Protein phosphatase 1B

Overview
NameProtein phosphatase 1B
Smed IDSMED30009072
Length (bp)1270
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Protein phosphatase 1B (SMED30009072) t-SNE clustered cells

Violin plots show distribution of expression levels for Protein phosphatase 1B (SMED30009072) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Homology
BLAST of Protein phosphatase 1B vs. Ensembl Human
Match: PPM1A (protein phosphatase, Mg2+/Mn2+ dependent 1A [Source:HGNC Symbol;Acc:HGNC:9275])

HSP 1 Score: 277.33 bits (708), Expect = 1.974e-89
Identity = 153/374 (40.91%), Postives = 222/374 (59.36%), Query Frame = 2
Query:  104 MGSYNGKPNTEKYNESGKFGDIYYSSSSMQGMRSHMEDFQCISLNLPYPFEDWAYFAIFDGHGGYRVSELCSXXXXXXXXXXXXFKNINLLNLDKSQIINGIKKAFISLDDKISHFSE--------GTTVSAVFITPNYLIFMNCGDSRSVLIRESDIFFSSIDHKPTNPLEKERILKAGGQITMDRLNGNMSVSRALGDSYYKKDYNLSAFEQLMSAEPDVYIISRNSENDQIIVLACDGVWDVFSNTELKQLLLQRFKCTDDLVKISDELIDAALYKGSKDNISAIIVAFVNAPKVESECQR----LDRLLD---ENIINKTMXXXXXXXXXXXXXXLIEYMKNIALEN---LPPGG-IVSKQSIIVNLFEK 1168
            MG++  KP  EK+N  G+   + Y  SSMQG R  MED     + LP   E W++FA++DGH G +V++ C   LL+ I   ++FK  +        + NGI+  F+ +D+ +   SE        G+T   V I+P +  F+NCGDSR +L R   + F + DHKP+NPLEKERI  AGG + + R+NG+++VSRALGD  YK  +     EQL+S EP+V+ I R+ E+DQ I+LACDG+WDV  N EL   +  R + TDDL K+ +E++D  LYKGS+DN+S I++ F NAPKV  E  +    LD+ L+   E II K             + DL+  M+ +A EN   LPPGG + SK+++I  ++ +
Sbjct:    1 MGAFLDKPKMEKHNAQGQGNGLRYGLSSMQGWRVEMEDAHTAVIGLPSGLESWSFFAVYDGHAGSQVAKYCCEHLLDHITNNQDFKG-SAGAPSVENVKNGIRTGFLEIDEHMRVMSEKKHGADRSGSTAVGVLISPQHTYFINCGDSRGLLCRNRKVHFFTQDHKPSNPLEKERIQNAGGSVMIQRVNGSLAVSRALGDFDYKCVHGKGPTEQLVSPEPEVHDIERSEEDDQFIILACDGIWDVMGNEELCDFVRSRLEVTDDLEKVCNEVVDTCLYKGSRDNMSVILICFPNAPKVSPEAVKKEAELDKYLECRVEEIIKKQ---------GEGVPDLVHVMRTLASENIPSLPPGGELASKRNVIEAVYNR 364          
BLAST of Protein phosphatase 1B vs. Ensembl Human
Match: PPM1B (protein phosphatase, Mg2+/Mn2+ dependent 1B [Source:HGNC Symbol;Acc:HGNC:9276])

HSP 1 Score: 277.33 bits (708), Expect = 2.280e-89
Identity = 153/371 (41.24%), Postives = 230/371 (61.99%), Query Frame = 2
Query:  104 MGSYNGKPNTEKYNESGKFGDIYYSSSSMQGMRSHMEDFQCISLNLPYPFEDWAYFAIFDGHGGYRVSELCSXXXXXXXXXXXXF----KNINLLNLDKSQIINGIKKAFISLDDKISHFSE--------GTTVSAVFITPNYLIFMNCGDSRSVLIRESDIFFSSIDHKPTNPLEKERILKAGGQITMDRLNGNMSVSRALGDSYYKKDYNLSAFEQLMSAEPDVYIISRNSENDQIIVLACDGVWDVFSNTELKQLLLQRFKCTDDLVKISDELIDAALYKGSKDNISAIIVAFVNAPKVESECQRLDRLLDENIINKTMXXXXXXXXXXXXXXLIEYMKNIALE---NLPP-GGIVSKQSIIVNLFEK 1168
            MG++  KP TEK+N  G    + Y  SSMQG R  MED     + +P+  EDW++FA++DGH G RV+  CS  LL  I   E+F    K+ + L L    + NGI+  F+ +D+ + +FS+        G+T   V I+P ++ F+NCGDSR+VL R   + FS+ DHKP NP EKERI  AGG + + R+NG+++VSRALGD  YK        EQL+S EP+VY I R +E D+ I+LACDG+WDV SN EL + +  R + +DDL  + + ++D  L+KGS+DN+S ++V F NAPKV  E  + D  LD+++ ++ +E +  +S +  + DL   M+ ++ E   NLPP GG+  K+++I  ++ +
Sbjct:    1 MGAFLDKPKTEKHNAHGAGNGLRYGLSSMQGWRVEMEDAHTAVVGIPHGLEDWSFFAVYDGHAGSRVANYCSTHLLEHITTNEDFRAAGKSGSALELSVENVKNGIRTGFLKIDEYMRNFSDLRNGMDRSGSTAVGVMISPKHIYFINCGDSRAVLYRNGQVCFSTQDHKPCNPREKERIQNAGGSVMIQRVNGSLAVSRALGDYDYKCVDGKGPTEQLVSPEPEVYEILR-AEEDEFIILACDGIWDVMSNEELCEYVKSRLEVSDDLENVCNWVVDTCLHKGSRDNMSIVLVCFSNAPKVSDEAVKKDSELDKHLESR-VEEIMEKSGEEGMPDLAHVMRILSAENIPNLPPGGGLAGKRNVIEAVYSR 369          
BLAST of Protein phosphatase 1B vs. Ensembl Human
Match: PPM1B (protein phosphatase, Mg2+/Mn2+ dependent 1B [Source:HGNC Symbol;Acc:HGNC:9276])

HSP 1 Score: 277.33 bits (708), Expect = 2.288e-89
Identity = 153/371 (41.24%), Postives = 230/371 (61.99%), Query Frame = 2
Query:  104 MGSYNGKPNTEKYNESGKFGDIYYSSSSMQGMRSHMEDFQCISLNLPYPFEDWAYFAIFDGHGGYRVSELCSXXXXXXXXXXXXF----KNINLLNLDKSQIINGIKKAFISLDDKISHFSE--------GTTVSAVFITPNYLIFMNCGDSRSVLIRESDIFFSSIDHKPTNPLEKERILKAGGQITMDRLNGNMSVSRALGDSYYKKDYNLSAFEQLMSAEPDVYIISRNSENDQIIVLACDGVWDVFSNTELKQLLLQRFKCTDDLVKISDELIDAALYKGSKDNISAIIVAFVNAPKVESECQRLDRLLDENIINKTMXXXXXXXXXXXXXXLIEYMKNIALE---NLPP-GGIVSKQSIIVNLFEK 1168
            MG++  KP TEK+N  G    + Y  SSMQG R  MED     + +P+  EDW++FA++DGH G RV+  CS  LL  I   E+F    K+ + L L    + NGI+  F+ +D+ + +FS+        G+T   V I+P ++ F+NCGDSR+VL R   + FS+ DHKP NP EKERI  AGG + + R+NG+++VSRALGD  YK        EQL+S EP+VY I R +E D+ I+LACDG+WDV SN EL + +  R + +DDL  + + ++D  L+KGS+DN+S ++V F NAPKV  E  + D  LD+++ ++ +E +  +S +  + DL   M+ ++ E   NLPP GG+  K+++I  ++ +
Sbjct:    1 MGAFLDKPKTEKHNAHGAGNGLRYGLSSMQGWRVEMEDAHTAVVGIPHGLEDWSFFAVYDGHAGSRVANYCSTHLLEHITTNEDFRAAGKSGSALELSVENVKNGIRTGFLKIDEYMRNFSDLRNGMDRSGSTAVGVMISPKHIYFINCGDSRAVLYRNGQVCFSTQDHKPCNPREKERIQNAGGSVMIQRVNGSLAVSRALGDYDYKCVDGKGPTEQLVSPEPEVYEILR-AEEDEFIILACDGIWDVMSNEELCEYVKSRLEVSDDLENVCNWVVDTCLHKGSRDNMSIVLVCFSNAPKVSDEAVKKDSELDKHLESR-VEEIMEKSGEEGMPDLAHVMRILSAENIPNLPPGGGLAGKRNVIEAVYSR 369          
BLAST of Protein phosphatase 1B vs. Ensembl Human
Match: AC013717.1 (novel protein, PPM1B-SLC3A1 readthrough)

HSP 1 Score: 277.33 bits (708), Expect = 2.336e-89
Identity = 153/371 (41.24%), Postives = 230/371 (61.99%), Query Frame = 2
Query:  104 MGSYNGKPNTEKYNESGKFGDIYYSSSSMQGMRSHMEDFQCISLNLPYPFEDWAYFAIFDGHGGYRVSELCSXXXXXXXXXXXXF----KNINLLNLDKSQIINGIKKAFISLDDKISHFSE--------GTTVSAVFITPNYLIFMNCGDSRSVLIRESDIFFSSIDHKPTNPLEKERILKAGGQITMDRLNGNMSVSRALGDSYYKKDYNLSAFEQLMSAEPDVYIISRNSENDQIIVLACDGVWDVFSNTELKQLLLQRFKCTDDLVKISDELIDAALYKGSKDNISAIIVAFVNAPKVESECQRLDRLLDENIINKTMXXXXXXXXXXXXXXLIEYMKNIALE---NLPP-GGIVSKQSIIVNLFEK 1168
            MG++  KP TEK+N  G    + Y  SSMQG R  MED     + +P+  EDW++FA++DGH G RV+  CS  LL  I   E+F    K+ + L L    + NGI+  F+ +D+ + +FS+        G+T   V I+P ++ F+NCGDSR+VL R   + FS+ DHKP NP EKERI  AGG + + R+NG+++VSRALGD  YK        EQL+S EP+VY I R +E D+ I+LACDG+WDV SN EL + +  R + +DDL  + + ++D  L+KGS+DN+S ++V F NAPKV  E  + D  LD+++ ++ +E +  +S +  + DL   M+ ++ E   NLPP GG+  K+++I  ++ +
Sbjct:    1 MGAFLDKPKTEKHNAHGAGNGLRYGLSSMQGWRVEMEDAHTAVVGIPHGLEDWSFFAVYDGHAGSRVANYCSTHLLEHITTNEDFRAAGKSGSALELSVENVKNGIRTGFLKIDEYMRNFSDLRNGMDRSGSTAVGVMISPKHIYFINCGDSRAVLYRNGQVCFSTQDHKPCNPREKERIQNAGGSVMIQRVNGSLAVSRALGDYDYKCVDGKGPTEQLVSPEPEVYEILR-AEEDEFIILACDGIWDVMSNEELCEYVKSRLEVSDDLENVCNWVVDTCLHKGSRDNMSIVLVCFSNAPKVSDEAVKKDSELDKHLESR-VEEIMEKSGEEGMPDLAHVMRILSAENIPNLPPGGGLAGKRNVIEAVYSR 369          
BLAST of Protein phosphatase 1B vs. Ensembl Human
Match: PPM1B (protein phosphatase, Mg2+/Mn2+ dependent 1B [Source:HGNC Symbol;Acc:HGNC:9276])

HSP 1 Score: 276.944 bits (707), Expect = 3.210e-89
Identity = 153/371 (41.24%), Postives = 230/371 (61.99%), Query Frame = 2
Query:  104 MGSYNGKPNTEKYNESGKFGDIYYSSSSMQGMRSHMEDFQCISLNLPYPFEDWAYFAIFDGHGGYRVSELCSXXXXXXXXXXXXF----KNINLLNLDKSQIINGIKKAFISLDDKISHFSE--------GTTVSAVFITPNYLIFMNCGDSRSVLIRESDIFFSSIDHKPTNPLEKERILKAGGQITMDRLNGNMSVSRALGDSYYKKDYNLSAFEQLMSAEPDVYIISRNSENDQIIVLACDGVWDVFSNTELKQLLLQRFKCTDDLVKISDELIDAALYKGSKDNISAIIVAFVNAPKVESECQRLDRLLDENIINKTMXXXXXXXXXXXXXXLIEYMKNIALE---NLPP-GGIVSKQSIIVNLFEK 1168
            MG++  KP TEK+N  G    + Y  SSMQG R  MED     + +P+  EDW++FA++DGH G RV+  CS  LL  I   E+F    K+ + L L    + NGI+  F+ +D+ + +FS+        G+T   V I+P ++ F+NCGDSR+VL R   + FS+ DHKP NP EKERI  AGG + + R+NG+++VSRALGD  YK        EQL+S EP+VY I R +E D+ I+LACDG+WDV SN EL + +  R + +DDL  + + ++D  L+KGS+DN+S ++V F NAPKV  E  + D  LD+++ ++ +E +  +S +  + DL   M+ ++ E   NLPP GG+  K+++I  ++ +
Sbjct:    1 MGAFLDKPKTEKHNAHGAGNGLRYGLSSMQGWRVEMEDAHTAVVGIPHGLEDWSFFAVYDGHAGSRVANYCSTHLLEHITTNEDFRAAGKSGSALELSVENVKNGIRTGFLKIDEYMRNFSDLRNGMDRSGSTAVGVMISPKHIYFINCGDSRAVLYRNGQVCFSTQDHKPCNPREKERIQNAGGSVMIQRVNGSLAVSRALGDYDYKCVDGKGPTEQLVSPEPEVYEILR-AEEDEFIILACDGIWDVMSNEELCEYVKSRLEVSDDLENVCNWVVDTCLHKGSRDNMSIVLVCFSNAPKVSDEAVKKDSELDKHLESR-VEEIMEKSGEEGMPDLAHVMRILSAENIPNLPPGGGLAGKRNVIEAVYSR 369          
BLAST of Protein phosphatase 1B vs. Ensembl Celegans
Match: ppm-1.A (Protein phosphatase ppm-1 [Source:UniProtKB/Swiss-Prot;Acc:Q19775])

