++A+D G  P T ++ + + + D+NDN P    S     V EN   G  +  L+A D D    K    F  +        YF +   +G L+T +P+DRE      + V   +             S V + + V+D NDN
Sbjct:  742 IISVTEENQYAPRFA--HPPLELSLPENHPAGSSLARVTATDTDAGVNGAIVYS---IASGDGSGLFDISRASGD-----VLLVGELDYETEKLYNLSVCAADGGWQAK-TECSG-VSISVTDVNDNPPMLNASDYYPVIPENAPSGTTVLVMDAVDADSPSNAVTMYSLDDGEADL------FVLNQKTGVLTTQGFLDYETK-QTYELTVRAFNYPDTFHYSTAQVHVQITGVNEYFPRFVQREYNFVVSESAPV--GAPVGSVFATDR--DAGIDGTVFY--------MLFGESRSKGFSV-NEHTGEIIVSSQLDREREASATLRVIAKNAGS--IRGFDVDEVLVNVAITDAND-PPVFSSALYHGRVSEAASVGTHVVG--VSAHDFDSPPGWRTFSFLIQ---SGNAGRAFSINAHTGLIVVASPLDRESVPLYNLTVVAVDMGEPPATGTTVVVVALEDVNDNGPFLLTSSA--KVTENQPAGMTVLNLEAGDPDLPPNKGPYTFQLLGSDPAWRGYFSLSS-SGLLKTARPIDREQKPEFHLPVAIADAGSPP------LTSTVTLHLSVLDQNDN 1277          

HSP 8 Score: 75.0998 bits (183), Expect = 1.090e-13
Identity = 139/571 (24.34%), Postives = 219/571 (38.35%), Query Frame = 3
Query:  351 LCCKLIGFQYLTPTDPGTFFILIKILDQNDKAPQFSSIKRPFFKIPENVEVGKVIDLPMAVDSDSEKYSVRRYSLSYIYHLDQTHDFRLHVTNDNPPRPQLIVNSKLDYEKINKYVFRLFAYDFDEKSIGNSCSTTIEIEIEDLNDNVPKFNQLTYNANIDENKRDDKLIKFT-VSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINS--LDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDADT----HSNMIHCKLVDYNDLFY---------LDSPSKFNTL--------------LNYKPFNLKTINKIDRESNHGSFLRITISCTD-SEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPIIVTDRDSG------LNGKFEFYL----EDFRN-FSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDD-TDRKNKDI 1934
            +C    G+Q  T        + I + D ND  P  ++    +  IPEN   G  + +  AVD+DS   +V  YSL      D   D  L V N       L     LDYE    Y   + A+++ +    +  +  + ++I  +N+  P+F Q  YN  + E+      +     +D D+G +G V   +  ++     R K F +  NE   E+I S  LD E +                   +SA +++  KN                       I G     ++V V +TDA+      S + H ++ +   +            DSP  + T               +N     +   + +DRES       +T+   D  EP    TT   + + +EDVNDN P             +   V  N P  + V + ++G        G + F L      +R  FS SS       SG + T R +D E K +F   +   D G  PLTS+ T+ ++VLD NDN     +     N F +   G  IG ++  D D +DR N D+
Sbjct:  830 VCAADGGWQAKTECS----GVSISVTDVNDNPPMLNASDY-YPVIPENAPSGTTVLVMDAVDADSPSNAVTMYSLD-----DGEAD--LFVLNQK--TGVLTTQGFLDYETKQTYELTVRAFNYPDTF--HYSTAQVHVQITGVNEYFPRFVQREYNFVVSESAPVGAPVGSVFATDRDAGIDGTVFYMLFGES-----RSKGFSV--NEHTGEIIVSSQLDRERE-------------------ASATLRVIAKNAGS--------------------IRGFDVDEVLVNVAITDANDPPVFSSALYHGRVSEAASVGTHVVGVSAHDFDSPPGWRTFSFLIQSGNAGRAFSINAHTGLIVVASPLDRESV--PLYNLTVVAVDMGEPPATGTT--VVVVALEDVNDNGPFL---------LTSSAKVTENQPAGMTVLNLEAGDPDLPPNKGPYTFQLLGSDPAWRGYFSLSS-------SGLLKTARPIDREQKPEFHLPVAIADAGSPPLTSTVTLHLSVLDQNDNPSEARDVRVHVNYFGSPFPGGFIGDVRPRDPDISDRFNCDL 1318          
BLAST of Protocadherin Fat 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004042.1 (pep scaffold:Pmarinus_7.0:GL479143:9150:31231:-1 gene:ENSPMAG00000003698.1 transcript:ENSPMAT00000004042.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 170.244 bits (430), Expect = 7.560e-43
Identity = 168/605 (27.77%), Postives = 273/605 (45.12%), Query Frame = 3
Query:  585 YHLDQTHDFRLHVTNDNPPRPQLIVNSKLDYEKINKYVFRLFAYDFDEKSIGNSCSTTIEIEIEDLNDNVPKFNQLTYNANIDENKRDDKLIKFTVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDADTHSNM-IHCKLVDYNDLFYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKP---------IIVTDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFTQRSLDYETK---------NKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLRTRKPLDRETLESISIKVTAKNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAPKFI-PRLNMKQKVEFIVEQFVDGNTCTELPYTVQDIDDGGINGQNCCYTILENDYNKLFSL 2339
            YHL    +    V   +P   ++ V+  LD+E  + Y   + A D        S    +E+++ D+NDN P+F+   + A + EN     ++  T  D DSG NG V  +I+D          +F +  N   +  +++LD E +   +E T+ ATD+G+P+   + +V I + + NDN P+  F ++ FS         G P    V+ V   DAD   N  I   L+D +  F +  PS     ++          +++RE   G  +++  S    +P+  ++T+  + I ++DVNDNAP F Q  Y            + FP+P         +  +D D G NG+  F++      S + +F + + SG+I + R L Y            NK+ F + A+D+G  PL+S +T+TIN++  N NAPRF    Y   V   V  G +I  + A+D D D  N  I YS+   G+ S  FD+D   G L  R  L  +     S+ V A++  +          S    +I V + N  AP+F  P L +      + E    G++   +  T  D  D G+NG    Y+I   D + LF +
Sbjct:  267 YHLASGGNLG-DVFAVDPQSGEVSVHRALDHEYQHHYELVVEARDSGFPPF--SAYLKLEVDVLDINDNAPEFSSSRFWAKVPENTPPRTIVVLTAVDKDSGINGQVDYSIID-----GNIGNVFRVNPNSGEIRSVSTLDRE-NVASYELTVKATDRGSPTQHCTVKVLISVTDENDNSPR--FTQI-FSAHVREDAAVGFP----VLRVSTLDADEGPNAAITFSLLDPSLPFSIH-PSTGEITVS---------RRLNREDRSGYAVKVRAS----DPAWTVSTD--VTIVVDDVNDNAPRFGQTAYY-----------IEFPEPSEGEALVARVSASDADDGANGQVFFFMR-----SQTENFRVGRDSGEIHSVRPLRYRDPAGGGSGANLNKYSFVVTAMDRGRPPLSSDATVTINIVVPNANAPRFLRERYSTPVAATVRAGTRILDMSAVDPDRD-VNGQIAYSVV-GGNASRRFDVD-AGGFLHLRASLAGDAGSIFSVTVEARDRGRPP------LSSRATAIISVTEENQYAPRFAHPPLELS-----LPENHPAGSSLARV--TATDT-DAGVNGA-IVYSIASGDGSGLFDI 805          

HSP 2 Score: 151.754 bits (382), Expect = 4.245e-37
Identity = 170/697 (24.39%), Postives = 299/697 (42.90%), Query Frame = 3
Query:  384 TPTDPGTFFILIKILDQNDKAPQFSSIKRPFFKIPENVEVGKVIDLPMAVDSDSEKYSVRRYSLSYIYHLDQTHDFRLHVTNDNPPRPQLIVNSKLDYEKINKYVFRLFAYDFDEKSIGNSCSTTIEIEIEDLNDNVPKFNQLTYNANIDENKRDDKLI-KFTVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINSLDYETDP---------HLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDADTHSN-MIHCKLVDYNDLFYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTD-SEPSRQITTNESLNIQIEDVNDNAPMFSQ---QIYIGXXXXXXXXXXXXFPKPIIVTDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLRTRKPLDRETLESISIKVTAKN-PNKYSSHFVRNTDSEVDVMIKVMDVNDNAPKFIPRLNMKQKVEFIVEQFVDGNTCTELPYTVQDIDDGGINGQNCCYTILENDYNKLFSLMTDTPSYIC-LQRKPEKYQSYTVTLIARD 2423
            +PT   T  +LI + D+ND +P+F+ I     +  E+  VG  +     +D+D    +   +SL     LD +  F +H     P   ++ V+ +L+ E  + Y  ++ A D        + ST + I ++D+NDN P+F Q  Y     E    + L+ + + SD D G NG V   +  +T+        F + R+   +  +  L Y  DP         + + F + A D+G P LSS A V I++   N N P+   ++    V+ +V       A + ++++   D D   N  I   +V  N     D  +     L           +     + GS   +T+   D   P   +++  +  I + + N  AP F+    ++ +        ++       +  TD D+G+NG   + +    +   S  F I + SG +     LDYET+  +   + A D G+Q  T  S ++I+V D+NDN P  + S Y   + EN   G  +  + A+D D+   N    YS++     +  F +++ TG L T+  LD ET ++  + V A N P+ +  H+     S   V +++  VN+  P+F+ R     +  F+V +         +        D GI+G    Y +     +K FS+   T   I   Q   E+  S T+ +IA++
Sbjct:  417 SPTQHCTVKVLISVTDENDNSPRFTQIFSAHVR--EDAAVGFPVLRVSTLDADEGPNAAITFSL-----LDPSLPFSIH-----PSTGEITVSRRLNREDRSGYAVKVRASD-----PAWTVSTDVTIVVDDVNDNAPRFGQTAYYIEFPEPSEGEALVARVSASDADDGANGQVFFFMRSQTEN-------FRVGRDSGEIHSVRPLRYR-DPAGGGSGANLNKYSFVVTAMDRGRPPLSSDATVTINIVVPNANAPRFLRERYSTPVAATVR------AGTRILDMSAVDPDRDVNGQIAYSVVGGNASRRFDVDAGGFLHL-----------RASLAGDAGSIFSVTVEARDRGRP--PLSSRATAIISVTEENQYAPRFAHPPLELSLPENHPAGSSLAR-----VTATDTDAGVNGAIVYSIA---SGDGSGLFDISRASGDVLLVGELDYETEKLYNLSVCAADGGWQAKTECSGVSISVTDVNDNPPMLNASDYYPVIPENAPSGTTVLVMDAVDADSP-SNAVTMYSLDDG--EADLFVLNQKTGVLTTQGFLDYETKQTYELTVRAFNYPDTF--HY-----STAQVHVQITGVNEYFPRFVQR-----EYNFVVSE--SAPVGAPVGSVFATDRDAGIDG-TVFYMLFGESRSKGFSVNEHTGEIIVSSQLDREREASATLRVIAKN 1043          

HSP 3 Score: 132.109 bits (331), Expect = 4.225e-31
Identity = 150/596 (25.17%), Postives = 250/596 (41.95%), Query Frame = 3
Query:  399 GTFFILIKILDQNDKAPQFSSIKRPFFKIPENVEVGKVIDLPMAVDSDSEKYSVRRYSLSYIYHLDQTHDFRLHVTNDNPPRPQLIVNSKLDYEKINKYVFRLFAYDFDEKSIGNSCSTTIEIEIEDLNDNVPKFNQLTYNANIDENK-RDDKLIKFTVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDADTHSNMIHCKLV---DYNDLFYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPIIV---TDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLRTRKPLDRETLESISIKVTAKNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAPKF 2165
            GT  + + + D+ND  P+F + +     +PE+  +G  + L  A D+D+   ++  Y L       +  D    V   NP   Q+I  + LD E    YV  + A D    + G S S T+ + + D+ND+ P+F    Y A    +      +   T  D D+G NG +  ++             F +      +    +L    D      T+  +D G P  S+   V +  +   D G   +F         S S  E  P  + +  V    +   +  +   L    +  D+F +D  S            +     +D E  H   L +    +   P    +    L + + D+NDNAP FS   +   V EN        P+ I+V    D+DSG+NG+ ++ + D  N  +   F ++  SG+I +  +LD E    +   + A D+G      +  + I+V D NDN+PRF++  +  +V E+ +VG+ +  +  +D D +  N  I +S+    D S  F I   TG++   + L+RE     ++KV A +P    S          DV I V DVNDNAP+F
Sbjct:    8 GTGTVTVLVEDENDNLPRFGAAEL-RAAVPEDAPIGSDVALVNATDADAGLNAIISYRL-------RGGDGHFSV---NPSTGQIITTASLDREGRESYVLEVTALD-GGPTPGLSSSATLVVAVTDVNDHTPRFLNAPYVAYAPSSAPAGTAVFAVTARDADAGPNGDLRFSLSGSAS------AGFSVDPRRGVIHAARALQGPRDD--LTLTVRVSDGGAPPRSAVTTVTVRFR---DAGEFPRFAP----GPRSFSFREDQPPGTTITVV-AARSSRRAGPVSYHLASGGNLGDVFAVDPQSG----------EVSVHRALDHEYQHHYELVVEARDSGFPP---FSAYLKLEVDVLDINDNAPEFSSSRFWAKVPENTP------PRTIVVLTAVDKDSGINGQVDYSIID-GNIGNV--FRVNPNSGEIRSVSTLDRENVASYELTVKATDRGSPTQHCTVKVLISVTDENDNSPRFTQI-FSAHVREDAAVGFPVLRVSTLDAD-EGPNAAITFSLL---DPSLPFSIHPSTGEITVSRRLNREDRSGYAVKVRASDPAWTVS---------TDVTIVVDDVNDNAPRF 539          

HSP 4 Score: 130.183 bits (326), Expect = 1.724e-30
Identity = 165/633 (26.07%), Postives = 270/633 (42.65%), Query Frame = 3
Query:  417 IKILDQNDKAPQFSSIKRPFFKIPENVEVGKVIDLPMAVDSDSEKYSVRRYSLSYIYHLDQTHDFRLHVTNDNPPRPQLIVNSKLDYEKINKYVFRLFAYDFDEKSIGNSCSTTIEIEIEDLNDNVPKFNQLTYNANIDENKRDDKLIKFTV-----SDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDADTHSN-MIHCKLVDYNDLFYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPIIVTDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLRTRKPLDRETLESISIKVTAKNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAPKF--------IPRLNMKQKVEFIVEQFVDGNTCTELPYTVQDIDDG 2273
            + +LD ND AP+FSS  R + K+PEN     ++ L  AVD DS       YS   I   +  + FR+     NP   ++   S LD E +  Y   + A   D  S    C+  + I + D NDN P+F Q+ ++A++    R+D  + F V      D D G N  +T +++D +         F I  +   + +   L+ E D   +   + A+D   P+ + S  V I + ++NDN P  +F +  +     +   E     +LV  V  +DAD  +N  +   +    + F +   S    + + +P   +        +N   +  +  +     P   ++++ ++ I I   N NAP F ++ Y   V               +  DRD  +NG+  + +      + S  F +D   G +  + SL  +  + F   + A D+G  PL+S +T  I+V + N  APRF+      ++ EN   G  +  + A D D    N  I YSI   GD S  FDI R +GD+     LD ET +  ++ V A +       +   T+    V I V DVNDN P          IP  N       +V   VD ++ +    T+  +DDG
Sbjct:  324 VDVLDINDNAPEFSS-SRFWAKVPENTPPRTIVVL-TAVDKDSGINGQVDYS---IIDGNIGNVFRV-----NPNSGEIRSVSTLDRENVASYELTVKAT--DRGSPTQHCTVKVLISVTDENDNSPRFTQI-FSAHV----REDAAVGFPVLRVSTLDADEGPNAAITFSLLDPS-------LPFSIHPSTGEITVSRRLNRE-DRSGYAVKVRASD---PAWTVSTDVTIVVDDVNDNAP--RFGQTAY----YIEFPEPSEGEALVARVSASDADDGANGQVFFFMRSQTENFRVGRDS--GEIHSVRPLRYRDPAGGGSGANLNKYSFVVTAMDRGRP--PLSSDATVTINIVVPNANAPRFLRERYSTPVAATVRAGTRILDMSAVDPDRD--VNGQIAYSVV---GGNASRRFDVDA-GGFLHLRASLAGDAGSIFSVTVEARDRGRPPLSSRATAIISVTEENQYAPRFAHPPLELSLPENHPAGSSLARVTATDTDAG-VNGAIVYSIA-SGDGSGLFDISRASGDVLLVGELDYETEKLYNLSVCAAD-----GGWQAKTECS-GVSISVTDVNDNPPMLNASDYYPVIPE-NAPSGTTVLVMDAVDADSPSNA-VTMYSLDDG 902          

HSP 5 Score: 115.546 bits (288), Expect = 4.722e-26
Identity = 124/476 (26.05%), Postives = 213/476 (44.75%), Query Frame = 3
Query:  744 SCSTTIEIEIEDLNDNVPKFNQLTYNANIDENK-RDDKLIKFTVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSII-EGLPAHSLVVEVRVTDADTHSNMIHCKLVDYNDLFYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPIIVTDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVL--DLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLRTRKPLDRETLESISIKVTAKNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAP 2159
            S   T  I + + N   P+F       ++ EN      L + T +D D+G NG +  +I            +F+I R    + L+  LDYET+  L+  ++ A D G  + +  + V I + ++NDN P +         S+   +I E  P+ + V+ +   DAD+ SN +         ++ LD       +LN K   L T   +D E+       +T+   +   +   +T + +++QI  VN+  P F Q+ Y  N   ++   V      +  TDRD+G++G   FY+      S S  F +++ +G+I     LD E +     ++IA + G         + +NV   D ND  P FS + Y   V E  SVG  +  + A D D+    +   + I+  G+    F I+ +TG +    PLDRE++   ++ V A +  +  +     T + V V++ + DVNDN P
Sbjct:  736 SSRATAIISVTEENQYAPRFAHPPLELSLPENHPAGSSLARVTATDTDAGVNGAIVYSIASGDGS-----GLFDISRASGDVLLVGELDYETE-KLYNLSVCAADGGWQAKTECSGVSISVTDVNDNPPMLN-------ASDYYPVIPENAPSGTTVLVMDAVDADSPSNAV--------TMYSLDDGEADLFVLNQKTGVLTTQGFLDYETKQ--TYELTVRAFNYPDTFHYSTAQ-VHVQITGVNEYFPRFVQREY--NFVVSESAPVGAPVGSVFATDRDAGIDGTV-FYM--LFGESRSKGFSVNEHTGEIIVSSQLDREREASATLRVIAKNAGSIRGFDVDEVLVNVAITDAND-PPVFSSALYHGRVSEAASVGTHVVGVSAHDFDSPPGWRTFSFLIQ-SGNAGRAFSINAHTGLIVVASPLDRESVPLYNLTVVAVDMGEPPA-----TGTTV-VVVALEDVNDNGP 1174          

HSP 6 Score: 108.997 bits (271), Expect = 4.073e-24
Identity = 118/480 (24.58%), Postives = 198/480 (41.25%), Query Frame = 3
Query: 1059 GTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDADTHSNMIHCKLVDYNDLFYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPIIVTDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLRTRKPLDRETLESISIKVTAKNPN--KYSSHFVRNTDSEVDVMIKVMDVNDNAPKFIPRLNMKQKVEFIVEQFVDGNTCTELPYTVQDID-DGGINGQNCCYTILENDYNKLFSLMTDTP---SYICLQRKPEKYQSYTVTLIARDRPPNVEGGLTSKISFPVLI 2480
            G P L+ +  V + +++ NDN P+    +L        ++ E  P  S V  V  TDAD   N I    +   D  +  +PS    +         T   +DRE      L +T    D  P+  ++++ +L + + DVND+ P F    Y+     +       F   +   D D+G NG   F L      S S+ F +D   G I   R+L    ++     +   D G  P ++ +T+T+   D  +  PRF+     F+  E+   G  I  + A    + R+   + Y +   G+    F +D  +G++   + LD E      + V A++     +S++          + + V+D+NDNAP+F           F  +  V  NT       +  +D D GINGQ   Y+I++ +   +F +  ++    S   L R  E   SY +T+ A DR     G  T   +  VLI
Sbjct:    2 GEPRLTGTGTVTVLVEDENDNLPRFGAAEL------RAAVPEDAPIGSDVALVNATDADAGLNAIISYRLRGGDGHFSVNPSTGQII---------TTASLDREGRESYVLEVTA--LDGGPTPGLSSSATLVVAVTDVNDHTPRFLNAPYVAYAPSSAPAGTAVF--AVTARDADAGPNGDLRFSLSG----SASAGFSVDPRRGVIHAARALQ-GPRDDLTLTVRVSDGGAPPRSAVTTVTVRFRDAGE-FPRFAPGPRSFSFREDQPPGTTITVVAA---RSSRRAGPVSYHLASGGNLGDVFAVDPQSGEVSVHRALDHEYQHHYELVVEARDSGFPPFSAYL--------KLEVDVLDINDNAPEF-------SSSRFWAK--VPENTPPRTIVVLTAVDKDSGINGQ-VDYSIIDGNIGNVFRVNPNSGEIRSVSTLDR--ENVASYELTVKATDR-----GSPTQHCTVKVLI 428          

HSP 7 Score: 108.227 bits (269), Expect = 6.879e-24
Identity = 145/585 (24.79%), Postives = 239/585 (40.85%), Query Frame = 3
Query:  414 LIKILDQNDKAPQFSSIKRPF-FKIPENVEVGKVIDLPMAVDSDSEKYSVRRYSLSYIYHLDQTHDFRLHVTNDNPPRPQLIVNSKLDYEKINKYVFRLFAYDFDEKSIGNSCSTTIEIEIEDLNDNVPKFNQLTYNANIDENK-RDDKLIKFTVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDADTHSNMIHCKLVDYNDLFYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESL-NIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPIIVTDRDSGLNGK-FEFYLEDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDT-DRKNKDIFYSIEPKGDHSSYFDIDRYTGDLRTRKPLDRETLESISIKVTAKNPNKYSSHFVRNTDSEVDVMIKVMDVNDN 2153
            +I + ++N  AP+F+    P    +PEN   G  +    A D+D+       YS   I   D +  F +   + +     +++  +LDYE    Y   + A D   ++    CS  + I + D+NDN P  N   Y   I EN      ++     D DS  N +   ++ D   +L      F + +    L     LDYET    +E T+ A +       S+AQV + +  +N+  P+   ++  F VS S  +  G P  S+    R  DA     + +        + + +S SK  ++ N     +   +++DRE    + LR+      S   R    +E L N+ I D ND  P+FS  +Y G V E            +   D DS    + F F ++   + +    F I+  +G I     LD E+   +   ++A+D G  P T ++ + + + D+NDN P    S     V EN   G  +  L+A D D    K    F  +        YF +   +G L+T +P+DRE      + V   +             S V + + V+D NDN
Sbjct:  742 IISVTEENQYAPRFA--HPPLELSLPENHPAGSSLARVTATDTDAGVNGAIVYS---IASGDGSGLFDISRASGD-----VLLVGELDYETEKLYNLSVCAADGGWQAK-TECSG-VSISVTDVNDNPPMLNASDYYPVIPENAPSGTTVLVMDAVDADSPSNAVTMYSLDDGEADL------FVLNQKTGVLTTQGFLDYETK-QTYELTVRAFNYPDTFHYSTAQVHVQITGVNEYFPRFVQREYNFVVSESAPV--GAPVGSVFATDR--DAGIDGTVFY--------MLFGESRSKGFSV-NEHTGEIIVSSQLDREREASATLRVIAKNAGS--IRGFDVDEVLVNVAITDAND-PPVFSSALYHGRVSEAASVGTHVVG--VSAHDFDSPPGWRTFSFLIQ---SGNAGRAFSINAHTGLIVVASPLDRESVPLYNLTVVAVDMGEPPATGTTVVVVALEDVNDNGPFLLTSSA--KVTENQPAGMTVLNLEAGDPDLPPNKGPYTFQLLGSDPAWRGYFSLSS-SGLLKTARPIDREQKPEFHLPVAIADAGSPP------LTSTVTLHLSVLDQNDN 1277          

HSP 8 Score: 74.7146 bits (182), Expect = 1.148e-13
Identity = 139/571 (24.34%), Postives = 219/571 (38.35%), Query Frame = 3
Query:  351 LCCKLIGFQYLTPTDPGTFFILIKILDQNDKAPQFSSIKRPFFKIPENVEVGKVIDLPMAVDSDSEKYSVRRYSLSYIYHLDQTHDFRLHVTNDNPPRPQLIVNSKLDYEKINKYVFRLFAYDFDEKSIGNSCSTTIEIEIEDLNDNVPKFNQLTYNANIDENKRDDKLIKFT-VSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINS--LDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDADT----HSNMIHCKLVDYNDLFY---------LDSPSKFNTL--------------LNYKPFNLKTINKIDRESNHGSFLRITISCTD-SEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPIIVTDRDSG------LNGKFEFYL----EDFRN-FSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDD-TDRKNKDI 1934
            +C    G+Q  T        + I + D ND  P  ++    +  IPEN   G  + +  AVD+DS   +V  YSL      D   D  L V N       L     LDYE    Y   + A+++ +    +  +  + ++I  +N+  P+F Q  YN  + E+      +     +D D+G +G V   +  ++     R K F +  NE   E+I S  LD E +                   +SA +++  KN                       I G     ++V V +TDA+      S + H ++ +   +            DSP  + T               +N     +   + +DRES       +T+   D  EP    TT   + + +EDVNDN P             +   V  N P  + V + ++G        G + F L      +R  FS SS       SG + T R +D E K +F   +   D G  PLTS+ T+ ++VLD NDN     +     N F +   G  IG ++  D D +DR N D+
Sbjct:  830 VCAADGGWQAKTECS----GVSISVTDVNDNPPMLNASDY-YPVIPENAPSGTTVLVMDAVDADSPSNAVTMYSLD-----DGEAD--LFVLNQK--TGVLTTQGFLDYETKQTYELTVRAFNYPDTF--HYSTAQVHVQITGVNEYFPRFVQREYNFVVSESAPVGAPVGSVFATDRDAGIDGTVFYMLFGES-----RSKGFSV--NEHTGEIIVSSQLDRERE-------------------ASATLRVIAKNAGS--------------------IRGFDVDEVLVNVAITDANDPPVFSSALYHGRVSEAASVGTHVVGVSAHDFDSPPGWRTFSFLIQSGNAGRAFSINAHTGLIVVASPLDRESV--PLYNLTVVAVDMGEPPATGTT--VVVVALEDVNDNGPFL---------LTSSAKVTENQPAGMTVLNLEAGDPDLPPNKGPYTFQLLGSDPAWRGYFSLSS-------SGLLKTARPIDREQKPEFHLPVAIADAGSPPLTSTVTLHLSVLDQNDNPSEARDVRVHVNYFGSPFPGGFIGDVRPRDPDISDRFNCDL 1318          
BLAST of Protocadherin Fat 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008517.1 (pep scaffold:Pmarinus_7.0:GL476786:43429:129410:1 gene:ENSPMAG00000007697.1 transcript:ENSPMAT00000008517.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 166.007 bits (419), Expect = 1.565e-41
Identity = 155/594 (26.09%), Postives = 264/594 (44.44%), Query Frame = 3
Query:  408 FILIKILDQNDKAPQFSSIKRPFFKIPENVEVGKVIDLPMAVDSDSEKYSVRRYSLSY-IYHLDQTHDFRLHVTNDNPPRPQLIVNSKLDYEKINKYVFRLFAYDFDEKSIGNSCSTTIEIEIEDLNDNVPKFNQLTYNANIDENK-RDDKLIKFTVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDADTHSNMIHCKLVDYNDLFYLDSPSKFNTLLNYKPFNLKTINKIDRES----NHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPIIVTDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLRTRKPLDRETLESISIKVTAKNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAPKFIP 2171
             + I + D  D  P F+     F  + ENV  G ++    A   D         +++Y I   DQ   F +  +       ++   + +D E+   Y  R+ A      S G +   ++ + + D+N++ P F++ +Y  +I E++  + +      +D DSG+NG V   I +      ++F IF   +    L +   LD ET    +  T+ A D G   LSSS  V + + ++NDN P        F       +       SLV  V+ TDAD  SN           + Y     + N  L+ +   + ++   DRE+       +    ++  TD    + +    ++ + ++DVNDN P F++ +Y  +V E+  N+       +  +D D G+NG   + + +    ++   F +D  +G+I    SLD E    +   + A D G  PL +S T+ + VLD NDN PRF+ES    +  E+  VG  + TL A D+DT   + D+ Y+I     H++ F IDR TG +   + LD ET     + V+A++  +          S   +++ V D NDN P F+P
Sbjct:  643 IVTITVADAQDTPPTFARDDYSFV-VFENVAPGTLVGSVSASTLDLNA------NVTYLIVSGDQRGSFSIEWSGG-----RIFTANAIDREEQAFYQLRVVA-----NSGGVAGEASVSVLVHDVNNHAPVFDRASYEVSIAEDEPVNSRFFSVRATDKDSGKNGEVKYEIGEGNG--GEKFGIFPDGQ----LYVRYELDRETREE-YSLTVSAMDTGVEPLSSSVTVNVTVLDVNDNKPLFNSSSYVFHFCEEQEV------GSLVGAVQATDADAGSN---------GGVTYSFEKPQVNFELDSETGRIASLRVFDREALIRQGGAASFSFSVVATDGGRPKPLQDRATVQVFVQDVNDNPPQFAKSVYQASVSESASNLTQLLR--VTASDVDEGVNGALRYAINEG---NEGGKFTVDASTGQITLLGSLDREETASYTLVVSATDSGTSPLAASCTVAVQVLDENDNPPRFTESLLSVDALESTRVGELLITLTASDEDTG-PSGDVRYAIVAGNTHAT-FAIDRSTGSVFLARRLDFETQRLYRLNVSAEDGGRPPRS------SATILVVHVRDFNDNPPAFLP 1184          

HSP 2 Score: 164.081 bits (414), Expect = 5.434e-41
Identity = 184/686 (26.82%), Postives = 296/686 (43.15%), Query Frame = 3
Query:  411 ILIKILDQNDKAPQFSSIKRPFFKIPENVEVGKVIDLPMAVDSDSEKYSVRRYSLSYIYHLDQTHDFRLHVTNDNPPRPQLIVNSKLDYEKINKYVFRLFAYDFDEKSIGNSCSTTIEIEIEDLNDNVPKFNQLTYNANIDENK-RDDKLIKFTVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDADTHSNMIHCKLVDYNDLFYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPIIVTDRDSGLNGKFEFYL------EDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIE-PKGDHSSYFDIDRYTGDLRTRKPLDRETL------ESISIKVTAKNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAPKFIPRLNMKQKVEFIVEQFVDGNTCTELPYTVQDIDDGGINGQNCCYTILENDYNKLFSLMTDTPSYICLQR-KPEKYQSYTVTLIARD 2423
            + + +LD ND+ P F+  K     + EN   G  +    A DSD  +    RY+            FRL          ++     LD E++ +Y   + A D     +G++   T+ +   DLNDN P F  + Y A+I EN+     +   T +DPD G NG V   +   T   + RF++  +      +    SLD E +  +++  + A D G     S A V I + +  D  P        F V       E +   +LV  V  +  D ++N+ +        +   D    F+  + +    + T N IDRE      LR+  +      S  +    S+++ + DVN++AP+F +  Y  ++ E++      F   +  TD+DSG NG+ ++ +      E F  F D          G+++ +  LD ET+ ++   + A+D G +PL+SS T+ + VLD+NDN P F+ S Y+F+  E   VG  +G +QA D D    N  + YS E P+ +    F++D  TG + + +  DRE L       S S  V A +  +      R T     V + V DVNDN P+F   +      E         N    L  T  D+D+ G+NG    Y I E +    F++   T     L     E+  SYT+ + A D
Sbjct:  432 LTVTLLDVNDEPPLFTQTKYVATAV-ENSLPGLFVVSVSAADSDLGENGTVRYNFDPDMPAQYREMFRLDSLTG-----KVTTLKSLDREELEEYPLVVQAQDRGSPPLGSTAKVTVVVG--DLNDNHPVFYPVQYFASILENEPGGTAVTTVTATDPDRGANGTVRYQL---TAGDAARFQVNAVTGA---VSTRVSLDRE-ERAVYQLQVTALDGGHLRARSPAIVTITVADAQDTPPTFARDDYSFVV------FENVAPGTLVGSVSASTLDLNANVTYL-------IVSGDQRGSFS--IEWSGGRIFTANAIDREEQAFYQLRVVAN------SGGVAGEASVSVLVHDVNNHAPVFDRASYEVSIAEDEPVNSRFFS--VRATDKDSGKNGEVKYEIGEGNGGEKFGIFPD----------GQLYVRYELDRETREEYSLTVSAMDTGVEPLSSSVTVNVTVLDVNDNKPLFNSSSYVFHFCEEQEVGSLVGAVQATDADAG-SNGGVTYSFEKPQVN----FELDSETGRIASLRVFDREALIRQGGAASFSFSVVATDGGRPKPLQDRAT-----VQVFVQDVNDNPPQFAKSVYQASVSESA------SNLTQLLRVTASDVDE-GVNGA-LRYAINEGNEGGKFTVDASTGQITLLGSLDREETASYTLVVSATD 1051          

HSP 3 Score: 161.384 bits (407), Expect = 3.664e-40
Identity = 162/601 (26.96%), Postives = 254/601 (42.26%), Query Frame = 3
Query:  411 ILIKILDQNDKAPQFSSIKRPFFKIPENVEVGKVIDLPMAVDSDSEKYSVRRYSLSYIYHLDQTHDFRLHVTNDNPPRP-------QLIVNSKLDYEKINKYVFRLFAYDFDEKSIGNSCSTTIEIEIEDLNDNVPKFNQLTYNANIDENKRDDKLIKFTVSDPDSGRNGIVTVNIVDKTDELSKRFKI-FEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDAD--THSNMIHCKLVDYNDL--FYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPIIVTDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPK--GDHSSYFDIDRYTGDLRTRKPLDRETLESISIKVTAKNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAPKFIP 2171
            + + + D ND AP F           E+  VG+ + L  AVD D     V  ++   +       + RL      PPRP        L     LD E    Y   + A D    S        + + ++D NDN P F +  Y A++ E    D  +   + D      G + V    KT  +S R  + FE +R                   +  +L A D G P LS  A   I L ++NDN P I+F  L    + S S+ E     ++   V VTDAD  T +  +   +V  N+   F L +P      +      LK  +++DRE        +TI  +D+      +   SL + + DVND+AP F+   Y      ++     ++ K +   D DSGLN K  + +    + +D   F +D+ +G + T   +D E  +     I A D+G QP T+ +++T+ +LD+ND  P F+++ Y+    EN   G  + ++ A D D   +N  + Y+ +P     +   F +D  TG + T K LDRE LE   + V A++             S   V + V D+NDN P F P
Sbjct:    9 VRVVVGDVNDNAPSFPEPGVMEVAFKEDAAVGRQVLLDTAVDRDVGPNGVNHHAYKIV---SGNEEGRLV-----PPRPVTKRAFLHLATTGPLDREANPSYALAVQAED--GGSPRRYGRLQVNVTVQDANDNPPAFEKPAYRASVAE----DSPVGAALRDLLHRGRGPLAVPFDPKTGMVSTRQPLDFEARRQ------------------YTLSLRAADGGNPPLSGRATAVIQLLDVNDNDPAIRFVYLP-PAARSASVDESAAPGTVAALVTVTDADSPTANGELSVSIVGGNERGHFVLHAPGVPGLRV------LKVASQLDRE--RIPMYNLTILASDNGKPVARSATASLVVYVNDVNDHAPRFALSAY--AAALSEGAPAGSYVKDVTAMDADSGLNAKLRYSIV---SGNDLGWFSVDESTGLVTTDGKVDREVASSVVLNISAQDQGAQPKTAYTSLTVTLLDVNDEPPLFTQTKYVATAVENSLPGLFVVSVSAADSDLG-ENGTVRYNFDPDMPAQYREMFRLDSLTGKVTTLKSLDREELEEYPLVVQAQDRGSPP------LGSTAKVTVVVGDLNDNHPVFYP 556          

