Actin

Overview
NameActin
Smed IDSMED30009076
Length (bp)1515
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Actin (SMED30009076) t-SNE clustered cells

Violin plots show distribution of expression levels for Actin (SMED30009076) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Actin (SMED30009076) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Actin (SMED30009076) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30009076

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 87

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
muscle progenitor cellSMED30009076SMESG000066035.1 SMESG000066029.1 SMESG000066027.1 SMESG000066020.1 SMED30009076smed_20140614PMID:29906446
Zeng et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30009076SMESG000066035.1 SMESG000066029.1 SMESG000066027.1 SMESG000066020.1 Contig26913uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30009076SMESG000066035.1 SMESG000066029.1 SMESG000066027.1 SMESG000066020.1 Contig26913newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30009076SMESG000066035.1 SMESG000066029.1 SMESG000066027.1 SMESG000066020.1 Contig7559uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30009076SMESG000066035.1 SMESG000066029.1 SMESG000066027.1 SMESG000066020.1 Contig7559newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30009076SMESG000066035.1 SMESG000066029.1 SMESG000066027.1 SMESG000066020.1 SMESG000066019.1 Contig29670uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30009076SMESG000066035.1 SMESG000066029.1 SMESG000066027.1 SMESG000066020.1 SMESG000066019.1 Contig29670newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30009076SMESG000066035.1 SMESG000066029.1 SMESG000066027.1 SMESG000066020.1 Contig3958uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30009076SMESG000066035.1 SMESG000066029.1 SMESG000066027.1 SMESG000066020.1 Contig3958newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30009076SMESG000066035.1 SMESG000066029.1 SMESG000066027.1 SMESG000066020.1 Contig7373uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30009076SMESG000066035.1 SMESG000066029.1 SMESG000066027.1 SMESG000066020.1 Contig7373newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30009076SMESG000066035.1 SMESG000066029.1 SMESG000066027.1 SMESG000066020.1 Contig51690uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30009076SMESG000066035.1 SMESG000066029.1 SMESG000066027.1 SMESG000066020.1 Contig51690newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30009076SMESG000050145.1 SMESG000050131.1 Contig3958uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30009076SMESG000050145.1 SMESG000050131.1 Contig3958newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
protonephridiaSMED30009076SMESG000066035.1 SMESG000066029.1 SMESG000066027.1 SMESG000066020.1 dd_Smed_v4_37_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30009076SMESG000066035.1 SMESG000066029.1 SMESG000066027.1 SMESG000066020.1 dd_Smed_v4_37_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30009076SMESG000066035.1 SMESG000066029.1 SMESG000066027.1 SMESG000066020.1 dd_Smed_v4_37_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30009076SMESG000066035.1 SMESG000066029.1 SMESG000066027.1 SMESG000066020.1 dd_Smed_v4_37_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30009076SMESG000066035.1 SMESG000066029.1 SMESG000066027.1 SMESG000066020.1 dd_Smed_v4_37_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30009076SMESG000066035.1 SMESG000066029.1 SMESG000066027.1 SMESG000066020.1 dd_Smed_v4_37_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30009076SMESG000066035.1 SMESG000066029.1 SMESG000066027.1 SMESG000066020.1 dd_Smed_v4_37_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30009076SMESG000066035.1 SMESG000066029.1 SMESG000066027.1 SMESG000066020.1 dd_Smed_v4_37_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30009076SMESG000066035.1 SMESG000066029.1 SMESG000066027.1 SMESG000066020.1 dd_Smed_v4_37_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30009076SMESG000066035.1 SMESG000066029.1 SMESG000066027.1 SMESG000066020.1 dd_Smed_v4_37_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30009076SMESG000066035.1 SMESG000066029.1 SMESG000066027.1 SMESG000066020.1 dd_Smed_v4_37_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30009076SMESG000066035.1 SMESG000066029.1 SMESG000066027.1 SMESG000066020.1 Contig17752uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30009076SMESG000066035.1 SMESG000066029.1 SMESG000066027.1 SMESG000066020.1 Contig17752newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30009076SMESG000066035.1 SMESG000066029.1 SMESG000066027.1 SMESG000066020.1 Contig17750uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30009076SMESG000066035.1 SMESG000066029.1 SMESG000066027.1 SMESG000066020.1 Contig17750newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30009076SMESG000066035.1 SMESG000066029.1 SMESG000066027.1 SMESG000066020.1 Contig17751uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30009076SMESG000066035.1 SMESG000066029.1 SMESG000066027.1 SMESG000066020.1 Contig17751newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30009076SMESG000041945.1 Contig1191GPL15192PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30009076SMESG000066035.1 SMESG000066029.1 SMESG000066027.1 SMESG000066020.1 Contig14284newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30009076SMESG000066035.1 SMESG000066029.1 SMESG000066027.1 SMESG000066020.1 Contig14284uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30009076SMESG000066035.1 SMESG000066029.1 SMESG000066027.1 SMESG000066020.1 Contig11918uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30009076SMESG000066035.1 SMESG000066029.1 SMESG000066027.1 SMESG000066020.1 Contig11918newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30009076SMESG000066035.1 SMESG000066029.1 SMESG000066027.1 SMESG000066020.1 SMESG000023258.1 Contig11919uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30009076SMESG000066035.1 SMESG000066029.1 SMESG000066027.1 SMESG000066020.1 SMESG000023258.1 Contig11919newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30009076SMESG000066035.1 SMESG000066029.1 SMESG000066027.1 SMESG000066020.1 Contig1191GPL15192PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
parenchymal cellSMED30009076SMESG000066035.1 SMESG000066029.1 SMESG000066027.1 SMESG000066020.1 dd_Smed_v4_90_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30009076SMESG000066035.1 SMESG000066029.1 SMESG000066027.1 SMESG000066020.1 dd_Smed_v4_90_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30009076SMESG000066035.1 SMESG000066029.1 SMESG000066027.1 SMESG000066020.1 dd_Smed_v4_90_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30009076SMESG000066035.1 SMESG000066029.1 SMESG000066027.1 SMESG000066020.1 dd_Smed_v4_90_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30009076SMESG000066035.1 SMESG000066029.1 SMESG000066027.1 SMESG000066020.1 dd_Smed_v4_90_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30009076SMESG000066035.1 SMESG000066029.1 SMESG000066027.1 SMESG000066020.1 dd_Smed_v4_90_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30009076SMESG000066035.1 SMESG000066029.1 SMESG000066027.1 SMESG000066020.1 Contig10048uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30009076SMESG000066035.1 SMESG000066029.1 SMESG000066027.1 SMESG000066020.1 Contig10048newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
musculature systemSMED30009076SMESG000066035.1 SMESG000066029.1 SMESG000066027.1 SMESG000066020.1 dd_Smed_v6_90_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30009076SMESG000066035.1 SMESG000066029.1 SMESG000066027.1 SMESG000066020.1 dd_Smed_v6_90_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle progenitor cellSMED30009076SMESG000066035.1 SMESG000066029.1 SMESG000066027.1 SMESG000066020.1 dd_Smed_v6_90_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pharynx musculatureSMED30009076SMESG000066035.1 SMESG000066029.1 SMESG000066027.1 SMESG000066020.1 dd_Smed_v6_90_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
musculature systemSMED30009076SMESG000066035.1 SMESG000066029.1 SMESG000066027.1 SMESG000066020.1 dd_Smed_v6_37_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30009076SMESG000066035.1 SMESG000066029.1 SMESG000066027.1 SMESG000066020.1 dd_Smed_v6_37_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle progenitor cellSMED30009076SMESG000066035.1 SMESG000066029.1 SMESG000066027.1 SMESG000066020.1 dd_Smed_v6_37_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pharynx musculatureSMED30009076SMESG000066035.1 SMESG000066029.1 SMESG000066027.1 SMESG000066020.1 dd_Smed_v6_37_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30009076SMESG000066035.1 SMESG000066029.1 SMESG000066027.1 SMESG000066020.1 Contig22094newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30009076SMESG000066035.1 SMESG000066029.1 SMESG000066027.1 SMESG000066020.1 Contig24881uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30009076SMESG000066035.1 SMESG000066029.1 SMESG000066027.1 SMESG000066020.1 Contig24881newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30009076SMESG000066035.1 SMESG000066029.1 SMESG000066027.1 SMESG000066020.1 Contig24244uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30009076SMESG000066035.1 SMESG000066029.1 SMESG000066027.1 SMESG000066020.1 Contig24244newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30009076SMESG000066035.1 SMESG000066029.1 SMESG000066027.1 SMESG000066020.1 Contig26822uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30009076SMESG000066035.1 SMESG000066029.1 SMESG000066027.1 SMESG000066020.1 Contig26822newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30009076SMESG000066035.1 SMESG000066029.1 SMESG000066027.1 SMESG000066020.1 Contig23832newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30009076SMESG000066035.1 SMESG000066029.1 SMESG000066027.1 SMESG000066020.1 Contig23832uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30009076SMESG000066035.1 SMESG000066029.1 SMESG000066027.1 SMESG000066020.1 Contig22094uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30009076SMESG000066035.1 SMESG000066029.1 SMESG000066027.1 SMESG000066020.1 Contig25686uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30009076SMESG000066035.1 SMESG000066029.1 SMESG000066027.1 SMESG000066020.1 Contig25686newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30009076SMESG000066035.1 SMESG000066029.1 SMESG000066027.1 SMESG000066020.1 SMESG000046334.1 SMESG000040051.1 Contig25065newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30009076SMESG000066035.1 SMESG000066029.1 SMESG000066027.1 SMESG000066020.1 SMESG000046334.1 SMESG000040051.1 Contig25065uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30009076SMESG000066035.1 SMESG000066029.1 SMESG000066027.1 SMESG000066020.1 Contig9909uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30009076SMESG000066035.1 SMESG000066029.1 SMESG000066027.1 SMESG000066020.1 Contig9909newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30009076SMESG000066035.1 SMESG000066029.1 SMESG000066027.1 SMESG000066020.1 Contig986uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30009076SMESG000066035.1 SMESG000066029.1 SMESG000066027.1 SMESG000066020.1 Contig986newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30009076SMESG000066035.1 SMESG000066029.1 SMESG000066027.1 SMESG000066020.1 Contig8477newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30009076SMESG000066035.1 SMESG000066029.1 SMESG000066027.1 SMESG000066020.1 Contig8477uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30009076SMESG000066035.1 SMESG000066029.1 SMESG000066027.1 SMESG000066020.1 Contig9944newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30009076SMESG000066035.1 SMESG000066029.1 SMESG000066027.1 SMESG000066020.1 Contig9944uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30009076SMESG000066035.1 SMESG000066029.1 SMESG000066027.1 SMESG000066020.1 Contig9561uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30009076SMESG000066035.1 SMESG000066029.1 SMESG000066027.1 SMESG000066020.1 Contig9561newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30009076SMESG000081077.1 Contig986uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30009076SMESG000081077.1 Contig986newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
nervous systemSMED30009076SMESG000066035.1 SMESG000066029.1 SMESG000066027.1 SMESG000066020.1 dd_Smed_v4_90_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30009076SMESG000066035.1 SMESG000066029.1 SMESG000066027.1 SMESG000066020.1 dd_Smed_v4_90_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30009076SMESG000066035.1 SMESG000066029.1 SMESG000066027.1 SMESG000066020.1 dd_Smed_v4_90_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30009076SMESG000066035.1 SMESG000066029.1 SMESG000066027.1 SMESG000066020.1 dd_Smed_v4_90_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30009076SMESG000066035.1 SMESG000066029.1 SMESG000066027.1 SMESG000066020.1 dd_Smed_v4_90_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Actin vs. Ensembl Human
Match: ACTG1 (actin gamma 1 [Source:HGNC Symbol;Acc:HGNC:144])