HSP 1 Score: 221.861 bits (564), Expect = 2.672e-68
Identity = 123/306 (40.20%), Postives = 185/306 (60.46%), Query Frame = 2
Query:  104 MGSYNGKPNTEKYNESGKFGDIYYSSSSMQGMRSHMEDFQCIS--LNLPYPFEDWAYFAIFDGHGGYRVSELCSXXXXXXXXXXXXFKNINLLNLDKSQIIN---------GIKKAFISLDDKISHFS-----EGTTVSAVFITPNYLIFMNCGDSRSVLIRESDIFFSSIDHKPTNPLEKERILKAGGQITMDRLNGNMSVSRALGDSYYKKDYNLSAFEQLMSAEPDVYIISRNSENDQIIVLACDGVWDVFSNTELKQLLLQRFKCTDDLVKISDELIDAALYKGSKDNISAIIVAFVNAPKV 973
            MG++  KP T+K N  G+   I Y  SSMQG R  MED       ++   P++DW++FA+FDGH G+ ++   S +LL  ++ +EEF+ +     + + ++          GIKK F+S D+ IS  S      G T     +TP + I  N GDSR+V+  +++IF +  DHKP    E++RI  AGG + + R+NG+++VSRA GD  YK D  L A +QL+S EPDVYI  RN ENDQ +V+ACDG++DV +N EL + +  R     DL ++ D+++D  L KGS+DN++ ++V F  AP+V
Sbjct:    1 MGAFLDKPKTDKTNVHGEGNGIRYGMSSMQGWRICMEDSHIAEAIMSQSSPYKDWSFFAVFDGHAGHHIANRASSQLLEHLISSEEFREMTKTLEENNGVLTDSTLKLLEKGIKKGFLSFDE-ISKTSNDISKSGCTAVCAIVTPTHFIIGNLGDSRAVVAGKNEIFGTE-DHKPYLEKERKRIEGAGGSVMIQRINGSLAVSRAFGDYEYKDDPRLPADQQLVSPEPDVYIRERNLENDQFMVVACDGIYDVMTNEELAEFVKDRLSVHSDLREVCDDVLDECLVKGSRDNMTMVVVCFPAAPEV 304          
BLAST of Protein phosphatase 1B vs. Ensembl Celegans
Match: ppm-1.A (Protein phosphatase ppm-1 [Source:UniProtKB/Swiss-Prot;Acc:Q19775])

HSP 1 Score: 221.861 bits (564), Expect = 2.672e-68
Identity = 123/306 (40.20%), Postives = 185/306 (60.46%), Query Frame = 2
Query:  104 MGSYNGKPNTEKYNESGKFGDIYYSSSSMQGMRSHMEDFQCIS--LNLPYPFEDWAYFAIFDGHGGYRVSELCSXXXXXXXXXXXXFKNINLLNLDKSQIIN---------GIKKAFISLDDKISHFS-----EGTTVSAVFITPNYLIFMNCGDSRSVLIRESDIFFSSIDHKPTNPLEKERILKAGGQITMDRLNGNMSVSRALGDSYYKKDYNLSAFEQLMSAEPDVYIISRNSENDQIIVLACDGVWDVFSNTELKQLLLQRFKCTDDLVKISDELIDAALYKGSKDNISAIIVAFVNAPKV 973
            MG++  KP T+K N  G+   I Y  SSMQG R  MED       ++   P++DW++FA+FDGH G+ ++   S +LL  ++ +EEF+ +     + + ++          GIKK F+S D+ IS  S      G T     +TP + I  N GDSR+V+  +++IF +  DHKP    E++RI  AGG + + R+NG+++VSRA GD  YK D  L A +QL+S EPDVYI  RN ENDQ +V+ACDG++DV +N EL + +  R     DL ++ D+++D  L KGS+DN++ ++V F  AP+V
Sbjct:    1 MGAFLDKPKTDKTNVHGEGNGIRYGMSSMQGWRICMEDSHIAEAIMSQSSPYKDWSFFAVFDGHAGHHIANRASSQLLEHLISSEEFREMTKTLEENNGVLTDSTLKLLEKGIKKGFLSFDE-ISKTSNDISKSGCTAVCAIVTPTHFIIGNLGDSRAVVAGKNEIFGTE-DHKPYLEKERKRIEGAGGSVMIQRINGSLAVSRAFGDYEYKDDPRLPADQQLVSPEPDVYIRERNLENDQFMVVACDGIYDVMTNEELAEFVKDRLSVHSDLREVCDDVLDECLVKGSRDNMTMVVVCFPAAPEV 304          
BLAST of Protein phosphatase 1B vs. Ensembl Celegans
Match: ppm-1.A (Protein phosphatase ppm-1 [Source:UniProtKB/Swiss-Prot;Acc:Q19775])

HSP 1 Score: 222.246 bits (565), Expect = 1.981e-67
Identity = 123/306 (40.20%), Postives = 185/306 (60.46%), Query Frame = 2
Query:  104 MGSYNGKPNTEKYNESGKFGDIYYSSSSMQGMRSHMEDFQCIS--LNLPYPFEDWAYFAIFDGHGGYRVSELCSXXXXXXXXXXXXFKNINLLNLDKSQIIN---------GIKKAFISLDDKISHFS-----EGTTVSAVFITPNYLIFMNCGDSRSVLIRESDIFFSSIDHKPTNPLEKERILKAGGQITMDRLNGNMSVSRALGDSYYKKDYNLSAFEQLMSAEPDVYIISRNSENDQIIVLACDGVWDVFSNTELKQLLLQRFKCTDDLVKISDELIDAALYKGSKDNISAIIVAFVNAPKV 973
            MG++  KP T+K N  G+   I Y  SSMQG R  MED       ++   P++DW++FA+FDGH G+ ++   S +LL  ++ +EEF+ +     + + ++          GIKK F+S D+ IS  S      G T     +TP + I  N GDSR+V+  +++IF +  DHKP    E++RI  AGG + + R+NG+++VSRA GD  YK D  L A +QL+S EPDVYI  RN ENDQ +V+ACDG++DV +N EL + +  R     DL ++ D+++D  L KGS+DN++ ++V F  AP+V
Sbjct:   84 MGAFLDKPKTDKTNVHGEGNGIRYGMSSMQGWRICMEDSHIAEAIMSQSSPYKDWSFFAVFDGHAGHHIANRASSQLLEHLISSEEFREMTKTLEENNGVLTDSTLKLLEKGIKKGFLSFDE-ISKTSNDISKSGCTAVCAIVTPTHFIIGNLGDSRAVVAGKNEIFGTE-DHKPYLEKERKRIEGAGGSVMIQRINGSLAVSRAFGDYEYKDDPRLPADQQLVSPEPDVYIRERNLENDQFMVVACDGIYDVMTNEELAEFVKDRLSVHSDLREVCDDVLDECLVKGSRDNMTMVVVCFPAAPEV 387          
BLAST of Protein phosphatase 1B vs. Ensembl Celegans
Match: ppm-1.A (Protein phosphatase ppm-1 [Source:UniProtKB/Swiss-Prot;Acc:Q19775])

HSP 1 Score: 206.453 bits (524), Expect = 1.689e-62
Identity = 114/283 (40.28%), Postives = 172/283 (60.78%), Query Frame = 2
Query:  173 YSSSSMQGMRSHMEDFQCIS--LNLPYPFEDWAYFAIFDGHGGYRVSELCSXXXXXXXXXXXXFKNINLLNLDKSQIIN---------GIKKAFISLDDKISHFS-----EGTTVSAVFITPNYLIFMNCGDSRSVLIRESDIFFSSIDHKPTNPLEKERILKAGGQITMDRLNGNMSVSRALGDSYYKKDYNLSAFEQLMSAEPDVYIISRNSENDQIIVLACDGVWDVFSNTELKQLLLQRFKCTDDLVKISDELIDAALYKGSKDNISAIIVAFVNAPKV 973
            Y  SSMQG R  MED       ++   P++DW++FA+FDGH G+ ++   S +LL  ++ +EEF+ +     + + ++          GIKK F+S D+ IS  S      G T     +TP + I  N GDSR+V+  +++IF +  DHKP    E++RI  AGG + + R+NG+++VSRA GD  YK D  L A +QL+S EPDVYI  RN ENDQ +V+ACDG++DV +N EL + +  R     DL ++ D+++D  L KGS+DN++ ++V F  AP+V
Sbjct:    6 YGMSSMQGWRICMEDSHIAEAIMSQSSPYKDWSFFAVFDGHAGHHIANRASSQLLEHLISSEEFREMTKTLEENNGVLTDSTLKLLEKGIKKGFLSFDE-ISKTSNDISKSGCTAVCAIVTPTHFIIGNLGDSRAVVAGKNEIFGTE-DHKPYLEKERKRIEGAGGSVMIQRINGSLAVSRAFGDYEYKDDPRLPADQQLVSPEPDVYIRERNLENDQFMVVACDGIYDVMTNEELAEFVKDRLSVHSDLREVCDDVLDECLVKGSRDNMTMVVVCFPAAPEV 286          
BLAST of Protein phosphatase 1B vs. Ensembl Celegans
Match: ppm-2 (Probable protein phosphatase 2C T23F11.1 [Source:UniProtKB/Swiss-Prot;Acc:P49596])

HSP 1 Score: 144.821 bits (364), Expect = 2.385e-39
Identity = 100/299 (33.44%), Postives = 154/299 (51.51%), Query Frame = 2
Query:  104 MGSYNGKPNTEKYNESGKFGDIYYSSSSMQGMRSHMEDFQCISLNLPYPFEDWAYFAIFDGHGGYRVSELCSXXXXXXXXXXXXFKNINLLNLDKSQIINGIKKAFISLDDKISHFSE------GTTVSAVFITPNYLIFMNCGDSRSVLIRESDIFFSSIDHKPTNPLEKERILKAGGQITMDRLNGNMSVSRALGDSYYKKDYNLSAFEQLMSAEPDVYIISRNSENDQIIVLACDGVWDVFSNTELKQLLLQRFKCTDDLVKISDELIDAALYKGSK------DNISAIIVAFVNA 964
            MG    +P T+K + S    +    SS MQG R  MED     L+LP   +  A+FA++DGHGG +VS+   I L   ++  +EF   N+           I+K F+ LD ++    E      GTT   V I    +   N GDSR+V     +    S DHKP++  E  RI+ AGG +  +R+NGN+++SRALGD  +K      A EQ+++A PDV I  + + + + IVLACDG+WDV +N E+   + ++     D   I +EL+   L    +      DN++ ++V  ++ 
Sbjct:    1 MGQTLSEPVTKKESASCANENYLVGSSCMQGWRVDMEDAHTHLLSLPDDPK-CAFFAVYDGHGGSKVSQYSGINLHKKVVAQKEFSEGNMKE--------AIEKGFLELDQQMRVDEETKDDVSGTTAVVVLIKEGDVYCGNAGDSRAVSSVVGEARPLSFDHKPSHETEARRIIAAGGWVEFNRVNGNLALSRALGDFAFKNCDTKPAEEQIVTAFPDV-ITDKLTPDHEFIVLACDGIWDVMTNQEVVDFVREKLAEKRDPQSICEELLTRCLAPDCQMGGLGCDNMTVVLVGLLHG 289          
BLAST of Protein phosphatase 1B vs. Ensembl Fly
Match: CG6036 (gene:FBgn0039421 transcript:FBtr0085027)