HSP 4 Score: 155.606 bits (392), Expect = 2.336e-38
Identity = 143/522 (27.39%), Postives = 241/522 (46.17%), Query Frame = 3
Query:  639 PRPQLIVNSKLDYEKINKYVFRLFAYDFDEKSIGNSCSTTIEIEIEDLNDNVPKFNQLTYNANIDENKRDDKLI-KFTVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINSLDYET-----DPHLFEFTLLATDQGTPS-LSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDADTHSNMIHCKLVDYNDL-----FYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPIIVTDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLRTRKPLDRETLESISIKVTAKNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAPKFI 2168
            P  QL V  +LD E   +Y   + A D   + +  S S T+ + + D+NDN P FN  +Y  +  E +    L+     +D D+G NG VT +         K    FE+      +  +   D E          F F+++ATD G P  L   A V++ ++++NDN P+        SVS S S +  L        +RVT +D    +        N+      F +D+ +   TLL            +DRE    +   + +S TDS  S  +  + ++ +Q+ D NDN P F++ +   +VD  +   V      +  +D D+G +G   + +      +    F ID+ +G +F  R LD+ET+  +R  + A D G  P +S++ + ++V D NDN P F       ++ EN+ +G ++ T+ A D D D  N ++ YSI  +    ++F ID  +G++ T   +DRE    +  +VT +  +K      R +  + +V + V D NDNAP+F+
Sbjct:  810 PDGQLYVRYELDRETREEYSLTVSAMDTGVEPL--SSSVTVNVTVLDVNDNKPLFNSSSYVFHFCEEQEVGSLVGAVQATDADAGSNGGVTYS-------FEKPQVNFELDSETGRIASLRVFDREALIRQGGAASFSFSVVATDGGRPKPLQDRATVQVFVQDVNDNPPQFAKSVYQASVSESASNLTQL--------LRVTASDVDEGVNGALRYAINEGNEGGKFTVDASTGQITLLG----------SLDREET--ASYTLVVSATDSGTS-PLAASCTVAVQVLDENDNPPRFTESLL--SVDALESTRVGELLITLTASDEDTGPSGDVRYAIVAGNTHAT---FAIDRSTGSVFLARRLDFETQRLYRLNVSAEDGGRPPRSSATILVVHVRDFNDNPPAFLPGDVFASIMENIPIGTRVITVTARDPDAD-VNGELHYSIARQFPPGAHFTIDPESGEICTAAEIDREVTGGL-FEVTVRATDKAIPVHTRRSALK-NVTVLVTDENDNAPRFV 1293          

HSP 5 Score: 143.28 bits (360), Expect = 1.510e-34
Identity = 148/602 (24.58%), Postives = 259/602 (43.02%), Query Frame = 3
Query:  411 ILIKILDQNDKAPQFSSIKRPFFKIPENVEVGKVIDLPMAVDSDSEKYSVRRYSLSYIYHLDQTHDFRLHVTNDNPPRPQLIVNSKLDYEKINKYVFRLFAYDFDEKSIGNSCSTTIEIEIEDLNDNVPKFNQLTYNANIDENKRDD----KLIKFTV--SDPDSGRNGIVTVNIV--DKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDADTHSNMIHCKLVDYNDLFYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPIIVTDRDSGLNGKFEFYLE------DFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLRTRKPLDRETLESISIKVTAKN---PNKYSSHFVRNTDSEVDVMIKVMDVNDNAPKF 2165
            + I + D ND  P F+ +     ++ EN   G+VI    A D+D  + ++  YS+          D    V         L  + +LD E+   Y+  + A D       ++    + + + D NDN P+F++  Y+ ++ E+   D    + +  TV   D DSG  G VT  +   + +D     F +  +      L +   LD E+    +     ATD G   L+++A++ +++ + NDN P ++   L      +  + E  P  + ++ +  TD D     ++ +L      F + S              L     +DRE      L + +S     P  ++++   +++ + DVNDNAP F+      +    + + V      +   D DSG N   E+ L            +    F ++ ++G++   R LD E +  +   ++A+DKG  PLTS++T+ + V D NDNAPRF    Y   + E+   G ++  L A D D +  N ++ Y I   GD +  F +D   G L   +PLDRE   S  + V A++   P +  +  VR         + + DVND +P F
Sbjct: 1502 VEISVEDVNDNPPVFA-VPEMELEVEENTGEGEVIFTLSATDADQGQNALVTYSVLSGSEGAFVVDAASGV---------LRASRRLDREERASYLLTVRASDGT-----HATDARLSVAVRDANDNSPRFSRHAYSFDVAEDAAPDGKTTRAVIGTVLAGDADSGPFGEVTYALAPSEDSDWADGAFGLHPVTGA---LNVTRPLDRESR-ACYVLRARATDGG--GLAATARLYVNVLDANDNAPSVQNDSL------AAEVPEDAPPGTSLLRISATDDD---EGVNAELE-----FSISSGDPEGRFAVGNDGQLSVARALDRERQSFYNLVVRVSDRARHPPARLSSAVRVSLILTDVNDNAPAFTSPR---SALAPEDSPVGAVVATVQAVDPDSGRNSYVEYALATDGEEGGGGAGAGPGPFALNTVTGEVRLVRELDREARQSYALTVLAVDKGRPPLTSTATLAVTVGDANDNAPRFPRREYEAAIAEDEPPGTEVLRLSAWDPD-EGANGELRYDIA-SGDPTGDFRLDPVLGTLAVARPLDRERTASYELAVRARDGGGPARSDTASVR---------VTLSDVNDCSPAF 2054          

HSP 6 Score: 136.732 bits (343), Expect = 1.480e-32
Identity = 156/572 (27.27%), Postives = 247/572 (43.18%), Query Frame = 3
Query:  417 IKILDQNDKAPQFSSIKRPFFKIPENVEVGKVIDLPMAVDSDSEKYSVRRYSLSYIYHLDQTHDFRLHVTNDNPPRPQLIVNSKLDYEKINKYVFRLFAYDFDEKSI---GNSCS-------------------TTIEIEIEDLNDNVPKFNQLTYNANIDENKRD-DKLIKFTVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDADTH-SNMIHCKLVDYND--LFYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTDS-EPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPIIVTDRD--SGLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFTQRSLDYE-TKNKFRFKIIAIDKGYQPLTSSST---ITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLRTRKPLDRET 2033
            + +LD ND  P F+S     F   E  EVG ++    A D+D+       YS                       +PQ  VN +LD E       R+F    D +++   G + S                    T+++ ++D+NDN P+F +  Y A++ E+  +  +L++ T SD D G NG +   I ++ +E  K    F +  +   + L+ SLD E +   +   + ATD GT  L++S  V + + + NDN P+     L      SV  +E      L++ +  +D DT  S  +   +V  N    F +D  +           ++    ++D E+      R+ +S  D   P R   T   L + + D NDN P F      G+V  + +  +    + I VT RD  + +NG+  + +   R F   + F ID  SG+I T   +D E T   F   + A DK     T  S    +T+ V D NDNAPRF     I       + G  +GTLQA D D + +N  + Y++   GD +  F +DR TG + T   LDRE+
Sbjct:  850 VTVLDVNDNKPLFNSSSY-VFHFCEEQEVGSLVGAVQATDADAGSNGGVTYSFE---------------------KPQ--VNFELDSETGRIASLRVF----DREALIRQGGAASFSFSVVATDGGRPKPLQDRATVQVFVQDVNDNPPQFAKSVYQASVSESASNLTQLLRVTASDVDEGVNGALRYAI-NEGNEGGK----FTVDASTGQITLLGSLDRE-ETASYTLVVSATDSGTSPLAASCTVAVQVLDENDNPPRFTESLL------SVDALESTRVGELLITLTASDEDTGPSGDVRYAIVAGNTHATFAIDRSTG----------SVFLARRLDFETQR--LYRLNVSAEDGGRPPRSSAT--ILVVHVRDFNDNPPAF----LPGDVFASIMENIPIGTRVITVTARDPDADVNGELHYSIA--RQFPPGAHFTIDPESGEICTAAEIDREVTGGLFEVTVRATDKAIPVHTRRSALKNVTVLVTDENDNAPRFVTPTAILVDGLRAAAGSVVGTLQASDPD-EAENAAVRYAVT-GGDAAILFRLDRRTGIIETSTELDRES 1359          

HSP 7 Score: 119.398 bits (298), Expect = 3.206e-27
Identity = 167/688 (24.27%), Postives = 291/688 (42.30%), Query Frame = 3
Query:  402 TFFILIKILDQNDKAPQFSSIKRPFFKIPENVEVGKVIDLPMAVDSDSEKYSVRRYSLSYIYHLDQTHDFRLHVTNDNPPRPQLIVNSKLDYEKINKYVFRLFAYDFDEKSIGNSCSTTIEIEIEDLNDNVPKFNQLTYNANIDENKRDDKLIKFTVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDADTHSNMIHCKLVDYNDLFYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPIIVTDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFTQRSLDYET------KNKFRFKIIAIDKGY-QPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLRTRKPLDRETLESISIKVTAKNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAPKFIPRLNMKQKVEFIVEQFVDGNTCTELPYTVQDID-DGGINGQNCCYTILENDYNKLFSLMTDTPSYICLQRKP-EKYQSYTVTLIARD--RPP 2432
            T  + + + D ND  P F  ++  F  I EN   G  +    A D D       RY L+          F+++            V++++  ++  + V++L     D   +       + I + D  D  P F +  Y+  + EN     L+  +VS      N  VT  IV      S     F I+ +   +   N++D E +   ++  ++A   G   ++  A V + + ++N++ P   F +  + VS    I E  P +S    VR TD D+  N      V Y ++   +   KF    + +   L    ++DRE+     L ++   T  EP   ++++ ++N+ + DVNDN P+F+   Y+      +   V +    +  TD D+G NG   +  E         +F +D  +G+I + R  D E          F F ++A D G  +PL   +T+ + V D+NDN P+F++S Y  +V E+ S   ++  + A D D +  N  + Y+I  +G+    F +D  TG +     LDRE   S ++ V+A +             +   V ++V+D NDN P+F   L     +E             EL  T+   D D G +G +  Y I+  + +  F++   T S    +R   E  + Y + + A D  RPP
Sbjct:  537 TAKVTVVVGDLNDNHPVFYPVQY-FASILENEPGGTAVTTVTATDPDRGANGTVRYQLT----AGDAARFQVNAVTG-------AVSTRVSLDREERAVYQLQVTALDGGHLRARSPAIVTITVADAQDTPPTFARDDYSFVVFENVAPGTLVG-SVSASTLDLNANVTYLIVSGDQRGS-----FSIEWSGGRIFTANAIDRE-EQAFYQLRVVANSGG---VAGEASVSVLVHDVNNHAPV--FDRASYEVS----IAEDEPVNSRFFSVRATDKDSGKN----GEVKY-EIGEGNGGEKFGIFPDGQ---LYVRYELDRETREEYSLTVSAMDTGVEP---LSSSVTVNVTVLDVNDNKPLFNSSSYV--FHFCEEQEVGSLVGAVQATDADAGSNGGVTYSFE-----KPQVNFELDSETGRIASLRVFDREALIRQGGAASFSFSVVATDGGRPKPLQDRATVQVFVQDVNDNPPQFAKSVYQASVSESASNLTQLLRVTASDVD-EGVNGALRYAIN-EGNEGGKFTVDASTGQITLLGSLDREETASYTLVVSATDSGTSP------LAASCTVAVQVLDENDNPPRFTESLLSVDALE--------STRVGELLITLTASDEDTGPSG-DVRYAIVAGNTHATFAIDRSTGSVFLARRLDFETQRLYRLNVSAEDGGRPP 1161          

HSP 8 Score: 111.694 bits (278), Expect = 6.769e-25
Identity = 123/511 (24.07%), Postives = 209/511 (40.90%), Query Frame = 3
Query:  417 IKILDQNDKAPQFSSIKRPFFKIPENVEVGK----VIDLPMAVDSDSEKYSVRRYSLSYIYHLDQTHD-FRLHVTNDNPPRPQLIVNSKLDYEKINKYVFRLFAYDFDEKSIGNSCSTTIEIEIEDLNDNVPKFNQLTYNANIDENKR-DDKLIKFTVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGT---PSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDADTHSN--MIHCKLVDYNDLFYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPIIVTDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTD 1916
            + + D ND +P+FS     F    +    GK    VI   +A D+DS  +    Y+L+     D     F LH     P    L V   LD E    YV R  A D      G + +  + + + D NDN P     +  A + E+      L++ + +D D G N  +  +I     E   RF +     N+  L +  +LD E     +   +  +D+       LSS+ +V + L ++NDN P        F+   S    E  P  ++V  V+  D D+  N  + +    D  +             LN     ++ + ++DRE+   S+    ++     P   +T+  +L + + D NDNAP F ++ Y   + E++          +   D D G NG+  +   D  +   + DF +D + G +   R LD E    +   + A D G    + ++++ + + D+ND +P F  S Y  +  EN   G  +  LQ +  D D
Sbjct: 1605 VAVRDANDNSPRFSRHAYSFDVAEDAAPDGKTTRAVIGTVLAGDADSGPFGEVTYALAPSEDSDWADGAFGLH-----PVTGALNVTRPLDRESRACYVLRARATD----GGGLAATARLYVNVLDANDNAPSVQNDSLAAEVPEDAPPGTSLLRISATDDDEGVNAELEFSISSGDPE--GRFAV----GNDGQLSVARALDRERQ-SFYNLVVRVSDRARHPPARLSSAVRVSLILTDVNDNAPA-------FTSPRSALAPEDSPVGAVVATVQAVDPDSGRNSYVEYALATDGEEGGGGAGAGPGPFALNTVTGEVRLVRELDREARQ-SYALTVLAVDKGRPP--LTSTATLAVTVGDANDNAPRFPRREYEAAIAEDEPPGTEVLR--LSAWDPDEGANGELRY---DIASGDPTGDFRLDPVLGTLAVARPLDRERTASYELAVRARDGGGPARSDTASVRVTLSDVNDCSPAFQLSPYTVHARENTQ-GPPVLILQVVARDDD 2083          

HSP 9 Score: 58.9214 bits (141), Expect = 7.972e-9
Identity = 45/135 (33.33%), Postives = 69/135 (51.11%), Query Frame = 3
Query: 1761 PLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLRTRKPLDRETLESISIKVTAKNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAPKF 2165
            P++S + + I+V D+NDN P F+       V EN   G  I TL A D D   +N  + YS+    + +  F +D  +G LR  + LDRE   S  + V A +     +H    TD+ + V ++  D NDN+P+F
Sbjct: 1495 PMSSFNQVEISVEDVNDNPPVFAVPEMELEVEENTGEGEVIFTLSATDADQG-QNALVTYSVLSGSEGA--FVVDAASGVLRASRRLDREERASYLLTVRASD----GTH---ATDARLSVAVR--DANDNSPRF 1617          
BLAST of Protocadherin Fat 1 vs. Ensembl Nematostella
Match: EDO46189 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQM0])

HSP 1 Score: 197.593 bits (501), Expect = 4.546e-51
Identity = 194/674 (28.78%), Postives = 309/674 (45.85%), Query Frame = 3
Query:  417 IKILDQNDKAPQFSSIKRPFFKIPENVEVGKVIDLPMAVDSDSEKYSVRRYSLSYIYHLDQTHDFRLHVTNDNPPRPQLIVNSKLDYEKINKYVFRLFAYDFDEKSIGNSCSTTIEIEIEDLNDNVPKFNQLTYNANIDENKR-DDKLIKFTVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDADTHSNMIHCKLVDYNDLFYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPIIVTDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLRTRKPLDRETLESISIKVTAKN---PNKYSSHFVRNTDSEVDVMIKVMDVNDNAPKFIPRLNMKQKVEFIVEQFVDGNTCTELPYTVQDIDDGGINGQNCCYTILENDYNKLFSLMTDTPSYICLQRKPEKYQSYTVTLIARDR 2426
            I I D+ND  P F+   R  F I E+   G  +    A D D        Y+   I   +Q + F+L     +P    L V S LD E I  Y   + A D    S   S + +I + + D+NDN P+F +  ++  I E+      +++  V D D G NG +T+++   + E S  F I     +  F+     LDYET    ++ T+ A D G+PS S++AQVKI + N+NDN P         S +   SI E +  ++ VV++  TD+D           +    F +D  S            +    ++DRE+     L +  + T S+    +  N +  I++ DVNDNAP+F+   Y  ++ EN           +  TDRD G N K  + L    +  D+S F ++  +G + T+R LD E +  +  ++ A+D G    ++ + IT+ + DLNDN+P+FS+S Y   V EN + G  I  + A D D    N  + YSI   G+H + F ID  TG +     +DRE L S ++ ++AK+   P   S+ F         V I V D NDN+P F        +  + +++ V   +   +  T  D D+G  N Q   Y+I+  D +       +    +  +   E   +YT+T+ A DR
Sbjct:  778 ISIADENDNQPTFTGPSR--FNISEDSPTGTRVGQLTATDRDIGPNGAVTYA---IISGNQGNSFQL-----DPRSGILSVRSTLDRETIPSYTLVVKASD--AGSPQQSITASIHVSVLDVNDNAPRFEKSLFSGEIREDASVHSTVLQVKVEDKDEGSNGAITLSL---SGEGSDNFTI----DSTGFVLSKTPLDYET-TAAYQLTVTARDGGSPSKSATAQVKITIINVNDNVPSF------VSPAQVTSIPEDVAINTHVVKLNATDSDGTPLTFDIVEGNAGSSFKIDQSSGL----------ISVAKRLDRETTANYTLVVRATETGSQ-GESVYNNAT--IRVLDVNDNAPVFNPGSYAKSLHENLPIGQTV--AKVTATDRDEGENAKVTYEL----SVGDTSKFEVNPATGLVTTKRPLDREDQASYSLRVTAMDHGKPSQSAVAAITLTINDLNDNSPQFSQSKYTLTVTENTANGSNILRVLASDPDAG-ANGRVTYSI-ISGNHGNAFRIDSTTGRITVVGVVDREALASYNLTISAKDSGVPPWVSTAF---------VAITVADENDNSPIF-----ASNETSYGIDEGVSIGSRVAV-VTATDRDEGS-NAQ-VFYSIVRGDTSAFAINAMNGVLTVKKEINRETVPTYTLTIRASDR 1387          

HSP 2 Score: 186.808 bits (473), Expect = 8.237e-48
Identity = 217/781 (27.78%), Postives = 340/781 (43.53%), Query Frame = 3
Query:  216 SLLENDLPPFKLQLNQLIQPNNGVNREAVCRDNPGEKVRKFCKADLCCKLIGFQYLTPTDPGTFFILIKILDQNDKAPQFSSIKRPFFKIPENVEVGKVIDLPMAVDSDSEKYSVRRYSLSYIYHLDQTHDFRLHVTNDNPPRPQLIVNSKLDYEKINKYVFRLFAYDFDEKSIGNSCSTTIEIEIEDLNDNVPKFNQLTYNANIDENKRDDKLIKFTVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSN-SVSIIEGLPAHSLVVEVRVTDADTH-SNMIHCKLVDYN--DLFYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPIIVTDRDSGLNGKFEFYLEDFRNFSDSSD-FLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLRTRKPLDRETLESISIKVTAKNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAPKFI--PRLNMKQKVEFIVEQFVDGNTCTELPYTVQDIDDGGINGQNCCYTILENDYNKLFSLMTDTPSYICLQRKP---EKYQSYTVTLIARDRPPNVEGGLTSKISFPVLIINDPHSKISTSGFSNH 2528
            SL+  D   F +    +I+     +RE               KA     L      +P+  G   + I+ILD ND  P FSS +     + E+V +G  +    A D D+   +  RYS +     +  H F L           + V+  LD+E+ + Y   L   D     + ++    + I + D+NDN P F+   Y + + EN      +  T  D DS  NG +   I+   D+      +F I  +   + +  S DYE     ++ T+ A D+G P    +AQV I ++++ND+ P        FS SN S  I E     S VV V  TD D+     +  +L+  N    F +D+ S           +++  +++DRE+     L++         S   +++  + I ++D+NDN+P+F Q  Y+  V E+           +  TD D   NG   + L      SD++D F I+  +G I  +  LDYE K ++   + A D G    +S + + + V D+NDN P+F++S Y   V EN++ G  +  + A D D+    K I YSI   G+ +  F +DR+TG++ TR PLDRET+ S S+ + A +        VR   +   V I + D NDN P F    R N       I E    G    +L  T +DI   G NG    Y I+  +    F L  D  S I   R     E   SYT+ + A D   + +  +T+ I   VL +ND   +   S FS  
Sbjct:  206 SLVSGDTSYFTVDSQGVIRTKGAFDRE--------------TKASYQVALRAQDGGSPSRSGQATVEIEILDVNDNRPVFSSAQYTA-SVDEDVAIGAAMVTVTASDKDNGNNADLRYSFT---SGNTNHAFTLDAVTG-----VVTVSRSLDFEQRSSYALGLSVTDRGSPPLTDTSH--LLINVNDINDNPPVFSPSAYQSRVKENTPAGTQVSAT--DRDSSTNGALVFGIIKGNDD-----GVFTIDGSTGIISIAKSPDYENKTR-YDLTVQARDRGVPVKYDTAQVTIFIEDVNDHSPV-------FSPSNYSKQIPESTVIGSTVVTVTATDLDSGPRGRLEYRLISGNVKGAFNIDANSG----------SIRVSSELDRETTPSYSLQVEAR---DGGSTSRSSSTRVTIALQDINDNSPIF-QGPYVFRVSESSSPGHQI--GQVAATDADDSSNGDVRYAL------SDNTDVFSINTSTGLITLKTQLDYEKKTQYMVTVTAKDGGTPSRSSLTVVKVMVDDVNDNPPQFAKSLYTCTVGENLAAGVAVCYVTATDADSGANGK-ISYSI-LSGNENMAFAMDRFTGEITTRVPLDRETIASYSLTINADD-----GSLVRFM-AATTVNISIADENDNQPTFTGPSRFN-------ISEDSPTGTRVGQLTATDRDI---GPNGA-VTYAIISGNQGNSFQL--DPRSGILSVRSTLDRETIPSYTLVVKASD-AGSPQQSITASIHVSVLDVNDNAPRFEKSLFSGE 902          

HSP 3 Score: 157.147 bits (396), Expect = 1.301e-38
Identity = 190/703 (27.03%), Postives = 303/703 (43.10%), Query Frame = 3
Query:  399 GTFFILIKILDQNDKAPQFSSIKRPFFKIPENVEVGKVIDLPMAVDSDSEKYSVRRYSLSYIYHLDQTHDFRLHVTNDNPPRPQLIVNSKLDYEKINKYVFRLFAYDFDEKSIGNSCSTTIEIEIEDLNDNVPKFNQLTYNANIDENKRDDKLIK-FTVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDADTHSNMIHCKLVDYNDLFYLDSPSKFNTLLNYKPFNLKTINKI-------DRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPIIVTDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLRTRKPLDRETLESISIKVTAKNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAPKFIPRLNMKQKVEFIVEQFVDGNTCTELPYTVQDIDDGGINGQNCCYTILENDYNKLFSLMTDTPSYICL--QRKPEKYQSYTVTLIARDRPPNVEGGLTSKISFPVL 2477
            G   ++I + D+ND AP+F  +    F I EN    +V  +  A D DS   +   YSL         + F +     N    ++   + LD+E  + Y  R+ A+D      G   +    I ++D+NDN P F    Y   + E+     +++  T  D D G N  ++ ++V      S     F +  ++  +    + D ET    ++  L A D G+PS S  A V+I + ++NDN P     +   SV   V+I       + +V V  +D D  +N          DL Y      F +      F L  +  +       D E      L ++++   S P   +T    L I + D+NDN P+FS   Y     +++V         +  TDRDS  NG   F +      +D   F ID  +G I   +S DYE K ++   + A D+G      ++ +TI + D+ND++P FS S+Y   + E+  +G  + T+ A D D+  + +  +  I   G+    F+ID  +G +R    LDRET  S S++V A++    S        S   V I + D+NDN+P F         V  + E    G+   ++  T  D DD   NG +  Y + +N    +FS+ T T   I L  Q   EK   Y VT+ A+D      GG  S+ S  V+
Sbjct:   52 GRTVVVIDVKDENDNAPEF-PLNSYVFNIRENTPAAQVA-IVTATDRDSGTNAAITYSL-----FSGENKFMM-----NSKTGEIRTVTPLDHETKDSYTMRISAFD------GKHTTFVPLITVDDVNDNAPFFALSVYKTGVYEDVAVGSIVRQLTAVDLDVGINARLSYSLV------SGDTSYFTVD-SQGVIRTKGAFDRETKAS-YQVALRAQDGGSPSRSGQATVEIEILDVNDNRPVFSSAQYTASVDEDVAI------GAAMVTVTASDKDNGNNA---------DLRY-----SFTSGNTNHAFTLDAVTGVVTVSRSLDFEQRSSYALGLSVTDRGSPP---LTDTSHLLINVNDINDNPPVFSPSAY-----QSRVKENTPAGTQVSATDRDSSTNGALVFGI---IKGNDDGVFTIDGSTGIISIAKSPDYENKTRYDLTVQARDRGVPVKYDTAQVTIFIEDVNDHSPVFSPSNYSKQIPESTVIGSTVVTVTATDLDSGPRGRLEYRLI--SGNVKGAFNIDANSGSIRVSSELDRETTPSYSLQVEARDGGSTSRS------SSTRVTIALQDINDNSPIF-----QGPYVFRVSESSSPGHQIGQVAAT--DADDSS-NG-DVRYALSDN--TDVFSINTST-GLITLKTQLDYEKKTQYMVTVTAKD------GGTPSRSSLTVV 671          

HSP 4 Score: 155.606 bits (392), Expect = 4.005e-38
Identity = 194/683 (28.40%), Postives = 311/683 (45.53%), Query Frame = 3
Query:  402 TFFILIKILDQNDKAPQFS-SIKRPFFKIPENVEVGKVIDLPMAVDSDSEKYSVRRYSLSYIYHLDQTHDFRLHVTNDNPPRPQLIVNSKLDYEKINKYVFRLFAYDFDEKSIGNSCSTTIEIEIEDLNDNVPKFNQLTYNANIDENKR-DDKLIKFTVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVS-IIEGLPAHSLVVEVRVTDADTHSN-MIHCKLVDYND--LFYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPIIVTDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLRTRKPLDRETLESISIKVTAKNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAPKFIPRLNMKQKVEFIVEQFVDGNTCTELPYTVQDIDDGGINGQNCCYTILENDYNKLFSL---MTDTPSYICLQRKPEKYQSYTVTLIARD 2423
            TF  LI + D ND AP F+ S+ +    + E+V VG ++    AVD D    + R   LSY      T  F +          Q ++ +K  +++  K  +++     D  S   S   T+EIEI D+NDN P F+   Y A++DE+      ++  T SD D+G N  +  +              F +      + +  SLD+E     +   L  TD+G+P L+ ++ + I++ ++NDN P        FS S   S + E  PA +   +V  TD D+ +N  +   ++  ND  +F +D  +   ++     +  KT  + D          +T+   D     +  T + + I IEDVND++P+FS   Y   + E+ V         +  TD DSG  G+ E+ L    + +    F ID  SG I     LD ET   +  ++ A D G    +SS+ +TI + D+NDN+P F +  Y+F V E+ S G +IG + A D D D  N D+ Y++    D++  F I+  TG +  +  LD E      + VTAK+    S    R++ + V VM+   DVNDN P+F   L        + E    G     + Y      D G NG+   Y+IL  + N  F++     +  + + L R  E   SY++T+ A D
Sbjct:  151 TFVPLITVDDVNDNAPFFALSVYKT--GVYEDVAVGSIVRQLTAVDLDV-GINAR---LSYSLVSGDTSYFTVD--------SQGVIRTKGAFDRETKASYQVALRAQDGGSPSRSGQATVEIEILDVNDNRPVFSSAQYTASVDEDVAIGAAMVTVTASDKDNGNNADLRYSFTSGNTN-----HAFTLDAVTGVVTVSRSLDFEQRSS-YALGLSVTDRGSPPLTDTSHLLINVNDINDNPPV-------FSPSAYQSRVKENTPAGT---QVSATDRDSSTNGALVFGIIKGNDDGVFTIDGSTGIISIAKSPDYENKT--RYD----------LTVQARDRGVPVKYDTAQ-VTIFIEDVNDHSPVFSPSNYSKQIPESTVIGSTVV--TVTATDLDSGPRGRLEYRL---ISGNVKGAFNIDANSGSIRVSSELDRETTPSYSLQVEARDGGSTSRSSSTRVTIALQDINDNSPIF-QGPYVFRVSESSSPGHQIGQVAATDAD-DSSNGDVRYALS---DNTDVFSINTSTGLITLKTQLDYEKKTQYMVTVTAKDGGTPS----RSSLTVVKVMVD--DVNDNPPQFAKSLYTCT----VGENLAAG---VAVCYVTATDADSGANGK-ISYSILSGNENMAFAMDRFTGEITTRVPLDR--ETIASYSLTINADD 764          

HSP 5 Score: 150.599 bits (379), Expect = 1.469e-36
Identity = 158/592 (26.69%), Postives = 263/592 (44.43%), Query Frame = 3
Query:  402 TFFILIKILDQNDKAPQFSSIKRPFFKIPENVEVGKVIDLPMAVDSDSEKYSVRRYSLSYIYHLDQTHDFRLHVTNDNPPRPQLIVNSKLDYEKINKYVFRLFAYDFDEKSIGNSCSTTIEIEIEDLNDNVPKFNQLTYNANIDEN-KRDDKLIKFTVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDADTHSNMIHCKLVDYN-DLFYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPIIVTDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLRTRKPLDRETLESISIKVTAKNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAPKFIP 2171
            T F+ I + D+ND +P F+S     + I E V +G  + +  A D D    +   YS+        T  F ++  N       L V  +++ E +  Y   + A D     +  +    + + + D+NDN P FN  +Y  ++ EN  +   ++     D D G N ++  +I+   DE  KRFKI         +     LD+E +   +   + ATD      ++   V I + NLND  P   F +  ++ S    + E  P  + VV+V  +D D+  ++ +  +   + D F +D  S            + T + +DRE      +++ ++   + P   +T    + I+I D NDN+P F    Y  ++ EN      +F   +  TD D G N +  +      N S +  F+I   SG I   + LD E K+ +   I A D G  P  SS TI + V+D+ND+ P  + S    +V EN      +  + A D DT   N ++ +S+    +H S F +D  TGD+ T+ PLDRE     ++++   +    S   V       DV+I V+D +DN P+F P
Sbjct: 1291 TAFVAITVADENDNSPIFAS-NETSYGIDEGVSIGSRVAVVTATDRDEGSNAQVFYSIVR----GDTSAFAINAMNG-----VLTVKKEINRETVPTYTLTIRASDRGSPMM--TSDKELTVVVNDVNDNPPVFNSQSYIGSVRENSAQSTSVLTVAADDSDVGANAVLRYSIISGNDE--KRFKI---NSTSGVIMTTTPLDFE-EKSQYGLEVTATDS---KYTAKTNVTIRVINLNDITPA--FTQQNYTAS----VRENSPTSTSVVKVSASDRDSFGSLSYSIVGGKDSDKFSIDQRSGI----------ISTADVLDRELVSLYAIQVRVTDAGNPPLSNLTW---VTIKILDENDNSPKFDSSSYSSSILENSAPSSFSFK--LAATDADEGTNARITY------NLSRNDAFMIGASSGVITLAQPLDRENKSTYDLAIQARDHGTPPQASSITIRVTVIDINDHRPLINSSSLRGSVRENQPKETHVMRILASDADTGL-NAELTFSLLSN-EHKSVFTLDNTTGDISTKVPLDREQQAVYTLRIGVADKGNPSLSSV------ADVIIDVIDEDDNCPRFQP 1826          

HSP 6 Score: 143.28 bits (360), Expect = 2.358e-34
Identity = 160/601 (26.62%), Postives = 268/601 (44.59%), Query Frame = 3
Query:  384 TPTDPGTFFILIKILDQNDKAPQFSSIKRPFFKIPENVEVGKVIDLPMAVDSDSE--KYSVRRYSLSYIYHLDQTHDFRLHVTNDNPPRPQLIVNSKLDYEKINKYVFRLFAYDFDEKSIGNSCSTTIEIEIEDLNDNVPKFNQLTYNANIDEN-KRDDKLIKFTVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDADTHSN-MIHCKLV--DYNDLFYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMF-SQQIYIGXXXXXXXXXXXXFPKPIIVTDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLRTRKPLDRETLESISIKVTAKNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAPKF 2165
            +P+   T  + I I++ ND  P F S  +    IPE+V +   +    A DSD     + +   +    + +DQ+                + V  +LD E    Y   + A   +  S G S      I + D+NDN P FN  +Y  ++ EN      + K T +D D G N  VT  +     + SK    FE+      +     LD E D   +   + A D G PS S+ A + + + +LNDN P+    K   +V+      E     S ++ V  +D D  +N  +   ++  ++ + F +DS +            +  +  +DRE+   S+  +TIS  DS     ++T   + I + D NDN+P+F S +   G  +   +   V     +  TDRD G N +  + +   R   D+S F I+ ++G +  ++ ++ ET   +   I A D+G   +TS   +T+ V D+NDN P F+   YI +V EN +    + T+ A D D    N  + YSI   G+    F I+  +G + T  PLD E      ++VTA + +KY+        ++ +V I+V+++ND  P F
Sbjct:  974 SPSKSATAQVKITIINVNDNVPSFVSPAQ-VTSIPEDVAINTHVVKLNATDSDGTPLTFDIVEGNAGSSFKIDQSSGL-------------ISVAKRLDRETTANYTLVVRAT--ETGSQGESVYNNATIRVLDVNDNAPVFNPGSYAKSLHENLPIGQTVAKVTATDRDEGENAKVTYEL--SVGDTSK----FEVNPATGLVTTKRPLDRE-DQASYSLRVTAMDHGKPSQSAVAAITLTINDLNDNSPQFSQSKYTLTVT------ENTANGSNILRVLASDPDAGANGRVTYSIISGNHGNAFRIDSTTG----------RITVVGVVDREA-LASY-NLTISAKDSGVPPWVST-AFVAITVADENDNSPIFASNETSYGIDEGVSIGSRVAV---VTATDRDEGSNAQVFYSI--VRG--DTSAFAINAMNGVLTVKKEINRETVPTYTLTIRASDRGSPMMTSDKELTVVVNDVNDNPPVFNSQSYIGSVRENSAQSTSVLTVAADDSDVG-ANAVLRYSI-ISGNDEKRFKINSTSGVIMTTTPLDFEEKSQYGLEVTATD-SKYT--------AKTNVTIRVINLNDITPAF 1514          