HSP 1 Score: 753.436 bits (1944), Expect = 0.000e+0
Identity = 363/374 (97.06%), Postives = 370/374 (98.93%), Query Frame = 3
Query:  333 DEEVTALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMXXXXXXXXLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESAGIHETTFNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEITALAPSTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 1454
            +EE+ ALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAVLSLYASGRTTGIV+DSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEM+TAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMES GIHETTFNSIMKCDVDIRKDLYANTVLSGG+TMYPGIADRMQKEITALAPSTMKIKI+APPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IVHRKCF
Sbjct:    2 EEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375          
BLAST of Actin vs. Ensembl Human
Match: ACTG1 (actin gamma 1 [Source:HGNC Symbol;Acc:HGNC:144])

HSP 1 Score: 753.436 bits (1944), Expect = 0.000e+0
Identity = 363/374 (97.06%), Postives = 370/374 (98.93%), Query Frame = 3
Query:  333 DEEVTALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMXXXXXXXXLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESAGIHETTFNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEITALAPSTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 1454
            +EE+ ALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAVLSLYASGRTTGIV+DSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEM+TAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMES GIHETTFNSIMKCDVDIRKDLYANTVLSGG+TMYPGIADRMQKEITALAPSTMKIKI+APPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IVHRKCF
Sbjct:    2 EEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375          
BLAST of Actin vs. Ensembl Human
Match: ACTG1 (actin gamma 1 [Source:HGNC Symbol;Acc:HGNC:144])

HSP 1 Score: 753.436 bits (1944), Expect = 0.000e+0
Identity = 363/374 (97.06%), Postives = 370/374 (98.93%), Query Frame = 3
Query:  333 DEEVTALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMXXXXXXXXLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESAGIHETTFNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEITALAPSTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 1454
            +EE+ ALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAVLSLYASGRTTGIV+DSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEM+TAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMES GIHETTFNSIMKCDVDIRKDLYANTVLSGG+TMYPGIADRMQKEITALAPSTMKIKI+APPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IVHRKCF
Sbjct:    2 EEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375          
BLAST of Actin vs. Ensembl Human
Match: ACTG1 (actin gamma 1 [Source:HGNC Symbol;Acc:HGNC:144])

HSP 1 Score: 753.436 bits (1944), Expect = 0.000e+0
Identity = 363/374 (97.06%), Postives = 370/374 (98.93%), Query Frame = 3
Query:  333 DEEVTALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMXXXXXXXXLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESAGIHETTFNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEITALAPSTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 1454
            +EE+ ALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAVLSLYASGRTTGIV+DSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEM+TAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMES GIHETTFNSIMKCDVDIRKDLYANTVLSGG+TMYPGIADRMQKEITALAPSTMKIKI+APPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IVHRKCF
Sbjct:    2 EEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375          
BLAST of Actin vs. Ensembl Human
Match: ACTG1 (actin gamma 1 [Source:HGNC Symbol;Acc:HGNC:144])

HSP 1 Score: 753.436 bits (1944), Expect = 0.000e+0
Identity = 363/374 (97.06%), Postives = 370/374 (98.93%), Query Frame = 3
Query:  333 DEEVTALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMXXXXXXXXLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESAGIHETTFNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEITALAPSTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 1454
            +EE+ ALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAVLSLYASGRTTGIV+DSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEM+TAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMES GIHETTFNSIMKCDVDIRKDLYANTVLSGG+TMYPGIADRMQKEITALAPSTMKIKI+APPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IVHRKCF
Sbjct:    2 EEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375          
BLAST of Actin vs. Ensembl Celegans
Match: act-4 (Actin-4 [Source:UniProtKB/Swiss-Prot;Acc:P10986])

HSP 1 Score: 754.977 bits (1948), Expect = 0.000e+0
Identity = 363/376 (96.54%), Postives = 372/376 (98.94%), Query Frame = 3
Query:  327 MADEEVTALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMXXXXXXXXLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESAGIHETTFNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEITALAPSTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 1454
            M D+EV ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAVLSLYASGRTTG+VLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEM+TAASSSSLEKSYELPDGQVIT+GNERFRCPEALFQPSFLGMESAGIHET++NSIMKCD+DIRKDLYANTVLSGG+TMYPGIADRMQKEITALAPSTMKIKI+APPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IVHRKCF
Sbjct:    1 MCDDEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGVVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITVGNERFRCPEALFQPSFLGMESAGIHETSYNSIMKCDIDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 376          
BLAST of Actin vs. Ensembl Celegans
Match: act-3 (Actin-3 [Source:UniProtKB/Swiss-Prot;Acc:P0DM42])

HSP 1 Score: 754.207 bits (1946), Expect = 0.000e+0
Identity = 362/376 (96.28%), Postives = 372/376 (98.94%), Query Frame = 3
Query:  327 MADEEVTALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMXXXXXXXXLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESAGIHETTFNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEITALAPSTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 1454
            M D+EV ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAVLSLYASGRTTG+VLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEM+TAASSSSLEKSYELPDGQVIT+GNERFRCPEA+FQPSFLGMESAGIHET++NSIMKCD+DIRKDLYANTVLSGG+TMYPGIADRMQKEITALAPSTMKIKI+APPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IVHRKCF
Sbjct:    1 MCDDEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGVVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITVGNERFRCPEAMFQPSFLGMESAGIHETSYNSIMKCDIDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 376          
BLAST of Actin vs. Ensembl Celegans
Match: act-3 (Actin-3 [Source:UniProtKB/Swiss-Prot;Acc:P0DM42])

HSP 1 Score: 754.207 bits (1946), Expect = 0.000e+0
Identity = 362/376 (96.28%), Postives = 372/376 (98.94%), Query Frame = 3
Query:  327 MADEEVTALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMXXXXXXXXLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESAGIHETTFNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEITALAPSTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 1454
            M D+EV ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAVLSLYASGRTTG+VLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEM+TAASSSSLEKSYELPDGQVIT+GNERFRCPEA+FQPSFLGMESAGIHET++NSIMKCD+DIRKDLYANTVLSGG+TMYPGIADRMQKEITALAPSTMKIKI+APPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IVHRKCF
Sbjct:    1 MCDDEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGVVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITVGNERFRCPEAMFQPSFLGMESAGIHETSYNSIMKCDIDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 376          
BLAST of Actin vs. Ensembl Celegans
Match: act-3 (Actin-3 [Source:UniProtKB/Swiss-Prot;Acc:P0DM42])

HSP 1 Score: 754.207 bits (1946), Expect = 0.000e+0
Identity = 362/376 (96.28%), Postives = 372/376 (98.94%), Query Frame = 3
Query:  327 MADEEVTALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMXXXXXXXXLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESAGIHETTFNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEITALAPSTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 1454
            M D+EV ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAVLSLYASGRTTG+VLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEM+TAASSSSLEKSYELPDGQVIT+GNERFRCPEA+FQPSFLGMESAGIHET++NSIMKCD+DIRKDLYANTVLSGG+TMYPGIADRMQKEITALAPSTMKIKI+APPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IVHRKCF
Sbjct:    1 MCDDEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGVVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITVGNERFRCPEAMFQPSFLGMESAGIHETSYNSIMKCDIDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 376          
BLAST of Actin vs. Ensembl Celegans
Match: act-1 (Actin-1 [Source:UniProtKB/Swiss-Prot;Acc:P0DM41])

HSP 1 Score: 754.207 bits (1946), Expect = 0.000e+0
Identity = 362/376 (96.28%), Postives = 372/376 (98.94%), Query Frame = 3
Query:  327 MADEEVTALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMXXXXXXXXLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESAGIHETTFNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEITALAPSTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 1454
            M D+EV ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAVLSLYASGRTTG+VLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEM+TAASSSSLEKSYELPDGQVIT+GNERFRCPEA+FQPSFLGMESAGIHET++NSIMKCD+DIRKDLYANTVLSGG+TMYPGIADRMQKEITALAPSTMKIKI+APPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IVHRKCF
Sbjct:    1 MCDDEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGVVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITVGNERFRCPEAMFQPSFLGMESAGIHETSYNSIMKCDIDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 376          
BLAST of Actin vs. Ensembl Fly
Match: Act5C (gene:FBgn0000042 transcript:FBtr0070822)

HSP 1 Score: 754.977 bits (1948), Expect = 0.000e+0
Identity = 365/376 (97.07%), Postives = 371/376 (98.67%), Query Frame = 3
Query:  327 MADEEVTALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMXXXXXXXXLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESAGIHETTFNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEITALAPSTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 1454
            M DEEV ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGV+HTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEM+TAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGME+ GIHETT+NSIMKCDVDIRKDLYANTVLSGG+TMYPGIADRMQKEITALAPSTMKIKI+APPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IVHRKCF
Sbjct:    1 MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 376          
BLAST of Actin vs. Ensembl Fly
Match: Act5C (gene:FBgn0000042 transcript:FBtr0100662)

HSP 1 Score: 754.977 bits (1948), Expect = 0.000e+0
Identity = 365/376 (97.07%), Postives = 371/376 (98.67%), Query Frame = 3
Query:  327 MADEEVTALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMXXXXXXXXLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESAGIHETTFNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEITALAPSTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 1454
            M DEEV ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGV+HTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEM+TAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGME+ GIHETT+NSIMKCDVDIRKDLYANTVLSGG+TMYPGIADRMQKEITALAPSTMKIKI+APPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IVHRKCF
Sbjct:    1 MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 376          
BLAST of Actin vs. Ensembl Fly
Match: Act5C (gene:FBgn0000042 transcript:FBtr0345894)

HSP 1 Score: 754.977 bits (1948), Expect = 0.000e+0
Identity = 365/376 (97.07%), Postives = 371/376 (98.67%), Query Frame = 3
Query:  327 MADEEVTALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMXXXXXXXXLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESAGIHETTFNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEITALAPSTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 1454
            M DEEV ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGV+HTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEM+TAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGME+ GIHETT+NSIMKCDVDIRKDLYANTVLSGG+TMYPGIADRMQKEITALAPSTMKIKI+APPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IVHRKCF
Sbjct:    1 MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 376          
BLAST of Actin vs. Ensembl Fly
Match: Act5C (gene:FBgn0000042 transcript:FBtr0070823)

HSP 1 Score: 754.977 bits (1948), Expect = 0.000e+0
Identity = 365/376 (97.07%), Postives = 371/376 (98.67%), Query Frame = 3
Query:  327 MADEEVTALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMXXXXXXXXLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESAGIHETTFNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEITALAPSTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 1454
            M DEEV ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGV+HTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEM+TAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGME+ GIHETT+NSIMKCDVDIRKDLYANTVLSGG+TMYPGIADRMQKEITALAPSTMKIKI+APPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IVHRKCF
Sbjct:    1 MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 376          
BLAST of Actin vs. Ensembl Fly
Match: Act5C (gene:FBgn0000042 transcript:FBtr0100663)

HSP 1 Score: 754.977 bits (1948), Expect = 0.000e+0
Identity = 365/376 (97.07%), Postives = 371/376 (98.67%), Query Frame = 3
Query:  327 MADEEVTALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMXXXXXXXXLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESAGIHETTFNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEITALAPSTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 1454
            M DEEV ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGV+HTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEM+TAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGME+ GIHETT+NSIMKCDVDIRKDLYANTVLSGG+TMYPGIADRMQKEITALAPSTMKIKI+APPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IVHRKCF
Sbjct:    1 MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 376          
BLAST of Actin vs. Ensembl Zebrafish
Match: actb1 (actin, beta 1 [Source:NCBI gene;Acc:57934])

HSP 1 Score: 753.051 bits (1943), Expect = 0.000e+0
Identity = 364/374 (97.33%), Postives = 369/374 (98.66%), Query Frame = 3
Query:  333 DEEVTALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMXXXXXXXXLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESAGIHETTFNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEITALAPSTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 1454
            DEE+ ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAVLSLYASGRTTGIV+DSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEM TAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMES GIHETTFNSIMKCDVDIRKDLYANTVLSGG+TMYPGIADRMQKEIT+LAPSTMKIKI+APPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IVHRKCF
Sbjct:    2 DEEIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMGTAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITSLAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375          
BLAST of Actin vs. Ensembl Zebrafish
Match: actb1 (actin, beta 1 [Source:NCBI gene;Acc:57934])