HSP 1 Score: 244.588 bits (623), Expect = 4.200e-77
Identity = 144/377 (38.20%), Postives = 224/377 (59.42%), Query Frame = 2
Query:  104 MGSYNGKPNTEKYNESGKFGDIYYSSSSMQGMRSHMEDFQCISLNLPYPFEDWAYFAIFDGHGGYRVSELCSXXXXXXXXXXXXFKNINLLNLDKSQIINGIKKAFISLDD---KISHFSEG-TTVSAVFITPNYLIFMNCGDSRSVLIRESDIFFSSIDHKPTNPLEKERILKAGGQITMDRLNGNMSVSRALGDSYYKKDYNLSAFEQLMSAEPDVYIISRNSENDQIIVLACDGVWDVFSNTELKQLLLQRFKCTDDLVKISDELIDAALYKGSKDNISAIIVAFVNAPKVESECQRLDRLLDENIINKTMXXXXXXXXXXXXXXLIEYMKNIA--LENLPP-GGIVSKQSIIVNLF-EKYVSVKSHCSDEFNI 1210
            MG +  KP TEK  + G    + Y  SSMQG R  MED    +  L  PF  W+YFA+FDGH G ++S  C+  L++ ILE+E F         K +   GI++ F+ LD+   K+ H  +G +T   VF++P+ +  +NCGDSR+V+ R      S+IDHKP +P E+ERI  AGG + + R+NG ++VSRA GD  +K D + S  +Q++S EPD+ + +R SE+D+ IV+ACDG+WDV +++E+ + +  R   T DL  I + ++D  L+KGS+DN++ +++    APKV+ +  + +R LD+ I+  T + +  +        LI  MK +A  + NLPP GG+ +K  II   F EK+    +   D F++
Sbjct:    5 MGGFLEKPETEKQAQEGHGNGLRYCVSSMQGWRLEMEDSHSAACRLKDPFATWSYFAVFDGHAGSQISLHCAEHLMSTILESESFS--------KHKYEAGIREGFLQLDEDMRKLYHDQQGGSTAICVFVSPDKIYLVNCGDSRAVISRNGAAVISTIDHKPFSPKEQERIQNAGGSVMIKRINGTLAVSRAFGDYDFKNDGSKSPVDQMVSPEPDIIVCNR-SEHDEFIVVACDGIWDVMTSSEVCEFIRSRLLVTYDLPMIVNSVLDICLHKGSRDNMTLLLLLLPGAPKVDMDAVKAERSLDQTIVQIT-KEVIEKHEIHDFETLIRLMKRMAINIPNLPPGGGLYAKYYIIEQAFHEKFPDTPAEIYDYFSM 371          
BLAST of Protein phosphatase 1B vs. Ensembl Fly
Match: alph (gene:FBgn0086361 transcript:FBtr0085442)

HSP 1 Score: 235.728 bits (600), Expect = 9.024e-74
Identity = 142/366 (38.80%), Postives = 206/366 (56.28%), Query Frame = 2
Query:  104 MGSYNGKPNTEKYNESGKFGDIYYSSSSMQGMRSHMEDFQCISLNLPYPFEDWAYFAIFDGHGGYRVSELCSXXXXXXXXXXXXFKNINLLNLDKSQIINGIKKAFISLDDKISHFSE---------GTTVSAVFITPNYLIFMNCGDSRSVLIRESDIFFSSIDHKPTNPLEKERILKAGGQITMDRLNGNMSVSRALGDSYYKKDYNLSAFEQLMSAEPDVYIISRNSENDQIIVLACDGVWDVFSNTELKQLLLQRFKCTDDLVKISDELIDAALYKGSKDNISAIIVAFVNAPKVESECQRLDRLLDENIINKTMXXXXXXXXXXXXXXLIEYMKNI-ALENLPP-GGIVSKQSIIVNLFEK 1168
            MG +  KP T K+N+ G+   + +  SSMQG RS MED       L     DW++FA+FDGH G +VSE C+  LL  I+ TEEF             + GI+  F+ +D+ +    E         GTT    F+    +   NCGDSR+VL R+    F++ DHKP  P EKERI  AGG + + R+NG ++VSRALGD  +K        EQL+S EP+++  SR  ++D+ +VLACDG+WDV SN ++   +  R + T +LV I+++++D  L+KGS+DN+S II+AF  APK   E    +  L E  I K        S  +  VDL++ ++N   +E LPP GG+ SK  +I   F++
Sbjct:    1 MGGFLDKPKTAKHNDEGEGNKLLFGVSSMQGWRSEMEDAYYARAGLGDALPDWSFFAVFDGHAGCKVSEHCAKHLLESIISTEEFIG--------GDHVKGIRTGFLRIDEVMRELPEFTRESEKCGGTTAVCAFVGLTQVYIANCGDSRAVLCRQGVPVFATQDHKPILPEEKERIYNAGGSVMIKRVNGTLAVSRALGDYDFKNVKEKGQCEQLVSPEPEIFCQSRQ-DSDEFLVLACDGIWDVMSNEDVCSFIHSRMRVTSNLVSIANQVVDTCLHKGSRDNMSIIIIAFPGAPKPTEEAIEAEHRL-EKQIEKITRDEIESSKITDYVDLLKCLQNRDDIEGLPPGGGLQSKYHVIERTFKQ 356          
BLAST of Protein phosphatase 1B vs. Ensembl Fly
Match: alph (gene:FBgn0086361 transcript:FBtr0085445)

HSP 1 Score: 235.728 bits (600), Expect = 9.024e-74
Identity = 142/366 (38.80%), Postives = 206/366 (56.28%), Query Frame = 2
Query:  104 MGSYNGKPNTEKYNESGKFGDIYYSSSSMQGMRSHMEDFQCISLNLPYPFEDWAYFAIFDGHGGYRVSELCSXXXXXXXXXXXXFKNINLLNLDKSQIINGIKKAFISLDDKISHFSE---------GTTVSAVFITPNYLIFMNCGDSRSVLIRESDIFFSSIDHKPTNPLEKERILKAGGQITMDRLNGNMSVSRALGDSYYKKDYNLSAFEQLMSAEPDVYIISRNSENDQIIVLACDGVWDVFSNTELKQLLLQRFKCTDDLVKISDELIDAALYKGSKDNISAIIVAFVNAPKVESECQRLDRLLDENIINKTMXXXXXXXXXXXXXXLIEYMKNI-ALENLPP-GGIVSKQSIIVNLFEK 1168
            MG +  KP T K+N+ G+   + +  SSMQG RS MED       L     DW++FA+FDGH G +VSE C+  LL  I+ TEEF             + GI+  F+ +D+ +    E         GTT    F+    +   NCGDSR+VL R+    F++ DHKP  P EKERI  AGG + + R+NG ++VSRALGD  +K        EQL+S EP+++  SR  ++D+ +VLACDG+WDV SN ++   +  R + T +LV I+++++D  L+KGS+DN+S II+AF  APK   E    +  L E  I K        S  +  VDL++ ++N   +E LPP GG+ SK  +I   F++
Sbjct:    1 MGGFLDKPKTAKHNDEGEGNKLLFGVSSMQGWRSEMEDAYYARAGLGDALPDWSFFAVFDGHAGCKVSEHCAKHLLESIISTEEFIG--------GDHVKGIRTGFLRIDEVMRELPEFTRESEKCGGTTAVCAFVGLTQVYIANCGDSRAVLCRQGVPVFATQDHKPILPEEKERIYNAGGSVMIKRVNGTLAVSRALGDYDFKNVKEKGQCEQLVSPEPEIFCQSRQ-DSDEFLVLACDGIWDVMSNEDVCSFIHSRMRVTSNLVSIANQVVDTCLHKGSRDNMSIIIIAFPGAPKPTEEAIEAEHRL-EKQIEKITRDEIESSKITDYVDLLKCLQNRDDIEGLPPGGGLQSKYHVIERTFKQ 356          
BLAST of Protein phosphatase 1B vs. Ensembl Fly
Match: alph (gene:FBgn0086361 transcript:FBtr0085446)

HSP 1 Score: 235.728 bits (600), Expect = 9.024e-74
Identity = 142/366 (38.80%), Postives = 206/366 (56.28%), Query Frame = 2
Query:  104 MGSYNGKPNTEKYNESGKFGDIYYSSSSMQGMRSHMEDFQCISLNLPYPFEDWAYFAIFDGHGGYRVSELCSXXXXXXXXXXXXFKNINLLNLDKSQIINGIKKAFISLDDKISHFSE---------GTTVSAVFITPNYLIFMNCGDSRSVLIRESDIFFSSIDHKPTNPLEKERILKAGGQITMDRLNGNMSVSRALGDSYYKKDYNLSAFEQLMSAEPDVYIISRNSENDQIIVLACDGVWDVFSNTELKQLLLQRFKCTDDLVKISDELIDAALYKGSKDNISAIIVAFVNAPKVESECQRLDRLLDENIINKTMXXXXXXXXXXXXXXLIEYMKNI-ALENLPP-GGIVSKQSIIVNLFEK 1168
            MG +  KP T K+N+ G+   + +  SSMQG RS MED       L     DW++FA+FDGH G +VSE C+  LL  I+ TEEF             + GI+  F+ +D+ +    E         GTT    F+    +   NCGDSR+VL R+    F++ DHKP  P EKERI  AGG + + R+NG ++VSRALGD  +K        EQL+S EP+++  SR  ++D+ +VLACDG+WDV SN ++   +  R + T +LV I+++++D  L+KGS+DN+S II+AF  APK   E    +  L E  I K        S  +  VDL++ ++N   +E LPP GG+ SK  +I   F++
Sbjct:    1 MGGFLDKPKTAKHNDEGEGNKLLFGVSSMQGWRSEMEDAYYARAGLGDALPDWSFFAVFDGHAGCKVSEHCAKHLLESIISTEEFIG--------GDHVKGIRTGFLRIDEVMRELPEFTRESEKCGGTTAVCAFVGLTQVYIANCGDSRAVLCRQGVPVFATQDHKPILPEEKERIYNAGGSVMIKRVNGTLAVSRALGDYDFKNVKEKGQCEQLVSPEPEIFCQSRQ-DSDEFLVLACDGIWDVMSNEDVCSFIHSRMRVTSNLVSIANQVVDTCLHKGSRDNMSIIIIAFPGAPKPTEEAIEAEHRL-EKQIEKITRDEIESSKITDYVDLLKCLQNRDDIEGLPPGGGLQSKYHVIERTFKQ 356          
BLAST of Protein phosphatase 1B vs. Ensembl Fly
Match: alph (gene:FBgn0086361 transcript:FBtr0085443)

HSP 1 Score: 235.728 bits (600), Expect = 1.272e-73
Identity = 142/366 (38.80%), Postives = 206/366 (56.28%), Query Frame = 2
Query:  104 MGSYNGKPNTEKYNESGKFGDIYYSSSSMQGMRSHMEDFQCISLNLPYPFEDWAYFAIFDGHGGYRVSELCSXXXXXXXXXXXXFKNINLLNLDKSQIINGIKKAFISLDDKISHFSE---------GTTVSAVFITPNYLIFMNCGDSRSVLIRESDIFFSSIDHKPTNPLEKERILKAGGQITMDRLNGNMSVSRALGDSYYKKDYNLSAFEQLMSAEPDVYIISRNSENDQIIVLACDGVWDVFSNTELKQLLLQRFKCTDDLVKISDELIDAALYKGSKDNISAIIVAFVNAPKVESECQRLDRLLDENIINKTMXXXXXXXXXXXXXXLIEYMKNI-ALENLPP-GGIVSKQSIIVNLFEK 1168
            MG +  KP T K+N+ G+   + +  SSMQG RS MED       L     DW++FA+FDGH G +VSE C+  LL  I+ TEEF             + GI+  F+ +D+ +    E         GTT    F+    +   NCGDSR+VL R+    F++ DHKP  P EKERI  AGG + + R+NG ++VSRALGD  +K        EQL+S EP+++  SR  ++D+ +VLACDG+WDV SN ++   +  R + T +LV I+++++D  L+KGS+DN+S II+AF  APK   E    +  L E  I K        S  +  VDL++ ++N   +E LPP GG+ SK  +I   F++
Sbjct:    1 MGGFLDKPKTAKHNDEGEGNKLLFGVSSMQGWRSEMEDAYYARAGLGDALPDWSFFAVFDGHAGCKVSEHCAKHLLESIISTEEFIG--------GDHVKGIRTGFLRIDEVMRELPEFTRESEKCGGTTAVCAFVGLTQVYIANCGDSRAVLCRQGVPVFATQDHKPILPEEKERIYNAGGSVMIKRVNGTLAVSRALGDYDFKNVKEKGQCEQLVSPEPEIFCQSRQ-DSDEFLVLACDGIWDVMSNEDVCSFIHSRMRVTSNLVSIANQVVDTCLHKGSRDNMSIIIIAFPGAPKPTEEAIEAEHRL-EKQIEKITRDEIESSKITDYVDLLKCLQNRDDIEGLPPGGGLQSKYHVIERTFKQ 356          
BLAST of Protein phosphatase 1B vs. Ensembl Zebrafish
Match: ppm1aa (protein phosphatase, Mg2+/Mn2+ dependent, 1Aa [Source:ZFIN;Acc:ZDB-GENE-991102-15])