HSP 7 Score: 135.576 bits (340), Expect = 5.336e-32
Identity = 163/601 (27.12%), Postives = 261/601 (43.43%), Query Frame = 3
Query:  666 KLDYEKINKYVFRLFAYDFDEKSIGNSC---STTIEIEIEDLNDNVPKFNQLTYNANIDENKRDDKLIKFTVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINSLDYET-DPHLFEFTLLATDQGT--PSLSSSAQVKIHLKNLNDNGP--KIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDADTHSNM-IHCKLVDYN-DLFYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTDS-EPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPIIVTDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLRTRKPLDRETLESISIKVTAKN---PNKYSSHFVRNTDSEVDVMIKVMDVNDNAPKFIPRLNMKQKVEFIVEQFVDGNTCTELPYTVQDIDDGGINGQNCCYTILENDYNKLFSLMTDTPSY-ICLQRKPEKYQSYTVTLIARD 2423
            K D E  ++Y   + A D       N C    T + I+++D NDN P+F   +Y  NI EN    ++   T +D DSG N  +T ++    ++     K  EI+        +  LD+ET D +    +       T  P         I + ++NDN P   +   K G        + E +   S+V ++   D D   N  +   LV  +   F +DS              ++T    DRE+   +  ++ +   D   PSR  +   ++ I+I DVNDN P+FS   Y  +VDE+           +  +D+D+G N    +    F + + +  F +D ++G +   RSLD+E ++ +   +   D+G  PLT +S + INV D+NDN P FS S Y   V EN   G ++    A D D+      +F  I  KG+    F ID  TG +   K  D E      + V A++   P KY +           V I + DVND++P F P    KQ    I E  V G+T   +  T  D+D G   G+   Y ++  +    F++  ++ S  +  +   E   SY++ + ARD
Sbjct:   27 KFDRESESRYRLTVLAQD-----AANRCHKGRTVVVIDVKDENDNAPEFPLNSYVFNIRENTPAAQVAIVTATDRDSGTNAAITYSLFSGENKFMMNSKTGEIR-------TVTPLDHETKDSYTMRISAFDGKHTTFVP--------LITVDDVNDNAPFFALSVYKTG--------VYEDVAVGSIVRQLTAVDLDVGINARLSYSLVSGDTSYFTVDSQGV-----------IRTKGAFDRETK--ASYQVALRAQDGGSPSR--SGQATVEIEILDVNDNRPVFSSAQYTASVDEDVAIGAAMVT--VTASDKDNGNNADLRY---SFTSGNTNHAFTLDAVTGVVTVSRSLDFEQRSSYALGLSVTDRGSPPLTDTSHLLINVNDINDNPPVFSPSAYQSRVKENTPAGTQV---SATDRDSSTNGALVFGII--KGNDDGVFTIDGSTGIISIAKSPDYENKTRYDLTVQARDRGVPVKYDT---------AQVTIFIEDVNDHSPVFSPSNYSKQ----IPESTVIGSTVVTV--TATDLDSGP-RGR-LEYRLISGNVKGAFNIDANSGSIRVSSELDRETTPSYSLQVEARD 557          

HSP 8 Score: 124.79 bits (312), Expect = 1.091e-28
Identity = 171/702 (24.36%), Postives = 302/702 (43.02%), Query Frame = 3
Query:  342 KADLCCKLIGFQYLTPTDPGTFFILIKILDQNDKAPQFSSIKRPFFKIPENVEVGKVIDLPMAVDSDSEKYSVRRYSLSYIYHLDQTHDFRLHVTNDNPPRPQLIVNSKLDYEKINKYVFRLFAYDFDEKSIGNSCSTT-IEIEIEDLNDNVPKFNQLTYNANIDENKR-DDKLIKFTVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKK-LGFSVSNSVSIIEGLPAHSLVVEVRVTDADTHSN-MIHCKLVDYNDLFYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPIIVTDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLRTRKPLDRETLESISIKVTAKNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAPKFIPRLNMKQKVEFIVEQFVDGNTCTELPYTVQDIDDGGINGQNCCYTILENDYNKLFSL---MTDTPSYICLQRKPEKYQSYTVTLIARDR 2426
            +A    ++    +  P+      I + I D ND +PQFS  K     + EN   G  I   +A D D+       YS   I   +  + FR+  T       ++ V   +D E +  Y   + A D     +    ST  + I + D NDN P F     +  IDE      ++   T +D D G N  V  +IV + D        F I      L +   ++ ET P  +  T+ A+D+G+P ++S  ++ + + ++NDN P    +  +G       S+ E     + V+ V   D+D  +N ++   ++  ND       S    ++   P + +       +S +G    + ++ TDS    + T   ++ I++ ++ND  P F+QQ Y  +V EN           +  +DRDS   G   + +   +   DS  F ID+ SG I T   LD E  + +  ++   D G  PL++ + +TI +LD NDN+P+F  S Y  ++ EN +       L A D D +  N  I Y++      +  F I   +G +   +PLDRE   +  + + A++      H      S + + + V+D+ND+ P  I   +++  V        +    T +   +    D G+N +   +++L N++  +F+L     D  + + L R  E+   YT+ +   D+
Sbjct: 1166 QASYSLRVTAMDHGKPSQSAVAAITLTINDLNDNSPQFSQSKYTL-TVTENTANGSNILRVLASDPDAGANGRVTYS---IISGNHGNAFRIDSTTG-----RITVVGVVDREALASYNLTISAKD---SGVPPWVSTAFVAITVADENDNSPIFASNETSYGIDEGVSIGSRVAVVTATDRDEGSNAQVFYSIV-RGDT-----SAFAINAMNGVLTVKKEINRETVP-TYTLTIRASDRGSPMMTSDKELTVVVNDVNDNPPVFNSQSYIG-------SVRENSAQSTSVLTVAADDSDVGANAVLRYSIISGNDEKRFKINSTSGVIMTTTPLDFE------EKSQYG----LEVTATDS----KYTAKTNVTIRVINLNDITPAFTQQNYTASVRENSPTSTSVVK--VSASDRDS--FGSLSYSIVGGK---DSDKFSIDQRSGIISTADVLDRELVSLYAIQVRVTDAGNPPLSNLTWVTIKILDENDNSPKFDSSSYSSSILENSAPSSFSFKLAATDAD-EGTNARITYNLS----RNDAFMIGASSGVITLAQPLDRENKSTYDLAIQARD------HGTPPQASSITIRVTVIDINDHRP-LINSSSLRGSVRE------NQPKETHVMRILASDADTGLNAE-LTFSLLSNEHKSVFTLDNTTGDISTKVPLDR--EQQAVYTLRIGVADK 1799          

HSP 9 Score: 113.62 bits (283), Expect = 3.157e-25
Identity = 137/501 (27.35%), Postives = 220/501 (43.91%), Query Frame = 3
Query:  411 ILIKILDQNDKAPQFSSIKRPFFKIPENVEVGKVIDLPMAVDSDSEKYSVRRYSLSYIYHLDQTHDFRLHVTNDNPPRPQLIVNSKLDYEKINKYVFRLFAYDFDEKSIGNSCSTTIEIEIEDLNDNVPKFNQLTYNANIDENK-RDDKLIKFTVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDADTHSNMIHCKLVDYNDLFYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPIIVTDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDD 1910
            + + + D ND  P F+S +     + EN      +    A DSD    +V RYS+  I   D+   F+++ T+       ++  + LD+E+ ++Y   + A D        +  T + I + +LND  P F Q  Y A++ EN      ++K + SD DS   G ++ +IV   D        F I +    +   + LD E    L+   +  TD G P LS+   V I + + NDN PK            S SI+E     S   ++  TDAD  +N      +  ND F + + S   TL   +P        +DRE+     L I      + P     T   + + + D+ND+ P+ +     G+V ENQ          I+ +D D+GLN +  F L    +    S F +D  +G I T+  LD E +  +  +I   DKG   L+S + + I+V+D +DN PRF  + Y   + E++  G  I  + A D D
Sbjct: 1398 LTVVVNDVNDNPPVFNS-QSYIGSVRENSAQSTSVLTVAADDSDVGANAVLRYSI--ISGNDEKR-FKINSTSG-----VIMTTTPLDFEEKSQYGLEVTATDSKY-----TAKTNVTIRVINLNDITPAFTQQNYTASVRENSPTSTSVVKVSASDRDS--FGSLSYSIVGGKDS-----DKFSIDQRSGIISTADVLDREL-VSLYAIQVRVTDAGNPPLSNLTWVTIKILDENDNSPKFDSSSY------SSSILENSAPSSFSFKLAATDADEGTNARITYNLSRNDAFMIGASSGVITLA--QP--------LDRENKSTYDLAIQARDHGTPPQASSIT---IRVTVIDINDHRPLINSSSLRGSVRENQPKETHVMR--ILASDADTGLNAELTFSLLSNEH---KSVFTLDNTTGDISTKVPLDREQQAVYTLRIGVADKGNPSLSSVADVIIDVIDEDDNCPRFQPTEYNVTISESLPRGASIVQVTARDID 1852          

HSP 10 Score: 81.6481 bits (200), Expect = 1.752e-15
Identity = 90/302 (29.80%), Postives = 149/302 (49.34%), Query Frame = 3
Query: 1641 DSSDFLIDKISGKIFTQ-RSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLRTRKPLDRETLESISIKVTAKNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAPKFIPRLNMKQKVEFIVEQFVDGNTCTELPYTVQDIDDGGINGQNCCYTILENDYNKLFSLMTDTPSYICLQRK--PEKYQSYTVTLIARD-RPPNVEGGLTSKISFPVLIINDPHSKISTSGFSNHPD 2534
            D   F ID  +G I T  R  D E+++++R  ++A D   +     + + I+V D NDNAP F  + Y+FN+ EN     ++  + A D D+   N  I YS+   G++   F ++  TG++RT  PLD ET +S +++++A +  K+++ FV         +I V DVNDNAP F     +      + E    G+   +L  T  D+ D GIN +   Y+++  D    F++  D+   I  +     E   SY V L A+D   P+  G  T +I   +L +ND     S++ ++   D
Sbjct:    8 DQGMFTIDSSTGSITTTGRKFDRESESRYRLTVLAQDAANRCHKGRTVVVIDVKDENDNAPEFPLNSYVFNIRENTPAA-QVAIVTATDRDSG-TNAAITYSLF-SGENK--FMMNSKTGEIRTVTPLDHETKDSYTMRISAFD-GKHTT-FVP--------LITVDDVNDNAPFFA----LSVYKTGVYEDVAVGSIVRQL--TAVDL-DVGINAR-LSYSLVSGD-TSYFTV--DSQGVIRTKGAFDRETKASYQVALRAQDGGSPSRSGQATVEIE--ILDVNDNRPVFSSAQYTASVD 281          
BLAST of Protocadherin Fat 1 vs. Ensembl Nematostella
Match: EDO34815 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SN97])

HSP 1 Score: 171.014 bits (432), Expect = 1.746e-43
Identity = 191/707 (27.02%), Postives = 302/707 (42.72%), Query Frame = 3
Query:  381 LTPTDPGT-------FFILIKILDQNDKAPQFSSIKRPFFKIPENVEVGKVIDLP---MAVDSDSEKYSVRRYSLSYIYHLDQTHDFRLHV--TNDNPPRPQLIVNSKLDYEKINKYVFRLFAYDFDEKSIGNSCSTTIEIEIEDLNDNVPKFNQLTYNANIDENKR-DDKLIKFTVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDADTHSNMIHCKLVDYNDLFYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPIIVTDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFTQRSLDYETKN-----KFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLRTRKPLDRETLESISIKVTAKNPNKYSSHFVRNT---DSEVDVMIKVMDVNDNAPKFIPRLNMKQKVEFIVEQFVDGNTCTELPYTVQDIDDGGINGQNCCYTILENDYNKLFSLMTDTPSYI----CLQRKPEKYQSYTVTLIARDR 2426
            +T TD G           L++ILD+ND  P+FS   R    I EN   G  + +    MA D D E  +  RY L+    +    + R  V  T  +PP         LD+E+   Y F + A D  +   G+     + I + D NDN P+F   +  + I E       + + T +DPDSG NG +  +I   ++        FEI R++  + +  SLD E    ++   + A D           V + L+++NDN PK  F K  F+V     + EG+   S++V    TD D  SN      + Y               +N    ++     +DRE+        T+   D      + +N ++N++I D NDN+P F    Y    D      V      +   DRD G NG   + +           F+I   +G I T   LD E ++      +   +   D G    TS + + I+V D NDN P+F++S Y   V EN+ VG K+  + A D+D+   N  I YS+   GD    F I+  TG +R +K ++RE  E+  + +TA +         R T    S+  V + V+DVNDN P F  R+  +   E        G    ++  T  D++  G    +  YTI+      +F++  +T   I     L R+ + +  YT+ ++ARD+
Sbjct:  192 ITATDGGVPISRTAIAIALVRILDRNDNVPKFSH-ARYTGSIQENSGPGVPVQMASSIMATDRDIESNADVRYRLNGSDSIQFAVNPRTGVITTRVSPP-------PSLDHERTTNYTFHVIAAD--QAGTGHESLAEVVIHVLDANDNTPRFIPSSIQSTISEAASIGQSVARVTANDPDSGLNGRIFFSINSGSE------GKFEIGRSDGVVRVSGSLDREAKA-VYVLNVSAIDGSYSPREGYGTVTVTLQDVNDNTPK--FTKPAFNVD----VSEGVAVGSVIVNATATDPDQGSNAAITYSMSYPGF-----------AINSNTGSVTITRPLDRETKQA--YSFTVHARDGG---GLESNVAVNVEIGDENDNSPQFPTVQY--QTDVIDRTPVGTIVLAVNAEDRDVGNNGHVTYAILILP-------FIIVPDTGNINTSSKLDREQQSLYTLVHYVLNLSVTDHGVTQFTSFALLNISVTDFNDNQPQFNQSEYSATVLENMPVGTKVTMVTARDEDSG-INSQIMYSLT-GGD--GVFSIEPSTGQIRLQKAINREAKENYHVTITASD---------RGTPVLSSDAKVHVHVLDVNDNPPVFTSRVYERTMSE---GNAAAGEFVVQVNATDADVERNG----HVTYTIMHGALG-MFTI-NETTGVIRTQGVLNRESKDF--YTLIVMARDQ 826          

HSP 2 Score: 144.436 bits (363), Expect = 3.592e-35
Identity = 175/576 (30.38%), Postives = 253/576 (43.92%), Query Frame = 3
Query:  795 PKFNQLTYNANIDENKRDDKLIKFTV--SDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSN-SVSIIEGLPAHSLVVEVRVTDADTHSNMIHCKLVDYNDLFYLDSPSKFNTLLNYKPFNLKTI---NKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXX-XXFPKPIIVTDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFTQRS----LDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLRTRKPLDRETLESISIKVTAKNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAPKFI-PRLNMKQKVEFIVEQFVDGNTCTELPYTVQDIDDGGINGQNCCYTILENDYNKLFSLMTDTPSYICLQR--KPEKYQSYTVTLIARDRPPNVEGGLTSKISFPVLI 2480
            P F   +YNA   E      ++  TV  +D D G NG V  +IVD      +    F +  N   ++   +L+ +     +  T+ A D G PS S++ +V I + +LNDN P        F+ +N S ++ E  P  + +++V  TDAD+  N      V Y+ +   DS   F  +   K  N  TI     +DRE N   F  +TI+ TD       T      ++I D NDN P FS   Y G++ EN    V V     I+ TDRD   N    + L    N SDS  F ++  +G I T+ S    LD+E    + F +IA D+      S + + I+VLD NDN PRF  S     + E  S+G  +  + A D D+   N  IF+SI    +    F+I R  G +R    LDRE      + V+A +   YS      T     V + + DVNDN PKF  P  N+       V   +   T T       D D     G N   T     Y   F++ ++T S + + R    E  Q+Y+ T+ ARD      GGL S ++  V I
Sbjct:    1 PVFTPASYNATFTEGSSTRGVLIATVKATDSDDGANGDVDYSIVDGNVGDPRSNSDFTLDPNTGMIKTARNLERQ-QTFSYNLTIGAADHGLPSFSATTRVSIVVGDLNDNNPV-------FNPTNYSTTVFENSPVGTSLLDVTATDADSGQN----AYVTYS-VTAGDSHGLFRAVT--KVSNHGTIEVAGNLDREVN--DFYNLTITATDGGVPISRTAIAIALVRILDRNDNVPKFSHARYTGSIQENSGPGVPVQMASSIMATDRDIESNADVRYRL----NGSDSIQFAVNPRTGVITTRVSPPPSLDHERTTNYTFHVIAADQAGTGHESLAEVVIHVLDANDNTPRFIPSSIQSTISEAASIGQSVARVTANDPDSGL-NGRIFFSINSGSE--GKFEIGRSDGVVRVSGSLDREAKAVYVLNVSAID-GSYSPREGYGT-----VTVTLQDVNDNTPKFTKPAFNVDVSEGVAVGSVIVNATAT-------DPD----QGSNAAIT-YSMSYPG-FAINSNTGS-VTITRPLDRETKQAYSFTVHARD-----GGGLESNVAVNVEI 527          

HSP 3 Score: 112.849 bits (281), Expect = 3.184e-25
Identity = 123/481 (25.57%), Postives = 203/481 (42.20%), Query Frame = 3
Query:  411 ILIKILDQNDKAPQFSSIKRPFFKI--PENVEVGKVIDLPMAVDSDSEKYSVRRYSLSYIYHLDQTHDFRLHVTNDNPPRPQLIVNSKLDYEKINKYVFRLFAYDFDEKSIGNSCSTTIEIEIEDLNDNVPKFNQLTYNAN-IDENKRDDKLIKFTVSDPDSGRNGIVTVNI-------VDKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDADTHSN-MIHCKLVDYNDLFYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPIIVTDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAP 1820
            + + + D ND  P+F+   +P F +   E V VG VI    A D D    +   YS+SY      ++   + +T     RP       LD E    Y F + A D      G   +  + +EI D NDN P+F  + Y  + ID       ++     D D G NG VT  I       V  T  ++   K+   Q++ + L              +   L  TD G    +S A + I + + NDN P+    +       S +++E +P  + V  V   D D+  N  I   L   + +F ++ PS     L       K IN+  +E+ H     +TI+ +D   +  ++++  +++ + DVNDN P+F+ ++Y              F   +  TD D   NG   + +           F I++ +G I TQ  L+ E+K+ +   ++A D+G  P     TI ++V+D NDN P
Sbjct:  424 VTVTLQDVNDNTPKFT---KPAFNVDVSEGVAVGSVIVNATATDPDQGSNAAITYSMSYPGFAINSNTGSVTIT-----RP-------LDRETKQAYSFTVHARDGG----GLESNVAVNVEIGDENDNSPQFPTVQYQTDVIDRTPVGTIVLAVNAEDRDVGNNGHVTYAILILPFIIVPDTGNINTSSKLDREQQSLYTLVH------------YVLNLSVTDHGVTQFTSFALLNISVTDFNDNQPQFNQSEY------SATVLENMPVGTKVTMVTARDEDSGINSQIMYSLTGGDGVFSIE-PSTGQIRLQ------KAINREAKENYH-----VTITASD-RGTPVLSSDAKVHVHVLDVNDNPPVFTSRVY-ERTMSEGNAAAGEFVVQVNATDADVERNGHVTYTIM----HGALGMFTINETTGVIRTQGVLNRESKDFYTLIVMARDQGAVPYMDFGTIDVHVIDKNDNTP 849          
BLAST of Protocadherin Fat 1 vs. Ensembl Nematostella
Match: EDO39230 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SAP5])

HSP 1 Score: 170.629 bits (431), Expect = 1.246e-42
Identity = 173/626 (27.64%), Postives = 285/626 (45.53%), Query Frame = 3
Query:  408 FILIKILDQNDKAPQFSSIKRPFFKIPENVEVG-KVIDLPMAVDSDSEKYSVRRYSLSYIYHLDQTHDFRLHVTNDNPPRPQLIVNSKLDYEKINKYVFRLFAYD--FDEKSIGNSCSTTIEIEIEDLNDNVPKFNQLTYNANIDENKR-DDKLIKFTVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINS----LDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIE-GLPAHSLVVEVRVTDADTHSNMIHCKLV-----DYNDLFYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPIIVTDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSST--ITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDID-----RYTGDLRTRKPLDRETLESISIKVTAKNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAPKFIPRLNMKQKVEFI-VEQFV 2219
             + I ++DQND+ P F+  K     +PE+  +G  V+D+  A D+D  + +   Y   +I   D    F +  +   P + +L+VN KLD+E  + Y   + A D  F + ++       + + I+D+ND  P F+   Y + I EN      ++  T SD DS     ++ ++ D+  +  +   I        ++  I +    LD E  P +  FT++A D      ++ A+++++L ++NDN P+       F  S  +  +E   P+ + V+ ++  D D      + KL         D F +D  S            +KT    DRE     F ++ +  TD+   R   + + + I + D ND+ P F+++ Y G+V EN           +  TD D G N +FEF +      +D   F ID  +G +     LDYE K ++   +   D+G  PL    T  + I +LD NDNAP F    Y  +V E+V     + T+ A+D D+   N +  ++I+P+ D    F I+        G +RTR PLD+E   S  +KVTA +              E +V I V+DVNDN P F+P   + Q  E +   QFV
Sbjct: 2657 ILYITVVDQNDQPPVFAP-KSYAISVPEDSPIGTSVLDI-YATDADVGENAKITY---FISKGDPEGKFSIVTS---PVKGELVVNGKLDFETKSSYTLEVTATDGKFSDTAV-------VTVTIQDVNDLPPVFSSPLYESRIQENTGPGAGVVMVTASDIDSP---TISFSLDDRGKDYFQITPIRASGPGNVWVGDIRTGSKQLDREESP-VKVFTVIANDG---KHTAQAEIRVNLTDVNDNAPR-------FPASPYIGYVEENKPSGTSVMYIQAVDDDDPLAGGNAKLSYELTDSAGDKFSIDPLSGL----------IKTKVTFDREQTPNKF-KVRVKATDAGNPRLSASVDGI-IHVSDANDHKPKFTEKFYRGSVAENAPPGYSVLR--VTATDEDVGPNAEFEFVV---VQGNDPHAFYIDPFNGTVLVSGILDYEKKKEYTITLTVADRGMPPLQGDETAYVVIEILDANDNAPEFIPKIYNASVLEDVGARQPVLTVTAVDKDSG-PNGNFTFAIDPRSDPDDAFTIEPNPNNASIGIIRTRVPLDQEKTPSFHLKVTATDAG--------GLQGEGEVRINVIDVNDNGPWFVPPFFVGQIKEGVSARQFV 3227          

HSP 2 Score: 136.346 bits (342), Expect = 3.947e-32
Identity = 156/603 (25.87%), Postives = 268/603 (44.44%), Query Frame = 3
Query:  399 GTFFILIKILDQNDKAPQFSSIKRPF-FKIPENVEVGKVIDLPMAVDSDSEKYSVRRYSLSYIYHLDQTHDFRLHVTNDNPPRPQLIVNSKLDYEKINKYVFRLFAYDFDEKSIGNSCSTTIEIEIEDLNDNVPKFNQLTYNANIDENKRDDKLIKFTVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQ------VKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDADTHSNM-IHCKLVD-YNDLFYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPIIVTDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFN--VFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLRTRKPLDRETLESISIKVTAKNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAPKFIPR 2174
            G  F+ + + + ND  P F  +K  + F++ E    G+ + + +AVD+D +  +  +   +  + +DQ+                + +NS LD  K N+Y  ++ A D    S G + + ++   + D N+NVP+F      +  + + RD K+ + T +D D G+NG +T +I D + +      +F I+     +  + SLD E         ++  + G+     S +      + I+++++NDN P     K   SV +S       P  S ++ V+ TDAD+ SN  I   L+D    LF LDS     T  N     L+T  K+  E +     +   S   ++P +   T  +  I+I   N+  P FSQQ+Y  +++EN             VT   +  +   E   E+      +      +  G I T    DYE    +  +  A DK    L S+  + IN++D+ND +P F  +    N  V EN     K+ +++AIDDD    ++ + Y ++     +  F ID  TG + T+  LDRE      ++VTAK+          N +S + + I V+D ND  P F P+
Sbjct: 2133 GLCFVNVTLTNVNDNRPTF--LKSAYEFRVAEGAATGESLAIVVAVDADGDAVTYSKAGGALQFSVDQSTGV-------------ITLNSALDPNK-NQYTLQVMAKD----SGGLTSTVSVTFNVADANNNVPQFTNCGTVSIRENDPRDTKITQLTATDADRGQNGQITYSIEDASSQ-----TLFSIEPRTGVVRSLTSLDRENKDSY--NAIIKAEDGSSKQDESERLLWYCYLTINVEDVNDNRPYFLAAKYFGSVFSSA------PNGSNILTVQATDADSGSNAKIKYALLDSAGGLFRLDSSGILRTNTNPARLQLETGKKLLLEVSA----KDVESIAGTQPGKP--TKYTTQIEILVSNEEPPKFSQQVYTASINENMETGST-------VTRITATSSTGAEISYENVDTNPRAKILFRVQPDGYIITGDRPDYERGTTYNMQFAAKDK-KTLLYSTVKVVINIIDVNDVSPAFLLAINTRNARVLENKPAPTKVISMKAIDDDGSEPHRRVTYEMK----DNPNFQIDASTGMITTKTTLDREVTPKYDVEVTAKDG--------VNKESAI-LYITVVDQNDQPPVFAPK 2675          

HSP 3 Score: 134.42 bits (337), Expect = 1.678e-31
Identity = 170/619 (27.46%), Postives = 252/619 (40.71%), Query Frame = 3
Query:  402 TFFILIKILDQNDKAPQFSSIKRPFF--KIPENVEVGKVIDLPMAVDSDSEKYSVRRYSLSYIYHLDQTHDFRLHVTNDNPPRPQLIV-------NSKLDYEKINKYVFRLFAYDFDEKSIGNSCSTTIEIEIEDLNDNVPKFNQLTYNANIDENKRDDKLIKFTVS----DPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDADTHSNM-IHCKLVDYND--LFYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTD-SEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPIIVTDRDSGLNGKFEFYLEDFRNFSDSSDFLID-----KISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDID-----RYTGDLRTRKPLDRETLESISIKVTAKN-----PNKYSSHFVRNTDSEVDVMIKVMDVNDNAPK 2162
            T  + + I D ND  P FSS   P +  +I EN   G  + +  A D DS   S         + LD        +T      P  +        + +LD E+    VF + A D       ++    I + + D+NDN P+F    Y   ++ENK     + +  +    DP +G N  ++  +   TD    +F I  +      ++   + D E  P+ F+  + ATD G P LS+S    IH+ + ND+ PK   K    SV+      E  P    V+ V  TD D   N      +V  ND   FY+D            PFN   +     +        IT++  D   P  Q      + I+I D NDNAP F  +IY  +V E+           +   D+DSG NG F F ++   +  D+  F I+        G I T+  LD E    F  K+ A D G   L     + INV+D+NDN P F    ++  + E VS    +  L+A D D   K++ I +SI   G     F +D       + DL +    DRE      I + A +     P K  ++          V + V+DVNDNAPK
Sbjct: 2759 TAVVTVTIQDVNDLPPVFSS---PLYESRIQENTGPGAGVVMVTASDIDSPTIS---------FSLDDRGKDYFQITPIRASGPGNVWVGDIRTGSKQLDREESPVKVFTVIANDGK-----HTAQAEIRVNLTDVNDNAPRFPASPYIGYVEENKPSGTSVMYIQAVDDDDPLAGGNAKLSYEL---TDSAGDKFSIDPLSG---LIKTKVTFDREQTPNKFKVRVKATDAGNPRLSASVDGIIHVSDANDHKPKFTEKFYRGSVA------ENAPPGYSVLRVTATDEDVGPNAEFEFVVVQGNDPHAFYID------------PFNGTVLVSGILDYEKKKEYTITLTVADRGMPPLQGDETAYVVIEILDANDNAPEFIPKIYNASVLEDVGARQPVLT--VTAVDKDSGPNGNFTFAIDPRSDPDDA--FTIEPNPNNASIGIIRTRVPLDQEKTPSFHLKVTATDAG--GLQGEGEVRINVIDVNDNGPWFVPPFFVGQIKEGVSARQFVTKLKAYDPDAFVKDQVITFSIY-NGTVGENFKLDPVSVTNESVDLHSYGVFDREAAPVWKIGIEAVDNVGPKPQKNFTY----------VYVDVLDVNDNAPK 3319          

HSP 4 Score: 124.79 bits (312), Expect = 1.319e-28
Identity = 161/600 (26.83%), Postives = 263/600 (43.83%), Query Frame = 3
Query:  402 TFFILIKILDQNDKAPQFS-SIKRPFFKIPENVEV-GKVIDLPMAVDSDSEKYSVRRYSLSYIYHLDQTHDFRLHVTNDNPPRPQLIVNSKLDYEKINKYVFRLFAYDFDEKSIGNSCSTTIEIEIEDLNDNVPKFNQLTYNANIDENKR-DDKLIKFTVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELI--NSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDADTHSNMIHCKLVDYNDLFYLDSPSKFNTLLNYKPFNLKTINK-IDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXX-XXXXXXFPKPIIVTDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFTQRSLDYE-TKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLRTRKPLDRETLESISIKVTAKNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAPKFIPRL 2177
            T  ++I I+D ND +P F  +I     ++ EN     KVI +    D  SE +  RR +    Y +    +F++  +        +   + LD E   KY   + A D   K      S  + I + D ND  P F   +Y  ++ E+      ++    +D D G N  +T   + K D   K    F I  +    EL+    LD+ET    +   + ATD      S +A V + ++++ND  P          +  +     G+        V VT +D  S  I   L D    ++  +P + +   N    +++T +K +DRE +       T+   D + + Q      + + + DVNDNAP F    YIG V+EN+     V + + +   D  +G N K  + L D    S    F ID +SG I T+ + D E T NKF+ ++ A D G   L++S    I+V D ND+ P+F+E  Y  +V EN   G+ +  + A D+D     +  F  ++    H+ Y  ID + G +     LD E  +  +I +T  +            D    V+I+++D NDNAP+FIP++
Sbjct: 2553 TVKVVINIIDVNDVSPAFLLAINTRNARVLENKPAPTKVISMKAIDDDGSEPH--RRVT----YEMKDNPNFQIDASTG-----MITTKTTLDREVTPKYDVEVTAKDGVNKE-----SAILYITVVDQNDQPPVFAPKSYAISVPEDSPIGTSVLDIYATDADVGENAKITY-FISKGDPEGK----FSIVTSPVKGELVVNGKLDFETKSS-YTLEVTATDG---KFSDTAVVTVTIQDVNDLPPVFSSPLYESRIQENTGPGAGV--------VMVTASDIDSPTISFSLDDRGKDYFQITPIRASGPGNVWVGDIRTGSKQLDREESPVKVF--TVIANDGKHTAQ----AEIRVNLTDVNDNAPRFPASPYIGYVEENKPSGTSVMYIQAVDDDDPLAGGNAKLSYELTD----SAGDKFSIDPLSGLIKTKVTFDREQTPNKFKVRVKATDAGNPRLSASVDGIIHVSDANDHKPKFTEKFYRGSVAENAPPGYSVLRVTATDEDVGPNAEFEFVVVQGNDPHAFY--IDPFNGTVLVSGILDYEKKKEYTITLTVADRGMPPLQ----GDETAYVVIEILDANDNAPEFIPKI 3103          

HSP 5 Score: 114.775 bits (286), Expect = 1.653e-25
Identity = 196/783 (25.03%), Postives = 313/783 (39.97%), Query Frame = 3
Query:  216 SLLENDLPPFKLQLNQLIQPNNGVNREAVCRDNPGEKVRKFCKADLCCKLIGFQYLTPTDPGTFFILIKILDQNDKAPQFSSIKRPFFKIPENVEVGKVIDLPMAVDSDSEKYSVRRYSLSYIYHLDQTHDFRLHVTNDNPPRPQLIVNSKLDYEKINKYVFRLFAYDFDEKSIGNSCSTTIEIEIEDLNDNVPKFNQL--TYNANIDENK-RDDKLIKFTVSDPDSGR-NGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDADTHSNMIHCKLVDYNDLFYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIY-------IGXXXXXXXXXXXXFPKPIIVTDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLRTRKPLDRETLESISIKVTAKNPNKYSSHFVRNTD-------SEVDVMIKVMDVNDNAPKFIPRLNMKQKVEFIVEQFVDGNTCTELP--YTVQDI----DDGGINGQNCCYTILENDYNKLFSLMTDTPSYICLQRKPEKYQSYTVTLIARDRP-PNVEGGLTSKISFPVLIIND 2489
            +LL++    F+L  + +++ N    R  +     G+K+     A     + G Q   P  P  +   I+IL  N++ P+FS  +     I EN+E G  +    A  S   + S      +    +     FR+       P   +I   + DYE+   Y  +  A D  +K++  S +  + I I D+ND  P F     T NA + ENK    K+I     D D    +  VT  + D  +        F+I  +   +    +LD E  P  ++  + A D        SA + I + + ND  P    K      S ++S+ E  P  + V+++  TDAD   N      +   D        KF+ + +     L    K+D E+     L +T   TD     + +    + + I+DVND  P+FS  +Y        G      +    +   P I    D    GK  F +   R     + ++ D  +G     + LD E      F +IA D  +   T+ + I +N+ D+NDNAPRF  S YI  V EN   G  +  +QA+DDD      +   S E        F ID  +G ++T+   DRE           + PNK+    V+ TD       + VD +I V D ND+ PKF              E+F  G+     P  Y+V  +    +D G N +     +  ND +  +    +    +      EK + YT+TL   DR  P ++G  T+ +   +L  ND
Sbjct: 2395 ALLDSAGGLFRLDSSGILRTNTNPARLQL---ETGKKLLLEVSAKDVESIAGTQ---PGKPTKYTTQIEILVSNEEPPKFSQ-QVYTASINENMETGSTVTRITATSSTGAEISYENVDTNPRAKIL----FRVQ------PDGYIITGDRPDYERGTTYNMQFAAKD--KKTLLYS-TVKVVINIIDVNDVSPAFLLAINTRNARVLENKPAPTKVISMKAIDDDGSEPHRRVTYEMKDNPN--------FQIDASTGMITTKTTLDREVTPK-YDVEVTAKDGVN---KESAILYITVVDQNDQPPVFAPK------SYAISVPEDSPIGTSVLDIYATDADVGENAKITYFISKGD-----PEGKFSIVTSPVKGELVVNGKLDFETKSSYTLEVT--ATDG----KFSDTAVVTVTIQDVNDLPPVFSSPLYESRIQENTGPGAGVVMVTASDIDSPTISFSLDD--RGKDYFQITPIRASGPGNVWVGDIRTG----SKQLDREESPVKVFTVIANDGKH---TAQAEIRVNLTDVNDNAPRFPASPYIGYVEENKPSGTSVMYIQAVDDDDPLAGGNAKLSYELTDSAGDKFSIDPLSGLIKTKVTFDRE-----------QTPNKFKVR-VKATDAGNPRLSASVDGIIHVSDANDHKPKF-------------TEKFYRGSVAENAPPGYSVLRVTATDEDVGPNAEFEFVVVQGNDPHAFYIDPFNGTVLVSGILDYEKKKEYTITLTVADRGMPPLQGDETAYVVIEILDAND 3094          