HSP 1 Score: 753.051 bits (1943), Expect = 0.000e+0
Identity = 364/374 (97.33%), Postives = 369/374 (98.66%), Query Frame = 3
Query:  333 DEEVTALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMXXXXXXXXLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESAGIHETTFNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEITALAPSTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 1454
            DEE+ ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAVLSLYASGRTTGIV+DSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEM TAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMES GIHETTFNSIMKCDVDIRKDLYANTVLSGG+TMYPGIADRMQKEIT+LAPSTMKIKI+APPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IVHRKCF
Sbjct:    2 DEEIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMGTAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITSLAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375          
BLAST of Actin vs. Ensembl Zebrafish
Match: actb2 (actin, beta 2 [Source:NCBI gene;Acc:57935])

HSP 1 Score: 751.51 bits (1939), Expect = 0.000e+0
Identity = 363/374 (97.06%), Postives = 369/374 (98.66%), Query Frame = 3
Query:  333 DEEVTALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMXXXXXXXXLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESAGIHETTFNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEITALAPSTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 1454
            D+E+ ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAVLSLYASGRTTGIV+DSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEM TAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMES GIHETTFNSIMKCDVDIRKDLYANTVLSGG+TMYPGIADRMQKEIT+LAPSTMKIKI+APPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IVHRKCF
Sbjct:    2 DDEIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMGTAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITSLAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375          
BLAST of Actin vs. Ensembl Zebrafish
Match: actb2 (actin, beta 2 [Source:NCBI gene;Acc:57935])

HSP 1 Score: 751.51 bits (1939), Expect = 0.000e+0
Identity = 363/374 (97.06%), Postives = 369/374 (98.66%), Query Frame = 3
Query:  333 DEEVTALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMXXXXXXXXLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESAGIHETTFNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEITALAPSTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 1454
            D+E+ ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAVLSLYASGRTTGIV+DSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEM TAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMES GIHETTFNSIMKCDVDIRKDLYANTVLSGG+TMYPGIADRMQKEIT+LAPSTMKIKI+APPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IVHRKCF
Sbjct:    2 DDEIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMGTAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITSLAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375          
BLAST of Actin vs. Ensembl Zebrafish
Match: actb2 (actin, beta 2 [Source:NCBI gene;Acc:57935])

HSP 1 Score: 751.51 bits (1939), Expect = 0.000e+0
Identity = 363/374 (97.06%), Postives = 369/374 (98.66%), Query Frame = 3
Query:  333 DEEVTALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMXXXXXXXXLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESAGIHETTFNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEITALAPSTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 1454
            D+E+ ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAVLSLYASGRTTGIV+DSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEM TAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMES GIHETTFNSIMKCDVDIRKDLYANTVLSGG+TMYPGIADRMQKEIT+LAPSTMKIKI+APPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IVHRKCF
Sbjct:    2 DDEIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMGTAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITSLAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375          
BLAST of Actin vs. Ensembl Xenopus
Match: actg1 (actin gamma 1 [Source:NCBI gene;Acc:394957])

HSP 1 Score: 755.362 bits (1949), Expect = 0.000e+0
Identity = 365/374 (97.59%), Postives = 370/374 (98.93%), Query Frame = 3
Query:  333 DEEVTALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMXXXXXXXXLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESAGIHETTFNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEITALAPSTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 1454
            DEE+ ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAVLSLYASGRTTGIV+DSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEM+TAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMES GIHETTFNSIMKCDVDIRKDLYANTVLSGG+TMYPGIADRMQKEITALAPSTMKIKI+APPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IVHRKCF
Sbjct:    2 DEEIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375          
BLAST of Actin vs. Ensembl Xenopus
Match: actb (actin, beta [Source:NCBI gene;Acc:407952])

HSP 1 Score: 750.74 bits (1937), Expect = 0.000e+0
Identity = 362/374 (96.79%), Postives = 370/374 (98.93%), Query Frame = 3
Query:  333 DEEVTALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMXXXXXXXXLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESAGIHETTFNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEITALAPSTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 1454
            D+++ ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAVLSLYASGRTTGIV+DSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEM+TAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMES GIHETT+NSIMKCDVDIRKDLYANTVLSGG+TMYPGIADRMQKEITALAPSTMKIKI+APPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IVHRKCF
Sbjct:    2 DDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375          
BLAST of Actin vs. Ensembl Xenopus
Match: rspry1 (ring finger and SPRY domain containing 1 [Source:Xenbase;Acc:XB-GENE-1002344])

HSP 1 Score: 734.947 bits (1896), Expect = 0.000e+0
Identity = 353/374 (94.39%), Postives = 363/374 (97.06%), Query Frame = 3
Query:  333 DEEVTALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMXXXXXXXXLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESAGIHETTFNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEITALAPSTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 1454
            DEE TALV DNGSG+ KAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGI+TNWDDMEKIWHHTFYNELRVAPEEHP LLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVTH VPIYEGYALPHAI+RLDLAGRDLTDYLMKILTERGYSF TTAEREIVRDIKEKLCYVALDFE EM+TAASSSSLEKSYELPDGQVITIGNERFRCPE LFQPSF+GMESAGIHETT+NSIMKCD+DIRKDLYAN VLSGG+TMYPGIADRMQKEITALAPSTMKIKI+APPERKYSVWIGGSILASLSTFQQMWISKQEYDE+GP IVHRKCF
Sbjct:    4 DEETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKANREKMTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTERGYSFVTTAEREIVRDIKEKLCYVALDFENEMATAASSSSLEKSYELPDGQVITIGNERFRCPETLFQPSFIGMESAGIHETTYNSIMKCDIDIRKDLYANNVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDEAGPSIVHRKCF 377          
BLAST of Actin vs. Ensembl Xenopus
Match: acta2 (actin, alpha 2, smooth muscle, aorta [Source:NCBI gene;Acc:496696])

HSP 1 Score: 734.176 bits (1894), Expect = 0.000e+0
Identity = 358/390 (91.79%), Postives = 370/390 (94.87%), Query Frame = 3
Query:  291 LFLN*LKTTL-INMADEE-VTALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMXXXXXXXXLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESAGIHETTFNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEITALAPSTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 1454
            LFL   +T L   M DEE  TALV DNGSG+CKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGI+TNWDDMEKIWHH+FYNELRVAPEEHP LLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVTH VPIYEGYALPHAI+RLDLAGRDLTDYLMKILTERGYSF TTAEREIVRDIKEKLCYVALDFE EM+TAASSSSLEKSYELPDGQVITIGNERFRCPE LFQPSF+GMESAGIHETT+NSIMKCD+DIRKDLYAN VLSGG+TMYPGIADRMQKEITALAPSTMKIKI+APPERKYSVWIGGSILASLSTFQQMWISK EYDE+GP IVHRKCF
Sbjct:    8 LFLARSETELQYKMCDEEDTTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREKMTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTERGYSFVTTAEREIVRDIKEKLCYVALDFENEMATAASSSSLEKSYELPDGQVITIGNERFRCPETLFQPSFIGMESAGIHETTYNSIMKCDIDIRKDLYANNVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKPEYDEAGPSIVHRKCF 397          
BLAST of Actin vs. Ensembl Xenopus
Match: MGC75582 (MGC75582, possible similarity to act2 [Source:NCBI gene;Acc:394982])

HSP 1 Score: 733.791 bits (1893), Expect = 0.000e+0
Identity = 352/374 (94.12%), Postives = 363/374 (97.06%), Query Frame = 3
Query:  333 DEEVTALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMXXXXXXXXLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESAGIHETTFNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEITALAPSTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 1454
            DEE TALV DNGSG+ KAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGI+TNWDDMEKIWHHTFYNELRVAPEEHP LLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVTH VPIYEGYALPHAI+RLDLAGRDLTDYLMKILTERGYSF TTAEREIVRDIKEKLCYVALDFE EM+TAASSSSLEKSYELPDGQVITIGNERFRCPE LFQPSF+GMESAGIHETT+NSIMKCD+DIRKDLYAN VLSGG+TMYPGIADRMQKEITALAPSTMKIKI+APPERKYSVWIGGSILASLSTFQQMWI+KQEYDE+GP IVHRKCF
Sbjct:    4 DEETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKANREKMTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTERGYSFVTTAEREIVRDIKEKLCYVALDFENEMATAASSSSLEKSYELPDGQVITIGNERFRCPETLFQPSFIGMESAGIHETTYNSIMKCDIDIRKDLYANNVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWITKQEYDEAGPSIVHRKCF 377          
BLAST of Actin vs. Ensembl Mouse
Match: Actg1 (actin, gamma, cytoplasmic 1 [Source:MGI Symbol;Acc:MGI:87906])

HSP 1 Score: 753.436 bits (1944), Expect = 0.000e+0
Identity = 363/374 (97.06%), Postives = 370/374 (98.93%), Query Frame = 3
Query:  333 DEEVTALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMXXXXXXXXLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESAGIHETTFNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEITALAPSTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 1454
            +EE+ ALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAVLSLYASGRTTGIV+DSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEM+TAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMES GIHETTFNSIMKCDVDIRKDLYANTVLSGG+TMYPGIADRMQKEITALAPSTMKIKI+APPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IVHRKCF
Sbjct:    2 EEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375          
BLAST of Actin vs. Ensembl Mouse
Match: Actg1 (actin, gamma, cytoplasmic 1 [Source:MGI Symbol;Acc:MGI:87906])

HSP 1 Score: 753.436 bits (1944), Expect = 0.000e+0
Identity = 363/374 (97.06%), Postives = 370/374 (98.93%), Query Frame = 3
Query:  333 DEEVTALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMXXXXXXXXLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESAGIHETTFNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEITALAPSTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 1454
            +EE+ ALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAVLSLYASGRTTGIV+DSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEM+TAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMES GIHETTFNSIMKCDVDIRKDLYANTVLSGG+TMYPGIADRMQKEITALAPSTMKIKI+APPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IVHRKCF
Sbjct:    2 EEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375          
BLAST of Actin vs. Ensembl Mouse
Match: Actb (actin, beta [Source:MGI Symbol;Acc:MGI:87904])

HSP 1 Score: 752.666 bits (1942), Expect = 0.000e+0
Identity = 363/374 (97.06%), Postives = 370/374 (98.93%), Query Frame = 3
Query:  333 DEEVTALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMXXXXXXXXLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESAGIHETTFNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEITALAPSTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 1454
            D+++ ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAVLSLYASGRTTGIV+DSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEM+TAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMES GIHETTFNSIMKCDVDIRKDLYANTVLSGG+TMYPGIADRMQKEITALAPSTMKIKI+APPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IVHRKCF
Sbjct:    2 DDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375          
BLAST of Actin vs. Ensembl Mouse
Match: Actg2 (actin, gamma 2, smooth muscle, enteric [Source:MGI Symbol;Acc:MGI:104589])

HSP 1 Score: 735.332 bits (1897), Expect = 0.000e+0
Identity = 352/376 (93.62%), Postives = 364/376 (96.81%), Query Frame = 3
Query:  327 MADEEVTALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMXXXXXXXXLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESAGIHETTFNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEITALAPSTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 1454
            M +EE TALV DNGSG+CKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGI+TNWDDMEKIWHH+FYNELRVAPEEHP LLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVTH VPIYEGYALPHAI+RLDLAGRDLTDYLMKILTERGYSF TTAEREIVRDIKEKLCYVALDFE EM+TAASSSSLEKSYELPDGQVITIGNERFRCPE LFQPSF+GMESAGIHETT+NSIMKCD+DIRKDLYAN VLSGG+TMYPGIADRMQKEITALAPSTMKIKI+APPERKYSVWIGGSILASLSTFQQMWISK EYDE+GP IVHRKCF
Sbjct:    1 MCEEETTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREKMTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTERGYSFVTTAEREIVRDIKEKLCYVALDFENEMATAASSSSLEKSYELPDGQVITIGNERFRCPETLFQPSFIGMESAGIHETTYNSIMKCDIDIRKDLYANNVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKPEYDEAGPSIVHRKCF 376          
BLAST of Actin vs. Ensembl Mouse
Match: Actg2 (actin, gamma 2, smooth muscle, enteric [Source:MGI Symbol;Acc:MGI:104589])