HSP 1 Score: 271.552 bits (693), Expect = 2.350e-87
Identity = 148/373 (39.68%), Postives = 220/373 (58.98%), Query Frame = 2
Query:  104 MGSYNGKPNTEKYNESGKFGDIYYSSSSMQGMRSHMEDFQCISLNLPYPFEDWAYFAIFDGHGGYRVSELCSXXXXXXXXXXXXFKNINLLNLDKSQ-----IINGIKKAFISLDDKISHFSE---------GTTVSAVFITPNYLIFMNCGDSRSVLIRESDIFFSSIDHKPTNPLEKERILKAGGQITMDRLNGNMSVSRALGDSYYKKDYNLSAFEQLMSAEPDVYIISRNSENDQIIVLACDGVWDVFSNTELKQLLLQRFKCTDDLVKISDELIDAALYKGSKDNISAIIVAFVNAPKVESECQRLDRLLDENIINKTMXXXXXXXXXXXXXXLIEYMKNIALE---NLPPGG-IVSKQSIIVNLFEK 1168
            MG++  KP  EK+N  G    + Y  SSMQG R  MED     + LP   + W++FA++DGH G +V+  C   LL  I    +F+          +     + +GI+  F+ +DD +   SE         G+T   V I+P ++ F+NCGDSR +L R   + F + DHKP+NPLEKERI  AGG + + R+NG+++VSRALGD  YK  +     EQL+S EP+V  I R+   D+ IVLACDG+WDV +N EL   +  R + TDDL ++ +E++D  LYKGS+DN+S ++V FV+APKV  E  + +  LD+ + ++ +E +     D  + DL+  M+ +A E   NLPPGG + SK+S+I  ++ K
Sbjct:    1 MGAFLDKPKMEKHNAHGDGNSLRYGLSSMQGWRVEMEDAHTAVIGLPNSLDLWSFFAVYDGHAGSQVARYCCEHLLEHITSNPDFQGGGGGGGPAVEPSVDSVKSGIRTGFLQIDDHMRQISEKKHGGADRSGSTAVGVMISPRHIYFINCGDSRGLLSRGGAVHFFTQDHKPSNPLEKERIQNAGGSVMIQRVNGSLAVSRALGDFDYKCVHGKGPTEQLVSPEPEVCAIERSEAEDEFIVLACDGIWDVMANEELCDFVRSRLEVTDDLERVCNEIVDTCLYKGSRDNMSVVLVCFVSAPKVSPEAVKREAELDKYLESR-VEEILKRQGDEGVPDLVHVMRTLASESIPNLPPGGELASKRSVIEAVYNK 372          
BLAST of Protein phosphatase 1B vs. Ensembl Zebrafish
Match: ppm1aa (protein phosphatase, Mg2+/Mn2+ dependent, 1Aa [Source:ZFIN;Acc:ZDB-GENE-991102-15])

HSP 1 Score: 271.166 bits (692), Expect = 3.487e-87
Identity = 148/373 (39.68%), Postives = 220/373 (58.98%), Query Frame = 2
Query:  104 MGSYNGKPNTEKYNESGKFGDIYYSSSSMQGMRSHMEDFQCISLNLPYPFEDWAYFAIFDGHGGYRVSELCSXXXXXXXXXXXXFKNINLLNLDKSQ-----IINGIKKAFISLDDKISHFSE---------GTTVSAVFITPNYLIFMNCGDSRSVLIRESDIFFSSIDHKPTNPLEKERILKAGGQITMDRLNGNMSVSRALGDSYYKKDYNLSAFEQLMSAEPDVYIISRNSENDQIIVLACDGVWDVFSNTELKQLLLQRFKCTDDLVKISDELIDAALYKGSKDNISAIIVAFVNAPKVESECQRLDRLLDENIINKTMXXXXXXXXXXXXXXLIEYMKNIALE---NLPPGG-IVSKQSIIVNLFEK 1168
            MG++  KP  EK+N  G    + Y  SSMQG R  MED     + LP   + W++FA++DGH G +V+  C   LL  I    +F+          +     + +GI+  F+ +DD +   SE         G+T   V I+P ++ F+NCGDSR +L R   + F + DHKP+NPLEKERI  AGG + + R+NG+++VSRALGD  YK  +     EQL+S EP+V  I R+   D+ IVLACDG+WDV +N EL   +  R + TDDL ++ +E++D  LYKGS+DN+S ++V FV+APKV  E  + +  LD+ + ++ +E +     D  + DL+  M+ +A E   NLPPGG + SK+S+I  ++ K
Sbjct:    1 MGAFLDKPKMEKHNAHGDGNSLRYGLSSMQGWRVEMEDAHTAVIGLPNSLDLWSFFAVYDGHAGSQVARYCCEHLLEHITSNPDFQGGGGGGGPAVEPSVDSVKSGIRTGFLQIDDHMRQISEKKHGGADRSGSTAVGVMISPRHIYFINCGDSRGLLSRGGAVHFFTQDHKPSNPLEKERIQNAGGSVMIQRVNGSLAVSRALGDFDYKCVHGKGPTEQLVSPEPEVCAIERSEAEDEFIVLACDGIWDVMANEELCDFVRSRLEVTDDLERVCNEIVDTCLYKGSRDNMSVVLVCFVSAPKVSPEAVKREAELDKYLESR-VEEILKRQGDEGVPDLVHVMRTLASESIPNLPPGGELASKRSVIEAVYNK 372          
BLAST of Protein phosphatase 1B vs. Ensembl Zebrafish
Match: ppm1aa (protein phosphatase, Mg2+/Mn2+ dependent, 1Aa [Source:ZFIN;Acc:ZDB-GENE-991102-15])

HSP 1 Score: 270.781 bits (691), Expect = 5.646e-87
Identity = 148/373 (39.68%), Postives = 220/373 (58.98%), Query Frame = 2
Query:  104 MGSYNGKPNTEKYNESGKFGDIYYSSSSMQGMRSHMEDFQCISLNLPYPFEDWAYFAIFDGHGGYRVSELCSXXXXXXXXXXXXFKNINLLNLDKSQ-----IINGIKKAFISLDDKISHFSE---------GTTVSAVFITPNYLIFMNCGDSRSVLIRESDIFFSSIDHKPTNPLEKERILKAGGQITMDRLNGNMSVSRALGDSYYKKDYNLSAFEQLMSAEPDVYIISRNSENDQIIVLACDGVWDVFSNTELKQLLLQRFKCTDDLVKISDELIDAALYKGSKDNISAIIVAFVNAPKVESECQRLDRLLDENIINKTMXXXXXXXXXXXXXXLIEYMKNIALE---NLPPGG-IVSKQSIIVNLFEK 1168
            MG++  KP  EK+N  G    + Y  SSMQG R  MED     + LP   + W++FA++DGH G +V+  C   LL  I    +F+          +     + +GI+  F+ +DD +   SE         G+T   V I+P ++ F+NCGDSR +L R   + F + DHKP+NPLEKERI  AGG + + R+NG+++VSRALGD  YK  +     EQL+S EP+V  I R+   D+ IVLACDG+WDV +N EL   +  R + TDDL ++ +E++D  LYKGS+DN+S ++V FV+APKV  E  + +  LD+ + ++ +E +     D  + DL+  M+ +A E   NLPPGG + SK+S+I  ++ K
Sbjct:    1 MGAFLDKPKMEKHNAHGDGNSLRYGLSSMQGWRVEMEDAHTAVIGLPNSLDLWSFFAVYDGHAGSQVARYCCEHLLEHITSNPDFQGGGGGGGPAVEPSVDSVKSGIRTGFLQIDDHMRQISEKKHGGADRSGSTAVGVMISPRHIYFINCGDSRGLLSRGGAVHFFTQDHKPSNPLEKERIQNAGGSVMIQRVNGSLAVSRALGDFDYKCVHGKGPTEQLVSPEPEVCAIERSEAEDEFIVLACDGIWDVMANEELCDFVRSRLEVTDDLERVCNEIVDTCLYKGSRDNMSVVLVCFVSAPKVSPEAVKREAELDKYLESR-VEEILKRQGDEGVPDLVHVMRTLASESIPNLPPGGELASKRSVIEAVYNK 372          
BLAST of Protein phosphatase 1B vs. Ensembl Zebrafish
Match: ppm1aa (protein phosphatase, Mg2+/Mn2+ dependent, 1Aa [Source:ZFIN;Acc:ZDB-GENE-991102-15])

HSP 1 Score: 270.396 bits (690), Expect = 8.281e-87
Identity = 148/373 (39.68%), Postives = 220/373 (58.98%), Query Frame = 2
Query:  104 MGSYNGKPNTEKYNESGKFGDIYYSSSSMQGMRSHMEDFQCISLNLPYPFEDWAYFAIFDGHGGYRVSELCSXXXXXXXXXXXXFKNINLLNLDKSQ-----IINGIKKAFISLDDKISHFSE---------GTTVSAVFITPNYLIFMNCGDSRSVLIRESDIFFSSIDHKPTNPLEKERILKAGGQITMDRLNGNMSVSRALGDSYYKKDYNLSAFEQLMSAEPDVYIISRNSENDQIIVLACDGVWDVFSNTELKQLLLQRFKCTDDLVKISDELIDAALYKGSKDNISAIIVAFVNAPKVESECQRLDRLLDENIINKTMXXXXXXXXXXXXXXLIEYMKNIALE---NLPPGG-IVSKQSIIVNLFEK 1168
            MG++  KP  EK+N  G    + Y  SSMQG R  MED     + LP   + W++FA++DGH G +V+  C   LL  I    +F+          +     + +GI+  F+ +DD +   SE         G+T   V I+P ++ F+NCGDSR +L R   + F + DHKP+NPLEKERI  AGG + + R+NG+++VSRALGD  YK  +     EQL+S EP+V  I R+   D+ IVLACDG+WDV +N EL   +  R + TDDL ++ +E++D  LYKGS+DN+S ++V FV+APKV  E  + +  LD+ + ++ +E +     D  + DL+  M+ +A E   NLPPGG + SK+S+I  ++ K
Sbjct:    1 MGAFLDKPKMEKHNAHGDGNSLRYGLSSMQGWRVEMEDAHTAVIGLPNSLDLWSFFAVYDGHAGSQVARYCCEHLLEHITSNPDFQGGGGGGGPAVEPSVDSVKSGIRTGFLQIDDHMRQISEKKHGGADRSGSTAVGVMISPRHIYFINCGDSRGLLSRGGAVHFFTQDHKPSNPLEKERIQNAGGSVMIQRVNGSLAVSRALGDFDYKCVHGKGPTEQLVSPEPEVCAIERSEAEDEFIVLACDGIWDVMANEELCDFVRSRLEVTDDLERVCNEIVDTCLYKGSRDNMSVVLVCFVSAPKVSPEAVKREAELDKYLESR-VEEILKRQGDEGVPDLVHVMRTLASESIPNLPPGGELASKRSVIEAVYNK 372          
BLAST of Protein phosphatase 1B vs. Ensembl Zebrafish
Match: ppm1ba (protein phosphatase, Mg2+/Mn2+ dependent, 1Ba [Source:ZFIN;Acc:ZDB-GENE-991102-16])

HSP 1 Score: 269.626 bits (688), Expect = 2.080e-86
Identity = 139/373 (37.27%), Postives = 226/373 (60.59%), Query Frame = 2
Query:  104 MGSYNGKPNTEKYNESGKFGDIYYSSSSMQGMRSHMEDFQCISLNLPYPFEDWAYFAIFDGHGGYRVSELCSXXXXXXXXXXXXFKNINLLNLDKSQ------IINGIKKAFISLDDKISHFSE--------GTTVSAVFITPNYLIFMNCGDSRSVLIRESDIFFSSIDHKPTNPLEKERILKAGGQITMDRLNGNMSVSRALGDSYYKKDYNLSAFEQLMSAEPDVYIISRNSENDQIIVLACDGVWDVFSNTELKQLLLQRFKCTDDLVKISDELIDAALYKGSKDNISAIIVAFVNAPKVESECQRLDRLLDENIINKTMXXXXXXXXXXXXXXLIEYMKNIALE---NLPP-GGIVSKQSIIVNLFEK 1168
            MG++  KP TEK+N  G+   + +  SSMQG R  MED    ++ LP+  +DW++F ++DGH G RV+  CS  LL  I+       +        +      +  GI+  F+ +D+ +  F++        G+T  AV ++P +L F+NCGDSR++L R   + FS++DHKP +P EKERI  AGG + + R+NG+++VSRALGD  YK        EQL+S EP+V+ I+R+   D+ +VLACDG+WDV +N +L   +  R + TDDL ++ +E++D +L+KGS+DN+S ++V   NAP+V  +  + D  LD+ + ++ +E L  ++ +  + +L   M +++ E   NLPP GG+ SK S+I  ++ +
Sbjct:    1 MGAFLDKPKTEKHNAHGEGNGLRFGLSSMQGWRVEMEDAHTAAVGLPHGLDDWSFFGVYDGHAGSRVANYCSKHLLEHIVAAGSADELRKAGAPAPETPAIEAVKRGIRAGFLRIDEHMRSFTDLRNGMDRSGSTAVAVLLSPEHLYFINCGDSRALLCRSGHVCFSTMDHKPCDPREKERIQNAGGSVMIQRVNGSLAVSRALGDYDYKCVEGKGPTEQLVSPEPEVFEIARSDAEDEFVVLACDGIWDVMTNEDLCAFVRSRLEVTDDLERVCNEVVDTSLHKGSRDNMSIVLVCLPNAPQVSEDAVKRDAELDKYLESR-VEELIEKAGEDGVPELAHVMSSLSQENIPNLPPGGGLASKHSVIETVYNR 372          
BLAST of Protein phosphatase 1B vs. Ensembl Xenopus
Match: ppm1a (protein phosphatase, Mg2+/Mn2+ dependent 1A [Source:NCBI gene;Acc:548912])