HSP 6 Score: 106.686 bits (265), Expect = 4.284e-23
Identity = 146/618 (23.62%), Postives = 261/618 (42.23%), Query Frame = 3
Query:  402 TFFILIKILDQNDKAPQFSSIKRPFFKIPENVEVGKVIDLPMAVDSDS-EKYSVRRYSLSYIYHLDQTHDFRLHVTNDNPPRPQLIVNSKLDYEKINKYVFRLFAYDFDEKSIGNSCSTTIEIEIEDLNDNVPKFNQLTYNANIDENKRDDKLIKFTVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDADTHSNMIHCKLVDYNDLFYLDSPSKFNTLLNYKPFN--LKTINKIDRES--NHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPIIVTDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFTQRS---LDYETKNKFRFKIIAID----KGYQPLTSSS-TITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDD----------DTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLRTRKPLDRETLESISIKVTAKNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAPKFIPRLNMK 2186
            T  + I +++ ND  P F   +    +IPE+  VG ++    A D D     +     L+Y     +    + ++   +P   ++ V+  LDYE    ++ +++A D  +KS    C   + + + ++NDN P F +  Y   + E     + +   V+    G      V        L      F + ++   + L ++LD    P+  ++TL    + +  L+S+  V  ++ + N+N P+       F+   +VSI E  P  + + ++  TDAD   N           + Y    +   TL + +P    ++++  +DRE+  ++ + ++     +  + S ++     L I +EDVNDN P F    Y G+V  +  N        +  TD DSG N K ++ L D    S    F +D  SG + T  +   L  ET  K   ++ A D     G QP   +  T  I +L  N+  P+FS+  Y  ++ EN+  G  +  + A             DT+ + K I + ++P G    Y      TGD   R   +R T  ++      K    YS+         V V+I ++DVND +P F+  +N +
Sbjct: 2023 TVDVKIDVINANDHFPYFDQ-QLYSVQIPESTAVGVLVQEVTAKDCDCLSSCTCSPGFLTYSIEPSKEQGGKFYI---DPATGKISVSVALDYEDQRYHLLKVYATDKGKKSFQGLC--FVNVTLTNVNDNRPTFLKSAYEFRVAEGAATGESLAIVVAVDADGD----AVTYSKAGGALQ-----FSVDQSTGVITLNSALD----PNKNQYTLQVMAKDSGGLTSTVSVTFNVADANNNVPQ-------FTNCGTVSIRENDPRDTKITQLTATDADRGQN---------GQITYSIEDASSQTLFSIEPRTGVVRSLTSLDRENKDSYNAIIKAEDGSSKQDESERLLWYCYLTINVEDVNDNRPYFLAAKYFGSVFSSAPNGSNIL--TVQATDADSGSNAKIKYALLD----SAGGLFRLDS-SGILRTNTNPARLQLETGKKLLLEVSAKDVESIAGTQPGKPTKYTTQIEILVSNEEPPKFSQQVYTASINENMETGSTVTRITATSSTGAEISYENVDTNPRAK-ILFRVQPDG----YI----ITGD---RPDYERGTTYNMQFAAKDKKTLLYST---------VKVVINIIDVNDVSPAFLLAINTR 2577          

HSP 7 Score: 92.8189 bits (229), Expect = 7.976e-19
Identity = 148/625 (23.68%), Postives = 256/625 (40.96%), Query Frame = 3
Query:  648 QLIVNSKLDYEKINKYVFRLFAYDFDEKSIGNSCSTTIEIEIEDLNDNVPKFNQLTYNANIDENKRDDKLIK-FTVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELIN-------SLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDADTHSNMIHCKLVDYNDLFYLDSPSKFNTLLNY---KPFNLKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPIIVTDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQP-----LTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLRTR---KPLDRETLESISIKVTAKN-----------PNKYSSHFVRNTDSEVDVMIKVMDVNDNAPKFIPRLNMKQKVEFIVEQFVDGNTCTELPYTVQDIDDGGINGQNCCYTILENDYNKLFSLMTDTPSYICLQRKP--EKYQSYTVTLIARDR 2426
            ++++NS LD+E+ ++  + L     ++   G   +  ++I++ + ND+ P F+Q  Y+  I E+     L++  T  D D   +   +   +  + E SK       Q  +F+++          +LDYE D       + ATD+G  S      V + L N+NDN P        F V+   +  E L   ++VV V   DAD  +       V Y         SK    L +   +   + T+N     + +   L++      ++ S  +T+  S+   + D N+N P F+     G V   + +        +  TD D G NG+  + +ED    S  + F I+  +G + +  SLD E K+ +   I A D   +      L     +TINV D+NDN P F  + Y  +VF +   G  I T+QA D D+    K  +  ++  G     F +D  +G LRT      L  ET + + ++V+AK+           P KY++             I+++  N+  PKF  ++        I E    G+T T +  T          G    Y  ++ +             YI    +P  E+  +Y +   A+D+
Sbjct: 1990 RILLNSLLDFER-DQTQYNLKVKATEQIPDGLDSTVDVKIDVINANDHFPYFDQQLYSVQIPESTAVGVLVQEVTAKDCDCLSSCTCSPGFLTYSIEPSKE------QGGKFYIDPATGKISVSVALDYE-DQRYHLLKVYATDKGKKSFQGLCFVNVTLTNVNDNRPTFLKSAYEFRVAEGAATGESL---AIVVAV---DADGDA-------VTY---------SKAGGALQFSVDQSTGVITLNSALDPNKNQYTLQVM-----AKDSGGLTSTVSVTFNVADANNNVPQFTN---CGTVSIRENDPRDTKITQLTATDADRGQNGQITYSIEDA---SSQTLFSIEPRTGVVRSLTSLDRENKDSYNAIIKAEDGSSKQDESERLLWYCYLTINVEDVNDNRPYFLAAKYFGSVFSSAPNGSNILTVQATDADSGSNAKIKYALLDSAG---GLFRLDS-SGILRTNTNPARLQLETGKKLLLEVSAKDVESIAGTQPGKPTKYTTQ------------IEILVSNEEPPKFSQQVYTAS----INENMETGSTVTRITATSS-------TGAEISYENVDTNPRAKILFRVQPDGYIITGDRPDYERGTTYNMQFAAKDK 2546          

HSP 8 Score: 90.1225 bits (222), Expect = 4.891e-18
Identity = 135/521 (25.91%), Postives = 219/521 (42.03%), Query Frame = 3
Query:  633 NPPRPQLIVNSKLDYEKINKYVFRLFAYDFDEKSIGNSCSTTIEIEIEDLNDNVPKFNQLTYNANIDENKRDDKLIKFTVSDPDSGRN---GIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDADTHSNMIHCKLVDYNDLFYLDSPSKFNTLLNY-KPFNLKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPIIVTDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLRTRKPLDRETLESISIKVTAKNPNKYSSHFVRNTDSE-----VDVMIKVMDVNDNAPKFI 2168
            NP   Q+ V   L   K  +Y   +FA+D+    +  S + T+ ++        P+F++++Y+  + E+ +   L+   ++   SG      IV+ N+ DK            I   +  + L + LD+E D   +   + AT+Q    L S+  VKI + N ND+ P    +        SV I E      LV EV   D D  S+           L Y   PSK      Y  P   K    +  +     +  + +  TD +  +       +N+ + +VNDN P F +  Y   V E             +  D D+    K    L+          F +D+ +G I    +LD   KN++  +++A D G   LTS+ ++T NV D N+N P+F+    + ++ EN     KI  L A D D   +N  I YSIE      + F I+  TG +R+   LDRE  +S +  + A++ +       +  +SE       + I V DVNDN P F+
Sbjct: 1886 NPKTRQMEVAGSL---KDQRYDLDVFAFDYGIPRL-TSDTITLNVDGSAAGQLPPRFSKVSYHFMVSEDAKYLSLVGIILARSISGARLDYKIVSGNVGDKF-----------IAMGDGRILLNSLLDFERDQTQYNLKVKATEQIPDGLDSTVDVKIDVINANDHFPYFDQQLY------SVQIPESTAVGVLVQEVTAKDCDCLSSCTCSP----GFLTYSIEPSKEQGGKFYIDPATGKISVSVALDYEDQRYHLLKVYATD-KGKKSFQGLCFVNVTLTNVNDNRPTFLKSAYEFRVAEGAATGESLAIVVAVDADGDAVTYSKAGGALQ----------FSVDQSTGVITLNSALD-PNKNQYTLQVMAKDSG--GLTSTVSVTFNVADANNNVPQFTNCGTV-SIRENDPRDTKITQLTATDADRG-QNGQITYSIE-DASSQTLFSIEPRTGVVRSLTSLDRENKDSYNAIIKAEDGSS------KQDESERLLWYCYLTINVEDVNDNRPYFL 2358          

HSP 9 Score: 81.6481 bits (200), Expect = 1.836e-15
Identity = 119/485 (24.54%), Postives = 207/485 (42.68%), Query Frame = 3
Query:  636 PPRPQLIVNSKLDYEKINKYVFRLFAYDFDEKSIGNSCSTTIEIEIEDLNDNVPKF--NQLTYNANIDE-NKRDDKLIKFTVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDADTHSNMIHCKLVDYNDLFYLDSPSKFNTLLNYKPFNLKTINK-IDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPIIVTDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGY-QPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLRTRKPLDRETLESISIKVTAKNPN 2075
            P   Q+ +  KLD+E  + +   + A  +   +I  +     ++ I D+NDN P+F  ++ +    ID  + +D +L +    D DSG  G VT  I       +  F I  ++    F      + Y T    +   ++ATD  T       +  ++++ L+   P    +K     + S  + E       V  VR   +  ++ + +  +    D          NT      F + ++ K +DRE   G  L + ++        Q   + ++ + + D+ND+AP F+  IY  ++ E         P P+I  D D G NGK  + +    +      F ID  +GKI T+ +LDYET       I A D G  + L+  + + I+V+D NDN+P F+ + Y   +      G  +  + A D D+  +N  I YSI  +G+    F I+   G +   K L     +  S+KV A++ N
Sbjct: 1057 PDTGQVYLIKKLDFETKSYFPIAVRA-KYSGGAIELASEVVAKVTIVDVNDNGPRFAFHESSKTVVIDSFSAKDTQLAR--ALDADSGSLGEVTYGIDGGRSTSNLPFNI-NVKTGMIFA--TREILY-TQGSSYIIIVVATDGATDGSQKIQKFTVNVQVLDTPRPPSFPQK-----TYSAPVTETAGVGDTVTTVRAVYSKPNAFLKYTFVSGNED----------NTFC-VNGFGIISVAKSLDREKVAGYTLGMRVTLG------QHVDDTTVYVNLTDINDDAPHFTSAIYRRSIKEGLAEDTEILP-PVIAVDHDFGSNGKILYSILSGVHPDWDKYFNIDSATGKITTKMTLDYETHKSHTLFIRAEDNGSPKRLSGIAQVDIDVIDRNDNSPVFAAAFYRAKISLGAVKGTSVLQVHATDLDSG-QNGQITYSI-IQGNEEEAFTINE-QGVILVDKSLTTVAADKFSLKVEARDKN 1508          

HSP 10 Score: 81.6481 bits (200), Expect = 1.851e-15
Identity = 138/609 (22.66%), Postives = 256/609 (42.04%), Query Frame = 3
Query:  657 VNSKLDYEKINKYVFRLFAYDFDEKSIGNSCSTTIEIEIEDLNDNVPKFNQLTYNANI-DENKRDDKLIKFTVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNE-FFLELINSLDYETD--PHL-FEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDADTHSNMIHCKLVDYNDLFYLDSPSKFNTLLNYKP--FNLKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMF-----SQQIYIGXXXXXXXXXXXXFPKPIIVTDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLND-NAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLRTRKPLDRETLE--SISIKVTAKNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAPKFIPRLNMKQKVEFIVEQFVDGNTCTE-LPYTVQDIDDGGINGQNCCYTILEN---DYNKLFSLMTDTPSYIC-LQRKPEKYQSYTVTLIARD 2423
               KLD    +KY F + A D + +++    +  +E+ + D+ND+ P+F Q +Y  ++         L+     D D G N  V             R+++   + +E F L   N L   +   P++ ++  + A+D  T +  SSAQV +++   + +   I F K  ++ +    + E   A++LV   + T + + S + +  +  Y  +           + + KP    +  I K+D E+   S+  I +    S  + ++ +     + I DVNDN P F     S+ + I +       +           D DSG  G+  + ++  R+ S+   F I+  +G IF  R + Y   + +   ++A D            T+NV  L+    P F +  Y   V E   VG  + T++A+    +   K  F S    G+  + F ++ + G +   K LDRE +   ++ ++VT         H       +  V + + D+ND+AP F   +  +   E + E        TE LP  +    D G NG+   Y+IL     D++K F++ + T      +    E ++S+T+ + A D
Sbjct:  855 AGGKLDAHLASKYTFNVRATDRNFRNM--FATAQVEVNVIDVNDHKPEFLQESYWLSVPSSTPAGSSLVTVQAEDMDIGTNAQV-------------RYELLRQENSERFILNDNNQLSTASTLTPNVRYQLLIRASDSATRN-PSSAQVPVYVSVYSPSESPIVFDKSSYNQN----LPEDSSANTLVFTAKATRSGSSSGITYELVGGYKQIG--------EAMFSIKPDTGQVYLIKKLDFETK--SYFPIAVRAKYSGGAIELASEVVAKVTIVDVNDNGPRFAFHESSKTVVIDSFSAKDTQLARAL-------DADSGSLGEVTYGIDGGRSTSNLP-FNINVKTGMIFATREILYTQGSSYIIIVVATDGATDGSQKIQKFTVNVQVLDTPRPPSFPQKTYSAPVTETAGVGDTVTTVRAVYSKPNAFLKYTFVS----GNEDNTFCVNGF-GIISVAKSLDREKVAGYTLGMRVT------LGQHV-----DDTTVYVNLTDINDDAPHFTSAIYRRSIKEGLAED-------TEILPPVIAVDHDFGSNGK-ILYSILSGVHPDWDKYFNIDSATGKITTKMTLDYETHKSHTLFIRAED 1401          

HSP 11 Score: 77.7962 bits (190), Expect = 2.990e-14
Identity = 92/369 (24.93%), Postives = 162/369 (43.90%), Query Frame = 3
Query: 1089 VKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHSLVVE-VRVTDADTHSN--MIHCKLV----DYNDLFYLDSPSKFNTLLNYKPFNLKTINKIDRESN--HGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPIIVTDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLRTRKPLDRETLESISIKVTAKNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAPKFI 2168
            V ++L ++ND+ P         S     SI EGL   + ++  V   D D  SN  +++  L     D++  F +DS +            + T   +D E++  H  F+R      D+   ++++    ++I + D NDN+P+F+   Y   +    V         +  TD DSG NG+  + +      ++   F I++  G I   +SL     +KF  K+ A DK   P + S T+ INV  L D  P F  S     V E V    ++  ++A   +       + Y++   G+ +  F I+  TG L   + LD E      +K+ A++         R+  + V+++I V+++NDN P F+
Sbjct: 1304 VYVNLTDINDDAPHFT------SAIYRRSIKEGLAEDTEILPPVIAVDHDFGSNGKILYSILSGVHPDWDKYFNIDSATG----------KITTKMTLDYETHKSHTLFIR----AEDNGSPKRLSGIAQVDIDVIDRNDNSPVFAAAFYRAKISLGAVKGTSVLQ--VHATDLDSGQNGQITYSI---IQGNEEEAFTINE-QGVILVDKSLTTVAADKFSLKVEARDKNASPRSGSVTVEINVY-LPDGPPMFVVSPVTVYVKEGVPANHRVAGVKAATSEA------LTYTLL-SGNEAGMFRINPSTGSLDATRELDYEERRRYELKIEARD--------TRDRSAMVELIIIVVNINDNKPTFV 1630          

HSP 12 Score: 72.0182 bits (175), Expect = 1.407e-12
Identity = 118/484 (24.38%), Postives = 201/484 (41.53%), Query Frame = 3
Query:  741 NSCSTTIEIEIEDLNDNVPKFNQLTYNANIDENKR-DDKLIKFTVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINSLDYET-DPHLFEFTLLATDQGTPSLSSS-AQVKIHLKN------LNDNG-PKIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDADT---HSNMIHCKLVDYNDLFYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDV--NDNAPMFSQQIYIGXXXXXXXXXXXXFPKPIIVTDRDSGLN-----GKFEFYLEDFRNFSDSSDFLIDKISGKI-FTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLRTRKPLDRETLESISIKVTAKNPNKYSSHFVRNTDSEVDVMI 2129
            +S +  I + +ED ND  P F    Y   I EN      +++   +D D G NG +   + +  +        F I      + +  +LDY   D H    +  A D+G P  +S+ A V+I L+       L D+  PK   K        + SI E  P    ++ +R  D D    +  + +    +    F +D  S   TL +       +++  +  +NH     +T++ TD  P     T + L I+I+DV  N N+P F  Q  I  ++ ++     +    +  TD DS  N     GK  + +           F +D  +G++     SLD E  +++   + A D    P +S   + IN+LD +DN P FS+  YI  V EN   G  +  +  +  D D      +  I P       + I+  TG +RT K LD+  L +  ++V      + S+   +  D +V++ +
Sbjct:  230 HSGTANIRVNVEDANDQTPVFESSQYRETIAENTPIQTSVLRVRATDKDDGTNGGIYYYMKNPVNSY------FTIDAITGVIRVAKTLDYNARDKHTLYIS--ARDRGDPPRTSAEATVEISLRENIQGWPLPDSADPKENTKPYFPQSRYTFSIREDFPPKGALLVMRAADNDPIGPNKRLRYSLSGNGVSKFAIDPESGVVTLTD-------SVDYENTPNNH--VYDLTVTATDQGPGSLSATTQLL-IEIQDVDENKNSPRFDPQQAI--LEISENLKQNSLVTTVSATDSDSVGNPSSPDGKVVYSIVGGTGLGV---FRVDSNTGEVKVAVPSLDREGTSQYTLVVKASDNATFPRSSRLFLMINLLDEDDNFPYFSQPIYIAQVPENQPSGTFVTVV--VGRDADEGFNPSYTVITP----GVPYKIEPSTGVIRTSKSLDQSELSTRELQVIV----RVSTAGSKTADGQVNITV 680          

HSP 13 Score: 64.3142 bits (155), Expect = 3.814e-10
Identity = 114/508 (22.44%), Postives = 210/508 (41.34%), Query Frame = 3
Query:  405 FFILIKILDQNDKAPQFSSIKRPFFKIPENVEVGKVIDLPMAVDSDSEKYSVRRYSLSYIYHLDQTHDFRLHVTNDNPPRPQLIVNSKLDYEKINKYVFRLFAYDFDEKSIGNSCSTTIEIEIEDLNDNVPKFNQLTYNANIDENKRDDKLIKFTVS-DPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDADTHSNMIHCKLVDYND-LFYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPIIVTDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFTQ----RSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDD 1910
              I I+ +D+N  +P+F   ++   +I EN++   ++    A DSDS   +        +Y +       +   + N    ++ V S LD E  ++Y   + A D    +   S    + I + D +DN P F+Q  Y A + EN+     +   V  D D G N   TV               ++I+ +   +    SLD +++    E  ++       S ++  QV I + +  +  P  K       V   +  +  L   + V        D+ S  +   L    D LF +D  S    L     FN + +++ +        LRI    +    S Q   + SL +++ +  D  P FS   Y   VDE+        P  +I+ D D+  + +F+  +E   +     +F + + SG+ F +      LD    +K+ F + A D+ ++ + +++ + +NV+D+ND+ P F +  Y  +V  +   G  + T+QA D D
Sbjct:  462 LLIEIQDVDENKNSPRFDP-QQAILEISENLKQNSLVTTVSATDSDSVG-NPSSPDGKVVYSIVGGTGLGVFRVDSNTGEVKVAVPS-LDREGTSQYTLVVKASD--NATFPRSSRLFLMINLLDEDDNFPYFSQPIYIAQVPENQPSGTFVTVVVGRDADEGFNPSYTVITPGVP---------YKIEPSTGVIRTSKSLD-QSELSTRELQVIVRVSTAGSKTADGQVNITVISKVNRPPVFKNTPYSVKVPEEMGPLPNLFCIAAV--------DSLSRPVQYTLAPGADGLFEVDKDS--GRLHTKNSFNYENVDRYN--------LRIEARTS----SVQEVASASLTVEVTEEKD-LPKFSSDSYQLTVDESAAPGTTLAPGLLII-DSDTSSD-QFDCSMEAITSLHTLYNFEVTQQSGRCFLRVQAGGKLDAHLASKYTFNVRATDRNFRNMFATAQVEVNVIDVNDHKPEFLQESYWLSVPSSTPAGSSLVTVQAEDMD 929          

HSP 14 Score: 62.003 bits (149), Expect = 1.597e-9
Identity = 128/534 (23.97%), Postives = 219/534 (41.01%), Query Frame = 3
Query:  633 NPPRPQLIVNSKLDYEKI-NKYVFRLFAYDFDEKSIGNSCSTTIEIEIEDL--NDNVPKFNQLTYNANIDENKRDDKLIK-FTVSDPDSGRN-----GIVTVNIVDKTDELSKRFKIFEIQRNEFFLEL-INSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSII-EGLPAHSLVVEVRVTDADTHSNMIHCKLVDYNDLFYLDSPS----KFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPIIVTDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIG-TLQAIDDDTDRKNKDIFYSIEP-KGDHSSY-FDIDRYTG----DLRTRKPLDRETLESISIKVTAKNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAPKFI 2168
            +P    + +   +DYE   N +V+ L     D+     S +T + IEI+D+  N N P+F+       I EN + + L+   + +D DS  N     G V  +IV  T        +F +  N   +++ + SLD E     +   + A+D  T   SS   + I+L + +DN P        FS    ++ + E  P+ + V  V   DAD   N  +  +     + Y   PS    + +  L+    + + +  I R S  GS                 T +  +NI +    +  P+F    Y           +   P    +   DS L+   ++ L    +      F +DK SG++ T+ S +YE  +++  +I A     Q + S+S +T+ V +  D  P+FS   Y   V E+ + G  +   L  ID DT     D   S+E     H+ Y F++ + +G     ++    LD       +  V A + N       RN  +   V + V+DVND+ P+F+
Sbjct:  419 DPESGVVTLTDSVDYENTPNNHVYDLTVTATDQGPGSLSATTQLLIEIQDVDENKNSPRFDPQQAILEISENLKQNSLVTTVSATDSDSVGNPSSPDGKVVYSIVGGTG-----LGVFRVDSNTGEVKVAVPSLDREGTSQ-YTLVVKASDNATFPRSSRLFLMINLLDEDDNFPY-------FSQPIYIAQVPENQPSGTFVTVVVGRDADEGFNPSYTVITP--GVPYKIEPSTGVIRTSKSLDQSELSTRELQVIVRVSTAGS----------------KTADGQVNITVISKVNRPPVFKNTPY----SVKVPEEMGPLPNLFCIAAVDS-LSRPVQYTLAPGAD----GLFEVDKDSGRLHTKNSFNYENVDRYNLRIEARTSSVQEVASAS-LTVEVTEEKD-LPKFSSDSYQLTVDESAAPGTTLAPGLLIIDSDTSSDQFDC--SMEAITSLHTLYNFEVTQQSGRCFLRVQAGGKLDAHLASKYTFNVRATDRN------FRNMFATAQVEVNVIDVNDHKPEFL 902          

HSP 15 Score: 60.4622 bits (145), Expect = 4.733e-9
Identity = 108/485 (22.27%), Postives = 216/485 (44.54%), Query Frame = 3
Query:  417 IKILDQNDKAPQFSSIKRPF-FKIPENVEVGKVIDLPMAVDSDSEKYSVRRYSLS----YIYHLDQTHDFRLHVTNDNPPRPQLIVNSKLDYEKINKYVFRLFAYDFDEKSIGNSCSTTIEIEIEDLNDNVPKFNQLTYNANIDENKRDDKLIK--FTVSDPDSGRNGI-VTVNIVDKTDELSKRFKIFEI--QRNEFFLELINSLDYETDPHL---FEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDADTHSNMIHCKLVDYNDLFYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPIIVTDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIA-IDKGYQPLTSSSTITINVLDLNDNAPRFS 1829
            I ++ + ++ P F +   P+  K+PE  E+G + +L      DS    V+ Y+L+     ++ +D+    RLH  N              +YE +++Y  R+ A      S+    S ++ +E+ +  D +PKF+  +Y   +DE+      +     + D D+  +    ++  +     L      FE+  Q    FL +      + D HL   + F + ATD+   ++ ++AQV++++ ++ND+ P+   +    SV +S       PA S +V V+  D D  +N      V Y +L   ++  +F  +LN     L T + +     +   +R + S T +  S Q+     + + +   +++  +F +  Y  N+ E+     + F      +   SG+   +E  +  ++   ++  F I   +G+++  + LD+ETK+ F   + A    G   L S     + ++D+NDN PRF+
Sbjct:  678 ITVISKVNRPPVFKNT--PYSVKVPE--EMGPLPNLFCIAAVDSLSRPVQ-YTLAPGADGLFEVDKDSG-RLHTKN------------SFNYENVDRYNLRIEAR---TSSVQEVASASLTVEVTEEKD-LPKFSSDSYQLTVDESAAPGTTLAPGLLIIDSDTSSDQFDCSMEAITSLHTLYN----FEVTQQSGRCFLRV--QAGGKLDAHLASKYTFNVRATDRNFRNMFATAQVEVNVIDVNDHKPEFLQESYWLSVPSST------PAGSSLVTVQAEDMDIGTN----AQVRY-ELLRQENSERF--ILNDNN-QLSTASTLTPNVRYQLLIRASDSATRNPSSAQV----PVYVSVYSPSESPIVFDKSSYNQNLPEDSSANTLVFTAKATRSGSSSGIT--YEL-VGGYKQIGEAM-FSIKPDTGQVYLIKKLDFETKSYFPIAVRAKYSGGAIELASEVVAKVTIVDVNDNGPRFA 1112          

HSP 16 Score: 58.5362 bits (140), Expect = 2.032e-8
Identity = 77/280 (27.50%), Postives = 117/280 (41.79%), Query Frame = 3
Query: 1647 SDFLIDKISGKIFTQRSLDYET-KNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKD----IFYSIEPKGDHSSYFDIDRYTGDLRTRKPLDRETLESISIKVTAKNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAPKFIPRLNMKQKVEFIVEQFVDGNTCTELPYTVQDIDDGGINGQNCCYTILENDYNKLFSLMTDTPSYICLQRK--PEKYQSYTVTLIARDRPPNVEGGLTSKIS 2465
             D  I    G+I     LD+E  + ++  K+ A ++    L S+  + I+V++ ND+ P F +  Y   + E+ +VG  +  + A D D           + YSIEP  +    F ID  TG +     LD E      +KV A +  K S   +        V + + +VNDN P F     +K   EF V +   G    E    V  +D    +G    Y+         FS+   T   I L     P K Q YT+ ++A+D      GGLTS +S
Sbjct: 1980 GDKFIAMGDGRILLNSLLDFERDQTQYNLKVKATEQIPDGLDSTVDVKIDVINANDHFPYFDQQLYSVQIPESTAVGVLVQEVTAKDCDCLSSCTCSPGFLTYSIEPSKEQGGKFYIDPATGKISVSVALDYEDQRYHLLKVYATDKGKKSFQGL------CFVNVTLTNVNDNRPTF-----LKSAYEFRVAE---GAATGESLAIVVAVD---ADGDAVTYSKAGGALQ--FSVDQST-GVITLNSALDPNKNQ-YTLQVMAKD-----SGGLTSTVS 2233          

HSP 17 Score: 54.6842 bits (130), Expect = 2.628e-7
Identity = 53/178 (29.78%), Postives = 81/178 (45.51%), Query Frame = 3
Query: 1572 VTDRD-SGLNG--------KFEFYLEDFRNFSD--SSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSST-ITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLRTRKPLDRETLESISIKVTAKN 2069
             TDRD SG+ G        K  F +E  +  S   S  FL+ K +GK   +     +  N +    + +  G  P  S +  I +NV D ND  P F  S Y   + EN  +   +  ++A D D D  N  I+Y +  K   +SYF ID  TG +R  K LD    +  ++ ++A++
Sbjct:  159 ATDRDTSGIRGYSIISGNEKGYFKVETVQIGSGVTSRKFLVLKTTGKPIVR-----DDNNPYIMLTVQVTDGGNPSHSGTANIRVNVEDANDQTPVFESSQYRETIAENTPIQTSVLRVRATDKD-DGTNGGIYYYM--KNPVNSYFTIDAITGVIRVAKTLDYNARDKHTLYISARD 328          

HSP 18 Score: 52.7582 bits (125), Expect = 1.237e-6
Identity = 94/370 (25.41%), Postives = 152/370 (41.08%), Query Frame = 3
Query:  411 ILIKILDQNDKAPQF-SSIKRPFFK--IPENVEVGKVIDLP--MAVDSDSEKYSVRRYSLSYIYHLDQTHDFRLHVTNDNPPRPQLIVNSKLDYEKINKYVFRLFAYD-FDEKSIGNSCSTTIEIEIEDLNDNVPKFNQLTYNANIDENK-RDDKLIKFTVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSN-SVSIIEGLPAHSLVVEVRVTDADTHSNMIHCKLVDYNDLFYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMF 1496
            + + + D ND AP F S+I R   K  + E+ E+     LP  +AVD D        YS+    H D    F     N +    ++     LDYE    +   + A D    K +  S    ++I++ D NDN P F    Y A I     +   +++   +D DSG+NG +T +I+   +E  + F I     NE  + L++          F   + A D+     S S  V+I++  L D  P        F VS  +V + EG+PA+  V  V+   A T   + +  L       +  +PS           +L    ++D E      L+I     ++  +R  +    L I + ++NDN P F
Sbjct: 1304 VYVNLTDINDDAPHFTSAIYRRSIKEGLAEDTEI-----LPPVIAVDHDFGSNGKILYSILSGVHPDWDKYF-----NIDSATGKITTKMTLDYETHKSHTLFIRAEDNGSPKRL--SGIAQVDIDVIDRNDNSPVFAAAFYRAKISLGAVKGTSVLQVHATDLDSGQNGQITYSIIQGNEE--EAFTI-----NEQGVILVDKSLTTVAADKFSLKVEARDKNASPRSGSVTVEINVY-LPDGPPM-------FVVSPVTVYVKEGVPANHRVAGVK---AATSEALTYTLLSGNEAGMFRINPST---------GSLDATRELDYEERRRYELKI-----EARDTRDRSAMVELIIIVVNINDNKPTF 1629          
BLAST of Protocadherin Fat 1 vs. Ensembl Nematostella
Match: EDO48237 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RKF4])

HSP 1 Score: 165.622 bits (418), Expect = 3.382e-41
Identity = 162/595 (27.23%), Postives = 262/595 (44.03%), Query Frame = 3
Query:  387 PTDPGTFFILIKILDQNDKAPQFSSIKRPFFKIPENVEVGKVIDLPMAVDSDSEKYSVRRYSLSYIYHLDQTHDFRLHVTNDNPPRPQLIVNSKLDYEKINKYVFRLFAYDFDEKSIGNSCSTTIEIEIEDLNDNVPKFNQLTYNANIDEN-KRDDKLIKFTVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDADTHSNMIHCKLVDYNDLFYLDSPSKFNTLLNYKPFNLKTIN-KIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPIIVTDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLRTRKPLDRETLESISIKVTAKNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAPKF 2165
            P    T  + I +LD ND  PQFS  K     I E+V V +++    A D D              + +   +D  ++  + N    ++ V  KLDYE I  +   + A D  +  + N   TT++I + D+NDN P+F    +   I EN     +  +    D D G NG +T + +   ++L      F I  N   + +   LD E  P  F F + A D+G P    +AQ+ I L ++NDN PK   ++         SI E     + V++V+  D D+            N ++ + S S  +      P  L T++  ++  + H      ++S +D      +++   + + + D N +AP F ++ Y   V E+           ++ TDRD+G N K  + +          +F +D+ +G I T  SLD E  + +RF++ A D G   L + S + I++ D+NDN P F +  Y   V E++  G ++  + A D D   KN  I YS    GD    F ID   G +RT KPLDRET+    + V A +             + V V + + DV D+ P F
Sbjct:  212 PPRSATVTVKITLLDVNDCTPQFSK-KVYSATIREDVPVNQLVTTVRATDCDQGSNG------EVFFEIVSGND--MNFFSINRINGEVRVKQKLDYEMIGVFNLLVTAQDKGQPFLYNQ--TTVDIALIDVNDNAPQFVSSHFQTMIPENYAVGQEFYRVQAYDKDHGTNGEITFSFMQ--NDLP-----FSINENTGGISIKEELDREKVPK-FTFGIKARDKGVPFKEGTAQITITLLDINDNPPKFSQEEY------HTSIAENSRWGTSVLQVKAIDPDSGPT---------NVVYSIVSSSGHDRCFRINPQGLITLSCTLNYNTKH--VYVFSVSASDG----MLSSTALVYVNVTDSNTHAPEFKRRSYSAEVKEDASLGTSVLT--VLATDRDTGSNAKISYSIATL-----VPEFSVDETTGVIKTAGSLDREKVDTYRFEVTATDHGIPQLKAKSFVYIHIADVNDNDPVFLKPSYEAKVREDIRPGGRVIEVSASDADIG-KNAQIIYSFASNGDGQGTFTIDSTQGIIRTLKPLDRETIPEYELTVVATDQGTPPGQ------ASVKVKVILEDVKDSPPLF 752          

HSP 2 Score: 157.918 bits (398), Expect = 9.390e-39
Identity = 172/581 (29.60%), Postives = 266/581 (45.78%), Query Frame = 3
Query:  447 PQFSSIKRPFFKIPENVEVGKVIDLPMAVDSDSEKYSVRRYSLSYIYHLDQTHDFRL-HVTNDNPPRPQLIVNSK--LDYEKINKYVFRLFAYDFDEKSIGNSCSTTIEIEIEDLNDNVPKFNQLTYNANIDENKR-DDKLIKFTVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDADTHSNM-IHCKLVDYNDLFYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPIIVTDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLRTRKPLDRETLESISIKVTAKNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAPKFIPR 2174
            PQFS ++     + E+ EVG V+    A D DS    + RYS+S   +L     F +  +T         ++ +K  LD E ++++ FR+ A D  E S+      TI +   D+NDN P F +  Y A+I E+K   D ++    SD DSG NG V   I++ +D  +  F I E+      + ++  LD E  P  +   + A DQG P  S++  VKI L ++ND  P+   K        S +I E +P + LV  VR TD D  SN  +  ++V  ND+ +  S ++ N  +  K        K+D E   G F  +  +    +P   +    +++I + DVNDNAP F    +   + EN       +   +   D+D G NG+  F         +   F I++ +G I  +  LD E   KF F I A DKG      ++ ITI +LD+NDN P+FS+  Y  ++ EN   G  +  ++AID D+   N  + YSI     H   F I+   G +     L+  T       V+A +    S+           V + V D N +AP+F  R
Sbjct:   18 PQFSRLQEDA-SVSEDAEVGTVVATVSASDPDSGSNGMIRYSMSPSQNLMSATYFSIDQITG--------VITTKRGLDREFLDRHFFRVKAEDGGEPSLEGYMDLTINVL--DVNDNGPIFERNIYAADIPEDKSIGDFVLAVRASDADSGSNGEVKYCILN-SDGDNSAFSIGEVSGA---VTVMKKLDREKVP-TYTLQVQAQDQGNPPRSATVTVKITLLDVNDCTPQFSKKVY------SATIREDVPVNQLVTTVRATDCDQGSNGEVFFEIVSGNDMNFF-SINRINGEVRVK-------QKLDYEM-IGVFNLLVTAQDKGQPF--LYNQTTVDIALIDVNDNAPQFVSSHFQTMIPENYAVGQEFYR--VQAYDKDHGTNGEITFSF-----MQNDLPFSINENTGGISIKEELDREKVPKFTFGIKARDKGVPFKEGTAQITITLLDINDNPPKFSQEEYHTSIAENSRWGTSVLQVKAIDPDSGPTN--VVYSIVSSSGHDRCFRINP-QGLITLSCTLNYNTKHVYVFSVSASDGMLSSTAL---------VYVNVTDSNTHAPEFKRR 546          