HSP 1 Score: 735.332 bits (1897), Expect = 0.000e+0
Identity = 352/376 (93.62%), Postives = 364/376 (96.81%), Query Frame = 3
Query:  327 MADEEVTALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMXXXXXXXXLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESAGIHETTFNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEITALAPSTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 1454
            M +EE TALV DNGSG+CKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGI+TNWDDMEKIWHH+FYNELRVAPEEHP LLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVTH VPIYEGYALPHAI+RLDLAGRDLTDYLMKILTERGYSF TTAEREIVRDIKEKLCYVALDFE EM+TAASSSSLEKSYELPDGQVITIGNERFRCPE LFQPSF+GMESAGIHETT+NSIMKCD+DIRKDLYAN VLSGG+TMYPGIADRMQKEITALAPSTMKIKI+APPERKYSVWIGGSILASLSTFQQMWISK EYDE+GP IVHRKCF
Sbjct:    1 MCEEETTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREKMTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTERGYSFVTTAEREIVRDIKEKLCYVALDFENEMATAASSSSLEKSYELPDGQVITIGNERFRCPETLFQPSFIGMESAGIHETTYNSIMKCDIDIRKDLYANNVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKPEYDEAGPSIVHRKCF 376          
BLAST of Actin vs. UniProt/SwissProt
Match: sp|P53471|ACT2_SCHMA (Actin-2 OS=Schistosoma mansoni OX=6183 PE=2 SV=1)

HSP 1 Score: 761.14 bits (1964), Expect = 0.000e+0
Identity = 369/376 (98.14%), Postives = 373/376 (99.20%), Query Frame = 3
Query:  327 MADEEVTALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMXXXXXXXXLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESAGIHETTFNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEITALAPSTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 1454
            MADEEV ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN PAMYV IQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEM+TAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESAG+HETTFNSIMKCDVDIRKDLYANTVLSGG+TM+PGIADRMQKEITALAPSTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF
Sbjct:    1 MADEEVQALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVGIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESAGVHETTFNSIMKCDVDIRKDLYANTVLSGGTTMFPGIADRMQKEITALAPSTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 376          
BLAST of Actin vs. UniProt/SwissProt
Match: sp|P53505|ACT5_XENLA (Actin, cytoplasmic type 5 OS=Xenopus laevis OX=8355 PE=3 SV=1)

HSP 1 Score: 758.444 bits (1957), Expect = 0.000e+0
Identity = 366/376 (97.34%), Postives = 372/376 (98.94%), Query Frame = 3
Query:  327 MADEEVTALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMXXXXXXXXLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESAGIHETTFNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEITALAPSTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 1454
            MADEE+ ALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAVLSLYASGRTTGIV+DSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEM+TAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMES GIHETTFNSIMKCDVDIRKDLYANTVLSGG+TMYPGIADRMQKEITALAPSTMKIKI+APPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IVHRKCF
Sbjct:    1 MADEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 376          
BLAST of Actin vs. UniProt/SwissProt
Match: sp|P53478|ACT5_CHICK (Actin, cytoplasmic type 5 OS=Gallus gallus OX=9031 PE=3 SV=1)

HSP 1 Score: 758.059 bits (1956), Expect = 0.000e+0
Identity = 366/376 (97.34%), Postives = 372/376 (98.94%), Query Frame = 3
Query:  327 MADEEVTALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMXXXXXXXXLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESAGIHETTFNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEITALAPSTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 1454
            MADEE+ ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAVLSLYASGRTTGIV+DSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEM+TAASSSSLEKSYELPDGQVITIGNERFRCPEA+FQPSFLGMES GIHETTFNSIMKCDVDIRKDLYANTVLSGG+TMYPGIADRMQKEITALAPSTMKIKI+APPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IVHRKCF
Sbjct:    1 MADEEIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEAIFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 376          
BLAST of Actin vs. UniProt/SwissProt
Match: sp|P30163|ACT2_ONCVO (Actin-2 OS=Onchocerca volvulus OX=6282 GN=act-2b PE=3 SV=1)

HSP 1 Score: 757.288 bits (1954), Expect = 0.000e+0
Identity = 366/376 (97.34%), Postives = 371/376 (98.67%), Query Frame = 3
Query:  327 MADEEVTALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMXXXXXXXXLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESAGIHETTFNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEITALAPSTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 1454
            M DEEV ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEM+TAASSSSLEKSYELPDGQVIT+GNERFRCPEALFQPSFLGMESAGIHETT+NSIMKCD+DIRKDLYAN VLSGGSTMYPGIADRMQKEITALAPSTMKIKI+APPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IVHRKCF
Sbjct:    1 MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITVGNERFRCPEALFQPSFLGMESAGIHETTYNSIMKCDIDIRKDLYANNVLSGGSTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 376          
BLAST of Actin vs. UniProt/SwissProt
Match: sp|Q26065|ACT_PLAMG (Actin, adductor muscle OS=Placopecten magellanicus OX=6577 PE=2 SV=1)

HSP 1 Score: 755.362 bits (1949), Expect = 0.000e+0
Identity = 365/376 (97.07%), Postives = 372/376 (98.94%), Query Frame = 3
Query:  327 MADEEVTALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMXXXXXXXXLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESAGIHETTFNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEITALAPSTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 1454
            M D+EV ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFE EM+TAASSSSLEKSYELPDGQVITIGNERFRCPE+LFQPSFLGMESAGIHETT+NSIMKCDVDIRKDLYANTVLSGG+TM+PGIADRMQKEITALAPSTMKIKI+APPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IVHRKCF
Sbjct:    1 MCDDEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFENEMATAASSSSLEKSYELPDGQVITIGNERFRCPESLFQPSFLGMESAGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMFPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 376          
BLAST of Actin vs. TrEMBL
Match: A0A0K0ENM6 (BHLH domain-containing protein OS=Strongyloides stercoralis OX=6248 PE=3 SV=1)

HSP 1 Score: 765.377 bits (1975), Expect = 0.000e+0
Identity = 363/381 (95.28%), Postives = 375/381 (98.43%), Query Frame = 3
Query:  312 TTLINMADEEVTALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMXXXXXXXXLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESAGIHETTFNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEITALAPSTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 1454
             +++ M DEEV ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAVLSLYASGRTTG+VLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEM+TAASSSSLEKSYELPDGQVIT+GNERFRCPEA+FQPSFLGMESAGIHE+T+NSIMKCD+DIRKDLYANTVLSGG+TMYPGIADRMQKEITALAPSTMKIKI+APPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IVHRKCF
Sbjct:  232 NSILIMCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGVVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITVGNERFRCPEAMFQPSFLGMESAGIHESTYNSIMKCDIDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 612          
BLAST of Actin vs. TrEMBL
Match: A0A267FNB9 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig032221g3 PE=3 SV=1)

HSP 1 Score: 761.911 bits (1966), Expect = 0.000e+0
Identity = 369/376 (98.14%), Postives = 374/376 (99.47%), Query Frame = 3
Query:  327 MADEEVTALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMXXXXXXXXLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESAGIHETTFNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEITALAPSTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 1454
            M DEEV ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN+PAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEM+TAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMES+GIHETTFNSIMKCDVDIRKDLYANTVLSGG+TMYPGIADRMQKEIT+LAPSTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF
Sbjct:   25 MGDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESSGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITSLAPSTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 400          
BLAST of Actin vs. TrEMBL
Match: A0A4S2LD35 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_008170 PE=3 SV=1)

HSP 1 Score: 761.525 bits (1965), Expect = 0.000e+0
Identity = 368/376 (97.87%), Postives = 373/376 (99.20%), Query Frame = 3
Query:  327 MADEEVTALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMXXXXXXXXLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESAGIHETTFNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEITALAPSTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 1454
            M DE+V ALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEM TA++SSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESAGIHETT+NSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEITALAPSTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF
Sbjct:    1 MGDEDVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMGTASASSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESAGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEITALAPSTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 376          
BLAST of Actin vs. TrEMBL
Match: A0A074Z5S5 (Uncharacterized protein OS=Opisthorchis viverrini OX=6198 GN=T265_09500 PE=3 SV=1)

HSP 1 Score: 761.525 bits (1965), Expect = 0.000e+0
Identity = 368/376 (97.87%), Postives = 373/376 (99.20%), Query Frame = 3
Query:  327 MADEEVTALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMXXXXXXXXLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESAGIHETTFNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEITALAPSTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 1454
            M DE+V ALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEM TA++SSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESAGIHETT+NSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEITALAPSTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF
Sbjct:   44 MGDEDVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMGTASASSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESAGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEITALAPSTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 419          
BLAST of Actin vs. TrEMBL
Match: A0A419PSP4 (Actin-1 OS=Clonorchis sinensis OX=79923 GN=CSKR_10905s PE=3 SV=1)

HSP 1 Score: 761.525 bits (1965), Expect = 0.000e+0
Identity = 368/376 (97.87%), Postives = 373/376 (99.20%), Query Frame = 3
Query:  327 MADEEVTALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMXXXXXXXXLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESAGIHETTFNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEITALAPSTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 1454
            M DE+V ALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEM TA++SSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESAGIHETT+NSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEITALAPSTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF
Sbjct:    1 MGDEDVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMGTASASSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESAGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEITALAPSTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 376          
BLAST of Actin vs. Ensembl Cavefish
Match: actb1 (actin, cytoplasmic 1 [Source:NCBI gene;Acc:103039558])

HSP 1 Score: 753.051 bits (1943), Expect = 0.000e+0
Identity = 364/374 (97.33%), Postives = 369/374 (98.66%), Query Frame = 3
Query:  333 DEEVTALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMXXXXXXXXLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESAGIHETTFNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEITALAPSTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 1454
            DEE+ ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAVLSLYASGRTTGIV+DSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEM TAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMES GIHETTFNSIMKCDVDIRKDLYANTVLSGG+TMYPGIADRMQKEIT+LAPSTMKIKI+APPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IVHRKCF
Sbjct:    2 DEEIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMGTAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITSLAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375          
BLAST of Actin vs. Ensembl Cavefish
Match: actb2 (actin beta [Source:NCBI gene;Acc:103030443])

HSP 1 Score: 751.51 bits (1939), Expect = 0.000e+0
Identity = 363/374 (97.06%), Postives = 369/374 (98.66%), Query Frame = 3
Query:  333 DEEVTALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMXXXXXXXXLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESAGIHETTFNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEITALAPSTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 1454
            D+E+ ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAVLSLYASGRTTGIV+DSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEM TAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMES GIHETTFNSIMKCDVDIRKDLYANTVLSGG+TMYPGIADRMQKEIT+LAPSTMKIKI+APPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IVHRKCF
Sbjct:    2 DDEIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMGTAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITSLAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375          
BLAST of Actin vs. Ensembl Cavefish
Match: actb1 (actin, cytoplasmic 1 [Source:NCBI gene;Acc:103039558])