HSP 1 Score: 280.411 bits (716), Expect = 1.353e-90
Identity = 152/374 (40.64%), Postives = 225/374 (60.16%), Query Frame = 2
Query:  104 MGSYNGKPNTEKYNESGKFGDIYYSSSSMQGMRSHMEDFQCISLNLPYPFEDWAYFAIFDGHGGYRVSELCSXXXXXXXXXXXXFKNINLLNLDKSQIINGIKKAFISLDDKISHFSE--------GTTVSAVFITPNYLIFMNCGDSRSVLIRESDIFFSSIDHKPTNPLEKERILKAGGQITMDRLNGNMSVSRALGDSYYKKDYNLSAFEQLMSAEPDVYIISRNSENDQIIVLACDGVWDVFSNTELKQLLLQRFKCTDDLVKISDELIDAALYKGSKDNISAIIVAFVNAPKVESECQRLDRLLD-------ENIINKTMXXXXXXXXXXXXXXLIEYMKNIALE---NLPPGG-IVSKQSIIVNLFEK 1168
            MG++  KP  EK+N  G+   + Y  SSMQG R  MED     + LP   + W++FA++DGH G +V++ C   LL+ I   ++FK  +  +L    + NGI+  F+ +D+ +   SE        G+T   V  +PN++ F+NCGDSR +L R   + F + DHKP+NPLEKERI  AGG + + R+NG+++VSRALGD  YK  +     EQL+S EP+VY I R+ E+DQ I+LACDG+WDV  N EL   +  R + TDDL ++ +E++D  LYKGS+DN+S I++ F +APKV  E  + +  LD       E+II K          +  + DL+  M+ +A E   NLPPGG + SK+S+I  ++ +
Sbjct:    1 MGAFLDKPKMEKHNAHGQGNGLRYGLSSMQGWRVEMEDAHTAVIGLPNGLDAWSFFAVYDGHAGSQVAKYCCEHLLDHITSNQDFKGTDG-HLSVWSVKNGIRTGFLQIDEHMRVISEKKHGADRSGSTAVGVMTSPNHIYFINCGDSRGLLCRSKKVHFFTQDHKPSNPLEKERIQNAGGSVMIQRVNGSLAVSRALGDFDYKCVHGKGPTEQLVSPEPEVYEIERSEEDDQFIILACDGIWDVMGNEELCDFVWSRLEVTDDLERVCNEIVDTCLYKGSRDNMSVILICFPSAPKVLPEAVKREAELDKYLEGRVEDIIKKQ--------GEEGVPDLVHVMRTLASENIPNLPPGGELASKRSVIEAVYNR 365          
BLAST of Protein phosphatase 1B vs. Ensembl Xenopus
Match: ppm1b (protein phosphatase, Mg2+/Mn2+ dependent 1B [Source:NCBI gene;Acc:493392])

HSP 1 Score: 274.633 bits (701), Expect = 2.714e-88
Identity = 151/371 (40.70%), Postives = 231/371 (62.26%), Query Frame = 2
Query:  104 MGSYNGKPNTEKYNESGKFGDIYYSSSSMQGMRSHMEDFQCISLNLPYPFEDWAYFAIFDGHGGYRVSELCSXXXXXXXXXXXXFKNI----NLLNLDKSQIINGIKKAFISLDDKISHFSE--------GTTVSAVFITPNYLIFMNCGDSRSVLIRESDIFFSSIDHKPTNPLEKERILKAGGQITMDRLNGNMSVSRALGDSYYKKDYNLSAFEQLMSAEPDVYIISRNSENDQIIVLACDGVWDVFSNTELKQLLLQRFKCTDDLVKISDELIDAALYKGSKDNISAIIVAFVNAPKVESECQRLDRLLDENIINKTMXXXXXXXXXXXXXXLIEYMKNIALEN---LPP-GGIVSKQSIIVNLFEK 1168
            MG++  KP TEK+N  G    + Y  SSMQG R  MED     + +P   +DW++FA++DGH G RV+  CS  LL  I + E+F+      + L      + +GI+  F+ +D+ + +F++        G+T  AV ++P+++ F+NCGDSR+VL R   + FS+ DHKP NP EKERI  AGG + + R+NG+++VSRALGD  YK        EQL+S EP+VY I R  E D+ I+LACDG+WDV SN EL + +  R + TDDL K+ + ++D  L+KGS+DN+S ++V F NAPKV  E  + D  LD+++ ++ +E + + + +  + DL   M+ +A EN   LPP GG+ +K+S+I  ++ +
Sbjct:    1 MGAFLDKPKTEKHNAHGAGNGLRYGLSSMQGWRVEMEDAHTAVVGIPRGLDDWSFFAVYDGHAGSRVANYCSSHLLEHITDNEDFRATETPGSALEPTVENVKSGIRTGFLKIDEYMRNFADLRNGMDRSGSTAVAVLLSPSHVYFINCGDSRAVLYRSGQVCFSTQDHKPCNPREKERIQNAGGSVMIQRVNGSLAVSRALGDYDYKCVDGKGPTEQLVSPEPEVYEIVRADE-DEFIILACDGIWDVMSNEELCEFVKYRLELTDDLEKVCNSVVDTCLHKGSRDNMSIVLVCFPNAPKVSEEAIKKDADLDKHLESR-VEEIMTNAGEEGMPDLAHVMRILAAENVPHLPPGGGLAAKRSVIEEVYNR 369          
BLAST of Protein phosphatase 1B vs. Ensembl Xenopus
Match: ppm1b (protein phosphatase, Mg2+/Mn2+ dependent 1B [Source:NCBI gene;Acc:493392])

HSP 1 Score: 269.626 bits (688), Expect = 1.230e-86
Identity = 148/356 (41.57%), Postives = 221/356 (62.08%), Query Frame = 2
Query:  104 MGSYNGKPNTEKYNESGKFGDIYYSSSSMQGMRSHMEDFQCISLNLPYPFEDWAYFAIFDGHGGYRVSELCSXXXXXXXXXXXXFKNI----NLLNLDKSQIINGIKKAFISLDDKISHFSE--------GTTVSAVFITPNYLIFMNCGDSRSVLIRESDIFFSSIDHKPTNPLEKERILKAGGQITMDRLNGNMSVSRALGDSYYKKDYNLSAFEQLMSAEPDVYIISRNSENDQIIVLACDGVWDVFSNTELKQLLLQRFKCTDDLVKISDELIDAALYKGSKDNISAIIVAFVNAPKVESECQRLDRLLDENIINKTMXXXXXXXXXXXXXXLIEYMKNIALEN---LPPGG 1126
            MG++  KP TEK+N  G    + Y  SSMQG R  MED     + +P   +DW++FA++DGH G RV+  CS  LL  I + E+F+      + L      + +GI+  F+ +D+ + +F++        G+T  AV ++P+++ F+NCGDSR+VL R   + FS+ DHKP NP EKERI  AGG + + R+NG+++VSRALGD  YK        EQL+S EP+VY I R  E D+ I+LACDG+WDV SN EL + +  R + TDDL K+ + ++D  L+KGS+DN+S ++V F NAPKV  E  + D  LD+++ ++ +E + + + +  + DL   M+ +A EN   LPPGG
Sbjct:    1 MGAFLDKPKTEKHNAHGAGNGLRYGLSSMQGWRVEMEDAHTAVVGIPRGLDDWSFFAVYDGHAGSRVANYCSSHLLEHITDNEDFRATETPGSALEPTVENVKSGIRTGFLKIDEYMRNFADLRNGMDRSGSTAVAVLLSPSHVYFINCGDSRAVLYRSGQVCFSTQDHKPCNPREKERIQNAGGSVMIQRVNGSLAVSRALGDYDYKCVDGKGPTEQLVSPEPEVYEIVRADE-DEFIILACDGIWDVMSNEELCEFVKYRLELTDDLEKVCNSVVDTCLHKGSRDNMSIVLVCFPNAPKVSEEAIKKDADLDKHLESR-VEEIMTNAGEEGMPDLAHVMRILAAENVPHLPPGG 354          
BLAST of Protein phosphatase 1B vs. Ensembl Xenopus
Match: ppm1b (protein phosphatase, Mg2+/Mn2+ dependent 1B [Source:NCBI gene;Acc:493392])

HSP 1 Score: 269.626 bits (688), Expect = 1.732e-86
Identity = 148/360 (41.11%), Postives = 224/360 (62.22%), Query Frame = 2
Query:  104 MGSYNGKPNTEKYNESGKFGDIYYSSSSMQGMRSHMEDFQCISLNLPYPFEDWAYFAIFDGHGGYRVSELCSXXXXXXXXXXXXFKNI----NLLNLDKSQIINGIKKAFISLDDKISHFSE--------GTTVSAVFITPNYLIFMNCGDSRSVLIRESDIFFSSIDHKPTNPLEKERILKAGGQITMDRLNGNMSVSRALGDSYYKKDYNLSAFEQLMSAEPDVYIISRNSENDQIIVLACDGVWDVFSNTELKQLLLQRFKCTDDLVKISDELIDAALYKGSKDNISAIIVAFVNAPKVESECQRLDRLLDENIINKTMXXXXXXXXXXXXXXLIEYMKNIALEN---LPPGGIVSK 1138
            MG++  KP TEK+N  G    + Y  SSMQG R  MED     + +P   +DW++FA++DGH G RV+  CS  LL  I + E+F+      + L      + +GI+  F+ +D+ + +F++        G+T  AV ++P+++ F+NCGDSR+VL R   + FS+ DHKP NP EKERI  AGG + + R+NG+++VSRALGD  YK        EQL+S EP+VY I R  E D+ I+LACDG+WDV SN EL + +  R + TDDL K+ + ++D  L+KGS+DN+S ++V F NAPKV  E  + D  LD+++ ++ +E + + + +  + DL   M+ +A EN   LPPGG +++
Sbjct:    1 MGAFLDKPKTEKHNAHGAGNGLRYGLSSMQGWRVEMEDAHTAVVGIPRGLDDWSFFAVYDGHAGSRVANYCSSHLLEHITDNEDFRATETPGSALEPTVENVKSGIRTGFLKIDEYMRNFADLRNGMDRSGSTAVAVLLSPSHVYFINCGDSRAVLYRSGQVCFSTQDHKPCNPREKERIQNAGGSVMIQRVNGSLAVSRALGDYDYKCVDGKGPTEQLVSPEPEVYEIVRADE-DEFIILACDGIWDVMSNEELCEFVKYRLELTDDLEKVCNSVVDTCLHKGSRDNMSIVLVCFPNAPKVSEEAIKKDADLDKHLESR-VEEIMTNAGEEGMPDLAHVMRILAAENVPHLPPGGGLAE 358          
BLAST of Protein phosphatase 1B vs. Ensembl Xenopus
Match: ppm1b (protein phosphatase, Mg2+/Mn2+ dependent 1B [Source:NCBI gene;Acc:493392])

HSP 1 Score: 272.322 bits (695), Expect = 2.283e-86
Identity = 152/373 (40.75%), Postives = 230/373 (61.66%), Query Frame = 2
Query:  104 MGSYNGKPNTEKYNESGKFGDIYYSSSSMQGMRSHMEDFQCISLNLPYPFEDWAYFAIFDGHGGYRVSELCSXXXXXXXXXXXXFKNI----NLLNLDKSQIINGIKKAFISLDDKISHFSE--------GTTVSAVFITPNYLIFMNCGDSRSVLIRESDIFFSSIDHKPTNPLEKERILKAGGQITMDRLNGNMSVSRALGDSYYKKDYNLSAFEQLMSAEPDVYIISRNSENDQIIVLACDGVWDVFSNTELKQLLLQRFKCTDDLVKISDELIDAALYKGSKDNISAIIVAFVNAPKVESECQRLDRLLDENIINKTMXXXXXXXXXXXXXXLIEYMKNIALEN---LPP-GGIVSKQSIIVNLFEKYV 1174
            MG++  KP TEK+N  G    + Y  SSMQG R  MED     + +P   +DW++FA++DGH G RV+  CS  LL  I + E+F+      + L      + +GI+  F+ +D+ + +F++        G+T  AV ++P+++ F+NCGDSR+VL R   + FS+ DHKP NP EKERI  AGG + + R+NG+++VSRALGD  YK        EQL+S EP+VY I R  E D+ I+LACDG+WDV SN EL + +  R + TDDL K+ + ++D  L+KGS+DN+S ++V F NAPKV  E  + D  LD+++ ++ +E + + + +  + DL   M+ +A EN   LPP GG+ +K ++   LF + V
Sbjct:    1 MGAFLDKPKTEKHNAHGAGNGLRYGLSSMQGWRVEMEDAHTAVVGIPRGLDDWSFFAVYDGHAGSRVANYCSSHLLEHITDNEDFRATETPGSALEPTVENVKSGIRTGFLKIDEYMRNFADLRNGMDRSGSTAVAVLLSPSHVYFINCGDSRAVLYRSGQVCFSTQDHKPCNPREKERIQNAGGSVMIQRVNGSLAVSRALGDYDYKCVDGKGPTEQLVSPEPEVYEIVRADE-DEFIILACDGIWDVMSNEELCEFVKYRLELTDDLEKVCNSVVDTCLHKGSRDNMSIVLVCFPNAPKVSEEAIKKDADLDKHLESR-VEEIMTNAGEEGMPDLAHVMRILAAENVPHLPPGGGLAAKINLFFFLFRRSV 371          
BLAST of Protein phosphatase 1B vs. Ensembl Mouse
Match: Ppm1a (protein phosphatase 1A, magnesium dependent, alpha isoform [Source:MGI Symbol;Acc:MGI:99878])