HSP 3 Score: 143.665 bits (361), Expect = 1.885e-34
Identity = 131/466 (28.11%), Postives = 222/466 (47.64%), Query Frame = 3
Query:  786 DNVPKFNQLTYNANIDENKRDDKLIK-FTVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINSLDYE-TDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDADTHSN--MIHCKLVDYND--LFYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPIIVTDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLRTRKPLDRETLESISIKVTAKNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAPKF 2165
            +N P+F++L  +A++ E+     ++   + SDPDSG NG++  ++    + +S  +  F I +    +     LD E  D H F   + A D G PSL     + I++ ++NDNGP  +       +    SI +       V+ VR +DAD+ SN  + +C L    D   F +   S   T++           K+DRE      L++        P R  T   ++ I + DVND  P FS+++Y  +    +   V      +  TD D G NG+  F   +  + +D + F I++I+G++  ++ LDYE    F   + A DKG   L + +T+ I ++D+NDNAP+F  SH+   + EN +VG +   +QA D D    N +I +S      +   F I+  TG +  ++ LDRE +   +  + A++        V   +    + I ++D+NDN PKF
Sbjct:   15 NNPPQFSRLQEDASVSEDAEVGTVVATVSASDPDSGSNGMIRYSMSPSQNLMSATY--FSIDQITGVITTKRGLDREFLDRHFFR--VKAEDGGEPSLEGYMDLTINVLDVNDNGPIFERNIYAADIPEDKSIGD------FVLAVRASDADSGSNGEVKYCILNSDGDNSAFSIGEVSGAVTVMK----------KLDREKVPTYTLQVQAQ-DQGNPPRSATV--TVKITLLDVNDCTPQFSKKVY--SATIREDVPVNQLVTTVRATDCDQGSNGEVFF---EIVSGNDMNFFSINRINGEVRVKQKLDYEMIGVFNLLVTAQDKGQPFLYNQTTVDIALIDVNDNAPQFVSSHFQTMIPENYAVGQEFYRVQAYDKDHG-TNGEITFSFM---QNDLPFSINENTGGISIKEELDREKVPKFTFGIKARDKG------VPFKEGTAQITITLLDINDNPPKF 442          

HSP 4 Score: 134.035 bits (336), Expect = 1.712e-31
Identity = 171/612 (27.94%), Postives = 264/612 (43.14%), Query Frame = 3
Query:  381 LTPTDPGTFFIL------IKILDQNDKAPQFSSIKRPFFK--IPENVEVGKVIDLPMAVDSDSEKYSVRRYSLSYIYHLDQTHDFRLHVTNDNP-----PRPQLIVNSKLDYEKINKYVFRLFAYD----FDEKSIGNSCSTTIEIEIEDLNDNVPKFNQLTYNANIDENKR-DDKLIKFTVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDADTHSNM-IHCKLVDYNDLFYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPIIVTDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLRTRKPLDRETLESISIKVTAKNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAP 2159
            +T  D G  F+       I ++D ND APQF S     F+  IPEN  VG+            E Y V+ Y   +  + + T  F   + ND P         + +  +LD EK+ K+ F + A D    F E +        I I + D+NDN PKF+Q  Y+ +I EN R    +++    DPDSG       N+V      S   + F I   +  + L  +L+Y T  H++ F++ A+D     LSS+A V +++ + N + P+ K +      S S  + E     + V+ V  TD DT SN  I   +      F +D  +            +KT   +DRE       R  ++ TD     Q+     + I I DVNDN P+F +  Y   V E+           +  +D D G N +  +      N      F ID   G I T + LD ET  ++   ++A D+G  P  +S  + + + D+ D+ P F +  Y   V E+      + T++A   D   +   + YSI  +G+    FDI+  TG ++T   LD ET     + V A      S  F     +E  VM+ + D+NDN P
Sbjct:  309 VTAQDKGQPFLYNQTTVDIALIDVNDNAPQFVS---SHFQTMIPENYAVGQ------------EFYRVQAYDKDHGTNGEITFSF---MQNDLPFSINENTGGISIKEELDREKVPKFTFGIKARDKGVPFKEGT------AQITITLLDINDNPPKFSQEEYHTSIAENSRWGTSVLQVKAIDPDSG-----PTNVVYSIVSSSGHDRCFRIN-PQGLITLSCTLNYNTK-HVYVFSVSASDG---MLSSTALVYVNVTDSNTHAPEFKRR------SYSAEVKEDASLGTSVLTVLATDRDTGSNAKISYSIATLVPEFSVDETTGV----------IKTAGSLDREKVDT--YRFEVTATD-HGIPQLKAKSFVYIHIADVNDNDPVFLKPSYEAKVREDIRPGGRVIE--VSASDADIGKNAQIIYSFAS--NGDGQGTFTIDSTQGIIRTLKPLDRETIPEYELTVVATDQGTPPGQASVKVKVILEDVKDSPPLFEKPLYEVTVPEDTPPRSPVITVKAKSQDLSPET-GMMYSIV-RGNSPQVFDINPNTGAIQTLMKLDYETQSEYRLTVRAT----LSPFF-----TETTVMVYLKDINDNTP 852          

HSP 5 Score: 129.798 bits (325), Expect = 3.778e-30
Identity = 133/456 (29.17%), Postives = 225/456 (49.34%), Query Frame = 3
Query: 1170 VSIIEGLPAHSLVVEVRVTDADTHSNMIHCKLVDYNDLFYLDSPSKFNTLLNYKPFNLKTINKI-------DRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPIIVTDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLRTRKPLDRETLESISIKVTAKNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAPKFIPRLNMKQKVEFIVEQFVDGNTCTELPYTVQDID-DGGINGQNCCYTILENDYNKLFSLMTDTPSY-ICLQRKPEKYQSYTVTLIARDRP-PNVEGGLTSKISFPVLIINDPHSKIS 2507
             S+ E     ++V  V  +D D+ SN +         + Y  SPS+   L++   F++  I  +       DRE     F R+       EPS +   +  L I + DVNDN P+F + IY  ++ E++      F   +  +D DSG NG+ ++ +    +  D+S F I ++SG +   + LD E    +  ++ A D+G  P +++ T+ I +LD+ND  P+FS+  Y   + E+V V   + T++A D D    N ++F+ I   G+  ++F I+R  G++R ++ LD E +   ++ VTA++  +    F+ N   +  V I ++DVNDNAP+F+           I E +  G    +  Y VQ  D D G NG+   ++ ++ND    FS+  +T    I  +   EK   +T  + ARD+  P  EG  T++I+  +L IND   K S
Sbjct:   27 ASVSEDAEVGTVVATVSASDPDSGSNGM---------IRYSMSPSQ--NLMSATYFSIDQITGVITTKRGLDREFLDRHFFRVKAE-DGGEPSLEGYMD--LTINVLDVNDNGPIFERNIYAADIPEDKSIGD--FVLAVRASDADSGSNGEVKYCI--LNSDGDNSAFSIGEVSGAVTVMKKLDREKVPTYTLQVQAQDQGNPPRSATVTVKITLLDVNDCTPQFSKKVYSATIREDVPVNQLVTTVRATDCDQG-SNGEVFFEIV-SGNDMNFFSINRINGEVRVKQKLDYEMIGVFNLLVTAQDKGQ---PFLYN---QTTVDIALIDVNDNAPQFVS----SHFQTMIPENYAVG----QEFYRVQAYDKDHGTNGE-ITFSFMQNDLP--FSINENTGGISIKEELDREKVPKFTFGIKARDKGVPFKEG--TAQITITLLDINDNPPKFS 443          

HSP 6 Score: 129.028 bits (323), Expect = 5.771e-30
Identity = 194/702 (27.64%), Postives = 294/702 (41.88%), Query Frame = 3
Query:  387 PTDPGTFFILIKILDQNDKAPQFSSIKRPFFK--IPENVEVGKVIDLPMAVDSDSEKYSVRRYSLSYIYHLDQTHDFRLHVTNDNPP------RPQLIVNSKLDYEKINKYVFRLFAYDFDEKSIGNSCSTTIEIEIEDLNDNVPKFNQLTYNANIDENKRDDKLI-KFTVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSII-EGLPAHSLVVEVRVTDADTHSNMIHCKLVDYNDLFYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPIIVTDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKIS--GKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLRTRKPLDRETLESISIKVTAKNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAPKFI-PRLNMKQKVEFIVEQFVDGNTCTELPYTVQDIDDGGINGQNCCYTILEN-DYNKLFSLMTDTPSYICLQRKP---EKYQSYTVTLIARDR--PPN 2435
            P+  G   + I +LD ND  P F   +R  +   IPE+  +G  +    A D+DS      +Y +             L+   DN           + V  KLD EK+  Y  ++ A   D+ +   S + T++I + D+ND  P+F++  Y+A I E+   ++L+     +D D G NG V   IV   D        F I R    + +   LDYE    +F   + A D+G P L +   V I L ++NDN P+       F  S+  ++I E          V+  D D  +N         NDL     P   N   N    ++K   ++DRE        I        P ++ T    + I + D+NDN P FSQ+ Y  ++ EN            I  D DSG           +   S S      +I+  G I    +L+Y TK+ + F + A D     L+S++ + +NV D N +AP F    Y   V E+ S+G  + T+ A D DT   N  I YSI         F +D  TG ++T   LDRE +++   +VTA      + H +    ++  V I + DVNDN P F+ P    K     + E    G    E+  +  DI   G N Q   Y+   N D    F++  D+   I    KP   E    Y +T++A D+  PP 
Sbjct:  106 PSLEGYMDLTINVLDVNDNGPIF---ERNIYAADIPEDKSIGDFVLAVRASDADSGSNGEVKYCI-------------LNSDGDNSAFSIGEVSGAVTVMKKLDREKVPTYTLQVQAQ--DQGNPPRSATVTVKITLLDVNDCTPQFSKKVYSATIREDVPVNQLVTTVRATDCDQGSNGEVFFEIVSGND-----MNFFSINRINGEVRVKQKLDYEM-IGVFNLLVTAQDKGQPFLYNQTTVDIALIDVNDNAPQ-------FVSSHFQTMIPENYAVGQEFYRVQAYDKDHGTNGEITFSFMQNDL-----PFSINE--NTGGISIK--EELDREKVPKFTFGIKAR-DKGVPFKEGTAQ--ITITLLDINDNPPKFSQEEYHTSIAENSRWGTSVLQVKAI--DPDSGPTNVV------YSIVSSSGHDRCFRINPQGLITLSCTLNYNTKHVYVFSVSASDG---MLSSTALVYVNVTDSNTHAPEFKRRSYSAEVKEDASLGTSVLTVLATDRDTG-SNAKISYSI---ATLVPEFSVDETTGVIKTAGSLDREKVDTYRFEVTA------TDHGIPQLKAKSFVYIHIADVNDNDPVFLKPSYEAK-----VREDIRPGGRVIEVSASDADI---GKNAQ-IIYSFASNGDGQGTFTI--DSTQGIIRTLKPLDRETIPEYELTVVATDQGTPPG 732          

HSP 7 Score: 95.5153 bits (236), Expect = 1.160e-19
Identity = 94/372 (25.27%), Postives = 173/372 (46.51%), Query Frame = 3
Query:  402 TFFILIKILDQNDKAPQFSSIKRPF-FKIPENVEVGKVIDLPMAVDSDSEKYSVRRYSLSYI---YHLDQTHDFRLHVTNDNPPRPQLIVNSKLDYEKINKYVFRLFAYDFDEKSIGNSCSTTIEIEIEDLNDNVPKFNQLTYNANIDENKR-DDKLIKFTVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDADT--HSNMIHCKLVDYNDLFYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMF 1496
            T  + + + D N  AP+F   +R +  ++ E+  +G  +   +A D D+   +   YS++ +   + +D+T                +     LD EK++ Y F + A D     +     + + I I D+NDN P F + +Y A + E+ R   ++I+ + SD D G+N  +  +     D        F I   +  +  +  LD ET P  +E T++ATDQGTP   +S +VK+ L+++ D+ P   F+K  + V+    + E  P  S V+ V+    D    + M++        +   +SP  F+  +N     ++T+ K+D E+   S  R+T+  T S       T  ++ + ++D+NDN P+ 
Sbjct:  526 TALVYVNVTDSNTHAPEFK--RRSYSAEVKEDASLGTSVLTVLATDRDTGSNAKISYSIATLVPEFSVDETTGV-------------IKTAGSLDREKVDTYRFEVTATDHGIPQL--KAKSFVYIHIADVNDNDPVFLKPSYEAKVREDIRPGGRVIEVSASDADIGKNAQIIYSFASNGDGQGT----FTIDSTQGIIRTLKPLDRETIPE-YELTVVATDQGTPPGQASVKVKVILEDVKDSPPL--FEKPLYEVT----VPEDTPPRSPVITVKAKSQDLSPETGMMY-------SIVRGNSPQVFD--INPNTGAIQTLMKLDYETQ--SEYRLTVRATLSP----FFTETTVMVYLKDINDNTPVL 854          
BLAST of Protocadherin Fat 1 vs. Ensembl Nematostella
Match: EDO35412 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLK9])

HSP 1 Score: 164.466 bits (415), Expect = 7.479e-41
Identity = 191/697 (27.40%), Postives = 309/697 (44.33%), Query Frame = 3
Query:  411 ILIKILDQNDKAPQFSSIKRPFFKIPENVEVGKVIDLPMAVDSDSEKYSVRRYSLSYIYHLDQTHDFRLHVTNDNPPRPQLIVNSK--LDYEKINKYVFRLFAYDFDEKSIGNSCSTTIEIEIEDLNDNVPKFNQLTYNANIDENKRDD-KLIKFTVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDADTHSN-MIHCKLVDYND--LFYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTD-SEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPIIVTDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPK-GDHSSYFDIDRYTGDLRTRKPLDRETLESISIKVTAKNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAPKFIPRLNMKQKVEFIVEQFVDGNTCTELPYTVQDIDDGGINGQNCCYTILENDYNKLFSLMTDTPSYICLQRKPEKYQSYTVTLIARDRPPNVEGGLTSKISFPVL 2477
            + +++ D ND  P+F ++     +I E+++V     +  A D D+       Y+++     D T  F L  T   P    L V +K  LD E  + Y   + A D    ++   C   I I I D ND+ P F Q +Y  +I EN +    +++ + +D DSG NG +   I    D +     IF++  +   +    +LD+E   + + F ++A+D G PS +  A V I++ + NDN P++K   L     +     E    ++ +  + VTD D+++N     K+ + +D   F ++        L +    L+    +DRE     F  +T++ TD   PSR  +T   + I + DVNDN+P F+   Y  N+ E   N    +   +  TD D G NG   + +      +D   F +D  SG + T + LD E  +     I A D G  P T S+T+T+ ++D NDN PRF +S Y   + E  S+G  +  + A D D+   N  I Y I       +  F+++  TG L T+  LDRET    S  V AK+      H      S V V + + D+NDNAP F P       VE+      +      L  T  D D+G        Y I+  + N  FS+ + T     L     + + +   +I+     N     T+ ++  VL
Sbjct:   81 VQVQVDDINDNEPRFPTLYYTL-RIRESMDVNTTNPINTATDPDAGNNGTVDYTIA---SGDNTATFSLGTTA-CPTGSTLCVITKKPLDRETTDFYQLNITATDRGTPALMGYC--LINITILDENDHAPVFTQNSYLGSIAENTKPGVSILRVSAADRDSGSNGDIKYAI--DWDAIQSN-SIFDLDSSTGVIRTKQNLDFEV-KNSYTFNVIASDGGVPSKNDLATVTINVLDTNDNSPQLKITYLPPHNGDKAIRSENSLINTNIAYILVTDKDSNTNSQTELKITNGDDEGCFKVE-------FLGFYFIQLQ--KPLDRE--LVPFYNLTLNVTDKGVPSR--STLGFVLIDVTDVNDNSPAFTSNAYTANISELAQNGS--YVLQLNATDPDEGDNGTVSYSI---TGGNDLGWFQVDFQSGLVTTAKPLDREQVSSVTITITAQDHGSAPKTGSTTVTVTIIDGNDNKPRFMKSSYKGTISEGASIGATVLQVSATDVDSG-DNGRITYEISSSDAQVNGLFELNTQTGVLWTKSQLDRETKSLYSFTVLAKD------HGDPQLMSSVKVELTISDINDNAPVFYP-------VEYFASIMENEPPGKLLQVTATDADEG--TNAVISYDIIGGNNNGNFSIDSSTGVISTLASLDHEVEEFFSLIISAKDGGNKYAAKTAVVNVTVL 732          

HSP 2 Score: 155.606 bits (392), Expect = 3.794e-38
Identity = 198/705 (28.09%), Postives = 301/705 (42.70%), Query Frame = 3
Query:  384 TPTDPGTFFILIKILDQNDKAPQFSSIKRPFFKIPENVEVGKVIDLPMAVDSDSEKYSVRRYSLSY-------IYHLDQTHDFRLHVTNDNPPRPQLIVNSKLDYEKINKYVFRLFAYDFDEKSIGNSCSTTIEIEIEDLNDNVPKFNQLTY-------NANIDENKRDDKLIKFT-VSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDADTHSN-MIHCKLVDYNDLFYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPIIVTDRDSGLNGKFEFYLEDFRNFSDSSD------FLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLRTRKPLDRETLESISIKVTAKN-PNKYSSHFVRNTDSEVDVMIKVMDVNDNAPKFIPRLNMKQKVEFIVEQFVDGNTCTELPYTVQDIDDGGINGQNCCYTILENDYNKLFSLMTDTPSYICLQR---KPEKYQSYTVTLIAR 2420
            TP   G   I I ILD+ND AP F+        I EN + G  I    A D DS      +Y++ +       I+ LD +                +     LD+E  N Y F + A D    S  +    T+ I + D NDN P+  ++TY        A   EN   +  I +  V+D DS  N    + I +  DE   + +        +F++L   LD E  P  +  TL  TD+G PS S+   V I + ++NDN P         S + + +I E     S V+++  TD D   N  +   +   NDL +          ++++   + T   +DRE    S + ITI+  D   S   T + ++ + I D NDN P F +  Y G + E            +  TD DSG NG+  + +        SSD      F ++  +G ++T+  LD ETK+ + F ++A D G   L SS  + + + D+NDNAP F    Y  ++ EN   G K+  + A D D +  N  I Y I   G+++  F ID  TG + T   LD E  E  S+ ++AK+  NKY++           V + V++  DN P F     + +   F V + V   T     Y      +G I      Y I+  D   LF L+  T   I +     + EK Q Y + +IAR
Sbjct:  183 TPALMGYCLINITILDENDHAPVFTQ-NSYLGSIAENTKPGVSILRVSAADRDSGSNGDIKYAIDWDAIQSNSIFDLDSSTGV-------------IRTKQNLDFEVKNSYTFNVIASDGGVPSKNDLA--TVTINVLDTNDNSPQL-KITYLPPHNGDKAIRSENSLINTNIAYILVTDKDSNTNSQTELKITNGDDEGCFKVEFLGF----YFIQLQKPLDRELVP-FYNLTLNVTDKGVPSRSTLGFVLIDVTDVNDNSPAFT------SNAYTANISELAQNGSYVLQLNATDPDEGDNGTVSYSITGGNDLGWFQ--------VDFQSGLVTTAKPLDRE--QVSSVTITITAQD-HGSAPKTGSTTVTVTIIDGNDNKPRFMKSSYKGTISEGASIGATVL--QVSATDVDSGDNGRITYEIS-------SSDAQVNGLFELNTQTGVLWTKSQLDRETKSLYSFTVLAKDHGDPQLMSSVKVELTISDINDNAPVFYPVEYFASIMENEPPG-KLLQVTATDAD-EGTNAVISYDI-IGGNNNGNFSIDSSTGVISTLASLDHEVEEFFSLIISAKDGGNKYAAKTAV-------VNVTVLNKADNLPVF-----LYEMYNFTVYENVPKGTLVGRVYATTKDKNGSI-----SYAIVSGDPTNLF-LVDSTGGIIKINGDMDREEKAQ-YLLAVIAR 817          

HSP 3 Score: 137.502 bits (345), Expect = 1.165e-32
Identity = 180/702 (25.64%), Postives = 291/702 (41.45%), Query Frame = 3
Query:  408 FILIKILDQNDKAPQFSSIKRPFFKIPENVEVGKVIDLPMAVDSDSEKYSVRRYSLSYIYHLDQTH-DFRLHVTNDNPPRPQLIVNSKLDYEKINKYVFRLFAYDFDEKSIGNSCSTTIEIEIEDLNDNVPKFNQLTYNANIDENKR-DDKLIKFTVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDADTHSN-MIHCKLVDYNDL--FYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPIIV-----TDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLRTRKPLDRETLESISIKVTAKNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAPKFIPRLNMKQKVEFIVEQFVDGNTCTELPYTVQDIDDGGINGQNCCYTILENDYNKLFSLMTDTPSYICLQRKPEKYQSYTVTLIARDRPPNVEGGLTS-KISFPVLI 2480
            F+LI + D ND +P F+S       I E  + G  +    A D D        YS++    L     DF+  +     P         LD E+++     + A D    S   + STT+ + I D NDN P+F + +Y   I E       +++ + +D DSG NG +T  I     +++    +FE+      L   + LD ET   L+ FT+LA D G P L SS +V++ + ++NDN P        + V    SI+E  P   L+ +V  TDAD  +N +I   ++  N+   F +DS +            + T+  +D E     F  + IS  D   ++       +N+ + +  DN P+F  ++Y          V  N PK  +V     T +D   +  +     D  N      FL+D   G I     +D E K ++   +IA     +PL++ +T+ I VLD NDNAP+FS S  I ++     VG  +    A+D D   KN  + Y +    +   +  I+  +G ++  + L        +++V A +      H      S + + I  + +N + PKF           ++           +  Y V    D G NGQ   Y+I + +   LF +      YI          SY + + A D      GG+ S   S PV I
Sbjct:  410 FVLIDVTDVNDNSPAFTS-NAYTANISELAQNGSYVLQLNATDPDEGDNGTVSYSITGGNDLGWFQVDFQSGLVTTAKP---------LDREQVSSVTITITAQD--HGSAPKTGSTTVTVTIIDGNDNKPRFMKSSYKGTISEGASIGATVLQVSATDVDSGDNGRITYEISSSDAQVNG---LFELNTQTGVLWTKSQLDRET-KSLYSFTVLAKDHGDPQLMSSVKVELTISDINDNAPVF------YPVEYFASIMENEPPGKLL-QVTATDADEGTNAVISYDIIGGNNNGNFSIDSSTGV----------ISTLASLDHEVEE--FFSLIISAKDGG-NKYAAKTAVVNVTVLNKADNLPVFLYEMY-------NFTVYENVPKGTLVGRVYATTKDKNGSISYAIVSGDPTNL-----FLVDSTGGIIKINGDMDREEKAQYLLAVIARVGTVKPLSAQATVNIEVLDRNDNAPQFSTSSVIVDIDGTWLVGQVVYNAAAVDLDAG-KNGLVRYQLTSNAEGLLW--INSTSGVIKLARKLTDGDETQYTVQVLASDSGSPPQH------STMTIHI-TLSIN-HPPKFTLS-------SYVTHVLASQPLSYQFFYVVAVDQDSGKNGQ-LFYSIPQGNEEGLFGIFPGGKLYIRKSLLQALKGSYDLIVRATD------GGVPSFSASVPVTI 1038          

HSP 4 Score: 126.716 bits (317), Expect = 2.920e-29
Identity = 151/575 (26.26%), Postives = 250/575 (43.48%), Query Frame = 3
Query:  756 TIEIEIEDLNDNVPKFNQLTYNANIDENKRDDKLIKF-TVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINS-LDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKI-KFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDADTHSN-----MIHCKLVDYNDLFYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYI-----GXXXXXXXXXXXXFPKPIIVTDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFT--QRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLRTRKPLDRETLESISIKVTAKNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAPKFIPRLNMKQKVEFIVEQFVDGNTCTELPYTVQDIDDGGINGQNCCYTILEND--YNKLFSLMTDTPS-YICLQRKPEKYQSYTVTLIARDR 2426
            +++++++D+NDN P+F  L Y   I E+   +      T +DPD+G NG V   I    +  +                +    LD ET    ++  + ATD+GTP+L     + I + + ND+ P   +   LG       SI E       ++ V   D D+ SN      I    +  N +F LDS +            ++T   +D E  + S+    I+     PS+      ++N+   D NDN+P   +  Y+          ++ +++      I+VTD+DS  N + E  +    N  D   F ++ + G  F   Q+ LD E    +   +   DKG    ++   + I+V D+NDN+P F+ + Y  N+ E    G  +  L A D D +  N  + YSI   G+   +F +D  +G + T KPLDRE + S++I +TA++      H          V + ++D NDN P+F     MK   +  + +       T L  +  D+D G  NG+   Y I  +D   N LF L T T   +   Q   E    Y+ T++A+D 
Sbjct:   80 SVQVQVDDINDNEPRFPTLYYTLRIRESMDVNTTNPINTATDPDAGNNGTVDYTIASGDNTATFSLGTTACPTGSTLCVITKKPLDRET-TDFYQLNITATDRGTPALMGYCLINITILDENDHAPVFTQNSYLG-------SIAENTKPGVSILRVSAADRDSGSNGDIKYAIDWDAIQSNSIFDLDSSTGV----------IRTKQNLDFEVKN-SYTFNVIASDGGVPSKNDLATVTINVL--DTNDNSPQL-KITYLPPHNGDKAIRSENSLINTNIAYILVTDKDSNTNSQTELKI---TNGDDEGCFKVEFL-GFYFIQLQKPLDRELVPFYNLTLNVTDKGVPSRSTLGFVLIDVTDVNDNSPAFTSNAYTANISELAQNGSYVLQLNATDPD-EGDNGTVSYSIT-GGNDLGWFQVDFQSGLVTTAKPLDREQVSSVTITITAQD------HGSAPKTGSTTVTVTIIDGNDNKPRF-----MKSSYKGTISEGASIG-ATVLQVSATDVDSGD-NGR-ITYEISSSDAQVNGLFELNTQTGVLWTKSQLDRETKSLYSFTVLAKDH 612          

HSP 5 Score: 103.605 bits (257), Expect = 2.769e-22
Identity = 136/578 (23.53%), Postives = 246/578 (42.56%), Query Frame = 3
Query:  744 SCSTTIEIEIEDLNDNVPKFNQLTYNANIDENKRDDKLIKFTVSDP-DSGRNGIVTVNIVD---------KTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDADTHSNMIHCKLVDYNDLFYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPIIVTDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIF--YSIEPKGDHSSYFDIDRYTGDLRTRKPLDRETLES------ISIKVTAKNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAPKFIPRLNMKQKVEFIVEQFVDGNTCTELPYTVQDIDDGGINGQNCCYTILENDYNKLFSLMTDTPSYICLQRKPEKYQSYTVTLIARD 2423
            S S  + I I+D ND+   F   T+   + EN     L+   V+   D  R   +  +++          ++ +++ R ++    R E      +++       ++  T +  D+        A V + + +LNDN P   F +  ++++ S   + G P    V  ++  DAD   N    K   +  L       KF   +N     L     +DRE+   S   + +  TD+  +   +T + + I + D ND  P+F +  Y   V+  +  ++ +    +  +D+D G NG  ++ +    N + ++ F ++  +G++   +SLD+ET   +   I A D G  PL+S+  +T+NVLD+NDNAP F        V ENV+ G+ +G   A D DT       F  YS  P    S  F ++  T ++ T   +D ET+ +      + +  T +   K S+           + ++V D NDN+P F+                  G++   +  T +D D    NG+   Y+I+  + N  F+L   T     + + P+    Y +T+ A D
Sbjct: 1031 SASVPVTIYIQDSNDHRSLFVNNTFRFAVAENSSPGTLVGTLVAHALDHSRTKDIVYSLISSESHFAVDVRSGQITTRVRL---DREELIKNTGSNVYIMQAEAMYNDTTIKRDK--------AIVIVTVTDLNDNAPV--FSRAVYAITVSELSLPGSP----VFRIKAMDADEGDN---AKF--FYSLVSGTGMDKF--FINSSTGELHLSKTLDRETT--SSYNLVVKATDASNANLYSTAK-IEITVGDSNDQRPVFPESDY--TVNITEDALIGSLVINLNASDKDIGQNGLIKYSIS---NGNLAAMFDVESATGRLIVAKSLDFETTQLYELTITAQDHGLIPLSSTVNVTVNVLDVNDNAPLFPTQPVTLTVRENVNTGFPVGRCTASDRDTGTNAHIAFSMYSQTP----SKTFSVNSATCEITTIAAIDLETMPAGRDSFQLVVMATDQGSPKLSTR--------KSITVQVTDENDNSPGFVSP-----------PAAAAGSSLNVMTITAEDPDRNS-NGK-VTYSIISGN-NGYFNLHPSTGQLQMIHQIPDNPTIYQLTIQASD 1550          

HSP 6 Score: 97.0561 bits (240), Expect = 3.289e-20
Identity = 131/477 (27.46%), Postives = 207/477 (43.40%), Query Frame = 3
Query:  411 ILIKILDQNDKAPQFSSIKRPFFKIPENVEVGKVIDLPMAVDSDSEKYSVRRYSLSYIYHLDQTHDFRLHVTNDNPPRPQLIVNSKLDYEKINKYVFRLFAYDFDEKSIGNSCSTTIEIEIEDLNDNVPKFNQLTYNANIDENKRDD-KLIKFTVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINSLDYETDPH---LFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHSL-VVEVRVTDADTHSN-MIHCKLVDYNDLFYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTD-SEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPIIVTDRDSGLNGKFEFYLEDFRNFSDSS--DFLIDKISGKIFTQRSLDYETKNK-FRFKIIAIDK-GYQPLTSSSTITINVLDLN 1808
            I I + D ND+ P F         I E+  +G ++    A D D  +  + +YS+S   +L    D             +LIV   LD+E    Y   + A D     I  S +  + + + D+NDN P F        + EN      + + T SD D+G N  +  ++  +T       K F +      +  I ++D ET P     F+  ++ATDQG+P LS+   + + + + NDN P       GF     VS        SL V+ +   D D +SN  +   ++  N+ ++   PS            L+ I++I    ++ +  ++TI  +D  +PSRQ  T   +++  E      P FS   Y G+V EN+V         ++     S LNG  E+YL      SDSS   F + K +G + T R +D E     F   + A+DK G    TSS+T+TI V D+N
Sbjct: 1250 IEITVGDSNDQRPVFPESDYTV-NITEDALIGSLVINLNASDKDIGQNGLIKYSISN-GNLAAMFDVE-------SATGRLIVAKSLDFETTQLYELTITAQD--HGLIPLSSTVNVTVNVLDVNDNAPLFPTQPVTLTVRENVNTGFPVGRCTASDRDTGTNAHIAFSMYSQTPS-----KTFSVNSATCEITTIAAIDLETMPAGRDSFQLVVMATDQGSPKLSTRKSITVQVTDENDNSP-------GF-----VSPPAAAAGSSLNVMTITAEDPDRNSNGKVTYSIISGNNGYFNLHPST---------GQLQMIHQI---PDNPTIYQLTIQASDGGQPSRQ--TQTVVSVFKEGPIGGGPTFSSADYQGSVTENKVAGTSVV--TVLAAYPQSSLNGNIEYYLT-----SDSSKGGFEVVKSTGVVKTTRGIDREGMGASFNLVVYAVDKQGPSARTSSATVTITVQDVN 1677          

HSP 7 Score: 93.5893 bits (231), Expect = 3.801e-19
Identity = 154/595 (25.88%), Postives = 250/595 (42.02%), Query Frame = 3
Query:  417 IKILDQNDKAPQFSSIKRPFFKIPENVEVGKVIDLPMAVDSDSEKYSVRRYSLSYIYHLDQTHDFRLHVTNDNPPRPQLIVNSKLDYEKINKYVFRLFAYDFDEKSIGNS-CSTTIEIEIEDLN--DNVPKFNQLTYNANIDENKRDDKLIKFTVSDPDSGRNGIVTVNIV--DKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEG-LPAHSLVVEVRVTDADTHSN-MIHCKLV-DYNDLFYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPIIVTDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLRTRKPLDRETLESISIKVTAKNPNKYSSHFVRNTDS----EVDVMIKVMDVNDNAPKF 2165
            + I D ND AP F  ++  F  I EN   GK++ +  A D+D    +V  Y    I   +   +F +     +     +   + LD+E     V   F+     K  GN   + T  + +  LN  DN+P F    YN  + EN     L+   V      +NG ++  IV  D T+       +F +      +++   +D E     +   ++A       LS+ A V I + + NDN P+       FS S+ +  I+G      +V      D D   N ++  +L  +   L +++S S               + K+ R+   G   + T+    S+ S     + ++ I I    ++ P F+   Y+ +V  +Q      F   ++  D+DSG NG+  FY       ++   F I    GK++ ++SL    K  +   + A D G    ++S  +TI + D ND+   F  + + F V EN S G  +GTL A   D  R  KDI YS+     H   F +D  +G + TR  LDRE L    IK T  N     +  + N  +    +  V++ V D+NDNAP F
Sbjct:  625 LTISDINDNAPVFYPVEY-FASIMENEPPGKLLQV-TATDADEGTNAVISYD---IIGGNNNGNFSI-----DSSTGVISTLASLDHE-----VEEFFSLIISAKDGGNKYAAKTAVVNVTVLNKADNLPVFLYEMYNFTVYENVPKGTLVG-RVYATTKDKNGSISYAIVSGDPTN-------LFLVDSTGGIIKINGDMDREEKAQ-YLLAVIARVGTVKPLSAQATVNIEVLDRNDNAPQ-------FSTSSVIVDIDGTWLVGQVVYNAAAVDLDAGKNGLVRYQLTSNAEGLLWINSTSG--------------VIKLARKLTDGDETQYTVQVLASD-SGSPPQHSTMTIHITLSINHPPKFTLSSYVTHVLASQPLSYQFFY--VVAVDQDSGKNGQL-FY--SIPQGNEEGLFGIFP-GGKLYIRKSLLQALKGSYDLIVRATDGGVPSFSASVPVTIYIQDSNDHRSLFVNNTFRFAVAENSSPGTLVGTLVAHALDHSRT-KDIVYSLISSESH---FAVDVRSGQITTRVRLDREEL----IKNTGSNVYIMQAEAMYNDTTIKRDKAIVIVTVTDLNDNAPVF 1159          

HSP 8 Score: 59.6918 bits (143), Expect = 7.741e-9
Identity = 87/363 (23.97%), Postives = 145/363 (39.94%), Query Frame = 3
Query:  402 TFFILIKILDQNDKAPQFSSIKRPF-FKIPENVEVGKVIDLPMAVDSDSEKYSVRRYSLSYIYHLDQTHDFRLHVTNDNPPRPQLIVNSKLDYEKI--NKYVFRLFAYDFDEKSIGNSCSTTIEIEIEDLNDNVPKFNQLTYNANIDENKRDDKLIKFTVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDADTHSNMIHCKLVDYNDLFYLDSPSKFNTLLNYKPFN-LKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVN 1478
            T  + + +LD ND AP F +  +P    + ENV  G  +    A D D+   +   +S+   Y    +  F +     N    ++   + +D E +   +  F+L     D+ S   S   +I +++ D NDN P F      A          ++  T  DPD   NG VT +I+      S     F +  +   L++I+ +    +P +++ T+ A+D G PS  +   V +  +     GP         S     S+ E   A + VV V      +  N         N  +YL S S        K    +KT   IDRE    SF  +  +     PS + T++ ++ I ++DVN
Sbjct: 1352 TVNVTVNVLDVNDNAPLFPT--QPVTLTVRENVNTGFPVGRCTASDRDTGTNAHIAFSM---YSQTPSKTFSV-----NSATCEITTIAAIDLETMPAGRDSFQLVVMATDQGSPKLSTRKSITVQVTDENDNSPGFVSPPAAAA----GSSLNVMTITAEDPDRNSNGKVTYSII------SGNNGYFNLHPSTGQLQMIHQI--PDNPTIYQLTIQASDGGQPSRQTQTVVSVFKEGPIGGGPTFS------SADYQGSVTENKVAGTSVVTVLAAYPQSSLNG--------NIEYYLTSDSSKGGFEVVKSTGVVKTTRGIDREGMGASFNLVVYAVDKQGPSAR-TSSATVTITVQDVN 1677          

HSP 9 Score: 54.6842 bits (130), Expect = 2.599e-7
Identity = 49/174 (28.16%), Postives = 83/174 (47.70%), Query Frame = 3
Query: 1671 SGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRY---TGD---LRTRKPLDRETLESISIKVTAKNPNKYSSHFVRNTDSEVD---VMIKVMDVNDNAPKF 2165
            +G I T   +D ET  +   ++  ++   QP++    + + V D+NDN PRF   +Y   + E++ V        A D D    N  + Y+I   GD+++ F +      TG    + T+KPLDRET +   + +TA +         R T + +    + I ++D ND+AP F
Sbjct:   48 TGVISTTARIDRETTTQISLQLRTLNPSNQPIS----VQVQVDDINDNEPRFPTLYYTLRIRESMDVNTTNPINTATDPDAG-NNGTVDYTIA-SGDNTATFSLGTTACPTGSTLCVITKKPLDRETTDFYQLNITATD---------RGTPALMGYCLINITILDENDHAPVF 206          
BLAST of Protocadherin Fat 1 vs. Ensembl Medaka
Match: pcdh1b (protocadherin-1 [Source:NCBI gene;Acc:101174755])