HSP 1 Score: 748.814 bits (1932), Expect = 0.000e+0
Identity = 362/372 (97.31%), Postives = 367/372 (98.66%), Query Frame = 3
Query:  339 EVTALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMXXXXXXXXLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESAGIHETTFNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEITALAPSTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 1454
            E+ ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAVLSLYASGRTTGIV+DSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEM TAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMES GIHETTFNSIMKCDVDIRKDLYANTVLSGG+TMYPGIADRMQKEIT+LAPSTMKIKI+APPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IVHRKCF
Sbjct:    6 EIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMGTAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITSLAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 377          
BLAST of Actin vs. Ensembl Cavefish
Match: acta2 (actin alpha 2, smooth muscle [Source:NCBI gene;Acc:103040556])

HSP 1 Score: 737.258 bits (1902), Expect = 0.000e+0
Identity = 353/374 (94.39%), Postives = 364/374 (97.33%), Query Frame = 3
Query:  333 DEEVTALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMXXXXXXXXLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESAGIHETTFNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEITALAPSTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 1454
            DEE TALV DNGSG+CKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGI+TNWDDMEKIWHH+FYNELRVAPEEHP LLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVTH VPIYEGYALPHAI+RLDLAGRDLTDYLMKILTERGYSF TTAEREIVRDIKEKLCYVALDFE EM+TAASSSSLEKSYELPDGQVITIGNERFRCPE LFQPSF+GMESAGIHETT+NSIMKCD+DIRKDLYAN VLSGG+TMYPGIADRMQKEITALAPSTMKIKI+APPERKYSVWIGGSILASLSTFQQMWISKQEYDE+GP IVHRKCF
Sbjct:    4 DEESTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREKMTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTERGYSFVTTAEREIVRDIKEKLCYVALDFENEMATAASSSSLEKSYELPDGQVITIGNERFRCPETLFQPSFIGMESAGIHETTYNSIMKCDIDIRKDLYANNVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDEAGPSIVHRKCF 377          
BLAST of Actin vs. Ensembl Cavefish
Match: ENSAMXT00000003590.2 (actin, alpha cardiac-like [Source:NCBI gene;Acc:103024089])

HSP 1 Score: 733.406 bits (1892), Expect = 0.000e+0
Identity = 352/374 (94.12%), Postives = 362/374 (96.79%), Query Frame = 3
Query:  333 DEEVTALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMXXXXXXXXLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESAGIHETTFNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEITALAPSTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 1454
            DEE TALV DNGSG+ KAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGI+TNWDDMEKIWHHTFYNELRVAPEEHP LLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVTH VPIYEGYALPHAI+RLDLAGRDLTDYLMKILTERGYSF TTAEREIVRDIKEKLCYVALDFE EM+TAASSSSLEKSYELPDGQVITIGNERFRCPE LFQPSF+GMESAGIHET +NSIMKCD+DIRKDLYAN VLSGG+TMYPGIADRMQKEITALAPSTMKIKI+APPERKYSVWIGGSILASLSTFQQMWISKQEYDE+GP IVHRKCF
Sbjct:    4 DEETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKANREKMTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTERGYSFVTTAEREIVRDIKEKLCYVALDFENEMATAASSSSLEKSYELPDGQVITIGNERFRCPETLFQPSFIGMESAGIHETAYNSIMKCDIDIRKDLYANNVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDEAGPSIVHRKCF 377          
BLAST of Actin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000011113.1 (pep scaffold:Pmarinus_7.0:GL498954:115:1245:1 gene:ENSPMAG00000010086.1 transcript:ENSPMAT00000011113.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 754.592 bits (1947), Expect = 0.000e+0
Identity = 364/376 (96.81%), Postives = 372/376 (98.94%), Query Frame = 3
Query:  327 MADEEVTALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMXXXXXXXXLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESAGIHETTFNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEITALAPSTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 1454
            MA++E+ ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAVLSLYASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEM+TAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMES GIHETTFNSIMKCDVDIRKDLYANTVLSGG+TMYPGIADRMQKEITALAPSTMKIKI+APPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IVHRKCF
Sbjct:    1 MAEDEIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 376          
BLAST of Actin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004586.1 (pep scaffold:Pmarinus_7.0:GL479516:23873:27955:-1 gene:ENSPMAG00000004161.1 transcript:ENSPMAT00000004586.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 750.355 bits (1936), Expect = 0.000e+0
Identity = 362/376 (96.28%), Postives = 370/376 (98.40%), Query Frame = 3
Query:  327 MADEEVTALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMXXXXXXXXLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESAGIHETTFNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEITALAPSTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 1454
            MA++E+ ALVVDNGSGMCKAGFAGDDAPRAVFPSIVG P HQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAVLSLYASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEM+TAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMES GIHETTFNSIMKCDVDIRKDLYANTVLSGG+TMYPGIADRMQKEITALAPSTMKIKI+APPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IVHRKCF
Sbjct:    1 MAEDEIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGHPLHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 376          
BLAST of Actin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000011230.1 (pep scaffold:Pmarinus_7.0:GL476986:121012:122166:1 gene:ENSPMAG00000010203.1 transcript:ENSPMAT00000011230.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 460.685 bits (1184), Expect = 5.032e-161
Identity = 210/378 (55.56%), Postives = 284/378 (75.13%), Query Frame = 3
Query:  348 ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMV---------GMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMXXXXXXXXLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESAGIHETTFNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEITALAPSTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 1454
            A+V+DNGSG+CKAGFAG++APR   PS+VGRPR +  M+         G G    Y+G +A  +RG+L+L+YP+E GIVT WDDME++W H +  EL   P++ PVLLTEAPLNP  NRE+  Q++FE F APA+++A+QAVLSLYASG  TG+ +  GDGVTH VP++EGY LP A+LR D+AGRD+TD L +IL ERG++F ++AE EIV DIKE++CYVA D+E+E+        L   Y+LPDGQVIT+ ++RFR PE LF P+ +G+++ GIH+  + S+ + D+D+RK LY+N +LSGGS+++PG+ +R+ +E+  LAP    ++I APPERKYSVWIGGSILASLSTFQQMWI+  EY E GP +VHR+C 
Sbjct:    9 AVVMDNGSGLCKAGFAGENAPRFCVPSLVGRPRQRDTMLVSRGLDDAGGSGDGGCYIGRQALCRRGVLSLRYPVERGIVTRWDDMERVWAHAYEAELHARPQDQPVLLTEAPLNPLENREQAAQLLFERFGAPAVHIAVQAVLSLYASGMVTGLAVGVGDGVTHAVPVFEGYGLPRAVLRSDVAGRDVTDNLGRILAERGHAFVSSAEWEIVADIKEQVCYVAGDYEKEL--RRKPEELAVDYKLPDGQVITLHSQRFRAPELLFSPTIVGLDAPGIHQLVWKSVTRSDIDLRKSLYSNILLSGGSSLFPGLDERLWQELAKLAPRGAPVRIFAPPERKYSVWIGGSILASLSTFQQMWITAPEYKEFGPSVVHRRCL 384          
BLAST of Actin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008200.1 (pep scaffold:Pmarinus_7.0:GL477804:3783:17322:1 gene:ENSPMAG00000007412.1 transcript:ENSPMAT00000008200.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 238.81 bits (608), Expect = 9.935e-76
Identity = 126/288 (43.75%), Postives = 177/288 (61.46%), Query Frame = 3
Query:  375 MCKAGFAGDDAPRAVFPSIVGRP--RHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTF-YNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYA-SGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKIL-TERGYSF------TTTAEREIVR--DIKEKLCYVALDFEQEMXXXXXXXXLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESAGIHETTFNSIMKCDVDIR 1199
              K G+AG + P  +FP++VGRP  R    +  +  KD  VGD+A   R +L + YP+E+GIV NWDDM+ +W +TF  ++L V   E  +LLTE P+NP  NREK+ ++MFE +   A+Y+AIQAVL+LYA +G  TG+V+DSGDGVTH  P+YEG++LPH   RLD+AGRD+T YL+K+L     Y F       T+AE E V    ++    +  +     +             +LPDG++I +G ERF  PEALFQP  + +ES G+ E  FN+I   D+D R
Sbjct:    1 FVKCGYAGSNFPEHIFPALVGRPIIRSTAKVGNIEIKDLMVGDDASELRSMLEVNYPMENGIVRNWDDMKHLWDYTFGPDKLNVNTRECKILLTEPPMNPMKNREKIIEVMFEQYGFSAVYIAIQAVLTLYAQAGLLTGVVVDSGDGVTHICPVYEGFSLPHLTRRLDIAGRDITRYLIKVLWLNHSYFFIPVLFRCTSAEWESVNVSSLRRAKLFTIVRVRSFLP------------QLPDGRIIKVGGERFEAPEALFQPHLIDVESVGVAELLFNTIQAADIDTR 276          
BLAST of Actin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003686.1 (pep scaffold:Pmarinus_7.0:GL476472:70600:102044:1 gene:ENSPMAG00000003346.1 transcript:ENSPMAT00000003686.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 231.491 bits (589), Expect = 3.451e-71
Identity = 148/409 (36.19%), Postives = 213/409 (52.08%), Query Frame = 3
Query:  348 ALVVDNGSGMCKAGFAGDDAPRAVFPSI--------VGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRT--------TGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMXXXXXX-XXLEKSYELPDG-----QVITIGNERFRCPEALFQPSFLGME-SAGIHETTFNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEIT----------------ALAPSTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIV-HRKCF 1454
            A  +D  +   K G+AG+  P+ + PS         VG    + VM G+   D ++GDEA  K    T K+PI HGIV +WD ME+      +  LR  PE+H  LLTE PLN   NRE   +IMFE+FN P +Y+A+QAVL+L AS  +        TG V+DSGDGVTH +P+ EGY +   I  + +AGRD+T ++ ++L ER          E  + IKE+  Y+  D  +E S   +  S   K Y   +        I +G ERF  PE  F P F   + +  I E   N I  C +D+R+ LY N VLSGGSTM+     R+Q+++                  + P  + ++++    ++Y+VW GGS+LAS   F Q+  +K++Y+E GP I  H   F
Sbjct:    4 ACTLDKKNRYTKIGYAGNTEPQFIIPSCISIKESAKVGDQSQRRVMKGVDDLDFFIGDEAIEKPNYST-KWPIRHGIVEDWDLMERFMEQVIFKYLRAEPEDHYFLLTEPPLNTPENREYTAEIMFESFNIPGLYIAVQAVLALAASWTSRQVGERTLTGTVIDSGDGVTHVIPVAEGYVIGSCIKHIPIAGRDITYFIQQLLREREVGIPPEQSLETAKVIKERFSYICPDIVKEFSKFDADPSKWMKQYTGINAITKKEFTIDVGYERFLGPEIFFHPEFCNPDFTQPISEVVDNVIQNCPIDVRRPLYKNVVLSGGSTMFRDFGRRLQRDLKRTVDSRLKFSEELSGGRIKPKPIDVQVITHHMQRYAVWFGGSMLASTPEFFQVCHTKKDYEEYGPSICRHNPVF 411          
BLAST of Actin vs. Ensembl Yeast
Match: ACT1 (Actin; structural protein involved in cell polarization, endocytosis, and other cytoskeletal functions [Source:SGD;Acc:S000001855])

HSP 1 Score: 706.442 bits (1822), Expect = 0.000e+0
Identity = 332/374 (88.77%), Postives = 358/374 (95.72%), Query Frame = 3
Query:  333 DEEVTALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMXXXXXXXXLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESAGIHETTFNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEITALAPSTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 1454
            D EV ALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQG+MVGMGQKDSYVGDEAQSKRGILTL+YPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAP+NPK+NREKMTQIMFETFN PA YV+IQAVLSLY+SGRTTGIVLDSGDGVTH VPIY G++LPHAILR+DLAGRDLTDYLMKIL+ERGYSF+TTAEREIVRDIKEKLCYVALDFEQEM TAA SSS+EKSYELPDGQVITIGNERFR PEALF PS LG+ESAGI +TT+NSIMKCDVD+RK+LY N V+SGG+TM+PGIA+RMQKEITALAPS+MK+KI+APPERKYSVWIGGSILASL+TFQQMWISKQEYDESGP IVH KCF
Sbjct:    2 DSEVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRGILTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPMNPKSNREKMTQIMFETFNVPAFYVSIQAVLSLYSSGRTTGIVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSSIEKSYELPDGQVITIGNERFRAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMFPGIAERMQKEITALAPSSMKVKIIAPPERKYSVWIGGSILASLTTFQQMWISKQEYDESGPSIVHHKCF 375          
BLAST of Actin vs. Ensembl Yeast
Match: ARP2 (Essential component of the Arp2/3 complex; Arp2/3 is a highly conserved actin nucleation center required for the motility and integrity of actin patches; involved in endocytosis and membrane growth and polarity; required for efficient Golgi-to-ER trafficking in COPI mutants [Source:SGD;Acc:S000002187])