HSP 1 Score: 276.174 bits (705), Expect = 4.073e-89
Identity = 151/374 (40.37%), Postives = 224/374 (59.89%), Query Frame = 2
Query:  104 MGSYNGKPNTEKYNESGKFGDIYYSSSSMQGMRSHMEDFQCISLNLPYPFEDWAYFAIFDGHGGYRVSELCSXXXXXXXXXXXXFKNINLLNLDKSQIINGIKKAFISLDDKISHFSE--------GTTVSAVFITPNYLIFMNCGDSRSVLIRESDIFFSSIDHKPTNPLEKERILKAGGQITMDRLNGNMSVSRALGDSYYKKDYNLSAFEQLMSAEPDVYIISRNSENDQIIVLACDGVWDVFSNTELKQLLLQRFKCTDDLVKISDELIDAALYKGSKDNISAIIVAFVNAPKVESECQR----LDRLLD---ENIINKTMXXXXXXXXXXXXXXLIEYMKNIALEN---LPPGG-IVSKQSIIVNLFEK 1168
            MG++  KP  EK+N  G+   + Y  SSMQG R  MED     + LP   E W++FA++DGH G +V++ C   LL+ I   ++F+  +        + NGI+  F+ +D+ +   SE        G+T   V I+P +  F+NCGDSR +L R   + F + DHKP+NPLEKERI  AGG + + R+NG+++VSRALGD  YK  +     EQL+S EP+V+ I R+ E+DQ I+LACDG+WDV  N EL   +  R + TDDL K+ +E++D  LYKGS+DN+S I++ F +APKV +E  +    LD+ L+   E II K +           + DL+  M+ +A EN   LPPGG + SK+++I  ++ +
Sbjct:    1 MGAFLDKPKMEKHNAQGQGNGLRYGLSSMQGWRVEMEDAHTAVIGLPSGLETWSFFAVYDGHAGSQVAKYCCEHLLDHITNNQDFRG-SAGAPSVENVKNGIRTGFLEIDEHMRVMSEKKHGADRSGSTAVGVLISPQHTYFINCGDSRGLLCRNRKVHFFTQDHKPSNPLEKERIQNAGGSVMIQRVNGSLAVSRALGDFDYKCVHGKGPTEQLVSPEPEVHDIERSEEDDQFIILACDGIWDVMGNEELCDFVRSRLEVTDDLEKVCNEVVDTCLYKGSRDNMSVILICFPSAPKVSAEAVKKEAELDKYLESRVEEIIKKQV---------EGVPDLVHVMRTLASENIPSLPPGGELASKRNVIEAVYNR 364          
BLAST of Protein phosphatase 1B vs. Ensembl Mouse
Match: Ppm1b (protein phosphatase 1B, magnesium dependent, beta isoform [Source:MGI Symbol;Acc:MGI:101841])

HSP 1 Score: 273.092 bits (697), Expect = 9.855e-88
Identity = 148/371 (39.89%), Postives = 228/371 (61.46%), Query Frame = 2
Query:  104 MGSYNGKPNTEKYNESGKFGDIYYSSSSMQGMRSHMEDFQCISLNLPYPFEDWAYFAIFDGHGGYRVSELCSXXXXXXXXXXXXF----KNINLLNLDKSQIINGIKKAFISLDDKISHFSE--------GTTVSAVFITPNYLIFMNCGDSRSVLIRESDIFFSSIDHKPTNPLEKERILKAGGQITMDRLNGNMSVSRALGDSYYKKDYNLSAFEQLMSAEPDVYIISRNSENDQIIVLACDGVWDVFSNTELKQLLLQRFKCTDDLVKISDELIDAALYKGSKDNISAIIVAFVNAPKVESECQRLDRLLDENIINKTMXXXXXXXXXXXXXXLIEYMKNIALE---NLPP-GGIVSKQSIIVNLFEK 1168
            MG++  KP TEK+N  G    + Y  SSMQG R  MED     + +P+  ++W++FA++DGH G RV+  CS  LL  I   E+F    K+ + L      +  GI+  F+ +D+ + +FS+        G+T   V ++P ++ F+NCGDSR+VL R   + FS+ DHKP NP+EKERI  AGG + + R+NG+++VSRALGD  YK        EQL+S EP+VY I R +E D+ +VLACDG+WDV SN EL + +  R + +DDL  + + ++D  L+KGS+DN+S ++V F NAPKV  E  + D  LD+++ ++ +E +  +S +  + DL   M+ ++ E   NLPP GG+  K+ +I  ++ +
Sbjct:    1 MGAFLDKPKTEKHNAHGAGNGLRYGLSSMQGWRVEMEDAHTAVVGIPHGLDNWSFFAVYDGHAGSRVANYCSTHLLEHITTNEDFRAADKSGSALEPSVESVKTGIRTGFLKIDEYMRNFSDLRNGMDRSGSTAVGVMVSPTHMYFINCGDSRAVLCRNGQVCFSTQDHKPCNPVEKERIQNAGGSVMIQRVNGSLAVSRALGDYDYKCVDGKGPTEQLVSPEPEVYEIVR-AEEDEFVVLACDGIWDVMSNEELCEFVKSRLEVSDDLENVCNWVVDTCLHKGSRDNMSVVLVCFSNAPKVSEEAVKRDSELDKHLESR-VEEIMQKSGEEGMPDLAHVMRILSAENIPNLPPGGGLAGKRHVIEAVYSR 369          
BLAST of Protein phosphatase 1B vs. Ensembl Mouse
Match: Ppm1b (protein phosphatase 1B, magnesium dependent, beta isoform [Source:MGI Symbol;Acc:MGI:101841])

HSP 1 Score: 273.092 bits (697), Expect = 9.855e-88
Identity = 148/371 (39.89%), Postives = 228/371 (61.46%), Query Frame = 2
Query:  104 MGSYNGKPNTEKYNESGKFGDIYYSSSSMQGMRSHMEDFQCISLNLPYPFEDWAYFAIFDGHGGYRVSELCSXXXXXXXXXXXXF----KNINLLNLDKSQIINGIKKAFISLDDKISHFSE--------GTTVSAVFITPNYLIFMNCGDSRSVLIRESDIFFSSIDHKPTNPLEKERILKAGGQITMDRLNGNMSVSRALGDSYYKKDYNLSAFEQLMSAEPDVYIISRNSENDQIIVLACDGVWDVFSNTELKQLLLQRFKCTDDLVKISDELIDAALYKGSKDNISAIIVAFVNAPKVESECQRLDRLLDENIINKTMXXXXXXXXXXXXXXLIEYMKNIALE---NLPP-GGIVSKQSIIVNLFEK 1168
            MG++  KP TEK+N  G    + Y  SSMQG R  MED     + +P+  ++W++FA++DGH G RV+  CS  LL  I   E+F    K+ + L      +  GI+  F+ +D+ + +FS+        G+T   V ++P ++ F+NCGDSR+VL R   + FS+ DHKP NP+EKERI  AGG + + R+NG+++VSRALGD  YK        EQL+S EP+VY I R +E D+ +VLACDG+WDV SN EL + +  R + +DDL  + + ++D  L+KGS+DN+S ++V F NAPKV  E  + D  LD+++ ++ +E +  +S +  + DL   M+ ++ E   NLPP GG+  K+ +I  ++ +
Sbjct:    1 MGAFLDKPKTEKHNAHGAGNGLRYGLSSMQGWRVEMEDAHTAVVGIPHGLDNWSFFAVYDGHAGSRVANYCSTHLLEHITTNEDFRAADKSGSALEPSVESVKTGIRTGFLKIDEYMRNFSDLRNGMDRSGSTAVGVMVSPTHMYFINCGDSRAVLCRNGQVCFSTQDHKPCNPVEKERIQNAGGSVMIQRVNGSLAVSRALGDYDYKCVDGKGPTEQLVSPEPEVYEIVR-AEEDEFVVLACDGIWDVMSNEELCEFVKSRLEVSDDLENVCNWVVDTCLHKGSRDNMSVVLVCFSNAPKVSEEAVKRDSELDKHLESR-VEEIMQKSGEEGMPDLAHVMRILSAENIPNLPPGGGLAGKRHVIEAVYSR 369          
BLAST of Protein phosphatase 1B vs. Ensembl Mouse
Match: Ppm1b (protein phosphatase 1B, magnesium dependent, beta isoform [Source:MGI Symbol;Acc:MGI:101841])

HSP 1 Score: 272.707 bits (696), Expect = 1.146e-87
Identity = 148/371 (39.89%), Postives = 228/371 (61.46%), Query Frame = 2
Query:  104 MGSYNGKPNTEKYNESGKFGDIYYSSSSMQGMRSHMEDFQCISLNLPYPFEDWAYFAIFDGHGGYRVSELCSXXXXXXXXXXXXF----KNINLLNLDKSQIINGIKKAFISLDDKISHFSE--------GTTVSAVFITPNYLIFMNCGDSRSVLIRESDIFFSSIDHKPTNPLEKERILKAGGQITMDRLNGNMSVSRALGDSYYKKDYNLSAFEQLMSAEPDVYIISRNSENDQIIVLACDGVWDVFSNTELKQLLLQRFKCTDDLVKISDELIDAALYKGSKDNISAIIVAFVNAPKVESECQRLDRLLDENIINKTMXXXXXXXXXXXXXXLIEYMKNIALE---NLPP-GGIVSKQSIIVNLFEK 1168
            MG++  KP TEK+N  G    + Y  SSMQG R  MED     + +P+  ++W++FA++DGH G RV+  CS  LL  I   E+F    K+ + L      +  GI+  F+ +D+ + +FS+        G+T   V ++P ++ F+NCGDSR+VL R   + FS+ DHKP NP+EKERI  AGG + + R+NG+++VSRALGD  YK        EQL+S EP+VY I R +E D+ +VLACDG+WDV SN EL + +  R + +DDL  + + ++D  L+KGS+DN+S ++V F NAPKV  E  + D  LD+++ ++ +E +  +S +  + DL   M+ ++ E   NLPP GG+  K+ +I  ++ +
Sbjct:    1 MGAFLDKPKTEKHNAHGAGNGLRYGLSSMQGWRVEMEDAHTAVVGIPHGLDNWSFFAVYDGHAGSRVANYCSTHLLEHITTNEDFRAADKSGSALEPSVESVKTGIRTGFLKIDEYMRNFSDLRNGMDRSGSTAVGVMVSPTHMYFINCGDSRAVLCRNGQVCFSTQDHKPCNPVEKERIQNAGGSVMIQRVNGSLAVSRALGDYDYKCVDGKGPTEQLVSPEPEVYEIVR-AEEDEFVVLACDGIWDVMSNEELCEFVKSRLEVSDDLENVCNWVVDTCLHKGSRDNMSVVLVCFSNAPKVSEEAVKRDSELDKHLESR-VEEIMQKSGEEGMPDLAHVMRILSAENIPNLPPGGGLAGKRHVIEAVYSR 369          
BLAST of Protein phosphatase 1B vs. Ensembl Mouse
Match: Ppm1b (protein phosphatase 1B, magnesium dependent, beta isoform [Source:MGI Symbol;Acc:MGI:101841])