HSP 1 Score: 207.608 bits (527), Expect = 4.217e-54
Identity = 193/634 (30.44%), Postives = 295/634 (46.53%), Query Frame = 3
Query:  414 LIKILDQNDKAPQFSSIKRPFF--KIPENVEVGKVIDLPMAVDSDSEKYSVRRYSLSYIYHLDQTHDFRLHVTNDNPPR-PQLIVNSKLDYEKINKYVFRLFAYDFDEKSIGNSCSTTIEIEIEDLNDNVPKFNQLTYNANIDENKR-DDKLIKFTVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNS--VSIIEGLPAHSLVVEVRVTDADTHSNMIHCKLVDYNDLFYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPIIVTDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLRTRKPLDRETLESISIK---VTAKNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAP-----------KFIPRLNMKQKVEFIVEQFVDGNTCTELPYTV 2255
            +I++LD ND  PQFSS   P     IPEN   G +  +P+AVD DS    V  Y+LS     +Q   F L V  D   + PQ+IV   LD EK + Y   +   D  +     + S  + I + D NDN PKF +  Y A + EN      +++   +D D+G NG +  ++   +D + +   +  I R+   + +   +D E D +L +F ++A D+G  S SS AQV I +K+ NDN P I+ + +G  +  +   +I E +P  + V  V+V+D D   N +   +V  +  F L   S+       K F L+T   +D E       RI I   DS      +TN SL +Q+ D+NDN P FS  +   N  E+           ++ TD DSG+N +  + + +    S +S F I+  +G+I  +  LD E   ++ F + A DKG    T ++ + INV D NDN P+F  S Y F+V EN+     +G +   D D   +N  +   +EP    +  F I   TG + +    DRE   + + +   V A +P +          S V V I V+D NDNAP              P       VE +  + +D     EL YT+
Sbjct:  138 IIEVLDINDNTPQFSS---PILTLSIPENTHTGTLFSIPVAVDRDSGSNGVAEYALSAGPDANQL--FGLQVAEDVDEKIPQVIVIGNLDREKKDSYDLNIRVVDGGKPP--RASSALLRITVTDQNDNAPKFEKNQYEAELPENSPPGHSVLQVRANDADTGANGDIDYSLHQASDTVQR---LLRIDRSTGIIYVKGLVDREED-NLLKFYVVARDRGPNSKSSKAQVTISIKDQNDNAPAIEIRGIGLVIHQNFVANISEDMPIGTPVALVQVSDRDEGENAVVTCVVAGDVPFQLRPASESANDRKRKYF-LQTTTLLDYERIKD--YRIEIVAVDSGNPALSSTN-SLKVQVTDINDNTPSFSPALLEVNFAEDNQPGDKVID--VVATDADSGVNAELVYSIIES---SAASLFEINSNTGEIRVRNQLDREDVERYEFGVAAADKGVPSKTGTAIVVINVEDRNDNDPKFMLSGYSFSVNENMPPLNPVGVVTVSDADKG-ENSQVTLFVEPD---NGKFIIQNGTGTILSSISFDREKESTYTFRLKAVDAGDPPR---------SSYVGVTINVLDENDNAPYVTKPANSSYTHLKPSSPPDTPVEVVKAEDIDAGVNAELYYTI 738          

HSP 2 Score: 118.242 bits (295), Expect = 2.547e-26
Identity = 152/591 (25.72%), Postives = 254/591 (42.98%), Query Frame = 3
Query:  387 PTDPGTFFILIKILDQNDKAPQFSSIKRPFFKIPENVEVGKVIDLPMAVDSDSEKYSVRRYSLSYIYHLDQTHDFRLHVTNDNPPRPQLIVNSKLDYEKINKYVFRLFAYDFDEKSIGNSCSTTIEIEIEDLNDNVPKFN----QLTYNANIDENKRDDKLIK-----FTVSDPDSGRNGIVTVNIV-DKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDADTHSNMIHCKLVDYNDLFYLDSPSKFNTL--LNYKPFNLKTINKIDRESNHGSFLRITISCTDSE-PSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPII-VTDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAP---RFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLRTRKPL--DRETLESISIKVTAKN-PNKYSSHFVR 2099
            P    +  + I + DQND AP+F   +    ++PEN   G  +    A D+D+       YSL       Q  D    +   +     + V   +D E+ N   F + A D    S   S    + I I+D NDN P        L  + N   N  +D  I        VSD D G N +VT  +  D   +L    +    ++ ++FL+    LDYE     +   ++A D G P+LSS+  +K+ + ++NDN P      L       V+  E       V++V  TDAD+  N          +L Y    S   +L  +N     ++  N++DRE          ++  D   PS+  T    + I +ED NDN P F   +  G       N+    P  ++ V+D D G N +   ++E      D+  F+I   +G I +  S D E ++ + F++ A+D G  P +S   +TINVLD NDNAP   + + S Y  ++  +      +  ++A D D    N +++Y+I   G+    F I   +G+++  +      + L  + ++V+ K  P ++++  V 
Sbjct:  241 PPRASSALLRITVTDQNDNAPKFEKNQYE-AELPENSPPGHSVLQVRANDADTGANGDIDYSLH------QASDTVQRLLRIDRSTGIIYVKGLVDREEDNLLKFYVVARDRGPNS--KSSKAQVTISIKDQNDNAPAIEIRGIGLVIHQNFVANISEDMPIGTPVALVQVSDRDEGENAVVTCVVAGDVPFQLRPASESANDRKRKYFLQTTTLLDYERIKD-YRIEIVAVDSGNPALSSTNSLKVQVTDINDNTPSFSPALL------EVNFAEDNQPGDKVIDVVATDADSGVNA---------ELVYSIIESSAASLFEINSNTGEIRVRNQLDREDVE--RYEFGVAAADKGVPSK--TGTAIVVINVEDRNDNDPKF---MLSGYSFSVNENMPPLNPVGVVTVSDADKGENSQVTLFVE-----PDNGKFIIQNGTGTILSSISFDREKESTYTFRLKAVDAGDPPRSSYVGVTINVLDENDNAPYVTKPANSSYT-HLKPSSPPDTPVEVVKAEDIDAG-VNAELYYTIT-GGNPHGLFQISHNSGEIKLAQGFTGKHKGLHRLVVRVSDKGKPPRHTTALVH 791          
BLAST of Protocadherin Fat 1 vs. Ensembl Medaka
Match: pcdh1b (protocadherin-1 [Source:NCBI gene;Acc:101174755])

HSP 1 Score: 206.838 bits (525), Expect = 4.561e-54
Identity = 193/634 (30.44%), Postives = 294/634 (46.37%), Query Frame = 3
Query:  414 LIKILDQNDKAPQFSSIKRPFF--KIPENVEVGKVIDLPMAVDSDSEKYSVRRYSLSYIYHLDQTHDFRLHVTNDNPPR-PQLIVNSKLDYEKINKYVFRLFAYDFDEKSIGNSCSTTIEIEIEDLNDNVPKFNQLTYNANIDENKR-DDKLIKFTVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNS--VSIIEGLPAHSLVVEVRVTDADTHSNMIHCKLVDYNDLFYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPIIVTDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLRTRKPLDRETLESISIK---VTAKNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAPKFIPRLNMK-----------QKVEFIVEQFVDGNTCTELPYTV 2255
            +I++LD ND  PQFSS   P     IPEN   G +  +P+AVD DS    V  Y+LS     D    F L V  D   + PQ+IV   LD EK + Y   +   D  +     + S  + I + D NDN PKF +  Y A + EN      +++   +D D+G NG +  ++   +D + +   +  I R+   + +   +D E D +L +F ++A D+G  S SS AQV I +K+ NDN P I+ + +G  +  +   +I E +P  + V  V+V+D D   N +   +V  +  F L   S+       K F L+T   +D E       RI I   DS      +TN SL +Q+ D+NDN P FS  +   N  E+           ++ TD DSG+N +  + + +    S +S F I+  +G+I  +  LD E   ++ F + A DKG    T ++ + INV D NDN P+F  S Y F+V EN+     +G +   D D   +N  +   +EP    +  F I   TG + +    DRE   + + +   V A +P +          S V V I V+D NDNAP      N               VE +  + +D     EL YT+
Sbjct:  138 IIEVLDINDNTPQFSS---PILTLSIPENTHTGTLFSIPVAVDRDSGSNGVAEYALSA--GPDANQLFGLQVAEDVDEKIPQVIVIGNLDREKKDSYDLNIRVVDGGKPP--RASSALLRITVTDQNDNAPKFEKNQYEAELPENSPPGHSVLQVRANDADTGANGDIDYSLHQASDTVQR---LLRIDRSTGIIYVKGLVDREED-NLLKFYVVARDRGPNSKSSKAQVTISIKDQNDNAPAIEIRGIGLVIHQNFVANISEDMPIGTPVALVQVSDRDEGENAVVTCVVAGDVPFQLRPASESANDRKRKYF-LQTTTLLDYERIKD--YRIEIVAVDSGNPALSSTN-SLKVQVTDINDNTPSFSPALLEVNFAEDNQPGDKVID--VVATDADSGVNAELVYSIIES---SAASLFEINSNTGEIRVRNQLDREDVERYEFGVAAADKGVPSKTGTAIVVINVEDRNDNDPKFMLSGYSFSVNENMPPLNPVGVVTVSDADKG-ENSQVTLFVEPD---NGKFIIQNGTGTILSSISFDREKESTYTFRLKAVDAGDPPR---------SSYVGVTINVLDENDNAPYVTKPANSSYTHLKPSSPPDTPVEVVKAEDIDAGVNAELYYTI 738          

HSP 2 Score: 117.857 bits (294), Expect = 2.665e-26
Identity = 152/591 (25.72%), Postives = 254/591 (42.98%), Query Frame = 3
Query:  387 PTDPGTFFILIKILDQNDKAPQFSSIKRPFFKIPENVEVGKVIDLPMAVDSDSEKYSVRRYSLSYIYHLDQTHDFRLHVTNDNPPRPQLIVNSKLDYEKINKYVFRLFAYDFDEKSIGNSCSTTIEIEIEDLNDNVPKFN----QLTYNANIDENKRDDKLIK-----FTVSDPDSGRNGIVTVNIV-DKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDADTHSNMIHCKLVDYNDLFYLDSPSKFNTL--LNYKPFNLKTINKIDRESNHGSFLRITISCTDSE-PSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPII-VTDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSE---SHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLRTRKPL--DRETLESISIKVTAKN-PNKYSSHFVR 2099
            P    +  + I + DQND AP+F   +    ++PEN   G  +    A D+D+       YSL       Q  D    +   +     + V   +D E+ N   F + A D    S   S    + I I+D NDN P        L  + N   N  +D  I        VSD D G N +VT  +  D   +L    +    ++ ++FL+    LDYE     +   ++A D G P+LSS+  +K+ + ++NDN P      L       V+  E       V++V  TDAD+  N          +L Y    S   +L  +N     ++  N++DRE          ++  D   PS+  T    + I +ED NDN P F   +  G       N+    P  ++ V+D D G N +   ++E      D+  F+I   +G I +  S D E ++ + F++ A+D G  P +S   +TINVLD NDNAP  ++   S Y  ++  +      +  ++A D D    N +++Y+I   G+    F I   +G+++  +      + L  + ++V+ K  P ++++  V 
Sbjct:  241 PPRASSALLRITVTDQNDNAPKFEKNQYE-AELPENSPPGHSVLQVRANDADTGANGDIDYSLH------QASDTVQRLLRIDRSTGIIYVKGLVDREEDNLLKFYVVARDRGPNS--KSSKAQVTISIKDQNDNAPAIEIRGIGLVIHQNFVANISEDMPIGTPVALVQVSDRDEGENAVVTCVVAGDVPFQLRPASESANDRKRKYFLQTTTLLDYERIKD-YRIEIVAVDSGNPALSSTNSLKVQVTDINDNTPSFSPALL------EVNFAEDNQPGDKVIDVVATDADSGVNA---------ELVYSIIESSAASLFEINSNTGEIRVRNQLDREDVE--RYEFGVAAADKGVPSK--TGTAIVVINVEDRNDNDPKF---MLSGYSFSVNENMPPLNPVGVVTVSDADKGENSQVTLFVE-----PDNGKFIIQNGTGTILSSISFDREKESTYTFRLKAVDAGDPPRSSYVGVTINVLDENDNAPYVTKPANSSYT-HLKPSSPPDTPVEVVKAEDIDAG-VNAELYYTIT-GGNPHGLFQISHNSGEIKLAQGFTGKHKGLHRLVVRVSDKGKPPRHTTALVH 791          
BLAST of Protocadherin Fat 1 vs. Ensembl Medaka
Match: ENSORLT00000005325.2 (protocadherin-16 [Source:NCBI gene;Acc:101171352])

HSP 1 Score: 202.986 bits (515), Expect = 3.159e-52
Identity = 199/679 (29.31%), Postives = 307/679 (45.21%), Query Frame = 3
Query:  402 TFFILIKILDQNDKAPQFSSIKRPFFKIPENVEVGKVIDLPMAVDSDSEKYSVRRYSLSYIYHLDQTHDFRLHV--TNDNPPRPQLIVNSKLDYEKINKYVFRLFAYDFDEKSIGNSCSTTIEIEIEDLNDNVPKFNQLTYNANIDEN-KRDDKLIKFTVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDAD--THSNMIHCKLVDYNDLFYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPIIVTDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPK--GDHSSYFDIDRYTGDLRTRKPLDR-ETLESISIKVTAKNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAPKFIPRLNMKQKVEFIVEQFVDGNTCTELPYTVQDIDDGGINGQNCCYTILENDYNKLFSLMTDTPSYICLQRKPEKYQSYTVTLI 2414
            T  + I + D ND AP+F   K+   KIPE+  VG    L  A D+D ++ + + Y+   I   +  H F+L    + +      L+V+  LD EK + Y   + A  FD  S       T+E+ + D+ND+ P FNQ  Y+A I E+  +   +++   +D D G NG+V   I ++     +R+ + +++     + L   LDYE    + E  + A D  +    ++A V IH+++ NDN P +    L  S   S  I EG      V  + VTD D   ++N ++  L   +  F L +      L+            +DRE      LR+  + + + P R      S  IQ+ DVNDN P+F QQ Y       +V    +F   +   D+D G NG   + L   + +     F ID I+G I T  +LD+E++      +IA D G  PL+S++ + I V D+NDNAP FS + Y  +V EN   G     + A D+D       I Y++  K  G   + F I++ TG L T   LDR E LE   + VTA +    S        S V V +KVMD+NDN P F P L       + V         T +     +  D G NG+   Y  +    +  F+L  DT   I L R      +  ++++
Sbjct:  109 TIEVSITVNDINDHAPEFPK-KKALLKIPEHTVVGTRFSLDPATDADKDQLTTQGYA---IKEGNVGHMFKLESKRSANKVLYLDLVVSGLLDREKRSSYSLVIEA--FDGGSPRRVGFMTLEVTVTDINDHAPVFNQSRYHAIISESLPQGSSILQVFAADEDEGDNGLVLYEI-NRRQSDPERYFVIDLKSG--VITLNRPLDYELK-RVHELVVQARDNASQPEVTNAFVTIHVRDFNDNQPTMTIIFL--SEDGSPRISEGAQPGQYVARISVTDPDYGEYAN-VNVSLEGGDGKFALTTKDSIIYLIYVD-------QVLDREERDSYDLRVMATDSGTPPLR---AESSFTIQVTDVNDNPPLFDQQAY--RQTIPEVVYPGSFVLQVTARDKDQGPNGDVRYSLLKGKKW-----FSIDPITGIITTATALDFESEPAPSVTVIATDGGRPPLSSTAKVDIVVQDVNDNAPVFSSNFYNVSVKENTPAGTCFLEVSATDEDRGSFGT-ITYALTLKSGGTVQTPFTINKQTGQLCTASALDRDEGLEKYDLTVTATDGGGLS--------SAVGVRVKVMDINDNRPTFYPVL-------YTVSLSTHSAPGTSVVKVTANDPDAGENGR-ITYRTVPGGSSPFFTLNKDT-GVISLSRSLHSKANTVISMV 739          

HSP 2 Score: 177.563 bits (449), Expect = 2.431e-44
Identity = 174/592 (29.39%), Postives = 283/592 (47.80%), Query Frame = 3
Query:  417 IKILDQNDKAPQFSSIKRPF-FKIPENVEVGKVIDLPMAVDSD-SEKYSVRRYSLSYIYHLDQTHDFRLHVTNDNPPRPQLIVNSKLDYEKINKYVFRLF-----AYDFDEKSIGNSCSTTIEIEIEDLNDNVPKFNQLTYNANIDENKRDDKLIKFTVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDADTHSNMIHCKLVDYNDLFYLDSPSKFNTLLNYKPFNLKTINKIDRE-SNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPIIVTDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLRTRKPLDRETLESISIKVTAKNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAPKFI 2168
            I + D ND APQFS  + P    IPEN E G  I    A D D S   S  RYS+ + +   QT D        +P    L +  +LD E    +++ +      A D  ++  G   S T  + ++D NDN P F+  +  + +++      ++     D D G NG V+  I  ++   + RF +     N   L ++ +LD E +  +F  T++A D G P LS+S  + + + ++ND  P  +  + G        ++E     + V++V  TD D  SN      + Y  +      ++   ++N     + T  ++D E  NH     +T+   D            + ++++DVNDNAP+F++  Y   V ENQ  V + F K    TD DSG  G+ E+ +          DF +   +G + T   LD E K K+  +++A+D+G   L++++T+ + VLD+NDN+P FS++ Y   V EN   G+++  + A D D +  N  I Y +  + D +  F +D  TG + T  PLDRE L S + +V A +    S     N+ ++V V I  +DVNDNAP FI
Sbjct: 1406 INVQDSNDHAPQFS--EDPVTIVIPENKEPGASIYAFQAGDQDGSGPNSELRYSIEHQW--PQTSDLLAL----DPLSGVLTIRQQLDRES-TPFLYLVVRATDQAVDLSQRRWG---SVTARLFVKDENDNPPVFSSPSAISVMEDQPVGFVILHVMAHDADEGENGRVSYRI--QSGNNAGRFSL---SPNTGSLSILKALDRE-EQEVFNLTIVAEDHGIPQLSTSQVLCVQVIDVNDEAPMFQQAEFG------THVMENKGPGTTVLKVTATDRDQGSN----GHITYGGV------TEDGFVINPLTGVITTTKELDAELQNH---YVLTVYARDGGLPPNFA-KAVVRVEVQDVNDNAPVFAKMWYGLEVPENQPAVELCFVK---ATDPDSGPGGELEYKIA---AGDPDGDFQLHSRTGALSTSHGLDREKKPKYTLEVVAVDRGSPALSATATVEVKVLDVNDNSPVFSKNSYTVEVLENAEEGYQVLQVSATDVD-EGLNGKILYFLSQEADGA--FAVDEDTGRITTAAPLDREKLASYNFRVFAVD---LSPSVPINSSAQVKVTI--LDVNDNAPFFI 1945          

HSP 3 Score: 159.073 bits (401), Expect = 1.078e-38
Identity = 160/598 (26.76%), Postives = 265/598 (44.31%), Query Frame = 3
Query:  408 FILIKILDQNDKAPQFSSI-----KRPFFKIPENVEVGKVIDLPMAVDSDSEKYSVRRYSLSYIYHLDQTHDFRLHVTNDNPPRPQLIVNSKLDYEKINKYVFRLFAYDFDEKSIGNSCSTTIEIEIEDLNDNVPKFNQLTYNANIDENKRDDKLI-KFTVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSN--SVSIIEGLPAHSLVVEVRVTDADTHSNMIHCKLVDYNDLFYLDSPSKFNT--LLNYKPFNLKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPIIVTDRDSGLNGKFEFYLEDFRNFSDSSD--FLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLRTRKPLDRETLESISIKVTAKNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAPKF 2165
            F+ I + D ND  P  + I       P  +I E  + G+ +      D D  +Y+    SL       +  D +  +T  +     + V+  LD E+ + Y  R+ A D     +    S TI++   D+NDN P F+Q  Y   I E       + + T  D D G NG V  +++       K  K F I      +    +LD+E++P     T++ATD G P LSS+A+V I ++++NDN P           SN  +VS+ E  PA +  +EV  TD D  S       + Y     L S     T   +N +   L T + +DR+     +  +T++ TD      +++   + +++ D+NDN P F   +Y  ++  +           +   D D+G NG+  +     R     S   F ++K +G I   RSL  +        I A+D        ++ + ++++  + ++P F ++ Y F V E+V  G  +G ++A        +K I+YSI   GD   YF +D  +G +RT  PLD ET  S+ +++ A+  +  S    R       V I + D+NDNAP F
Sbjct:  330 FVTIHVRDFNDNQPTMTIIFLSEDGSP--RISEGAQPGQYVARISVTDPDYGEYANVNVSL-------EGGDGKFALTTKDSIIYLIYVDQVLDREERDSYDLRVMATDSGTPPLRAESSFTIQVT--DVNDNPPLFDQQAYRQTIPEVVYPGSFVLQVTARDKDQGPNGDVRYSLL-------KGKKWFSIDPITGIITTATALDFESEPAP-SVTVIATDGGRPPLSSTAKVDIVVQDVNDNAPVFS--------SNFYNVSVKENTPAGTCFLEVSATDEDRGS----FGTITY--ALTLKSGGTVQTPFTINKQTGQLCTASALDRDEGLEKY-DLTVTATDGG---GLSSAVGVRVKVMDINDNRPTFYPVLYTVSLSTHSAPGTSVVK--VTANDPDAGENGRITY-----RTVPGGSSPFFTLNKDTGVISLSRSLHSKANTVISMVITAVDGDGLTAPVNARVNVSIVGGSTSSPVFEQAQYFFTVSEDVLRGTAVGVVRAATKTG--VSKGIYYSIS-SGDPDGYFTVDSTSGTIRTALPLDHETCSSLDLEIQARYGSPPSYGISR-------VHISISDINDNAPTF 873          

HSP 4 Score: 155.221 bits (391), Expect = 1.580e-37
Identity = 173/621 (27.86%), Postives = 278/621 (44.77%), Query Frame = 3
Query:  666 KLDYEKINKYVFRLFAYDFDEKSIGNSCSTTIEIEIEDLNDNVPKFNQLTYNANIDENKRDDKLI-KFTVSDPD-SGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLS----SSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDADTHSN-MIHCKLVDYNDLFYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPIIVTDRDSGLNGKFEF--YLEDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLRTRKPLDRETLESISIKVTAKNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAPKFIPRLNMKQKVEFIVEQFVDGNTCTE-LPYTVQDIDDGGINGQNCCYTILENDYNKLFSLMTDTPSYIC---LQRKPEKYQSYTVTLIARDRPPNVEGGLTSKISFPVLIIND 2489
            +LDYEK + Y   +   DF  K+  NS    +EI ++D ND+ P+F++      I ENK     I  F   D D SG N  +  +I  +  + S    +  +      L +   LD E+ P L+   + ATDQ    LS     S   ++ +K+ NDN P        FS  +++S++E  P   +++ V   DAD   N  +  ++   N+        +F+  L+    +L  +  +DRE        +TI   D     Q++T++ L +Q+ DVND APMF QQ   G              K +  TDRD G NG   +    ED         F+I+ ++G I T + LD E +N +   + A D G  P  + + + + V D+NDNAP F++  Y   V EN     ++  ++A D D+     ++ Y I   GD    F +   TG L T   LDRE     +++V A +    +        +   V +KV+DVNDN+P F        K  + VE   +     + L  +  D+D+ G+NG+   +  L  + +  F++  DT        L R  EK  SY   + A D  P+V    ++++   +L +ND
Sbjct: 1374 ELDYEKGSSYTLHVEVSDF-SKAFPNSYLVKLEINVQDSNDHAPQFSEDPVTIVIPENKEPGASIYAFQAGDQDGSGPNSELRYSIEHQWPQTSDLLALDPLSG---VLTIRQQLDRESTPFLY-LVVRATDQAV-DLSQRRWGSVTARLFVKDENDNPPV-------FSSPSAISVMEDQPVGFVILHVMAHDADEGENGRVSYRIQSGNN------AGRFS--LSPNTGSLSILKALDREEQE--VFNLTIVAED-HGIPQLSTSQVLCVQVIDVNDEAPMF-QQAEFGTHVMENKGPGTTVLK-VTATDRDQGSNGHITYGGVTED--------GFVINPLTGVITTTKELDAELQNHYVLTVYARDGGLPPNFAKAVVRVEVQDVNDNAPVFAKMWYGLEVPEN-QPAVELCFVKATDPDSG-PGGELEYKIA-AGDPDGDFQLHSRTGALSTSHGLDREKKPKYTLEVVAVDRGSPA------LSATATVEVKVLDVNDNSPVF-------SKNSYTVEVLENAEEGYQVLQVSATDVDE-GLNGKILYF--LSQEADGAFAVDEDTGRITTAAPLDR--EKLASYNFRVFAVDLSPSVPINSSAQVKVTILDVND 1939          

HSP 5 Score: 136.732 bits (343), Expect = 8.669e-32
Identity = 153/579 (26.42%), Postives = 257/579 (44.39%), Query Frame = 3
Query:  384 TPTDPGTFFILIKILDQNDKAPQFSSIKRPF-FKIPENVEVGKVIDLPMAVDSDSEKYSVRRYSLSYIYHLDQTH--DFRLHVTNDNPPRPQLIVNSKLDYEKINKYVFRLFAYDFDEKSIGNSCSTTIEIEIEDLNDNVPKFNQLTYNANIDENKR-DDKLIKFTVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHSLVV-EVRVTDADTHSNMIHCKLVDYND--LFYLDSPSKFNTLLNYKPFN-LKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPIIVTDRDSGLNGKFEFYLE--DFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAID-KGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLRTRKPLDRETLESISIKVTAKNPNKYSS 2087
            +P   G   + + I+DQND +P   +I  P   +IPEN  +G  I L    D DS        +LSY   LD T    F +H          + +   LD+E+   Y   + A D   ++  N     I I +ED+NDN P F    Y  ++ E+      +I  T +D DSG NG V   ++  T E       F I  +   L + +  +++ +       + A+D G+P+LSS   V++H+ ++NDN P     +    VS         P  +L++ E    D    +      + + N+  +F ++S  +F     ++    L     +D E+   S   +T+  +D    ++ ++  +L I I DVNDN P+FS+  Y   + E  V+        +  TD DS  N + ++ +   D  N      F ID+ +G +  QR+LD E ++     I A D +GY  L     + ++V D+NDN P F        + EN+     +  L AID DT    +  +Y +E  G     F I++ +G++R++ P D E + S +    A +   +S+
Sbjct: 2231 SPRLAGLATLTVIIIDQNDNSP---TIPLPQEIRIPENTLIGTEITLVTGNDVDSSP------ALSYSLLLDPTALGKFGIHRYTGG-----VSITGPLDFEEKTWYTVTVQATDSQHQTEAN-----ITIVVEDINDNAPLFTHDLYQISLPEHTPPGSAVITVTATDRDSGENGRVNYRVMSSTQEG------FYIDPSNGTLFINHRAEFDPERPSVNIVIEASDGGSPALSSLTTVQVHISDINDNAPVFHQSEYRAMVSEDT-----FPGSTLLIFEAFDNDLSRENCGFDFAIANGNEGNVFQIESSVRFLEGRGFQTVGTLLLAEGLDFETK--SLYNLTVVVSDRGVPQRSSSVAAL-ITIGDVNDNPPVFSRPEYTVALSEGAVSGTEIIR--LTATDPDSTPNAEVQYTISSGDEMNL-----FSIDQWTGALRLQRALDREHQSTHVVIIQATDGQGYFALVP---VIVDVKDVNDNHPYFPVETLTATIQENLPANSPVTVLHAIDHDTGVFGQLKYYMMERSGSGRDSFVIEQNSGEVRSKIPFDFEKINSFNFVAVAVDSGNHSA 2766          

HSP 6 Score: 135.961 bits (341), Expect = 1.302e-31
Identity = 116/477 (24.32%), Postives = 219/477 (45.91%), Query Frame = 3
Query:  759 IEIEIEDLNDNVPKFNQLTYNANIDE--NKRDDKLIKFTVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDADTHSNMIHCKLVDYNDLFYL---DSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPIIVTDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFS----ESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLRTRKPLDRETLESISIKVTAKNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAPK 2162
            + I I D+NDN P F   +  + +     K    + +   +D DSG NG ++ +++      S   + F I R    + LI SL Y++ P  ++  ++A D G P LSS+  + +H++  +  GP   F  L + V     + E  P ++  ++VR  + +   N      +  +  + L      + F  + +     +++   +DRE+     L +  +   S   R  T + ++ + + D NDN+P  SQ+  +       +     F + +  TDRD+GLN +  + L           F I+  +G+I T+ +LD E ++ ++  ++  D G  P +++ T  I+VLD ND+AP F+    ++  +F V E +  G  +G++ A D D + +N  ++YS+   G     F ++  TG+L+T  PL        +  +TA +      H      S   + I+V+  + + PK
Sbjct:  859 VHISISDINDNAPTFLPSSSESLLLPEVTKMGTVIYRIQATDKDSGHNGQLSFDLISAGAAGSSGQRTFGIDRGSGEVRLIGSLSYDSVPR-YDLQVIAKDGGAPQLSSTFTLVVHIQAQDAQGPN--FDTLTYRVE----LRENAPLNTRFLQVRALNREASGNGGSSSSISSSISYRLRPDGDAAGFGIMPDSGWLFVRS--SLDREAKDMYLLTVLATSRHSGTGR--TGSATVRVTVTDENDNSPRLSQE-RVFLAVRENLVAGTGFGR-VSATDRDAGLNARLTYRL-----LHADKHFQINSQTGEISTRLALDREQQSSYQLFVVVQDGGTPPRSATGTAHISVLDENDHAPTFTHVRPDTERMFEVREGLPSGTMVGSVAAKDPD-EGENGTVYYSL--SGSRVERFSLNPNTGELKTASPLRWAERAEYTFTLTAAD------HGTPGLSSTCQIRIQVISSSRSIPK 1308          

HSP 7 Score: 132.494 bits (332), Expect = 1.518e-30
Identity = 165/616 (26.79%), Postives = 258/616 (41.88%), Query Frame = 3
Query:  342 KADLCCKLIGFQYLTPTDPGTFFILIKILDQNDKAPQFSSIKRPF-FKIPENVEVGKVIDLPMAVDSDSEKYSVRRYSLSYIYHLDQTHDFRLHVTNDNPPRPQLIVNSKLDYEKINKYVFRLFAYDFDEKSIGNSCSTTIEIEIEDLNDNVPKFNQLTYNANIDENKRDDKLIKFTVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLL--ATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDADTHSNMIHCKLVDYND--LFYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPII---VTDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLRTRKPLDRETLESISIKVTAKNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAPKF 2165
            K     +++     +P    T  + +K+LD ND +P FS  K  +  ++ EN E G  +    A D D         +   +Y L Q  D    V  D     ++   + LD EK+  Y FR+FA D    S+  + S  +++ I D+NDN P F Q      +   +    L      D D G NG V           S      EIQ  E    L  +          + TL+  A DQG+P+ S+   V +++K +  NG  I+F K     +  VSI E     + V + +    D     I   L   N   LF + S +            +++ N +D E      LR+ +       +   T+  + N+ ++DVNDN P F  Q Y+  + E Q      +  PII     D D G NG+  + ++   + S S  F ID ++G I T   +D E   + +  + A D+G   L   +T+T+ ++D NDN+P       I  + EN  +G +I  +   D D+   +  + YS+         F I RYTG +    PLD E     ++ V A +    S H      +E ++ I V D+NDNAP F
Sbjct: 1802 KPKYTLEVVAVDRGSPALSATATVEVKVLDVNDNSPVFS--KNSYTVEVLENAEEGYQVLQVSATDVD------EGLNGKILYFLSQEADGAFAVDEDTG---RITTAAPLDREKLASYNFRVFAVDL-SPSVPINSSAQVKVTILDVNDNAPFFIQDPLIIEVSSRRSQRVLATMKAEDKDFGANGSVFYRFATPVKGFSINSLTGEIQATEPLGSLTQA----------QRTLIVEAMDQGSPAQSAHGVVVVYVKEVEYNG--IRFSK----NARDVSIQENASKGTAVAQAQAEYPDGTRQGISYSLFSGNKKHLFKISSSTG--------EIWVESSNGLDFEET--PRLRLVVKAE----TVSSTSFMAFNLVLQDVNDNLPRFQLQNYVAFMKEAQG-----YEMPIIQVVAEDVDQGQNGQVTYSIQ---SSSMSGLFKIDPVTGSITTTAIMDREIFTQTKLVVTATDRGSPRLAGLATLTVIIIDQNDNSPTIPLPQEI-RIPENTLIGTEITLVTGNDVDS---SPALSYSLLLDPTALGKFGIHRYTGGVSITGPLDFEEKTWYTVTVQATD----SQH-----QTEANITIVVEDINDNAPLF 2354          

HSP 8 Score: 128.257 bits (321), Expect = 3.199e-29
Identity = 169/666 (25.38%), Postives = 285/666 (42.79%), Query Frame = 3
Query:  483 IPENVEVGKVIDLPMAVDSDSEKYSVRRYSLSYIYHLDQTHDFRLHVTNDNPPRPQLIVNSK--LDYEKINKYVFRLFAYDFDEKSIGNSCSTTIEIEIEDLNDNVPKFNQLTYNANIDENKR-DDKLIKFTVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLL---ATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDADTHSNMIHCKLVDYNDLFYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPIIVTDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFTQRSLDYETKN-KFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDID-----------RYTGDLRTRKPLDRETLESISIKVTAKNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAPKFIPRLNMKQKVEFIV---EQFVDGNTCTELPYTVQDIDDGGINGQNCCYTILENDYNKLFSLMTDTPSYICLQRKPEK-YQSYTVTLI 2414
            I EN   G  +    A   D  +  +  YSL   +  ++ H F++  +       ++ V S   LD+E+  +   RL       +++ ++      + ++D+NDN+P+F    Y A + E +  +  +I+    D D G+NG VT +I  ++  +S  FKI  +  +     ++       D  +F  T L   ATD+G+P L+  A + + + + NDN P I   +        + I E     + +  V   D D+   + +  L+D   L       KF   ++     +     +D E    ++  +T+  TDS    Q  T  ++ I +ED+NDNAP+F+  +Y  ++ E+           +  TDRDSG NG+  + +      S    F ID  +G +F     +++ +       I A D G   L+S +T+ +++ D+NDNAP F +S Y   V E+   G  +   +A D+D  R+N    ++I   G+  + F I+           +  G L   + LD ET    ++ V        S   V    S V  +I + DVNDN P F        + E+ V   E  V G     L  T    D          YTI   D   LFS+   T + + LQR  ++ +QS  V +I
Sbjct: 2055 IQENASKGTAVAQAQAEYPDGTRQGIS-YSL---FSGNKKHLFKISSSTG-----EIWVESSNGLDFEETPR--LRLVV---KAETVSSTSFMAFNLVLQDVNDNLPRFQLQNYVAFMKEAQGYEMPIIQVVAEDVDQGQNGQVTYSI--QSSSMSGLFKIDPVTGSITTTAIM-------DREIFTQTKLVVTATDRGSPRLAGLATLTVIIIDQNDNSPTIPLPQ-------EIRIPENTLIGTEITLVTGNDVDSSPALSYSLLLDPTAL------GKFG--IHRYTGGVSITGPLDFEEK--TWYTVTVQATDS----QHQTEANITIVVEDINDNAPLFTHDLYQISLPEHTPPGSAVIT--VTATDRDSGENGRVNYRVMS----STQEGFYIDPSNGTLFINHRAEFDPERPSVNIVIEASDGGSPALSSLTTVQVHISDINDNAPVFHQSEYRAMVSEDTFPGSTLLIFEAFDNDLSRENCGFDFAIA-NGNEGNVFQIESSVRFLEGRGFQTVGTLLLAEGLDFETKSLYNLTVVV------SDRGVPQRSSSVAALITIGDVNDNPPVF-------SRPEYTVALSEGAVSGTEIIRLTAT----DPDSTPNAEVQYTISSGDEMNLFSIDQWTGA-LRLQRALDREHQSTHVVII 2651          