HSP 1 Score: 362.459 bits (929), Expect = 1.382e-122
Identity = 180/376 (47.87%), Postives = 250/376 (66.49%), Query Frame = 3
Query:  351 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP---RHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEH-PVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMXXXXXXXXLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESAGIHETTFNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEITAL--------APSTM---KIKIVAPPERKYSVWIGGSILAS-LSTFQQMWISKQEYDESGP 1430
            +V+D G+G  K G AG++ P   FPSIVGRP     +   V    KD  +GDEA   R  L + YP+E+GI+ NW DME +W + F+ ++++    +  +LLTE P+NP  NREKM ++MFE ++   +YVAIQAVL+LYA G ++G+V+DSGDGVTH VP+YE   L H   RLD+AGRD+T +L+ +L+ RGY+F  TA+ E VR IKEKLCYV+ D + +   A  +++L +SYELPDG+ I +G ERF  PE LFQP  + +E  G+ E  FN++   DVDIR  LY   VLSGGS+MYPG+  R++KE+  L         PS +   K++I  PP RK+ V+IGG++LAS ++    MW+SKQE+ ESGP
Sbjct:    7 IVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASVATPLKDIMIGDEASEVRSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPSTSNGKILLTEPPMNPLKNREKMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVVDSGDGVTHIVPVYESVVLSHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTALVESYELPDGRTIKVGQERFEAPECLFQPGLVDVEQPGVGELLFNTVQSADVDIRSSLYKAIVLSGGSSMYPGLPSRLEKELKQLWFSRVLHNDPSRLDKFKVRIEDPPRRKHMVFIGGAVLASIMADKDHMWLSKQEWQESGP 382          
BLAST of Actin vs. Ensembl Yeast
Match: ARP1 (Actin-related protein of the dynactin complex; required for spindle orientation and nuclear migration; forms actin-like short filament composed of 9 or 10 Arp1p monomers; putative ortholog of mammalian centractin [Source:SGD;Acc:S000001171])

HSP 1 Score: 360.147 bits (923), Expect = 1.024e-121
Identity = 170/360 (47.22%), Postives = 251/360 (69.72%), Query Frame = 3
Query:  351 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAP-EEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYL-MKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMXXXXX-XXXLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESAGIHETTFNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEITALAPSTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDE 1421
            +V+DNGSG+ KAGF+G++ P+A+   +VG  ++  VM+   Q D+++G+ AQ  RG+L L+YPI+HG+V +WD ME IW +     L++    EHP+L+TEAP+NP  NRE+M Q++FETF+  A+YV+  AVLSLYASGRTTG V+D G+G   TVPIY+G+ALP +++R+D+ G D+T+ L  ++    G S  +++EREIVR +KEK+CY+A + ++E       +  L  +++LPDG+ I +GN+R+R PE LF P  +G+   G+ +    SI K D+D+RK L ++ +LSGG+T   G  DRM  ++ AL   T KIKI+AP ERKY+ WIGGSIL  LSTFQ++W  K ++ E
Sbjct:   15 VVIDNGSGIIKAGFSGEERPKALEYCLVGNTKYDKVMLEGLQGDTFIGNNAQKLRGLLKLRYPIKHGVVEDWDSMELIWSYVLNEVLQLQNIGEHPLLITEAPMNPLKNREQMAQVLFETFDVSALYVSNPAVLSLYASGRTTGCVVDCGEGYCSTVPIYDGFALPASMMRMDIGGADITEQLQFQLRKSAGVSLFSSSEREIVRTMKEKVCYLAKNIKKEEEKYLQGTQDLISTFKLPDGRCIEVGNDRYRAPEILFSPQIIGLGYDGLSDMCMQSIWKVDLDLRKPLLSSIILSGGTTTLKGFGDRMLWDLEALTKGTSKIKIIAPSERKYTTWIGGSILTGLSTFQRLWTKKSDWLE 374          
BLAST of Actin vs. Ensembl Yeast
Match: ARP3 (Essential component of the Arp2/3 complex; Arp2/3 is a highly conserved actin nucleation center required for the motility and integrity of actin patches; involved in endocytosis and membrane growth and polarity [Source:SGD;Acc:S000003826])

HSP 1 Score: 236.113 bits (601), Expect = 8.454e-73
Identity = 154/440 (35.00%), Postives = 234/440 (53.18%), Query Frame = 3
Query:  348 ALVVDNGSGMCKAGFAGDDAPRAVFP--------------SIVGRP-----------------RHQGVMVGM------GQK-----DSYVGDEA--QSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRT--------TGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTT--TAEREIVRDIKEKLCYVALDFEQEMXX-----XXXXXXLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESAGIHETTFN-SIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEITALA--------------PSTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHR 1445
            A+V+DNG+G+ K GFAG+D+P  VFP              S VG P                    G   G+      G++     D Y+G+EA   S+    +L YPI HG V NWD ME+ W ++ +  LR  PE+H  LLTE PLNP  NRE++ +I FE+FN   +Y+A+QAVL+L AS  +        TG V+DSGDGVTH +P+ EGY +  AI  + +AGRD+T ++  +L ERG + T+  TAE+     IK++ CYV  D  +E +      +  +  + ++ E    +V+ IG ERF  PE  F P     +      T  + +I  C +D+RK LY N VLSGGSTM+     R+Q+++ ++                + + + +++  +++ +VW GGS+LA  + F+    +K++Y+E GP IV  
Sbjct:    8 AVVMDNGTGLTKLGFAGNDSPSWVFPTAIATAAPSNTKKSSGVGAPSAVSNEASYFGNSTSATNFNGATGGLLSNNLSGKRGTEDLDFYIGNEALVASQGPSYSLSYPIRHGQVENWDHMERFWENSIFKYLRTEPEDHFFLLTEPPLNPPENREQVAEIFFESFNCAGLYIAVQAVLALAASWTSSKVTDRSLTGTVIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLLRERGEADTSLRTAEK-----IKQEYCYVCPDIVKEFNKFDKDPSKFAQFVVENQEKTRRKVVDIGYERFLAPEIFFNPEIASSDFLTPLPTVVDQTIQACPIDVRKGLYNNIVLSGGSTMFKDFGRRLQRDLKSIVNNRIAQSELLSGTKSTGVDVSVISHRKQRNAVWFGGSLLAQTAEFKGYCHTKKDYEEYGPEIVRN 442          
BLAST of Actin vs. Ensembl Yeast
Match: ARP4 (Nuclear actin-related protein involved in chromatin remodeling; component of chromatin-remodeling enzyme complexes [Source:SGD;Acc:S000003617])

HSP 1 Score: 98.2117 bits (243), Expect = 2.242e-22
Identity = 78/289 (26.99%), Postives = 123/289 (42.56%), Query Frame = 3
Query:  336 EEVTALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEH-PVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKIL-----------TERGYSFTTTA--------------EREIVRDIKEKLCYVALDFEQEMXXXXXXXXLEKSYELPDGQVITIGNE-RFRCPEALFQP 1121
            +EV+A+V+D GS     G++G D P+++ PS+ G+          G K  +        R    LK  IE+G+V +WD  ++ W     NEL +      P LLTE   N   NR+K  +++ E     A Y+A  +    +A+GR   +V+D G       PI +G  L  +  R  +AG+ +   + K L            +R   F                   R   ++ KE LC++      E +    SS+ ++S E P  + I   NE R+   E LF P
Sbjct:   12 DEVSAVVIDPGSYTTNIGYSGSDFPQSILPSVYGK-----YTADEGNKKIFSEQSIGIPRKDYELKPIIENGLVIDWDTAQEQWQWALQNELYLNSNSGIPALLTEPVWNSTENRKKSLEVLLEGMQFEACYLAPTSTCVSFAAGRPNCLVVDIGHDTCSVSPIVDGMTLSKSTRRNFIAGKFINHLIKKALEPKEIIPLFAIKQRKPEFIKKTFDYEVDKSLYDYANNRGFFQECKETLCHICPTKTLEETKTELSSTAKRSIESPWNEEIVFDNETRYGFAEELFLP 295          

HSP 2 Score: 93.5893 bits (231), Expect = 6.413e-21
Identity = 48/118 (40.68%), Postives = 72/118 (61.02%), Query Frame = 3
Query: 1083 NERFRCPEALFQPSFLGMESAGIHETTFNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEITALAPSTMKIKIVAPP---ERKYSVWIGGSILASLSTFQQMWISKQEYDESG 1427
            NE  + P    +P     E  G+ +  ++SIM  DVD+R  L  N VL+GG++  PG++DR+  E+  + PS +K +I+      ER+Y  W+GGSIL SL TF Q+W+ K+EY+E G
Sbjct:  363 NETGKRPLEEEKPPKENNELIGLADLVYSSIMSSDVDLRATLAHNVVLTGGTSSIPGLSDRLMTELNKILPS-LKFRILTTGHTIERQYQSWLGGSILTSLGTFHQLWVGKKEYEEVG 479          
BLAST of Actin vs. Ensembl Nematostella
Match: EDO38520 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SCN8])

HSP 1 Score: 752.666 bits (1942), Expect = 0.000e+0
Identity = 363/376 (96.54%), Postives = 372/376 (98.94%), Query Frame = 3
Query:  327 MADEEVTALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMXXXXXXXXLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESAGIHETTFNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEITALAPSTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 1454
            M D++V ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN+PAMYVAIQAVLSLYASGRTTGIV+DSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEM+TAASSSSLEKSYELPDGQVITIGNERFRCPEA+FQPSFLGMESAGIHETT+NSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEI+ALAP TMKIKI+APPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IVHRKCF
Sbjct:    1 MCDDDVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMTTAASSSSLEKSYELPDGQVITIGNERFRCPEAMFQPSFLGMESAGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEISALAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 376          
BLAST of Actin vs. Ensembl Nematostella
Match: EDO45013 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RU31])

HSP 1 Score: 750.355 bits (1936), Expect = 0.000e+0
Identity = 362/374 (96.79%), Postives = 370/374 (98.93%), Query Frame = 3
Query:  333 DEEVTALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMXXXXXXXXLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESAGIHETTFNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEITALAPSTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 1454
            ++EV ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN+PAMYVAIQAVLSLYASGRTTGIV+DSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEM TAASSSSLEKSYELPDGQVITIGNERFRCPEA+FQPSFLGMESAGIHETT+NSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEIT+LAP TMKIKI+APPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IVHRKCF
Sbjct:    2 EDEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMQTAASSSSLEKSYELPDGQVITIGNERFRCPEAMFQPSFLGMESAGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEITSLAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375          
BLAST of Actin vs. Ensembl Nematostella
Match: EDO37976 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SEA7])

HSP 1 Score: 749.584 bits (1934), Expect = 0.000e+0
Identity = 357/376 (94.95%), Postives = 372/376 (98.94%), Query Frame = 3
Query:  327 MADEEVTALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMXXXXXXXXLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESAGIHETTFNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEITALAPSTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 1454
            MAD+++ ALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN+PAMYVAIQAVLSLYASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEM TAASSSS+EKSYELPDGQVITIGNERFRCPEAL QPSFLGMES+GIHETT+NSIMKCDVDIRKDLYANTV+SGG+TMYPG+ADRMQKEI+ALAPSTMKIKI+APPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IVHRKCF
Sbjct:    1 MADDDIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVMDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMQTAASSSSIEKSYELPDGQVITIGNERFRCPEALLQPSFLGMESSGIHETTYNSIMKCDVDIRKDLYANTVMSGGTTMYPGLADRMQKEISALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPAIVHRKCF 376          
BLAST of Actin vs. Ensembl Nematostella
Match: EDO42646 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S0V7])