HSP 1 Score: 272.322 bits (695), Expect = 1.696e-87
Identity = 148/371 (39.89%), Postives = 228/371 (61.46%), Query Frame = 2
Query:  104 MGSYNGKPNTEKYNESGKFGDIYYSSSSMQGMRSHMEDFQCISLNLPYPFEDWAYFAIFDGHGGYRVSELCSXXXXXXXXXXXXF----KNINLLNLDKSQIINGIKKAFISLDDKISHFSE--------GTTVSAVFITPNYLIFMNCGDSRSVLIRESDIFFSSIDHKPTNPLEKERILKAGGQITMDRLNGNMSVSRALGDSYYKKDYNLSAFEQLMSAEPDVYIISRNSENDQIIVLACDGVWDVFSNTELKQLLLQRFKCTDDLVKISDELIDAALYKGSKDNISAIIVAFVNAPKVESECQRLDRLLDENIINKTMXXXXXXXXXXXXXXLIEYMKNIALE---NLPP-GGIVSKQSIIVNLFEK 1168
            MG++  KP TEK+N  G    + Y  SSMQG R  MED     + +P+  ++W++FA++DGH G RV+  CS  LL  I   E+F    K+ + L      +  GI+  F+ +D+ + +FS+        G+T   V ++P ++ F+NCGDSR+VL R   + FS+ DHKP NP+EKERI  AGG + + R+NG+++VSRALGD  YK        EQL+S EP+VY I R +E D+ +VLACDG+WDV SN EL + +  R + +DDL  + + ++D  L+KGS+DN+S ++V F NAPKV  E  + D  LD+++ ++ +E +  +S +  + DL   M+ ++ E   NLPP GG+  K+ +I  ++ +
Sbjct:    1 MGAFLDKPKTEKHNAHGAGNGLRYGLSSMQGWRVEMEDAHTAVVGIPHGLDNWSFFAVYDGHAGSRVANYCSTHLLEHITTNEDFRAADKSGSALEPSVESVKTGIRTGFLKIDEYMRNFSDLRNGMDRSGSTAVGVMVSPTHMYFINCGDSRAVLCRNGQVCFSTQDHKPCNPVEKERIQNAGGSVMIQRVNGSLAVSRALGDYDYKCVDGKGPTEQLVSPEPEVYEIVR-AEEDEFVVLACDGIWDVMSNEELCEFVKSRLEVSDDLENVCNWVVDTCLHKGSRDNMSVVLVCFSNAPKVSEEAVKRDSELDKHLESR-VEEIMQKSGEEGMPDLAHVMRILSAENIPNLPPGGGLAGKRHVIEAVYSR 369          
BLAST of Protein phosphatase 1B vs. UniProt/SwissProt
Match: sp|P20650|PPM1A_RAT (Protein phosphatase 1A OS=Rattus norvegicus OX=10116 GN=Ppm1a PE=1 SV=1)

HSP 1 Score: 280.411 bits (716), Expect = 7.916e-90
Identity = 149/367 (40.60%), Postives = 222/367 (60.49%), Query Frame = 2
Query:  104 MGSYNGKPNTEKYNESGKFGDIYYSSSSMQGMRSHMEDFQCISLNLPYPFEDWAYFAIFDGHGGYRVSELCSXXXXXXXXXXXXFKNINLLNLDKSQIINGIKKAFISLDDKISHFSE--------GTTVSAVFITPNYLIFMNCGDSRSVLIRESDIFFSSIDHKPTNPLEKERILKAGGQITMDRLNGNMSVSRALGDSYYKKDYNLSAFEQLMSAEPDVYIISRNSENDQIIVLACDGVWDVFSNTELKQLLLQRFKCTDDLVKISDELIDAALYKGSKDNISAIIVAFVNAPKVESECQRLDRLLDENIINKTMXXXXXXXXXXXXXXLIEYMKNIALEN---LPPGG-IVSKQSIIVNLFEK 1168
            MG++  KP  EK+N  G+   + Y  SSMQG R  MED     + LP   E W++FA++DGH G +V++ C   LL+ I   ++FK  +        + NGI+  F+ +D+ +   SE        G+T   V I+P +  F+NCGDSR +L R   + F + DHKP+NPLEKERI  AGG + + R+NG+++VSRALGD  YK  +     EQL+S EP+V+ I R+ E+DQ I+LACDG+WDV  N EL   +  R + TDDL K+ +E++D  LYKGS+DN+S I++ F NAPKV +E  + +  LD+ + N+       +     + DL+  M+ +A EN   LPPGG + SK+++I  ++ +
Sbjct:    1 MGAFLDKPKMEKHNAQGQGNGLRYGLSSMQGWRVEMEDAHTAVIGLPSGLETWSFFAVYDGHAGSQVAKYCCEHLLDHITNNQDFKG-SAGAPSVENVKNGIRTGFLEIDEHMRVMSEKKHGADRSGSTAVGVLISPQHTYFINCGDSRGLLCRNRKVHFFTQDHKPSNPLEKERIQNAGGSVMIQRVNGSLAVSRALGDFDYKCVHGKGPTEQLVSPEPEVHDIERSEEDDQFIILACDGIWDVMGNEELCDFVRSRLEVTDDLEKVCNEVVDTCLYKGSRDNMSVILICFPNAPKVSAEAVKKEAELDKYLENRV--EEIIKKQGEGVPDLVHVMRTLASENIPSLPPGGELASKRNVIEAVYNR 364          
BLAST of Protein phosphatase 1B vs. UniProt/SwissProt
Match: sp|O62829|PPM1A_BOVIN (Protein phosphatase 1A OS=Bos taurus OX=9913 GN=PPM1A PE=2 SV=1)

HSP 1 Score: 279.641 bits (714), Expect = 1.449e-89
Identity = 153/374 (40.91%), Postives = 223/374 (59.63%), Query Frame = 2
Query:  104 MGSYNGKPNTEKYNESGKFGDIYYSSSSMQGMRSHMEDFQCISLNLPYPFEDWAYFAIFDGHGGYRVSELCSXXXXXXXXXXXXFKNINLLNLDKSQIINGIKKAFISLDDKISHFSE--------GTTVSAVFITPNYLIFMNCGDSRSVLIRESDIFFSSIDHKPTNPLEKERILKAGGQITMDRLNGNMSVSRALGDSYYKKDYNLSAFEQLMSAEPDVYIISRNSENDQIIVLACDGVWDVFSNTELKQLLLQRFKCTDDLVKISDELIDAALYKGSKDNISAIIVAFVNAPKVESEC----QRLDRLLD---ENIINKTMXXXXXXXXXXXXXXLIEYMKNIALEN---LPPGG-IVSKQSIIVNLFEK 1168
            MG++  KP  EK+N  G+   + Y  SSMQG R  MED     + LP   E W++FA++DGH G +V++ C   LL+ I   ++FK  +        + NGI+  F+ +D+ +   SE        G+T   V I+P +  F+NCGDSR +L R   ++F + DHKP+NPLEKERI  AGG + + R+NG+++VSRALGD  YK  +     EQL+S EP+V+ I R+ E+DQ I+LACDG+WDV  N EL   +  R + TDDL K+ +E++D  LYKGS+DN+S I++ F NAPKV  E     + LD+ L+   E II K             + DL+  M+ +A EN   LPPGG + SK+++I  ++ +
Sbjct:    1 MGAFLDKPKMEKHNAQGQGNGLRYGLSSMQGWRVEMEDAHTAVIGLPSGLETWSFFAVYDGHAGSQVAKYCCEHLLDHITNNQDFKG-SAGAPSVENVKNGIRTGFLEIDEHMRVMSEKKHGADRSGSTAVGVLISPQHTYFINCGDSRGLLCRNRKVYFFTQDHKPSNPLEKERIQNAGGSVMIQRVNGSLAVSRALGDFDYKCVHGKGPTEQLVSPEPEVHDIERSEEDDQFIILACDGIWDVMGNEELCDFVRSRLEVTDDLEKVCNEVVDTCLYKGSRDNMSVILICFPNAPKVSPEAVKKEEELDKYLESRVEEIIKKQ---------GEGVPDLVHVMRTLASENIPSLPPGGELASKRNVIEAVYNR 364          
BLAST of Protein phosphatase 1B vs. UniProt/SwissProt
Match: sp|P35813|PPM1A_HUMAN (Protein phosphatase 1A OS=Homo sapiens OX=9606 GN=PPM1A PE=1 SV=1)

HSP 1 Score: 277.33 bits (708), Expect = 9.478e-89
Identity = 153/374 (40.91%), Postives = 222/374 (59.36%), Query Frame = 2
Query:  104 MGSYNGKPNTEKYNESGKFGDIYYSSSSMQGMRSHMEDFQCISLNLPYPFEDWAYFAIFDGHGGYRVSELCSXXXXXXXXXXXXFKNINLLNLDKSQIINGIKKAFISLDDKISHFSE--------GTTVSAVFITPNYLIFMNCGDSRSVLIRESDIFFSSIDHKPTNPLEKERILKAGGQITMDRLNGNMSVSRALGDSYYKKDYNLSAFEQLMSAEPDVYIISRNSENDQIIVLACDGVWDVFSNTELKQLLLQRFKCTDDLVKISDELIDAALYKGSKDNISAIIVAFVNAPKVESECQR----LDRLLD---ENIINKTMXXXXXXXXXXXXXXLIEYMKNIALEN---LPPGG-IVSKQSIIVNLFEK 1168
            MG++  KP  EK+N  G+   + Y  SSMQG R  MED     + LP   E W++FA++DGH G +V++ C   LL+ I   ++FK  +        + NGI+  F+ +D+ +   SE        G+T   V I+P +  F+NCGDSR +L R   + F + DHKP+NPLEKERI  AGG + + R+NG+++VSRALGD  YK  +     EQL+S EP+V+ I R+ E+DQ I+LACDG+WDV  N EL   +  R + TDDL K+ +E++D  LYKGS+DN+S I++ F NAPKV  E  +    LD+ L+   E II K             + DL+  M+ +A EN   LPPGG + SK+++I  ++ +
Sbjct:    1 MGAFLDKPKMEKHNAQGQGNGLRYGLSSMQGWRVEMEDAHTAVIGLPSGLESWSFFAVYDGHAGSQVAKYCCEHLLDHITNNQDFKG-SAGAPSVENVKNGIRTGFLEIDEHMRVMSEKKHGADRSGSTAVGVLISPQHTYFINCGDSRGLLCRNRKVHFFTQDHKPSNPLEKERIQNAGGSVMIQRVNGSLAVSRALGDFDYKCVHGKGPTEQLVSPEPEVHDIERSEEDDQFIILACDGIWDVMGNEELCDFVRSRLEVTDDLEKVCNEVVDTCLYKGSRDNMSVILICFPNAPKVSPEAVKKEAELDKYLECRVEEIIKKQ---------GEGVPDLVHVMRTLASENIPSLPPGGELASKRNVIEAVYNR 364          
BLAST of Protein phosphatase 1B vs. UniProt/SwissProt
Match: sp|P35814|PPM1A_RABIT (Protein phosphatase 1A OS=Oryctolagus cuniculus OX=9986 GN=PPM1A PE=2 SV=1)

HSP 1 Score: 276.944 bits (707), Expect = 1.459e-88
Identity = 148/367 (40.33%), Postives = 220/367 (59.95%), Query Frame = 2
Query:  104 MGSYNGKPNTEKYNESGKFGDIYYSSSSMQGMRSHMEDFQCISLNLPYPFEDWAYFAIFDGHGGYRVSELCSXXXXXXXXXXXXFKNINLLNLDKSQIINGIKKAFISLDDKISHFSE--------GTTVSAVFITPNYLIFMNCGDSRSVLIRESDIFFSSIDHKPTNPLEKERILKAGGQITMDRLNGNMSVSRALGDSYYKKDYNLSAFEQLMSAEPDVYIISRNSENDQIIVLACDGVWDVFSNTELKQLLLQRFKCTDDLVKISDELIDAALYKGSKDNISAIIVAFVNAPKVESECQRLDRLLDENIINKTMXXXXXXXXXXXXXXLIEYMKNIALEN---LPPGG-IVSKQSIIVNLFEK 1168
            MG++  KP  EK+N  G+   + Y  SSMQG R  MED     + LP   E W++FA++DGH G +V++ C   LL+ I   ++FK  +        + NGI+  F+ +D+ +   SE        G+T   V I+P +  F+NCGDSR +L R   + F + DHKP+NPLEKERI  AGG + + R+NG+++VSRALGD  YK  +     EQL+S EP+V+ I R+ E+DQ I+LACDG+WDV  N EL   +  R + TDDL K+ +E++D  LYKGS+DN+S I++ F NAPKV  E  + +  LD+ +  +       +     + DL+  M+ +A EN   LPPGG + SK+++I  ++ +
Sbjct:    1 MGAFLDKPKMEKHNAQGQGNGLRYGLSSMQGWRVEMEDAHTAVIGLPSGLETWSFFAVYDGHAGSQVAKYCCEHLLDHITNNQDFKG-SAGAPSVENVKNGIRTGFLEIDEHMRVMSEKKHGADRSGSTAVGVLISPQHTYFINCGDSRGLLCRNRKVHFFTQDHKPSNPLEKERIQNAGGSVMIQRVNGSLAVSRALGDFDYKCVHGKGPTEQLVSPEPEVHDIERSEEDDQFIILACDGIWDVMGNEELCDFVRSRLEVTDDLEKVCNEVVDTCLYKGSRDNMSVILICFPNAPKVSPEAVKKEAELDKYL--ECRVEEILKKQGEGVPDLVHVMRTLASENIPSLPPGGELASKRNVIEAVYNR 364          
BLAST of Protein phosphatase 1B vs. UniProt/SwissProt
Match: sp|P49443|PPM1A_MOUSE (Protein phosphatase 1A OS=Mus musculus OX=10090 GN=Ppm1a PE=1 SV=1)