HSP 9 Score: 125.176 bits (313), Expect = 2.864e-28
Identity = 143/549 (26.05%), Postives = 243/549 (44.26%), Query Frame = 3
Query:  411 ILIKILDQNDKAPQFSSIKRPFFKI--PENVEVGKVIDLPMAVDSDSEKYSVRRYSLSYIYHLDQTHD-FRLHVTNDNPPRPQLIVNSKLDYEKINKYVFRLFAYDFDEKSIGNSCSTTIEIEIEDLNDNVPKFNQLTYNANIDENK-RDDKLIKFTVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLE-----------LINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDADTHSNMIHCKLVDYNDLFYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPIIV---TDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNA--PRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTG 1997
            I I + D ND AP F+      ++I  PE+   G  +    A D DS +     Y +     +  T + F +     +P    L +N + +++     V  +     D  S   S  TT+++ I D+NDN P F+Q  Y A + E+      L+ F   D D  R        +   +E      +F+I+ +  FLE           L   LD+ET   L+  T++ +D+G P  SSS    I + ++NDN P   F +  ++V+ S    EG  + + ++ +  TD D+  N      +   D   L S  ++   L  +         +DRE  H S   + I  TD +    +     + + ++DVNDN P F  +     + EN          P+ V    D D+G+ G+ ++Y+ + R+ S    F+I++ SG++ ++   D+E  N F F  +A+D G      S+T+T+ V    ++   P F+ + + F V E    G  IG + A D+D    +  + YS+ P    S YFD+++ TG
Sbjct: 2340 ITIVVEDINDNAPLFT---HDLYQISLPEHTPPGSAVITVTATDRDSGENGRVNYRV-----MSSTQEGFYI-----DPSNGTLFINHRAEFDPERPSV-NIVIEASDGGSPALSSLTTVQVHISDINDNAPVFHQSEYRAMVSEDTFPGSTLLIFEAFDNDLSRENCGFDFAIANGNE----GNVFQIESSVRFLEGRGFQTVGTLLLAEGLDFETK-SLYNLTVVVSDRGVPQRSSSVAALITIGDVNDNPPV--FSRPEYTVALS----EGAVSGTEIIRLTATDPDSTPNAEVQYTISSGDEMNLFSIDQWTGALRLQ-------RALDRE--HQSTHVVIIQATDGQGYFALV---PVIVDVKDVNDNHPYFPVETLTATIQENLPAN-----SPVTVLHAIDHDTGVFGQLKYYMME-RSGSGRDSFVIEQNSGEVRSKIPFDFEKINSFNFVAVAVDSGNH----SATVTVQVFVTGEDEYDPLFTSTDFAFEVPEGAKKGQSIGQVLARDEDGG-VDGIVLYSLLPS---SPYFDVNKTTG 2837          

HSP 10 Score: 108.997 bits (271), Expect = 2.408e-23
Identity = 157/648 (24.23%), Postives = 265/648 (40.90%), Query Frame = 3
Query:  636 PPRPQLIVNSKLDYEKINKYVFRLFAYDFDEKSIGNSCSTTIEIEIEDLNDNVPKFNQLTYNANIDEN-KRDDKLIKFTVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDADTHSNMIHCKLVDYNDLFYLDSPSKFNTL-LNYKPFNLKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAP---MFSQQIYI--GXXXXXXXXXXXXFPKPIIVTDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAID--KGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSS-YFDIDRYTGDLRTRKPLDRETLESISIKVTAKNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAPKFIP----RLNMKQKVEFIVEQFVDGNTCTELPYTVQDIDDGGINGQNCCYTILENDYNKLFSLMTDTPSYICLQR-KPEKYQSYTVTLIARDRP-PNVEGGLTSKI-SFPVLIINDPHSKISTSGFSNH 2528
            P    L V S LD E  + Y+  + A        G + S T+ + + D NDN P+ +Q      + EN        + + +D D+G N  +T  ++       K F+I   Q  E    L  +LD E     ++  ++  D GTP  S++    I + + ND+ P   F  +         + EGLP+ ++V  V   D D   N           ++Y  S S+     LN     LKT + + R +    +     +     P   +++   + IQ+   + + P   + S  + +  G    + +  V    KP       + L G+  + + D  +   +  F++D++ G ++  R LDYE  + +   +   D  K + P +    + INV D ND+AP+FSE      + EN   G  I   QA D D    N ++ YSIE +   +S    +D  +G L  R+ LDRE+   + + V A +    +    +     V   + V D NDN P F       +   Q V F++           L     D D+G  NG+   Y I   +    FSL  +T S   L+    E+ + + +T++A D   P +    TS++    V+ +ND       + F  H
Sbjct: 1044 PDSGWLFVRSSLDREAKDMYLLTVLATS-RHSGTGRTGSATVRVTVTDENDNSPRLSQERVFLAVRENLVAGTGFGRVSATDRDAGLNARLTYRLL----HADKHFQI-NSQTGEISTRL--ALDREQQSS-YQLFVVVQDGGTPPRSATGTAHISVLDENDHAPT--FTHVRPDTERMFEVREGLPSGTMVGSVAAKDPDEGEN---------GTVYYSLSGSRVERFSLNPNTGELKTASPL-RWAERAEYTFTLTAADHGTPG--LSSTCQIRIQVISSSRSIPKPNVLSMTLNVVEGTAPGSIIGSVGQVDKP-----ESNVLEGQVTYLVVDGTDRDGT--FMVDRLRGDVYLVRELDYEKGSSYTLHVEVSDFSKAF-PNSYLVKLEINVQDSNDHAPQFSEDPVTIVIPENKEPGASIYAFQAGDQDGSGPNSELRYSIEHQWPQTSDLLALDPLSGVLTIRQQLDRESTPFLYLVVRATD---QAVDLSQRRWGSVTARLFVKDENDNPPVFSSPSAISVMEDQPVGFVI-----------LHVMAHDADEGE-NGR-VSYRIQSGNNAGRFSLSPNTGSLSILKALDREEQEVFNLTIVAEDHGIPQLS---TSQVLCVQVIDVNDEAPMFQQAEFGTH 1641          

HSP 11 Score: 94.3597 bits (233), Expect = 6.949e-19
Identity = 145/632 (22.94%), Postives = 256/632 (40.51%), Query Frame = 3
Query:  348 DLCCKL---IGFQYLTPTDPGTFFILIKILDQNDKAPQFSSIKRPFFKIPENVEVGKVIDLPMAVDSDSEKYSVRRYSLSYIYHLDQTHDFRLHVTNDNPPRPQLIVNSKLDYEKINKYVFRLFAYDFDEKSIGNSCSTTIEIEIEDLNDNVPKFNQLTYNANIDENK-RDDKLIKFTVSDPDSGRNGIVTVNIVDKTDELSKRFKI--------FEIQRNEFFLELINSLDYETDPHLFEFTLLATDQ--GTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDADTHSNM-IHCKLVDYNDLFYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPIIVT-----DRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDD-DTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLRTRKPLDRETLESISIKVTAKN-----PNKYSSHFVRNTDSEVDVMIKVMDVNDNAPKF 2165
            + C  L   I  +Y +P   G   + I I D ND AP F         +PE  ++G VI    A D DS       + L        +   R    +      +LI    L Y+ + +Y  ++ A D     + ++ +  + I+ +D     P F+ LTY   + EN   + + ++    + ++             +   S  +++        F I  +  +L + +SLD E    ++  T+LAT +  GT   + SA V++ + + NDN P++  +++  +V       E L A +    V  TD D   N  +  +L+  +  F ++S +            + T   +DRE    S+    +      P R  T   + +I + D ND+AP F+   ++    E    V    P   +V      D D G NG   + L   R       F ++  +G++ T   L +  + ++ F + A D G   L+S+  I I V+  + + P+ +      NV E  + G  IG++  +D  +++     + Y +    D    F +DR  GD+   + LD E   S ++ V   +     PN Y           V + I V D ND+AP+F
Sbjct:  835 ETCSSLDLEIQARYGSPPSYGISRVHISISDINDNAPTFLPSSSESLLLPEVTKMGTVIYRIQATDKDSGHNGQLSFDLISAGAAGSSGQ-RTFGIDRGSGEVRLI--GSLSYDSVPRYDLQVIAKDGGAPQLSSTFTLVVHIQAQDAQG--PNFDTLTYRVELRENAPLNTRFLQVRALNREA-----SGNGGSSSSISSSISYRLRPDGDAAGFGIMPDSGWLFVRSSLDREAK-DMYLLTVLATSRHSGT-GRTGSATVRVTVTDENDNSPRLSQERVFLAVR------ENLVAGTGFGRVSATDRDAGLNARLTYRLLHADKHFQINSQTG----------EISTRLALDRE-QQSSYQLFVVVQDGGTPPRSATG--TAHISVLDENDHAPTFT---HVRPDTERMFEVREGLPSGTMVGSVAAKDPDEGENGTVYYSLSGSR----VERFSLNPNTGELKTASPLRWAERAEYTFTLTAADHGTPGLSSTCQIRIQVISSSRSIPKPNVLSMTLNVVEGTAPGSIIGSVGQVDKPESNVLEGQVTYLVVDGTDRDGTFMVDRLRGDVYLVRELDYEKGSSYTLHVEVSDFSKAFPNSYL----------VKLEINVQDSNDHAPQF 1418          
BLAST of Protocadherin Fat 1 vs. Ensembl Medaka
Match: pcdh1a (protocadherin-1 [Source:NCBI gene;Acc:101157079])

HSP 1 Score: 196.823 bits (499), Expect = 1.149e-50
Identity = 174/586 (29.69%), Postives = 271/586 (46.25%), Query Frame = 3
Query:  417 IKILDQNDKAPQFSSIKRPFFKIPENVEVGKVIDLPMAVDSDSEKYSVRRYSLSYIYHLDQTHDFRLHVTNDNPPR-PQLIVNSKLDYEKINKYVFRLFAYDFDEKSIGNSCSTTIEIEIEDLNDNVPKFNQLTYNANIDENKR-DDKLIKFTVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNS---VSIIEGLPAHSLVVEVRVTDADTHSNMIHCKLVDYNDLFYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPIIVTDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLRTRKPLDRETLESISIKVTAKNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAP 2159
            I++ D ND  PQF  +      +PEN  +G +  +P+A D DSE+  V  Y+L+     D    F L V +D   + PQLIV   LD E  + Y   + A D             + + + D NDN PKF   +Y A + EN      +++    D D G NG +  ++    D + K   +  I R    + +   LD E + +   F ++A D+G    SS   V I + + NDN P ++ + +G  V++S    +I E +P  + V  V+V+D D   N +   +V  +  F L  P+  +T  N + + L+T   +D E       R+ I   DS      +TN SL +Q+ DVNDN+P+FS  I+  +  E            +  TD DSG N   E +     +      F ID  +G++  +  LD E K ++ F++ A DKG      ++T+ I VLD NDN P+F  S Y F+V EN+     +G +  +D D   +N  +  S+EP G     F +   TG + +    DRE   S + ++ A +  +          S V V I V+D NDN P
Sbjct:  197 IEVQDINDNTPQFP-LSVLTISVPENTIMGALFSIPLATDRDSERNGVADYALTA--GPDAATLFGLQVADDRGGKLPQLIVLGNLDRELKDSYDLTIKAVDGGNPQ--RYSQALLRVVVTDANDNSPKFEHPSYEAEVSENSPVGHSVLQVKADDSDMGPNGEIEYSLHQAVDPVPK---LLRIDRTTGIIYVKGPLDRE-EINSLSFYVVARDKGPQPKSSKTFVTIEVTDQNDNAPAVEIRGIGL-VTHSEGIANISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDVPFQL-RPASDSTSDNKRKYFLQTTTPLDYE--RVKEYRVEIVAVDSGNPALSSTN-SLKVQVTDVNDNSPVFSPTIFEVDFAEENQPGETILD--VTATDADSGTNA--ELFYNIVGDSYIKGLFEIDPNTGEVKARTPLDREHKERYEFRVTAADKGSPVHKGTATVVIKVLDCNDNDPKFMLSGYSFSVLENMPPLSPVGMVTVLDMDKG-ENAHVHLSVEPDG---GKFVVQNGTGTILSSISFDREKESSYTFRLKAVDGGEPPR------SSYVGVTINVLDENDNDP 754          

HSP 2 Score: 129.028 bits (323), Expect = 1.247e-29
Identity = 138/495 (27.88%), Postives = 223/495 (45.05%), Query Frame = 3
Query:  765 IEIEDLNDNVPKFNQLTYNANIDENKRDDKLIKFTVS-DPDSGRNGIVTVNIVDKTDELSKRFKIFEIQ----RNEFFLELI--NSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDADTHSN-----MIHCKLVDYNDLFYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPII-------VTDRDSGLN--------GKFEFYLEDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLRTRKPLDRETLESISIKVTAKNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAPKFI 2168
            IE++D+NDN P+F       ++ EN     L    ++ D DS RNG+    +    D  +    +F +Q    R     +LI   +LD E     ++ T+ A D G P   S A +++ + + NDN PK +       VS      E  P    V++V+  D+D   N      +H  +     L  +D  +    +    P + + IN           L   +   D  P  + ++   + I++ D NDNAP    +  IG V  ++    ++   P+        V+D+D G N        G   F L   R  SDS+    +K    + T   LDYE   ++R +I+A+D G   L+S++++ + V D+NDN+P FS + +  +  E    G  I  + A D D+   N ++FY+I         F+ID  TG+++ R PLDRE  E    +VTA +     S   + T +   V+IKV+D NDN PKF+
Sbjct:  197 IEVQDINDNTPQFPLSVLTISVPENTIMGALFSIPLATDRDSERNGVADYALTAGPDAAT----LFGLQVADDRGGKLPQLIVLGNLDRELK-DSYDLTIKAVDGGNPQRYSQALLRVVVTDANDNSPKFEHPSYEAEVS------ENSPVGHSVLQVKADDSDMGPNGEIEYSLHQAVDPVPKLLRIDRTTGI--IYVKGPLDREEINS----------LSFYVVARDKGPQPK-SSKTFVTIEVTDQNDNAPAVEIR-GIGLVTHSEGIANISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDVPFQL---RPASDSTSD--NKRKYFLQTTTPLDYERVKEYRVEIVAVDSGNPALSSTNSLKVQVTDVNDNSPVFSPTIFEVDFAEENQPGETILDVTATDADSG-TNAELFYNIVGDSYIKGLFEIDPNTGEVKARTPLDREHKERYEFRVTAAD---KGSPVHKGTAT---VVIKVLDCNDNDPKFM 654          

HSP 3 Score: 103.605 bits (257), Expect = 8.432e-22
Identity = 145/535 (27.10%), Postives = 223/535 (41.68%), Query Frame = 3
Query: 1020 PHLFEFTLLATD---QGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDADTHSNMIHCKLVDYNDLFYLDSPSKFNTLL----NYKPFNLKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPIIVTDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRF--------SESHYIFNVFENVSVGWKIGTLQAIDDDTDRKN-------KDIFYSIEPKGDHSS-----YFDIDRYTGDLRTRKPLDRETLESISIKVTA---KNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAPKFIPRLNMKQKVEFIVEQFVDGNTCTELPYTVQDIDDGGINGQNCCYTILENDYNK-LFSLMTDTPSYICLQRKP---EKYQSYTVTLIARDRPPNVEGGLTSKISFPVLIINDPHSKISTSGFS 2522
            P   EF +  TD     +P L    + +I ++++NDN P+     L  SV  + +I+  L +  L      TD D+  N +     DY      D+ + F   +      K   L  +  +DRE        +TI   D   + Q  +   L + + D NDN+P F    Y   V EN           +   D D G NG+ E+ L    +        ID+ +G I+ +  LD E  N   F ++A DKG QP +S + +TI V D NDNAP          + S  I N+ E++ VG  +  +Q  D D             D+ + + P  D +S     YF        L+T  PLD E ++   +++ A    NP   S++ ++         ++V DVNDN+P F P +    +V+F  E+   G T  ++  T  D D G        Y I+ + Y K LF +  +T       R P   E  + Y   + A D+   V  G T+ +   VL  ND   K   SG+S
Sbjct:  172 PCYLEFEVSVTDLLQNPSPRL---IEGRIEVQDINDNTPQFPLSVLTISVPEN-TIMGALFSIPLA-----TDRDSERNGV----ADYALTAGPDAATLFGLQVADDRGGKLPQLIVLGNLDRELKDS--YDLTIKAVDGG-NPQRYSQALLRVVVTDANDNSPKFEHPSYEAEVSENSPVGHSVLQ--VKADDSDMGPNGEIEYSLHQAVDPVPKL-LRIDRTTGIIYVKGPLDREEINSLSFYVVARDKGPQPKSSKTFVTIEVTDQNDNAPAVEIRGIGLVTHSEGIANISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDVPFQLRPASDSTSDNKRKYF--------LQTTTPLDYERVKEYRVEIVAVDSGNPALSSTNSLK---------VQVTDVNDNSPVFSPTIF---EVDF-AEENQPGETILDV--TATDADSG--TNAELFYNIVGDSYIKGLFEIDPNTGEVKA--RTPLDREHKERYEFRVTAADKGSPVHKG-TATVVIKVLDCNDNDPKFMLSGYS 659          

HSP 4 Score: 56.225 bits (134), Expect = 2.568e-7
Identity = 86/349 (24.64%), Postives = 146/349 (41.83%), Query Frame = 3
Query:  417 IKILDQNDKAPQFSSIKRPFFKI--PENVEVGKVIDLPMAVDSDSEKYSVRRYSL---SYIYHLDQTHDFRLHVTNDNPPRPQLIVNSKLDYEKINKYVFRLFAYDFDEKSIGNSCSTTIEIEIEDLNDNVPKFNQLTYNANIDENKRDDKLIKF-TVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDADTHSNMIHCKLVDYNDLFYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTD-SEPSRQITT 1442
            +++ D ND +P FS      F++   E  + G+ I    A D+DS   +   Y++   SYI  L     F +     +P   ++   + LD E   +Y FR+ A D  + S  +  + T+ I++ D NDN PKF    Y+ ++ EN      +   TV D D G N  V +++     +       F +Q     +    S D E +   + F L A D G P  SS   V I++ + NDN P +   K   S    +S +    +H  VVE    D+  +++++          F +   + +  L    P + +     +    HG   R+ +  +D  +P R  T 
Sbjct:  535 VQVTDVNDNSPVFSPT---IFEVDFAEENQPGETILDVTATDADSGTNAELFYNIVGDSYIKGL-----FEI-----DPNTGEVKARTPLDREHKERYEFRVTAAD--KGSPVHKGTATVVIKVLDCNDNDPKFMLSGYSFSVLENMPPLSPVGMVTVLDMDKGENAHVHLSVEPDGGK-------FVVQNGTGTILSSISFDREKESS-YTFRLKAVDGGEPPRSSYVGVTINVLDENDNDPVV--TKPSNSSFRQLSPVASPDSHVDVVEAEDLDSGPNADLV----------FSIAGGNPYQ-LFRISPSSGEITLAKEMTRKHGGLHRLVVRVSDRGKPPRHATA 847          
BLAST of Protocadherin Fat 1 vs. Ensembl Medaka
Match: pcdh1a (protocadherin-1 [Source:NCBI gene;Acc:101157079])

HSP 1 Score: 195.282 bits (495), Expect = 1.971e-50
Identity = 176/589 (29.88%), Postives = 273/589 (46.35%), Query Frame = 3
Query:  417 IKILDQNDKAPQFSSIKRPFFKIPENVEVGKVIDLPMAVDSDSEKYSVRRYSLSYIYHLDQTHDFRLHVTNDNPPR-PQLIVNSKLDYEKINKYVFRLFAYDFDEKSIGNS---CSTTIEIEIEDLNDNVPKFNQLTYNANIDENKR-DDKLIKFTVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNS---VSIIEGLPAHSLVVEVRVTDADTHSNMIHCKLVDYNDLFYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPIIVTDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLRTRKPLDRETLESISIKVTAKNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAP 2159
            I++ D ND  PQF  +      +PEN  +G +  +P+A D DSE+  V  Y+L+     D    F L V +D   + PQLIV   LD E  + Y   + A D      GN        + + + D NDN PKF   +Y A + EN      +++    D D G NG +  ++    D + K   +  I R    + +   LD E + +   F ++A D+G    SS   V I + + NDN P ++ + +G  V++S    +I E +P  + V  V+V+D D   N +   +V  +  F L  P+  +T  N + + L+T   +D E       R+ I   DS      +TN SL +Q+ DVNDN+P+FS  I+  +  E            +  TD DSG N   E +     +      F ID  +G++  +  LD E K ++ F++ A DKG      ++T+ I VLD NDN P+F  S Y F+V EN+     +G +  +D D   +N  +  S+EP G     F +   TG + +    DRE   S + ++ A +  +          S V V I V+D NDN P
Sbjct:  120 IEVQDINDNTPQFP-LSVLTISVPENTIMGALFSIPLATDRDSERNGVADYALTA--GPDAATLFGLQVADDRGGKLPQLIVLGNLDRELKDSYDLTIKAVDG-----GNPQRYSQALLRVVVTDANDNSPKFEHPSYEAEVSENSPVGHSVLQVKADDSDMGPNGEIEYSLHQAVDPVPK---LLRIDRTTGIIYVKGPLDRE-EINSLSFYVVARDKGPQPKSSKTFVTIEVTDQNDNAPAVEIRGIGL-VTHSEGIANISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDVPFQL-RPASDSTSDNKRKYFLQTTTPLDYE--RVKEYRVEIVAVDSGNPALSSTN-SLKVQVTDVNDNSPVFSPTIFEVDFAEENQPGETILD--VTATDADSGTNA--ELFYNIVGDSYIKGLFEIDPNTGEVKARTPLDREHKERYEFRVTAADKGSPVHKGTATVVIKVLDCNDNDPKFMLSGYSFSVLENMPPLSPVGMVTVLDMDKG-ENAHVHLSVEPDG---GKFVVQNGTGTILSSISFDREKESSYTFRLKAVDGGEPPR------SSYVGVTINVLDENDNDP 677          

HSP 2 Score: 127.102 bits (318), Expect = 3.207e-29
Identity = 138/495 (27.88%), Postives = 223/495 (45.05%), Query Frame = 3
Query:  765 IEIEDLNDNVPKFNQLTYNANIDENKRDDKLIKFTVS-DPDSGRNGIVTVNIVDKTDELSKRFKIFEIQ----RNEFFLELI--NSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDADTHSN-----MIHCKLVDYNDLFYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPII-------VTDRDSGLN--------GKFEFYLEDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLRTRKPLDRETLESISIKVTAKNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAPKFI 2168
            IE++D+NDN P+F       ++ EN     L    ++ D DS RNG+    +    D  +    +F +Q    R     +LI   +LD E     ++ T+ A D G P   S A +++ + + NDN PK +       VS      E  P    V++V+  D+D   N      +H  +     L  +D  +    +    P + + IN           L   +   D  P  + ++   + I++ D NDNAP    +  IG V  ++    ++   P+        V+D+D G N        G   F L   R  SDS+    +K    + T   LDYE   ++R +I+A+D G   L+S++++ + V D+NDN+P FS + +  +  E    G  I  + A D D+   N ++FY+I         F+ID  TG+++ R PLDRE  E    +VTA +     S   + T +   V+IKV+D NDN PKF+
Sbjct:  120 IEVQDINDNTPQFPLSVLTISVPENTIMGALFSIPLATDRDSERNGVADYALTAGPDAAT----LFGLQVADDRGGKLPQLIVLGNLDRELKDS-YDLTIKAVDGGNPQRYSQALLRVVVTDANDNSPKFEHPSYEAEVS------ENSPVGHSVLQVKADDSDMGPNGEIEYSLHQAVDPVPKLLRIDRTTGI--IYVKGPLDREEINS----------LSFYVVARDKGPQPK-SSKTFVTIEVTDQNDNAPAVEIR-GIGLVTHSEGIANISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDVPFQL---RPASDSTSD--NKRKYFLQTTTPLDYERVKEYRVEIVAVDSGNPALSSTNSLKVQVTDVNDNSPVFSPTIFEVDFAEENQPGETILDVTATDADSG-TNAELFYNIVGDSYIKGLFEIDPNTGEVKARTPLDREHKERYEFRVTAAD---KGSPVHKGTAT---VVIKVLDCNDNDPKFM 577          

HSP 3 Score: 103.219 bits (256), Expect = 8.235e-22
Identity = 147/537 (27.37%), Postives = 224/537 (41.71%), Query Frame = 3
Query: 1020 PHLFEFTLLATD---QGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDADTHSNMIHCKLVDYNDLFYLDSPSKFNTLL----NYKPFNLKTINKIDRESNHGSFLRITISCTDS-EPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPIIVTDRDSGLNGKFEFYLEDFRNFSDSSDFL-IDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRF--------SESHYIFNVFENVSVGWKIGTLQAIDDDTDRKN-------KDIFYSIEPKGDHSS-----YFDIDRYTGDLRTRKPLDRETLESISIKVTA---KNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAPKFIPRLNMKQKVEFIVEQFVDGNTCTELPYTVQDIDDGGINGQNCCYTILENDYNK-LFSLMTDTPSYICLQRKP---EKYQSYTVTLIARDRPPNVEGGLTSKISFPVLIINDPHSKISTSGFS 2522
            P   EF +  TD     +P L    + +I ++++NDN P+     L  SV  + +I+  L +  L      TD D+  N +     DY      D+ + F   +      K   L  +  +DRE        +TI   D   P R   +   L + + D NDN+P F    Y   V EN           +   D D G NG+ E+ L   +        L ID+ +G I+ +  LD E  N   F ++A DKG QP +S + +TI V D NDNAP          + S  I N+ E++ VG  +  +Q  D D             D+ + + P  D +S     YF        L+T  PLD E ++   +++ A    NP   S++ ++         ++V DVNDN+P F P +    +V+F  E+   G T  ++  T  D D G        Y I+ + Y K LF +  +T       R P   E  + Y   + A D+   V  G T+ +   VL  ND   K   SG+S
Sbjct:   95 PCYLEFEVSVTDLLQNPSPRL---IEGRIEVQDINDNTPQFPLSVLTISVPEN-TIMGALFSIPLA-----TDRDSERNGV----ADYALTAGPDAATLFGLQVADDRGGKLPQLIVLGNLDRELKDS--YDLTIKAVDGGNPQRY--SQALLRVVVTDANDNSPKFEHPSYEAEVSENSPVGHSVLQ--VKADDSDMGPNGEIEYSLH--QAVDPVPKLLRIDRTTGIIYVKGPLDREEINSLSFYVVARDKGPQPKSSKTFVTIEVTDQNDNAPAVEIRGIGLVTHSEGIANISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDVPFQLRPASDSTSDNKRKYF--------LQTTTPLDYERVKEYRVEIVAVDSGNPALSSTNSLK---------VQVTDVNDNSPVFSPTIF---EVDF-AEENQPGETILDV--TATDADSG--TNAELFYNIVGDSYIKGLFEIDPNTGEVKA--RTPLDREHKERYEFRVTAADKGSPVHKG-TATVVIKVLDCNDNDPKFMLSGYS 582          

HSP 4 Score: 54.6842 bits (130), Expect = 6.254e-7
Identity = 86/349 (24.64%), Postives = 146/349 (41.83%), Query Frame = 3
Query:  417 IKILDQNDKAPQFSSIKRPFFKI--PENVEVGKVIDLPMAVDSDSEKYSVRRYSL---SYIYHLDQTHDFRLHVTNDNPPRPQLIVNSKLDYEKINKYVFRLFAYDFDEKSIGNSCSTTIEIEIEDLNDNVPKFNQLTYNANIDENKRDDKLIKF-TVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDADTHSNMIHCKLVDYNDLFYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTD-SEPSRQITT 1442
            +++ D ND +P FS      F++   E  + G+ I    A D+DS   +   Y++   SYI  L     F +     +P   ++   + LD E   +Y FR+ A D  + S  +  + T+ I++ D NDN PKF    Y+ ++ EN      +   TV D D G N  V +++     +       F +Q     +    S D E +   + F L A D G P  SS   V I++ + NDN P +   K   S    +S +    +H  VVE    D+  +++++          F +   + +  L    P + +     +    HG   R+ +  +D  +P R  T 
Sbjct:  458 VQVTDVNDNSPVFSPT---IFEVDFAEENQPGETILDVTATDADSGTNAELFYNIVGDSYIKGL-----FEI-----DPNTGEVKARTPLDREHKERYEFRVTAAD--KGSPVHKGTATVVIKVLDCNDNDPKFMLSGYSFSVLENMPPLSPVGMVTVLDMDKGENAHVHLSVEPDGGK-------FVVQNGTGTILSSISFDREKESS-YTFRLKAVDGGEPPRSSYVGVTINVLDENDNDPVV--TKPSNSSFRQLSPVASPDSHVDVVEAEDLDSGPNADLV----------FSIAGGNPYQ-LFRISPSSGEITLAKEMTRKHGGLHRLVVRVSDRGKPPRHATA 770          
BLAST of Protocadherin Fat 1 vs. Planmine SMEST
Match: SMESG000048159.1 (SMESG000048159.1)

HSP 1 Score: 2085.84 bits (5403), Expect = 0.000e+0
Identity = 1096/1099 (99.73%), Postives = 1098/1099 (99.91%), Query Frame = 3
Query:   33 MSCLYXXXXXXXXXXXXXSEVLKTITITENDMSIQVLANLTEILASKTNLPHSFLSKVEIVSLLENDLPPFKLQLNQLIQPNNGVNREAVCRDNPGEKVRKFCKADLCCKLIGFQYLTPTDPGTFFILIKILDQNDKAPQFSSIKRPFFKIPENVEVGKVIDLPMAVDSDSEKYSVRRYSLSYIYHLDQTHDFRLHVTNDNPPRPQLIVNSKLDYEKINKYVFRLFAYDFDEKSIGNSCSTTIEIEIEDLNDNVPKFNQLTYNANIDENKRDDKLIKFTVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDADTHSNMIHCKLVDYNDLFYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPIIVTDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLRTRKPLDRETLESISIKVTAKNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAPKFIPRLNMKQKVEFIVEQFVDGNTCTELPYTVQDIDDGGINGQNCCYTILENDYNKLFSLMTDTPSYICLQRKPEKYQSYTVTLIARDRPPNVEGGLTSKISFPVLIINDPHSKISTSGFSNHPDSRFPNPSESKNXXXXXXXXXXXXXXXXXXXXXXXXXKRCSIPEQESDSTKCYQGINLSMNRNEGTKVNYLVSEPGLSPGKATISRSNLTNPQYADSINKTLTRNIPSNVSSPFTPPAYHQIIANQGVRIIPNPSRFHDQYTYEWSPVPEYRDRSIGRNPSNVEKIRSMSPTKSGLSFHTSSKMLNEDQFDSGYQILNPFGLSTSPQQQFNNYSPENLIPCENEISPVDTRSLTLLXXXXXXXXXXXXSKTTPRTMKKNYFQTTFV 3329
            MSCLYILLIFVLQFFQVLSEVLKTITITENDMSIQVLANLTEILASKTNLPHSFLSKVEIVSLLENDLPPFKLQLNQLIQPNNGVNREAVCRDNPGEKVRKFCKADLCCKLIGFQYLTPTDPGTFFILIKILDQNDKAPQFSSIKRPFFKIPENVEVGKVIDLPMAVDSDSEKYSVRRYSLSYIYHLDQTHDFRLHVTNDNPPRPQLIVNSKLDYEKINKYVFRLFAYDFDEKSIGNSCSTTIEIEIEDLNDNVPKFNQLTYNANIDENKRDDKLIKFTVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDADTHSNMIHCKLVDYNDLFYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGNVDENQVNVVVNFPKPIIVTDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQA DDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLRTRKPLDRETLESISIKVTAKNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAPKFIPRLNMKQKVEFIVEQFVDGNTCTELPYTVQDIDDGGINGQNCCYTILENDYNKLFSLMTDTPSYICLQRKPEKYQSYTVTLIARDRPPNVEGGLTSKISFPVLIINDPHSKISTSGFSNHPDSRFPNPSESKNLIIIGILTTVVLVVIIIIIIIIIIIKRCSIPEQESDSTKCYQGINLSMNRNEGTKVNYLVSEPGLSPGKATISRSNLTNPQYADSINKTLTRNIPSNVSSPFTPPAYHQIIANQGVRIIPNPSRFHDQYTYEWSPVPEYRDRS+GRNP+NVEKIRSMSPTKSGLSFHTSSKMLNEDQFDSGYQILNPFGLSTSPQQQFNNYSPENLIPCENEISPVDTRSLTLLNNFFDENNNGVNSKTTPRTMKKNYFQTTFV
Sbjct:    1 MSCLYILLIFVLQFFQVLSEVLKTITITENDMSIQVLANLTEILASKTNLPHSFLSKVEIVSLLENDLPPFKLQLNQLIQPNNGVNREAVCRDNPGEKVRKFCKADLCCKLIGFQYLTPTDPGTFFILIKILDQNDKAPQFSSIKRPFFKIPENVEVGKVIDLPMAVDSDSEKYSVRRYSLSYIYHLDQTHDFRLHVTNDNPPRPQLIVNSKLDYEKINKYVFRLFAYDFDEKSIGNSCSTTIEIEIEDLNDNVPKFNQLTYNANIDENKRDDKLIKFTVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDADTHSNMIHCKLVDYNDLFYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGNVDENQVNVVVNFPKPIIVTDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQATDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLRTRKPLDRETLESISIKVTAKNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAPKFIPRLNMKQKVEFIVEQFVDGNTCTELPYTVQDIDDGGINGQNCCYTILENDYNKLFSLMTDTPSYICLQRKPEKYQSYTVTLIARDRPPNVEGGLTSKISFPVLIINDPHSKISTSGFSNHPDSRFPNPSESKNLIIIGILTTVVLVVIIIIIIIIIIIKRCSIPEQESDSTKCYQGINLSMNRNEGTKVNYLVSEPGLSPGKATISRSNLTNPQYADSINKTLTRNIPSNVSSPFTPPAYHQIIANQGVRIIPNPSRFHDQYTYEWSPVPEYRDRSMGRNPNNVEKIRSMSPTKSGLSFHTSSKMLNEDQFDSGYQILNPFGLSTSPQQQFNNYSPENLIPCENEISPVDTRSLTLLNNFFDENNNGVNSKTTPRTMKKNYFQTTFV 1099          
BLAST of Protocadherin Fat 1 vs. Planmine SMEST
Match: SMESG000042045.1 (SMESG000042045.1)