HSP 1 Score: 748.814 bits (1932), Expect = 0.000e+0
Identity = 360/374 (96.26%), Postives = 370/374 (98.93%), Query Frame = 3
Query:  333 DEEVTALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMXXXXXXXXLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESAGIHETTFNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEITALAPSTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 1454
            D++V ALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN+PAMYVAIQAVLSLYASGRTTGIV+DSGDGVTHTVPIYEGYALPHAI+RLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEM TAASSSSLEKSYELPDGQVITIGNERFRCPEA+FQPSFLGMESAGIHETT+NSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEIT+LAP TMKIKI+APPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IVHRKCF
Sbjct:    2 DDDVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAIIRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMETAASSSSLEKSYELPDGQVITIGNERFRCPEAMFQPSFLGMESAGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEITSLAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375          
BLAST of Actin vs. Ensembl Nematostella
Match: EDO38006 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SEB1])

HSP 1 Score: 744.577 bits (1921), Expect = 0.000e+0
Identity = 358/374 (95.72%), Postives = 370/374 (98.93%), Query Frame = 3
Query:  333 DEEVTALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMXXXXXXXXLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESAGIHETTFNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEITALAPSTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 1454
            +++V ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN+PAMYVAIQAVLSLYASGRTTGIV+DSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKL YVALDFEQEM+TAA+SSSLEKSYELPDGQVITIGNERFRCPEA+FQPSFLGMESAGIHETT+NSIMKCDVDIRKDLYANTVLSGGSTM+PGIADRMQKEI+ALAP TMKIKI+APPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IVHRKCF
Sbjct:    2 EDDVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLAYVALDFEQEMATAAASSSLEKSYELPDGQVITIGNERFRCPEAMFQPSFLGMESAGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMFPGIADRMQKEISALAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375          
BLAST of Actin vs. Ensembl Medaka
Match: ENSORLT00000011677.2 (actin, cytoplasmic 2 [Source:NCBI gene;Acc:101168921])

HSP 1 Score: 754.977 bits (1948), Expect = 0.000e+0
Identity = 365/384 (95.05%), Postives = 374/384 (97.40%), Query Frame = 3
Query:  309 KTTLINMA--DEEVTALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMXXXXXXXXLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESAGIHETTFNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEITALAPSTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 1454
            +T +I M   +EE+ ALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAVLSLYASGRTTGIV+DSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEM TAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMES GIHETTFNSIMKCDVDIRKDLYANTVLSGG+TMYPGIADRMQKEITALAP+TMKIKI+APPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IVHRKCF
Sbjct:   27 RTVMIQMPKMEEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMGTAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPTTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 410          
BLAST of Actin vs. Ensembl Medaka
Match: ENSORLT00000029375.1 (actin, cytoplasmic 2 [Source:NCBI gene;Acc:101168921])

HSP 1 Score: 750.74 bits (1937), Expect = 0.000e+0
Identity = 362/374 (96.79%), Postives = 369/374 (98.66%), Query Frame = 3
Query:  333 DEEVTALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMXXXXXXXXLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESAGIHETTFNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEITALAPSTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 1454
            +EE+ ALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAVLSLYASGRTTGIV+DSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEM TAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMES GIHETTFNSIMKCDVDIRKDLYANTVLSGG+TMYPGIADRMQKEITALAP+TMKIKI+APPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IVHRKCF
Sbjct:    2 EEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMGTAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPTTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375          
BLAST of Actin vs. Ensembl Medaka
Match: actb (cytoplasmic actin OlCA1 [Source:NCBI gene;Acc:100049433])

HSP 1 Score: 750.355 bits (1936), Expect = 0.000e+0
Identity = 361/374 (96.52%), Postives = 370/374 (98.93%), Query Frame = 3
Query:  333 DEEVTALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMXXXXXXXXLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESAGIHETTFNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEITALAPSTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 1454
            D+++ ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELR+APEEHPVLLTEAPLNPKANREKMTQIMFETFN+PAMYVAIQAVLSLYASGRTTGIV+DSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEM TAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMES GIHETT+NSIMKCDVDIRKDLYANTVLSGG+TMYPGIADRMQKEITALAPSTMKIKI+APPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IVHRKCF
Sbjct:    2 DDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRIAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMGTAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375          
BLAST of Actin vs. Ensembl Medaka
Match: actb (cytoplasmic actin OlCA1 [Source:NCBI gene;Acc:100049433])

HSP 1 Score: 750.355 bits (1936), Expect = 0.000e+0
Identity = 361/374 (96.52%), Postives = 370/374 (98.93%), Query Frame = 3
Query:  333 DEEVTALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMXXXXXXXXLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESAGIHETTFNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEITALAPSTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 1454
            D+++ ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELR+APEEHPVLLTEAPLNPKANREKMTQIMFETFN+PAMYVAIQAVLSLYASGRTTGIV+DSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEM TAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMES GIHETT+NSIMKCDVDIRKDLYANTVLSGG+TMYPGIADRMQKEITALAPSTMKIKI+APPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IVHRKCF
Sbjct:    4 DDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRIAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMGTAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 377          
BLAST of Actin vs. Ensembl Medaka
Match: ENSORLT00000021726.2 (actin, cytoplasmic [Source:NCBI gene;Acc:101155523])

HSP 1 Score: 748.814 bits (1932), Expect = 0.000e+0
Identity = 361/374 (96.52%), Postives = 371/374 (99.20%), Query Frame = 3
Query:  333 DEEVTALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMXXXXXXXXLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESAGIHETTFNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEITALAPSTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 1454
            +++V+ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN+PAMYVAIQAVLSLYASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEM TAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESAGIHETT+NSIMKCDVDIRKDLYANTVLSGG+TMYPGIADRMQKEITALAP TMKIKI+APPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IVHRKCF
Sbjct:    2 EDDVSALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVMDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMQTAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESAGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPAIVHRKCF 375          
BLAST of Actin vs. Planmine SMEST
Match: SMESG000066035.1 (SMESG000066035.1)

HSP 1 Score: 769.229 bits (1985), Expect = 0.000e+0
Identity = 374/376 (99.47%), Postives = 376/376 (100.00%), Query Frame = 3
Query:  327 MADEEVTALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMXXXXXXXXLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESAGIHETTFNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEITALAPSTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 1454
            MADEEVTALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEM+TAASSSSLEKSYELPDGQVITIGNERFRCPE+LFQPSFLGMESAGIHETTFNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEITALAPSTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF
Sbjct:    1 MADEEVTALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPESLFQPSFLGMESAGIHETTFNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEITALAPSTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 376          
BLAST of Actin vs. Planmine SMEST
Match: SMESG000066029.1 (SMESG000066029.1)

HSP 1 Score: 767.303 bits (1980), Expect = 0.000e+0
Identity = 373/376 (99.20%), Postives = 375/376 (99.73%), Query Frame = 3
Query:  327 MADEEVTALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMXXXXXXXXLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESAGIHETTFNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEITALAPSTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 1454
            MADEEVTALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEM+TAASSSSLEKSYELPDGQVITIGNERFRCPE+LFQPSFLGMESAGIHETTFNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEITALAPSTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF
Sbjct:    1 MADEEVTALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPESLFQPSFLGMESAGIHETTFNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEITALAPSTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 376          
BLAST of Actin vs. Planmine SMEST
Match: SMESG000066027.1 (SMESG000066027.1)

HSP 1 Score: 767.303 bits (1980), Expect = 0.000e+0
Identity = 373/376 (99.20%), Postives = 375/376 (99.73%), Query Frame = 3
Query:  327 MADEEVTALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMXXXXXXXXLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESAGIHETTFNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEITALAPSTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 1454
            MADEEVTALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEM+TAASSSSLEKSYELPDGQVITIGNERFRCPE+LFQPSFLGMESAGIHETTFNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEITALAPSTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF
Sbjct:    1 MADEEVTALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPESLFQPSFLGMESAGIHETTFNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEITALAPSTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 376          
BLAST of Actin vs. Planmine SMEST
Match: SMESG000066020.1 (SMESG000066020.1)

HSP 1 Score: 766.918 bits (1979), Expect = 0.000e+0
Identity = 373/376 (99.20%), Postives = 376/376 (100.00%), Query Frame = 3
Query:  327 MADEEVTALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMXXXXXXXXLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESAGIHETTFNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEITALAPSTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 1454
            MADE+V+ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMSTAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESAGIHETTFNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEIT+LAPSTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF
Sbjct:    1 MADEDVSALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMSTAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESAGIHETTFNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEITSLAPSTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 376          
BLAST of Actin vs. Planmine SMEST
Match: SMESG000058003.1 (SMESG000058003.1)

HSP 1 Score: 761.14 bits (1964), Expect = 0.000e+0
Identity = 368/376 (97.87%), Postives = 376/376 (100.00%), Query Frame = 3
Query:  327 MADEEVTALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMXXXXXXXXLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESAGIHETTFNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEITALAPSTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 1454
            M+DE+++ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMSTAASSSSLEKSYELPDGQVITIGNERFRCPE+LFQP+FLGMESAGIHETTFNSIMKCDVDIRKDLYANTVLSGGSTM+PGIADRMQKEIT+LAPSTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF
Sbjct:    1 MSDEDISALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMSTAASSSSLEKSYELPDGQVITIGNERFRCPESLFQPAFLGMESAGIHETTFNSIMKCDVDIRKDLYANTVLSGGSTMFPGIADRMQKEITSLAPSTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 376          
The following BLAST results are available for this feature:
BLAST of Actin vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ACTG10.000e+097.06actin gamma 1 [Source:HGNC Symbol;Acc:HGNC:144][more]
ACTG10.000e+097.06actin gamma 1 [Source:HGNC Symbol;Acc:HGNC:144][more]
ACTG10.000e+097.06actin gamma 1 [Source:HGNC Symbol;Acc:HGNC:144][more]
ACTG10.000e+097.06actin gamma 1 [Source:HGNC Symbol;Acc:HGNC:144][more]
ACTG10.000e+097.06actin gamma 1 [Source:HGNC Symbol;Acc:HGNC:144][more]
back to top
BLAST of Actin vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
act-40.000e+096.54Actin-4 [Source:UniProtKB/Swiss-Prot;Acc:P10986][more]
act-30.000e+096.28Actin-3 [Source:UniProtKB/Swiss-Prot;Acc:P0DM42][more]
act-30.000e+096.28Actin-3 [Source:UniProtKB/Swiss-Prot;Acc:P0DM42][more]
act-30.000e+096.28Actin-3 [Source:UniProtKB/Swiss-Prot;Acc:P0DM42][more]
act-10.000e+096.28Actin-1 [Source:UniProtKB/Swiss-Prot;Acc:P0DM41][more]
back to top
BLAST of Actin vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Act5C0.000e+097.07gene:FBgn0000042 transcript:FBtr0070822[more]
Act5C0.000e+097.07gene:FBgn0000042 transcript:FBtr0100662[more]
Act5C0.000e+097.07gene:FBgn0000042 transcript:FBtr0345894[more]
Act5C0.000e+097.07gene:FBgn0000042 transcript:FBtr0070823[more]
Act5C0.000e+097.07gene:FBgn0000042 transcript:FBtr0100663[more]
back to top
BLAST of Actin vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
actb10.000e+097.33actin, beta 1 [Source:NCBI gene;Acc:57934][more]
actb10.000e+097.33actin, beta 1 [Source:NCBI gene;Acc:57934][more]
actb20.000e+097.06actin, beta 2 [Source:NCBI gene;Acc:57935][more]
actb20.000e+097.06actin, beta 2 [Source:NCBI gene;Acc:57935][more]
actb20.000e+097.06actin, beta 2 [Source:NCBI gene;Acc:57935][more]
back to top
BLAST of Actin vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
actg10.000e+097.59actin gamma 1 [Source:NCBI gene;Acc:394957][more]
actb0.000e+096.79actin, beta [Source:NCBI gene;Acc:407952][more]
rspry10.000e+094.39ring finger and SPRY domain containing 1 [Source:X... [more]
acta20.000e+091.79actin, alpha 2, smooth muscle, aorta [Source:NCBI ... [more]
MGC755820.000e+094.12MGC75582, possible similarity to act2 [Source:NCBI... [more]
back to top
BLAST of Actin vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Actg10.000e+097.06actin, gamma, cytoplasmic 1 [Source:MGI Symbol;Acc... [more]
Actg10.000e+097.06actin, gamma, cytoplasmic 1 [Source:MGI Symbol;Acc... [more]
Actb0.000e+097.06actin, beta [Source:MGI Symbol;Acc:MGI:87904][more]
Actg20.000e+093.62actin, gamma 2, smooth muscle, enteric [Source:MGI... [more]
Actg20.000e+093.62actin, gamma 2, smooth muscle, enteric [Source:MGI... [more]
back to top
BLAST of Actin vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P53471|ACT2_SCHMA0.000e+098.14Actin-2 OS=Schistosoma mansoni OX=6183 PE=2 SV=1[more]
sp|P53505|ACT5_XENLA0.000e+097.34Actin, cytoplasmic type 5 OS=Xenopus laevis OX=835... [more]
sp|P53478|ACT5_CHICK0.000e+097.34Actin, cytoplasmic type 5 OS=Gallus gallus OX=9031... [more]
sp|P30163|ACT2_ONCVO0.000e+097.34Actin-2 OS=Onchocerca volvulus OX=6282 GN=act-2b P... [more]
sp|Q26065|ACT_PLAMG0.000e+097.07Actin, adductor muscle OS=Placopecten magellanicus... [more]
back to top
BLAST of Actin vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0K0ENM60.000e+095.28BHLH domain-containing protein OS=Strongyloides st... [more]
A0A267FNB90.000e+098.14Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
A0A4S2LD350.000e+097.87Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A074Z5S50.000e+097.87Uncharacterized protein OS=Opisthorchis viverrini ... [more]
A0A419PSP40.000e+097.87Actin-1 OS=Clonorchis sinensis OX=79923 GN=CSKR_10... [more]
back to top
BLAST of Actin vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
actb10.000e+097.33actin, cytoplasmic 1 [Source:NCBI gene;Acc:1030395... [more]
actb20.000e+097.06actin beta [Source:NCBI gene;Acc:103030443][more]
actb10.000e+097.31actin, cytoplasmic 1 [Source:NCBI gene;Acc:1030395... [more]
acta20.000e+094.39actin alpha 2, smooth muscle [Source:NCBI gene;Acc... [more]
ENSAMXT00000003590.20.000e+094.12actin, alpha cardiac-like [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of Actin vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000011113.10.000e+096.81pep scaffold:Pmarinus_7.0:GL498954:115:1245:1 gene... [more]
ENSPMAT00000004586.10.000e+096.28pep scaffold:Pmarinus_7.0:GL479516:23873:27955:-1 ... [more]
ENSPMAT00000011230.15.032e-16155.56pep scaffold:Pmarinus_7.0:GL476986:121012:122166:1... [more]
ENSPMAT00000008200.19.935e-7643.75pep scaffold:Pmarinus_7.0:GL477804:3783:17322:1 ge... [more]
ENSPMAT00000003686.13.451e-7136.19pep scaffold:Pmarinus_7.0:GL476472:70600:102044:1 ... [more]
back to top
BLAST of Actin vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
ACT10.000e+088.77Actin; structural protein involved in cell polariz... [more]
ARP21.382e-12247.87Essential component of the Arp2/3 complex; Arp2/3 ... [more]
ARP11.024e-12147.22Actin-related protein of the dynactin complex; req... [more]
ARP38.454e-7335.00Essential component of the Arp2/3 complex; Arp2/3 ... [more]
ARP42.242e-2226.99Nuclear actin-related protein involved in chromati... [more]
back to top
BLAST of Actin vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO385200.000e+096.54Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO450130.000e+096.79Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO379760.000e+094.95Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO426460.000e+096.26Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO380060.000e+095.72Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Actin vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000011677.20.000e+095.05actin, cytoplasmic 2 [Source:NCBI gene;Acc:1011689... [more]
ENSORLT00000029375.10.000e+096.79actin, cytoplasmic 2 [Source:NCBI gene;Acc:1011689... [more]
actb0.000e+096.52cytoplasmic actin OlCA1 [Source:NCBI gene;Acc:1000... [more]
actb0.000e+096.52cytoplasmic actin OlCA1 [Source:NCBI gene;Acc:1000... [more]
ENSORLT00000021726.20.000e+096.52actin, cytoplasmic [Source:NCBI gene;Acc:101155523... [more]
back to top
BLAST of Actin vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000066035.10.000e+099.47SMESG000066035.1[more]
SMESG000066029.10.000e+099.20SMESG000066029.1[more]
SMESG000066027.10.000e+099.20SMESG000066027.1[more]
SMESG000066020.10.000e+099.20SMESG000066020.1[more]
SMESG000058003.10.000e+097.87SMESG000058003.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30009076 ID=SMED30009076|Name=Actin|organism=Schmidtea mediterranea sexual|type=transcript|length=1515bp
GTTTGTTCGAGGTGGCCTCGATCAAACAGGAAAATCGTAAACACATACAA
ACACAGACACACACATACAGAAACATAATCAAAGGAAAGATAAACACGCA
CACAGACAACGTTCAGAAATTCCAATAGTTCATCAATCCCATTCCGCTAT
TGGTTGTGTTAGAAACACGCGAAACTGATACAGTAACTGAATTAGTCAGT
GCACAGATTCTCGATTTTGATATTGCTAAATGATCATGTCTAAATTAGGA
GAATATATGATTCATCTACAACTATATAAATGGGAGAAAATTATTTTTGA
ATTAGTTAAAAACAACTTTAATAAACATGGCAGATGAAGAAGTAACCGCT
CTCGTTGTTGACAACGGATCTGGAATGTGCAAAGCCGGTTTCGCCGGAGA
TGATGCTCCACGAGCTGTGTTTCCATCTATTGTTGGCAGACCTCGTCATC
AAGGTGTCATGGTCGGTATGGGACAGAAAGACAGCTATGTCGGAGATGAA
GCTCAATCGAAGAGAGGTATTCTTACTTTGAAATACCCAATCGAACACGG
TATCGTTACCAATTGGGACGATATGGAGAAAATCTGGCATCATACTTTCT
ACAATGAATTGAGAGTAGCTCCAGAAGAACACCCAGTGTTGTTGACTGAA
GCTCCACTCAATCCAAAAGCCAACAGAGAGAAGATGACTCAAATCATGTT
TGAAACCTTCAATGCCCCAGCTATGTATGTTGCCATACAAGCTGTGTTGT
CATTGTATGCTTCTGGAAGAACAACTGGTATCGTTTTGGATTCAGGAGAT
GGTGTTACACACACTGTACCAATCTACGAAGGGTATGCTTTACCTCACGC
TATTTTGCGTTTGGATTTGGCCGGTAGAGATTTGACCGATTACTTGATGA
AGATCTTGACTGAAAGAGGTTACAGTTTCACCACCACTGCCGAAAGAGAA
ATCGTTCGAGATATCAAAGAGAAATTGTGTTACGTTGCTCTTGATTTCGA
GCAAGAAATGTCAACTGCAGCTTCAAGCAGTAGCTTAGAAAAAAGCTATG
AATTACCAGATGGACAAGTCATTACCATTGGCAATGAGAGATTCCGTTGC
CCAGAAGCTCTTTTCCAACCATCATTCTTGGGTATGGAATCTGCTGGAAT
TCATGAAACCACATTCAACAGTATCATGAAATGCGATGTCGATATTAGAA
AGGACTTGTATGCTAACACCGTTTTGTCAGGTGGTAGCACCATGTACCCT
GGTATTGCTGATCGTATGCAGAAAGAAATCACTGCTCTTGCACCAAGCAC
CATGAAGATCAAGATTGTCGCTCCACCAGAAAGAAAATACTCTGTCTGGA
TCGGTGGTTCGATTTTGGCTTCATTGTCCACTTTCCAACAAATGTGGATC
TCAAAACAAGAATATGACGAATCCGGACCTGGAATCGTTCACCGAAAATG
CTTCTAAATAGGATTTTTTGATTTTTGGCTTTTAGTTTTAACTAACGCTA
TTATTTAATTAATAA
back to top

protein sequence of SMED30009076-orf-1

>SMED30009076-orf-1 ID=SMED30009076-orf-1|Name=SMED30009076-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=377bp
MADEEVTALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQ
KDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPE
EHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTT
GIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYS
FTTTAEREIVRDIKEKLCYVALDFEQEMSTAASSSSLEKSYELPDGQVIT
IGNERFRCPEALFQPSFLGMESAGIHETTFNSIMKCDVDIRKDLYANTVL
SGGSTMYPGIADRMQKEITALAPSTMKIKIVAPPERKYSVWIGGSILASL
STFQQMWISKQEYDESGPGIVHRKCF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000019muscle progenitor cell
PLANA:0000020protonephridia
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000428musculature system
PLANA:0000478pharynx musculature
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR043129ATPase_NBD
IPR004000Actin
IPR004001Actin_CS
IPR020902Actin/actin-like_CS
Vocabulary: molecular function
TermDefinition
GO:0000166nucleotide binding
GO:0005524ATP binding
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0005856cytoskeleton
GO:0005886plasma membrane
GO:0005925focal adhesion
GO:0097433dense body
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR004000Actin familyPRINTSPR00190ACTINcoord: 62..84
score: 94.91
coord: 50..61
score: 92.79
coord: 116..129
score: 97.31
coord: 27..36
score: 96.55
coord: 141..160
score: 96.3
coord: 237..253
score: 91.95
IPR004000Actin familySMARTSM00268actin_3coord: 6..376
e-value: 6.8E-241
score: 816.2
IPR004000Actin familyPFAMPF00022Actincoord: 4..376
e-value: 2.6E-151
score: 503.9
IPR004000Actin familyPANTHERPTHR11937ACTINcoord: 5..374
NoneNo IPR availableGENE3DG3DSA:3.30.420.40coord: 139..339
e-value: 5.2E-192
score: 639.3
NoneNo IPR availableGENE3DG3DSA:3.30.420.40coord: 9..372
e-value: 5.2E-192
score: 639.3
NoneNo IPR availableGENE3DG3DSA:3.90.640.10coord: 181..273
e-value: 5.2E-192
score: 639.3
NoneNo IPR availablePANTHERPTHR11937:SF243ACTIN, CYTOPLASMIC TYPE 5coord: 5..374
NoneNo IPR availableCDDcd00012NBD_sugar-kinase_HSP70_actincoord: 9..182
e-value: 1.474E-20
score: 86.1035
IPR004001Actin, conserved sitePROSITEPS00406ACTINS_1coord: 54..64
IPR004001Actin, conserved sitePROSITEPS00432ACTINS_2coord: 357..365
IPR020902Actin/actin-like conserved sitePROSITEPS01132ACTINS_ACT_LIKEcoord: 105..117
IPR043129ATPase, nucleotide binding domainSUPERFAMILYSSF53067Actin-like ATPase domaincoord: 148..376
IPR043129ATPase, nucleotide binding domainSUPERFAMILYSSF53067Actin-like ATPase domaincoord: 5..154