HSP 1 Score: 443.351 bits (1139), Expect = 4.160e-137
Identity = 289/836 (34.57%), Postives = 459/836 (54.90%), Query Frame = 3
Query:   87 SEVLKTITITENDMSIQVLANLTEILASKTNLPHSFLSKVEIVSLLENDLPPFKLQLNQLIQPNNGVNREAVC--------RDNPGE-----KVRKFCKADLCCKLIGFQYLTPTDPGTFFILIKILDQNDKAPQFSSIKRPFFKIPENVEVGKVIDLPMAVDSDSEKYSVRRYSLSYIYHLDQTHDFRLHVTNDNPPRPQLIVNSKLDYEKINKYVFRLFAYDFDEKSIGNSCSTTIEIEIEDLNDNVPKFNQLTYNANIDENKRDDKLIKFTVSDPDSGRNGIVTVNIVD----KTDELSKRFKI-FEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDADTHSNMIHCKLVDYNDLFYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPIIVTDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLRTRKPLDRETLESISIKVTAKNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAPKFIPRLNMKQKVEFIVEQFVDGNTCTELPYTVQDIDDGGINGQNCCYTILENDYNKLFSLMTDTPSYICLQRKPEKYQSYTVTLIARDRPPNVEGGLTSKISFPVLIINDPHSKISTSGFSNHPDSR 2540
            S  L+ I++ EN    Q L +L ++L ++T +P+    + +I ++ E    PF L  N+L   +N ++RE++C         D   E     +    CK D CC +  FQ  +     +F+ILIK+LD+ND +P+F     P+  +PEN ++  VI LP A+D DSE + ++ Y +S  + +     F L +      RPQL++ S LD E I++Y F L A D +     +     +EI++ D+NDN P F++  Y ANI E+ +   +I F V+D D G+N  V++ I      K D++ + F+I F        + LI+ +DYET+P+ + F L+ATD G P LSS+A+V I L N ND  P IK  + G  VS S+++ E  PA ++V  ++V+D D+    I C L DY+  F + + ++ + L +YK F + T+  +DRE +   +L+I I C+D +    +TTN +++I + D+NDN P+F++  Y G + EN     V   +PI+  D+D G N    + ++  +N +D   F ID  SGKI +++S+DYE    F F IIAIDK    L+S++ I ++V+D NDNAP F + HY F V ENV V  +IG ++  D DT  +NK + Y  +   ++     +D+ +G L+T  P+DRE + SI+I +TA+N   Y +  +   DSE  V+I + DVNDN P F      K  + F + +      C  +PY V D D    N  +CC   L+ND N +  L+++TP+++CLQ        Y V+L A D   N    L +K+SF +    D   ++S + FS   D++
Sbjct:   18 SNFLEMISVKENIYYSQPLLDLEKVLKNRTIIPYDKHQRYKIYAVTEK-ASPFSLIDNRLSVVSN-IDRESICPIKNSLNDYDQSAETYNSQQSSHSCKYDECCTVFSFQVDSGIKISSFYILIKVLDENDNSPKFLPFLNPYQTLPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTL-LDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKLVNVISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITAINEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQAPVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNL--MDSECMVIITIEDVNDNPPIFSLINPAKSSLIFTINKGFRHENCQMIPYAVSDADHDEPNSDSCCILQLDNDQNGMLYLLSNTPNFLCLQNTMNTPGIYRVSLTATDNKNNPNKSLKAKVSFNI----DVRHEVSDNPFSEKSDNK 844          
BLAST of Protocadherin Fat 1 vs. Planmine SMEST
Match: SMESG000042045.1 (SMESG000042045.1)

HSP 1 Score: 441.425 bits (1134), Expect = 1.325e-136
Identity = 287/830 (34.58%), Postives = 456/830 (54.94%), Query Frame = 3
Query:  105 ITITENDMSIQVLANLTEILASKTNLPHSFLSKVEIVSLLENDLPPFKLQLNQLIQPNNGVNREAVC--------RDNPGE-----KVRKFCKADLCCKLIGFQYLTPTDPGTFFILIKILDQNDKAPQFSSIKRPFFKIPENVEVGKVIDLPMAVDSDSEKYSVRRYSLSYIYHLDQTHDFRLHVTNDNPPRPQLIVNSKLDYEKINKYVFRLFAYDFDEKSIGNSCSTTIEIEIEDLNDNVPKFNQLTYNANIDENKRDDKLIKFTVSDPDSGRNGIVTVNIVD----KTDELSKRFKI-FEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDADTHSNMIHCKLVDYNDLFYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPIIVTDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLRTRKPLDRETLESISIKVTAKNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAPKFIPRLNMKQKVEFIVEQFVDGNTCTELPYTVQDIDDGGINGQNCCYTILENDYNKLFSLMTDTPSYICLQRKPEKYQSYTVTLIARDRPPNVEGGLTSKISFPVLIINDPHSKISTSGFSNHPDSR 2540
            I++ EN    Q L +L ++L ++T +P+    + +I ++ E    PF L  N+L   +N ++RE++C         D   E     +    CK D CC +  FQ  +     +F+ILIK+LD+ND +P+F     P+  +PEN ++  VI LP A+D DSE + ++ Y +S  + +     F L +      RPQL++ S LD E I++Y F L A D +     +     +EI++ D+NDN P F++  Y ANI E+ +   +I F V+D D G+N  V++ I      K D++ + F+I F        + LI+ +DYET+P+ + F L+ATD G P LSS+A+V I L N ND  P IK  + G  VS S+++ E  PA ++V  ++V+D D+    I C L DY+  F + + ++ + L +YK F + T+  +DRE +   +L+I I C+D +    +TTN +++I + D+NDN P+F++  Y G + EN     V   +PI+  D+D G N    + ++  +N +D   F ID  SGKI +++S+DYE    F F IIAIDK    L+S++ I ++V+D NDNAP F + HY F V ENV V  +IG ++  D DT  +NK + Y  +   ++     +D+ +G L+T  P+DRE + SI+I +TA+N   Y +  +   DSE  V+I + DVNDN P F      K  + F + +      C  +PY V D D    N  +CC   L+ND N +  L+++TP+++CLQ        Y V+L A D   N    L +K+SF +    D   ++S + FS   D++
Sbjct:    2 ISVKENIYYSQPLLDLEKVLKNRTIIPYDKHQRYKIYAVTEK-ASPFSLIDNRLSVVSN-IDRESICPIKNSLNDYDQSAETYNSQQSSHSCKYDECCTVFSFQVDSGIKISSFYILIKVLDENDNSPKFLPFLNPYQTLPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTL-LDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKLVNVISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITAINEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQAPVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNL--MDSECMVIITIEDVNDNPPIFSLINPAKSSLIFTINKGFRHENCQMIPYAVSDADHDEPNSDSCCILQLDNDQNGMLYLLSNTPNFLCLQNTMNTPGIYRVSLTATDNKNNPNKSLKAKVSFNI----DVRHEVSDNPFSEKSDNK 822          
BLAST of Protocadherin Fat 1 vs. Planmine SMEST
Match: SMESG000053174.1 (SMESG000053174.1)

HSP 1 Score: 417.927 bits (1073), Expect = 1.362e-127
Identity = 288/838 (34.37%), Postives = 459/838 (54.77%), Query Frame = 3
Query:  111 ITENDMSIQVLANLTEILASKTNLPHSFL--SKVEIVSLLENDLPPFKLQLNQLIQPNNGVNREAVCRDNPGEKVRKFCKA-DLCCKLIGFQY-LTPTDPGTFFILIKILDQNDKAPQFSSIKRPFFKIPENVEVGKVIDLPMAVDSDSEKYSVRRYSLSYIYHLDQTHDFRLHVTNDNPPRPQLIVNSKLDYEKINKYVFRLFAYDFDEKSIGNSCSTTIEIEIEDLNDNVPKFNQLTYNANIDENKRDDKLIKFTVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEI-----QRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDADTHSNMIHCKLVDYNDLFYLDSPSKFNTLLN-YKPFNLKTINKIDRESNH----GSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPIIVTDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGY-QPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDH--SSYFDIDRYTGDLRTRKPLDRETLESISIKVTAKNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAPKFIPRLNMKQKVEFIV--EQFVDGNTCTELPYTVQDIDDGGINGQNCCYTILENDYNKLFSLMTDTPSYICLQRKPEKYQSYTVTLIARDRPPNVEGGLTSKISFPVLIINDPHSKISTSGFSNHPDSRFPNPSESKN 2567
            ITEN    + + NL  +L SK+ +  S     K+ + +++ N L  F L  +  ++ +  ++RE +C      ++ K C +   CC ++ FQ      +  + FI + + D+ND  P F  ++ P+  I EN  +G  I LP A D D+  +SV  Y L   + L  + DF L   +     P LI+ S LD EK + Y F L A D  E +  N+  T I I+I D+NDN PKF +  Y   I EN   D + +  V+D D   NG + + + +   E   +    +I      + +  +  IN+LDYE   H FEF ++A D G  SLSS+A ++I + N+ND  P+I+F + G  ++   SI EG  ++ ++  V+V+DAD+  N + C L+   ++  ++  S+F   +N YK F+L+T   IDRE+N      S + +T+ C D +    + TN S+ I I DVNDN P F+Q +Y G ++EN  N  V     I   D+D  LNGK  ++++DF+N S++  F ID  +GKI+  +S D+E ++ + F ++A D+G+   L+SSSTI + + D NDNAP+FS+SH+ F V ENV +G  IG + A D D+  ++KDI + ++    +  S    +D  TG +RTR P+DRE   +I+  V +KNP++  +  ++    E  ++I V D+ND+ P F  RL    K + I+  E    G  C  +P+ V+D DD   N   CC   L+++YN L SL  DT + IC+ + P+K +S  VTLIA D+  N    + ++I+F +L INDP+  ++T   +  P SR   P ++K+
Sbjct:   26 ITENSKIYKTIFNLKTLLISKSKIDSSKAKDCKIFMSTVINNGL--FILDSDSNLKVSKQIDREELCPPQMMLQLNKVCGSIHTCCHILDFQISCNNEEMQSNFIRVFVDDENDNNPVFPIVQTPYCTIEENKPLGYRIPLPKAQDLDNATFSVSSYKLELPFKLGNSSDFEL-AKHFKDGVPYLIITSTLDREKTSMYTFTLIAIDGVEGN-RNTGKTEITIKIRDINDNAPKFERPIYIRTIKENVIVDPIFQILVTDEDEDENGRIDLKMHNSGQEWINKIFTLDILDQSIGKVQAQVRAINNLDYEQLYHSFEFKIVAQDGGRNSLSSTATLRIQILNVNDMSPEIRFVRNGQQITGGFSIDEGTLSNKILAYVQVSDADSMINQLQCSLLTPRNILMIEE-SRFRHPVNIYKQFSLRTTQNIDREANEPFLIDSKIIVTVQCDDYDNEIPLNTNASIFIIINDVNDNPPKFTQNVYYGQIEENINNHEVFMNAAIHAADKDLHLNGKVTYHIQDFKNSSNAMYFRIDSQNGKIYNSQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAPQFSQSHFAFFVDENVEIGHLIGQINATDRDSLPEHKDIRFIVKSDSQNRASKLITLDPLTGQIRTRYPIDREKTSTITFFVESKNPSRIFNDLIQ----EAMIVITVRDLNDSPPTF--RLKDPSKSQLIISLETLQQGQICESIPFEVEDADDNN-NVNPCCVVRLKHNYNGLLSLADDTQNIICINQVPKKVKSLPVTLIASDKHGN--DSIETEITFKILFINDPN--VATQSKNQPPSSRNQKPEQAKD 847          
BLAST of Protocadherin Fat 1 vs. Planmine SMEST
Match: SMESG000053174.1 (SMESG000053174.1)

HSP 1 Score: 410.994 bits (1055), Expect = 1.337e-125
Identity = 273/778 (35.09%), Postives = 430/778 (55.27%), Query Frame = 3
Query:  285 VNREAVCRDNPGEKVRKFCKA-DLCCKLIGFQY-LTPTDPGTFFILIKILDQNDKAPQFSSIKRPFFKIPENVEVGKVIDLPMAVDSDSEKYSVRRYSLSYIYHLDQTHDFRLHVTNDNPPRPQLIVNSKLDYEKINKYVFRLFAYDFDEKSIGNSCSTTIEIEIEDLNDNVPKFNQLTYNANIDENKRDDKLIKFTVSDPDSGRNGIVTVNIVDKTDELSKRFKIFEI-----QRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDADTHSNMIHCKLVDYNDLFYLDSPSKFNTLLN-YKPFNLKTINKIDRESNH----GSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGXXXXXXXXXXXXFPKPIIVTDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGY-QPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDH--SSYFDIDRYTGDLRTRKPLDRETLESISIKVTAKNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAPKFIPRLNMKQKVEFIV--EQFVDGNTCTELPYTVQDIDDGGINGQNCCYTILENDYNKLFSLMTDTPSYICLQRKPEKYQSYTVTLIARDRPPNVEGGLTSKISFPVLIINDPHSKISTSGFSNHPDSRFPNPSESKN 2567
            ++RE +C      ++ K C +   CC ++ FQ      +  + FI + + D+ND  P F  ++ P+  I EN  +G  I LP A D D+  +SV  Y L   + L  + DF L   +     P LI+ S LD EK + Y F L A D  E +  N+  T I I+I D+NDN PKF +  Y   I EN   D + +  V+D D   NG + + + +   E   +    +I      + +  +  IN+LDYE   H FEF ++A D G  SLSS+A ++I + N+ND  P+I+F + G  ++   SI EG  ++ ++  V+V+DAD+  N + C L+   ++  ++  S+F   +N YK F+L+T   IDRE+N      S + +T+ C D +    + TN S+ I I DVNDN P F+Q +Y G ++EN  N  V     I   D+D  LNGK  ++++DF+N S++  F ID  +GKI+  +S D+E ++ + F ++A D+G+   L+SSSTI + + D NDNAP+FS+SH+ F V ENV +G  IG + A D D+  ++KDI + ++    +  S    +D  TG +RTR P+DRE   +I+  V +KNP++  +  ++    E  ++I V D+ND+ P F  RL    K + I+  E    G  C  +P+ V+D DD   N   CC   L+++YN L SL  DT + IC+ + P+K +S  VTLIA D+  N    + ++I+F +L INDP+  ++T   +  P SR   P ++K+
Sbjct:   24 IDREELCPPQMMLQLNKVCGSIHTCCHILDFQISCNNEEMQSNFIRVFVDDENDNNPVFPIVQTPYCTIEENKPLGYRIPLPKAQDLDNATFSVSSYKLELPFKLGNSSDFEL-AKHFKDGVPYLIITSTLDREKTSMYTFTLIAIDGVEGN-RNTGKTEITIKIRDINDNAPKFERPIYIRTIKENVIVDPIFQILVTDEDEDENGRIDLKMHNSGQEWINKIFTLDILDQSIGKVQAQVRAINNLDYEQLYHSFEFKIVAQDGGRNSLSSTATLRIQILNVNDMSPEIRFVRNGQQITGGFSIDEGTLSNKILAYVQVSDADSMINQLQCSLLTPRNILMIEE-SRFRHPVNIYKQFSLRTTQNIDREANEPFLIDSKIIVTVQCDDYDNEIPLNTNASIFIIINDVNDNPPKFTQNVYYGQIEENINNHEVFMNAAIHAADKDLHLNGKVTYHIQDFKNSSNAMYFRIDSQNGKIYNSQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAPQFSQSHFAFFVDENVEIGHLIGQINATDRDSLPEHKDIRFIVKSDSQNRASKLITLDPLTGQIRTRYPIDREKTSTITFFVESKNPSRIFNDLIQ----EAMIVITVRDLNDSPPTF--RLKDPSKSQLIISLETLQQGQICESIPFEVEDADDNN-NVNPCCVVRLKHNYNGLLSLADDTQNIICINQVPKKVKSLPVTLIASDKHGN--DSIETEITFKILFINDPN--VATQSKNQPPSSRNQKPEQAKD 787          
The following BLAST results are available for this feature:
BLAST of Protocadherin Fat 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PCDH14.716e-5628.36protocadherin 1 [Source:HGNC Symbol;Acc:HGNC:8655][more]
PCDH17.438e-5628.36protocadherin 1 [Source:HGNC Symbol;Acc:HGNC:8655][more]
DCHS11.757e-4929.01dachsous cadherin-related 1 [Source:HGNC Symbol;Ac... [more]
PCDH11Y4.406e-4627.68protocadherin 11 Y-linked [Source:HGNC Symbol;Acc:... [more]
PCDH11X6.250e-4627.79protocadherin 11 X-linked [Source:HGNC Symbol;Acc:... [more]
back to top
BLAST of Protocadherin Fat 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fmi-11.791e-3326.72FlaMIngo (Cadherin plus 7TM domain) homolog [Sour... [more]
fmi-12.032e-3326.72FlaMIngo (Cadherin plus 7TM domain) homolog [Sour... [more]
cdh-16.381e-3226.34CaDHerin family [Source:UniProtKB/TrEMBL;Acc:Q5F4... [more]
hmr-13.142e-2423.94Cadherin-related hmr-1 [Source:UniProtKB/Swiss-Pr... [more]
hmr-13.142e-2423.94Cadherin-related hmr-1 [Source:UniProtKB/Swiss-Pr... [more]
back to top
BLAST of Protocadherin Fat 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ds2.459e-4728.39gene:FBgn0284247 transcript:FBtr0078045[more]
ds2.459e-4728.39gene:FBgn0284247 transcript:FBtr0343249[more]
stan2.793e-4630.78gene:FBgn0024836 transcript:FBtr0304900[more]
stan3.672e-4630.78gene:FBgn0024836 transcript:FBtr0303223[more]
stan3.672e-4630.78gene:FBgn0024836 transcript:FBtr0088214[more]
back to top
BLAST of Protocadherin Fat 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CT030123.11.200e-5329.53protocadherin 1b [Source:NCBI gene;Acc:572016][more]
pcdh1b4.025e-5329.37protocadherin 1b [Source:ZFIN;Acc:ZDB-GENE-091015-... [more]
CT030123.14.747e-5330.32protocadherin 1b [Source:NCBI gene;Acc:572016][more]
pcdh1b4.749e-5329.37protocadherin 1b [Source:ZFIN;Acc:ZDB-GENE-091015-... [more]
pcdh1a5.443e-5329.26protocadherin 1a [Source:ZFIN;Acc:ZDB-GENE-091116-... [more]
back to top
BLAST of Protocadherin Fat 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pcdh174.157e-5228.68protocadherin 17 [Source:Xenbase;Acc:XB-GENE-48022... [more]
pcdh175.015e-5228.66protocadherin 17 [Source:Xenbase;Acc:XB-GENE-48022... [more]
pcdh175.344e-5228.66protocadherin 17 [Source:Xenbase;Acc:XB-GENE-48022... [more]
pcdh176.951e-5228.66protocadherin 17 [Source:Xenbase;Acc:XB-GENE-48022... [more]
pcdh177.104e-5228.66protocadherin 17 [Source:Xenbase;Acc:XB-GENE-48022... [more]
back to top
BLAST of Protocadherin Fat 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pcdh17.131e-5728.51protocadherin 1 [Source:MGI Symbol;Acc:MGI:104692][more]
Pcdh17.131e-5728.51protocadherin 1 [Source:MGI Symbol;Acc:MGI:104692][more]
Pcdh11.084e-5528.47protocadherin 1 [Source:MGI Symbol;Acc:MGI:104692][more]
Dchs14.145e-4929.29dachsous cadherin related 1 [Source:MGI Symbol;Acc... [more]
Pcdh11x7.018e-4627.91protocadherin 11 X-linked [Source:MGI Symbol;Acc:M... [more]
back to top
BLAST of Protocadherin Fat 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q08174|PCDH1_HUMAN2.265e-5528.36Protocadherin-1 OS=Homo sapiens OX=9606 GN=PCDH1 P... [more]
sp|Q96JQ0|PCD16_HUMAN8.440e-4929.01Protocadherin-16 OS=Homo sapiens OX=9606 GN=DCHS1 ... [more]
sp|E9PVD3|PCD16_MOUSE2.899e-4829.29Protocadherin-16 OS=Mus musculus OX=10090 GN=Dchs1... [more]
sp|D4ACX8|PCD16_RAT1.768e-4729.13Protocadherin-16 OS=Rattus norvegicus OX=10116 GN=... [more]
sp|Q6WYY1|PC11X_PANPA2.540e-4627.83Protocadherin-11 X-linked OS=Pan paniscus OX=9597 ... [more]
back to top
BLAST of Protocadherin Fat 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4E0RII81.465e-10931.09Protocadherin Fat 1 OS=Fasciola hepatica OX=6192 G... [more]
A0A183A7P04.358e-10930.53Uncharacterized protein OS=Echinostoma caproni OX=... [more]
A0A5J4NYA98.251e-10631.53Protocadherin delta 1 OS=Paragonimus westermani OX... [more]
G4VRE52.713e-10431.74Putative cadherin OS=Schistosoma mansoni OX=6183 G... [more]
A0A3R7D3G08.943e-10129.39Protocadherin Fat 1 OS=Clonorchis sinensis OX=7992... [more]
back to top
BLAST of Protocadherin Fat 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pcdh1a1.299e-5429.38protocadherin 1a [Source:ZFIN;Acc:ZDB-GENE-091116-... [more]
pcdh1a1.855e-5429.38protocadherin 1a [Source:ZFIN;Acc:ZDB-GENE-091116-... [more]
pcdh1b9.397e-5429.87protocadherin 1b [Source:ZFIN;Acc:ZDB-GENE-091015-... [more]
dchs1b9.226e-5029.23dachsous cadherin-related 1b [Source:ZFIN;Acc:ZDB-... [more]
ENSAMXT00000036438.16.303e-4728.74pep primary_assembly:Astyanax_mexicanus-2.0:20:107... [more]
back to top
BLAST of Protocadherin Fat 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pcdh112.291e-4828.69protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-... [more]
si:ch211-199f5.13.993e-4526.81protocadherin 8 [Source:HGNC Symbol;Acc:HGNC:8660][more]
ENSPMAT00000004043.16.633e-4327.77pep scaffold:Pmarinus_7.0:GL479143:9150:31231:-1 g... [more]
ENSPMAT00000004042.17.560e-4327.77pep scaffold:Pmarinus_7.0:GL479143:9150:31231:-1 g... [more]
ENSPMAT00000008517.11.565e-4126.09pep scaffold:Pmarinus_7.0:GL476786:43429:129410:1 ... [more]
back to top
BLAST of Protocadherin Fat 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protocadherin Fat 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO461894.546e-5128.78Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO348151.746e-4327.02Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO392301.246e-4227.64Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO482373.382e-4127.23Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO354127.479e-4127.40Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Protocadherin Fat 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pcdh1b4.217e-5430.44protocadherin-1 [Source:NCBI gene;Acc:101174755][more]
pcdh1b4.561e-5430.44protocadherin-1 [Source:NCBI gene;Acc:101174755][more]
ENSORLT00000005325.23.159e-5229.31protocadherin-16 [Source:NCBI gene;Acc:101171352][more]
pcdh1a1.149e-5029.69protocadherin-1 [Source:NCBI gene;Acc:101157079][more]
pcdh1a1.971e-5029.88protocadherin-1 [Source:NCBI gene;Acc:101157079][more]
back to top
BLAST of Protocadherin Fat 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000048159.10.000e+099.73SMESG000048159.1[more]
SMESG000042045.14.160e-13734.57SMESG000042045.1[more]
SMESG000042045.11.325e-13634.58SMESG000042045.1[more]
SMESG000053174.11.362e-12734.37SMESG000053174.1[more]
SMESG000053174.11.337e-12535.09SMESG000053174.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30009079 ID=SMED30009079|Name=Protocadherin Fat 1|organism=Schmidtea mediterranea sexual|type=transcript|length=3521bp
GGATCTATTATTATTAAACAAACAAAATATTGATGTCTTGTCTTTATATT
CTGTTAATTTTCGTATTACAATTCTTTCAAGTCTTGTCAGAAGTCCTGAA
AACTATCACGATCACAGAAAATGACATGTCAATTCAAGTGTTAGCCAATC
TCACTGAAATTTTGGCATCTAAAACGAATTTGCCTCATTCGTTTTTGAGC
AAGGTCGAAATTGTGTCTTTGTTGGAAAATGATTTGCCTCCATTTAAGTT
ACAGTTGAATCAACTGATTCAACCGAATAACGGTGTCAACCGGGAGGCTG
TCTGCCGAGATAACCCCGGTGAGAAAGTTAGAAAGTTTTGTAAAGCGGAT
TTATGCTGTAAATTAATCGGATTCCAATATTTAACCCCGACTGATCCTGG
TACGTTTTTTATTTTAATCAAAATTCTTGATCAAAACGACAAAGCTCCGC
AATTTTCCTCTATTAAACGTCCATTTTTCAAAATTCCTGAAAATGTCGAA
GTAGGCAAAGTGATAGATTTACCAATGGCCGTTGATAGTGACAGTGAAAA
GTATTCTGTTCGTCGGTACTCACTTTCATATATCTATCACCTTGATCAGA
CTCATGATTTTCGGCTCCATGTTACCAATGATAATCCTCCTCGGCCTCAG
TTGATTGTCAATTCGAAATTGGATTACGAAAAAATAAACAAATATGTTTT
TCGTTTGTTTGCGTATGATTTTGACGAAAAATCTATCGGAAACAGCTGTT
CAACAACAATTGAAATCGAAATCGAAGATCTGAATGATAACGTGCCGAAA
TTCAATCAGCTCACGTATAACGCAAATATCGACGAAAACAAAAGAGATGA
TAAACTCATAAAATTTACTGTTTCCGACCCCGACAGCGGCAGGAATGGCA
TCGTAACTGTGAATATTGTCGACAAAACCGATGAGTTATCTAAACGGTTT
AAGATTTTCGAAATCCAAAGGAATGAATTTTTCCTCGAATTGATAAATTC
ATTGGATTACGAGACCGATCCTCATTTATTCGAATTTACGTTGCTTGCCA
CAGATCAAGGAACGCCTTCTCTATCTTCCTCAGCTCAAGTAAAAATACAT
TTAAAAAATCTCAATGATAATGGTCCAAAAATTAAATTTAAAAAATTAGG
TTTTTCGGTCAGTAACAGTGTTTCAATCATCGAAGGTTTGCCAGCACATT
CCTTGGTCGTTGAAGTAAGGGTAACAGATGCCGATACACATTCAAACATG
ATACATTGCAAACTCGTTGATTACAATGATCTTTTTTATCTTGACAGTCC
AAGCAAATTCAATACCTTACTTAATTACAAACCCTTCAATTTAAAAACCA
TTAATAAAATAGACCGAGAATCTAATCACGGTTCATTTCTTCGGATCACA
ATTTCTTGTACCGACAGCGAGCCAAGTCGACAAATCACAACGAACGAATC
TCTCAATATTCAAATCGAAGACGTAAATGACAATGCTCCGATGTTCTCCC
AGCAAATCTATATTGGAAATGTCGACGAAAACCAAGTAAACGTTGTCGTG
AATTTCCCCAAACCGATTATCGTCACAGATCGAGATTCAGGCTTGAATGG
TAAATTCGAATTCTATCTCGAAGACTTTCGAAATTTCTCCGACAGTTCTG
ATTTTCTAATTGACAAAATATCTGGGAAAATCTTTACACAGAGATCTCTA
GATTATGAAACGAAAAATAAATTCCGATTTAAAATTATAGCCATTGATAA
AGGGTATCAACCGTTGACCAGTAGCTCAACTATTACTATAAATGTGCTCG
ATCTCAATGACAACGCACCAAGATTCTCTGAATCTCATTACATTTTTAAT
GTGTTTGAAAACGTTTCTGTCGGCTGGAAAATCGGTACTCTTCAGGCCAT
AGATGATGATACGGATAGAAAGAATAAAGATATATTTTATTCAATTGAAC
CAAAAGGGGACCACTCGAGTTATTTTGACATAGACCGATATACTGGTGAC
CTAAGAACAAGAAAACCTCTAGATAGAGAAACTCTCGAATCAATTTCGAT
TAAGGTGACTGCAAAAAATCCTAACAAATATTCAAGTCATTTCGTGCGCA
ATACTGACTCGGAAGTAGACGTAATGATAAAAGTGATGGACGTAAACGAC
AACGCACCGAAATTTATACCGAGATTGAATATGAAACAGAAAGTCGAGTT
TATTGTCGAACAATTCGTTGATGGGAATACATGCACAGAATTGCCGTATA
CTGTTCAAGATATCGATGACGGAGGAATCAACGGACAGAACTGCTGTTAC
ACGATTCTTGAAAACGATTACAATAAACTATTCTCTTTAATGACTGACAC
TCCGTCTTATATTTGTCTGCAACGGAAACCCGAAAAATATCAGTCCTACA
CTGTGACACTCATAGCTAGGGATAGACCGCCGAATGTAGAGGGGGGACTC
ACATCTAAGATTTCATTTCCGGTTTTAATAATAAATGACCCTCACTCAAA
AATCTCTACGAGCGGCTTCTCAAATCACCCGGATTCAAGATTTCCAAATC
CAAGTGAATCAAAAAATTTAATTATCATCGGAATTTTGACAACTGTGGTC
TTGGTAGTAATAATTATAATTATTATCATTATAATTATTATCAAACGGTG
TTCAATACCAGAACAAGAATCTGACAGTACCAAGTGCTATCAAGGCATCA
ACTTATCAATGAACAGAAATGAAGGCACAAAAGTTAATTACCTGGTGTCA
GAGCCCGGCTTATCACCTGGAAAGGCTACAATTTCACGAAGCAACCTAAC
TAATCCTCAATATGCAGATTCCATCAACAAAACATTGACTAGAAATATAC
CCTCAAATGTCAGTTCACCTTTTACTCCCCCTGCCTATCATCAAATAATA
GCCAATCAAGGAGTTCGAATTATCCCTAATCCCAGCAGATTCCATGATCA
GTATACATATGAATGGTCTCCGGTTCCTGAATATCGAGATCGGTCAATCG
GCAGAAATCCCAGCAATGTCGAAAAAATCCGATCAATGTCTCCGACCAAA
AGTGGATTATCTTTCCACACCAGCTCCAAAATGCTCAATGAAGATCAGTT
TGACTCAGGCTATCAGATATTAAATCCATTCGGATTGTCAACCTCTCCCC
AACAGCAATTCAACAATTATTCTCCCGAAAACCTCATACCGTGTGAAAAC
GAAATATCTCCAGTTGATACAAGATCTTTGACTTTGTTAAACAACTTTTT
TGACGAAAACAACAACGGTGTCAACAGTAAAACCACCCCTAGGACAATGA
AGAAAAATTATTTTCAAACTACCTTTGTATAAACACGTGGAGAATTGATA
AAAATAATAATCGCTGTATTTTTTTCCCTTTCCGATCTGTAAGAGGATGA
CAGTATCGGGGCAACAGCTGGCTAAGCAACGTGATAGTTAAAACATATCT
CATTTAAAATTGAACCGTAATTTATAAGTTAAACCAGACTATACAAGGGA
ATTTATGAAGTTCCATCCGAT
back to top

protein sequence of SMED30009079-orf-1

>SMED30009079-orf-1 ID=SMED30009079-orf-1|Name=SMED30009079-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1100bp
MSCLYILLIFVLQFFQVLSEVLKTITITENDMSIQVLANLTEILASKTNL
PHSFLSKVEIVSLLENDLPPFKLQLNQLIQPNNGVNREAVCRDNPGEKVR
KFCKADLCCKLIGFQYLTPTDPGTFFILIKILDQNDKAPQFSSIKRPFFK
IPENVEVGKVIDLPMAVDSDSEKYSVRRYSLSYIYHLDQTHDFRLHVTND
NPPRPQLIVNSKLDYEKINKYVFRLFAYDFDEKSIGNSCSTTIEIEIEDL
NDNVPKFNQLTYNANIDENKRDDKLIKFTVSDPDSGRNGIVTVNIVDKTD
ELSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSS
AQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDA
DTHSNMIHCKLVDYNDLFYLDSPSKFNTLLNYKPFNLKTINKIDRESNHG
SFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGNVDEN
QVNVVVNFPKPIIVTDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISGKI
FTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSE
SHYIFNVFENVSVGWKIGTLQAIDDDTDRKNKDIFYSIEPKGDHSSYFDI
DRYTGDLRTRKPLDRETLESISIKVTAKNPNKYSSHFVRNTDSEVDVMIK
VMDVNDNAPKFIPRLNMKQKVEFIVEQFVDGNTCTELPYTVQDIDDGGIN
GQNCCYTILENDYNKLFSLMTDTPSYICLQRKPEKYQSYTVTLIARDRPP
NVEGGLTSKISFPVLIINDPHSKISTSGFSNHPDSRFPNPSESKNLIIIG
ILTTVVLVVIIIIIIIIIIIKRCSIPEQESDSTKCYQGINLSMNRNEGTK
VNYLVSEPGLSPGKATISRSNLTNPQYADSINKTLTRNIPSNVSSPFTPP
AYHQIIANQGVRIIPNPSRFHDQYTYEWSPVPEYRDRSIGRNPSNVEKIR
SMSPTKSGLSFHTSSKMLNEDQFDSGYQILNPFGLSTSPQQQFNNYSPEN
LIPCENEISPVDTRSLTLLNNFFDENNNGVNSKTTPRTMKKNYFQTTFV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
PLANA:0002028dorsal-ventral muscle cell
Vocabulary: INTERPRO
TermDefinition
IPR002126Cadherin-like_dom
IPR020894Cadherin_CS
IPR015919Cadherin-like_sf
Vocabulary: biological process
TermDefinition
GO:0007156homophilic cell adhesion via plasma membrane adhesion molecules
GO:0007155cell adhesion
Vocabulary: molecular function
TermDefinition
GO:0005509calcium ion binding
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0005886plasma membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002126Cadherin-likePRINTSPR00205CADHERINcoord: 693..710
score: 47.7
coord: 596..609
score: 38.26
coord: 142..171
score: 23.72
coord: 332..344
score: 27.8
coord: 653..679
score: 29.81
coord: 577..596
score: 44.51
IPR002126Cadherin-likeSMARTSM00112CA_2coord: 395..486
e-value: 2.2E-7
score: 40.5
coord: 620..709
e-value: 1.2E-17
score: 74.6
coord: 512..596
e-value: 4.5E-25
score: 99.3
coord: 164..255
e-value: 3.8E-6
score: 36.4
coord: 278..365
e-value: 3.4E-15
score: 66.5
IPR002126Cadherin-likePFAMPF00028Cadherincoord: 262..357
e-value: 5.5E-12
score: 46.0
coord: 507..589
e-value: 7.9E-12
score: 45.5
coord: 604..701
e-value: 3.7E-14
score: 52.9
NoneNo IPR availableGENE3DG3DSA:2.60.40.60coord: 483..593
e-value: 5.4E-26
score: 93.3
coord: 253..365
e-value: 6.7E-24
score: 86.5
NoneNo IPR availableGENE3DG3DSA:2.60.40.60coord: 594..707
e-value: 8.8E-26
score: 92.6
NoneNo IPR availableGENE3DG3DSA:2.60.40.60coord: 708..811
e-value: 2.0E-5
score: 26.8
NoneNo IPR availableGENE3DG3DSA:2.60.40.60coord: 366..482
e-value: 1.3E-12
score: 50.2
NoneNo IPR availableGENE3DG3DSA:2.60.40.60coord: 135..252
e-value: 1.0E-16
score: 63.4
NoneNo IPR availablePANTHERPTHR24028:SF257coord: 108..598
NoneNo IPR availablePANTHERPTHR24028FAMILY NOT NAMEDcoord: 108..598
NoneNo IPR availablePANTHERPTHR24028:SF257coord: 513..819
NoneNo IPR availablePANTHERPTHR24028FAMILY NOT NAMEDcoord: 513..819
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 151..257
score: 16.754
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 258..367
score: 20.218
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 374..488
score: 16.886
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 489..598
score: 22.892
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 599..711
score: 25.37
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 492..594
e-value: 2.43939E-22
score: 90.4505
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 261..363
e-value: 1.88837E-19
score: 82.3613
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 379..484
e-value: 8.07537E-10
score: 55.0122
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 148..253
e-value: 3.56908E-13
score: 64.2569
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 602..707
e-value: 6.9504E-24
score: 95.0729
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..19
score: 0.91
NoneNo IPR availableTMHMMTMhelixcoord: 846..868
IPR020894Cadherin conserved sitePROSITEPS00232CADHERIN_1coord: 586..596
IPR020894Cadherin conserved sitePROSITEPS00232CADHERIN_1coord: 699..709
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 586..714
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 482..598
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 379..502
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 704..817
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 245..371
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 129..270