HSP 1 Score: 276.174 bits (705), Expect = 2.849e-88
Identity = 151/374 (40.37%), Postives = 224/374 (59.89%), Query Frame = 2
Query:  104 MGSYNGKPNTEKYNESGKFGDIYYSSSSMQGMRSHMEDFQCISLNLPYPFEDWAYFAIFDGHGGYRVSELCSXXXXXXXXXXXXFKNINLLNLDKSQIINGIKKAFISLDDKISHFSE--------GTTVSAVFITPNYLIFMNCGDSRSVLIRESDIFFSSIDHKPTNPLEKERILKAGGQITMDRLNGNMSVSRALGDSYYKKDYNLSAFEQLMSAEPDVYIISRNSENDQIIVLACDGVWDVFSNTELKQLLLQRFKCTDDLVKISDELIDAALYKGSKDNISAIIVAFVNAPKVESECQR----LDRLLD---ENIINKTMXXXXXXXXXXXXXXLIEYMKNIALEN---LPPGG-IVSKQSIIVNLFEK 1168
            MG++  KP  EK+N  G+   + Y  SSMQG R  MED     + LP   E W++FA++DGH G +V++ C   LL+ I   ++F+  +        + NGI+  F+ +D+ +   SE        G+T   V I+P +  F+NCGDSR +L R   + F + DHKP+NPLEKERI  AGG + + R+NG+++VSRALGD  YK  +     EQL+S EP+V+ I R+ E+DQ I+LACDG+WDV  N EL   +  R + TDDL K+ +E++D  LYKGS+DN+S I++ F +APKV +E  +    LD+ L+   E II K +           + DL+  M+ +A EN   LPPGG + SK+++I  ++ +
Sbjct:    1 MGAFLDKPKMEKHNAQGQGNGLRYGLSSMQGWRVEMEDAHTAVIGLPSGLETWSFFAVYDGHAGSQVAKYCCEHLLDHITNNQDFRG-SAGAPSVENVKNGIRTGFLEIDEHMRVMSEKKHGADRSGSTAVGVLISPQHTYFINCGDSRGLLCRNRKVHFFTQDHKPSNPLEKERIQNAGGSVMIQRVNGSLAVSRALGDFDYKCVHGKGPTEQLVSPEPEVHDIERSEEDDQFIILACDGIWDVMGNEELCDFVRSRLEVTDDLEKVCNEVVDTCLYKGSRDNMSVILICFPSAPKVSAEAVKKEAELDKYLESRVEEIIKKQV---------EGVPDLVHVMRTLASENIPSLPPGGELASKRNVIEAVYNR 364          
BLAST of Protein phosphatase 1B vs. TrEMBL
Match: A0A2H1CX61 (Protein phosphatase 2C OS=Fasciola hepatica OX=6192 GN=D915_000734 PE=3 SV=1)

HSP 1 Score: 304.294 bits (778), Expect = 8.147e-97
Identity = 157/367 (42.78%), Postives = 230/367 (62.67%), Query Frame = 2
Query:  104 MGSYNGKPNTEKYNESGKFGDIYYSSSSMQGMRSHMEDFQCISLNLPYPFEDWAYFAIFDGHGGYRVSELCSXXXXXXXXXXXXFKNINL-LNLDKSQIINGIKKAFISLDDKISHFSE--------GTTVSAVFITPNYLIFMNCGDSRSVLIRESDIFFSSIDHKPTNPLEKERILKAGGQITMDRLNGNMSVSRALGDSYYKKDYNLSAFEQLMSAEPDVYIISRNSENDQIIVLACDGVWDVFSNTELKQLLLQRFKCTDDLVKISDELIDAALYKGSKDNISAIIVAFVNAPKVESECQRLDRLLDENIINKTMXXXXXXXXXXXXXXLIEYMKNIALENLPPGGIVSKQSIIVNLFEKYVS 1177
            MG+  G P TEKYNE+G    + Y  +SMQG R  MED  C    LP   +DW++FA+FDGH G  VS +C+ ELL  I++TEEFK I+  L     +I  GI+  F+SLDD++    +        G+T   V ITP ++ F NCGDSR+VLIR+ ++ F+++DHKP NP EKERI  AGG + ++R+NG+++VSR++GD  YK    L   EQL+S EP++ +++RN E D+IIVLACDG+WDV SN  L  LL  R +CTDDL  + +E ID  LYKGS DN+S ++VAF  AP+ + +C+  D  ++E +  +  +YL +     S+  ++ +++      +PP  +  K   I  L +++ S
Sbjct:    1 MGALLGTPKTEKYNETGSGNGLRYGIASMQGWRVSMEDAHCAITQLPGNLKDWSFFAVFDGHAGALVSAMCATELLKCIVDTEEFKKIDPDLAPSLPEIERGIRDGFLSLDDRLRQLPQVASGEDKSGSTAVCVLITPKHIFFANCGDSRAVLIRQGEVAFATVDHKPINPSEKERIQNAGGSVIVERVNGSLAVSRSIGDYAYKAVKGLGPTEQLISPEPEITVLNRNKELDEIIVLACDGIWDVLSNEALCSLLQHRMRCTDDLSLVCNETIDMCLYKGSSDNMSIVLVAFDPAPRTDPKCKSEDEKIEEVLFERAKKYLETTREQPSMESVLAHLQTFPEPQIPPFLVFCKGGKIQKLLDEFTS 367          
BLAST of Protein phosphatase 1B vs. TrEMBL
Match: A0A504YFS7 (Protein phosphatase type 2C alpha 2 OS=Fasciola gigantica OX=46835 GN=FGIG_08088 PE=3 SV=1)

HSP 1 Score: 304.294 bits (778), Expect = 9.793e-97
Identity = 157/367 (42.78%), Postives = 230/367 (62.67%), Query Frame = 2
Query:  104 MGSYNGKPNTEKYNESGKFGDIYYSSSSMQGMRSHMEDFQCISLNLPYPFEDWAYFAIFDGHGGYRVSELCSXXXXXXXXXXXXFKNINL-LNLDKSQIINGIKKAFISLDDKISHFSE--------GTTVSAVFITPNYLIFMNCGDSRSVLIRESDIFFSSIDHKPTNPLEKERILKAGGQITMDRLNGNMSVSRALGDSYYKKDYNLSAFEQLMSAEPDVYIISRNSENDQIIVLACDGVWDVFSNTELKQLLLQRFKCTDDLVKISDELIDAALYKGSKDNISAIIVAFVNAPKVESECQRLDRLLDENIINKTMXXXXXXXXXXXXXXLIEYMKNIALENLPPGGIVSKQSIIVNLFEKYVS 1177
            MG+  G P TEKYNE+G    + Y  +SMQG R  MED  C    LP   +DW++FA+FDGH G  VS +C+ ELL  I++TEEFK I+  L     +I  GI+  F+SLDD++    +        G+T   V ITP ++ F NCGDSR+VLIR+ ++ F+++DHKP NP EKERI  AGG + ++R+NG+++VSR++GD  YK    L   EQL+S EP++ +++RN E D+IIVLACDG+WDV SN  L  LL  R +CTDDL  + +E ID  LYKGS DN+S ++VAF  AP+ + +C+  D  ++E +  +  +YL +     S+  ++ +++      +PP  +  K   I  L +++ S
Sbjct:    1 MGALLGTPKTEKYNETGSGNGLRYGIASMQGWRVSMEDAHCAITQLPGNLKDWSFFAVFDGHAGALVSAMCATELLKCIVDTEEFKKIDPDLAPSLPEIERGIRDGFLSLDDRLRQLPQVASGEDKSGSTAVCVLITPKHIFFANCGDSRAVLIRQGEVAFATVDHKPINPSEKERIQNAGGSVIVERVNGSLAVSRSIGDYAYKAVKGLGPTEQLISPEPEITVLNRNKELDEIIVLACDGIWDVLSNEALCSLLQHRMRCTDDLSLVCNETIDMCLYKGSSDNMSIVLVAFDPAPRTDPKCKSEDEKVEEVLFERAKKYLETTREQPSMESVLAHLQTFPEPQIPPFLVFCKGGKIQKLLDEFTS 367          
BLAST of Protein phosphatase 1B vs. TrEMBL
Match: A0A0X3P3S7 (PPM-type phosphatase domain-containing protein OS=Schistocephalus solidus OX=70667 GN=TR160538 PE=3 SV=1)

HSP 1 Score: 303.138 bits (775), Expect = 9.959e-96
Identity = 168/393 (42.75%), Postives = 248/393 (63.10%), Query Frame = 2
Query:  104 MGSYNGKPNTEKYNESGKFGDIYYSSSSMQGMRSHMEDFQCISLNLPYPFEDWAYFAIFDGHGGYRVSELCSXXXXXXXXXXXXFKNINL-LNLDKSQIINGIKKAFISLDDKISHFSE--------GTTVSAVFITPNYLIFMNCGDSRSVLIRESDIFFSSIDHKPTNPLEKERILKAGGQITMDRLNGNMSVSRALGDSYYKKDYNLSAFEQLMSAEPDVYIISRNSENDQIIVLACDGVWDVFSNTELKQLLLQRFKCTDDLVKISDELIDAALYKGSKDNISAIIVAFVNAPKVE----SECQRLDRLLDENIINKTMXXXXXXXXXXXXXXLIEYMKNIALENLPPGGIVSKQSIIVNLFEKYVSVKSHCSDEFNIATKKLLNSKEM 1243
            MG+    P TEK+NESG   ++ Y  SSMQG R  MED  C    LP   +DW++FA+FDGH G  VSELC+ ELL  I++TEEFK I+  L     +I  GI++ F++LD+++ +  E        G+T   V ITPN++ F NCGDSR++LIR+  + F++ DHKP +P EKERI KAGG + + R+NG+++VSR++GD  YK D +L   +QL+S EP++ +I R   +DQ+IVLACDG+WDV SN  L +LLL+R +  DDL K+ DE ID  LYKGS DN+S ++VAF  APKV+    +E ++L+ +L E + NK +E  +   +      L  +++N+    LPP GI  K  ++  + + Y   K+  S    +   +LL+ +++
Sbjct:    3 MGALLDTPRTEKFNESGVGNNLRYGLSSMQGWRVSMEDAHCAITQLPGNLKDWSFFAVFDGHAGALVSELCASELLKCIVDTEEFKRIDPDLAPSIPEIQQGIREGFLALDERLRNLPEIASGKDRSGSTAVCVLITPNHIFFANCGDSRAMLIRDGKVSFATTDHKPVHPTEKERIQKAGGSVIIQRVNGSLAVSRSIGDFSYKTDRDLPPTQQLISPEPEITVIDREKASDQMIVLACDGIWDVLSNDNLCELLLERVQRLDDLSKVCDEAIDYCLYKGSSDNMSMVLVAFDPAPKVDPSLKAEDEKLEEVL-ERLTNKGLENAFFAPTSKIDCVL-NHLQNVCDFPLPPHGIYCKGGLVQRILDDY---KTSSSSRRALEESRLLSLQKL 390          
BLAST of Protein phosphatase 1B vs. TrEMBL
Match: A0A4Z2CS70 (Protein phosphatase 1A isoform 4 OS=Schistosoma japonicum OX=6182 GN=EWB00_007931 PE=3 SV=1)

HSP 1 Score: 297.36 bits (760), Expect = 4.341e-94
Identity = 154/361 (42.66%), Postives = 228/361 (63.16%), Query Frame = 2
Query:  104 MGSYNGKPNTEKYNESGKFGDIYYSSSSMQGMRSHMEDFQCISLNLPYPFEDWAYFAIFDGHGGYRVSELCSXXXXXXXXXXXXFKNINLLN-LDKSQIINGIKKAFISLD-DKISHFSEGTTVSAVFITPNYLIFMNCGDSRSVLIRESDIFFSSIDHKPTNPLEKERILKAGGQITMDRLNGNMSVSRALGDSYYKKDYNLSAFEQLMSAEPDVYIISRNSENDQIIVLACDGVWDVFSNTELKQLLLQRFKCTDDLVKISDELIDAALYKGSKDNISAIIVAFVNAPKVESECQRLDRLLDE---NIINKTMXXXXXXXXXXXXXXLIEYMKNIALENLPPGGIVSKQSIIVNLFEKY 1171
            MG++  KP TEK  + G+   + Y+ SSMQG R  MED       LP PF+DW+YF +FDGH G RVSELC+ +LL+ IL+TEEF+ +N    LD + +  GI   F++ D D  +    G+T    F+TP ++I  NCGDSR++L+R++    ++ DHKP NP+E +RI  AGGQ+ + R+NG+++VSR+LGD  YK+  + +A EQL+S EPDV+I+ R  E+DQII+LACDG+WDVF N  L   +L R  C   L  +  E++D +L+KGS+DN+S ++VA   AP V  E  R +  LD    N+I   +     +S+  ++  +   +KN+ L N PPGG  +K++ + N F  +
Sbjct:    1 MGAFLEKPKTEKVIDVGEGNGLRYAISSMQGWRVEMEDAHVAKSELPSPFQDWSYFGVFDGHAGSRVSELCATKLLDAILDTEEFQKLNPTKELDSTLVKKGIVNGFLTFDRDLAADEKSGSTAVVAFVTPTHIILANCGDSRAILVRDNKTLLATQDHKPYNPIESQRIFDAGGQVILSRVNGSLAVSRSLGDFEYKQVVSRAATEQLVSPEPDVFIVERKRESDQIILLACDGIWDVFENDTLTTYVLHRLCCLPSLADVCSEILDTSLHKGSRDNMSVLLVALDAAPTVNPEAVRKEMELDSSLNNMIVDIINSAGEDSNLLNVDYVASAVKNMNLPNYPPGGFNTKRAYVENFFNTH 361          
BLAST of Protein phosphatase 1B vs. TrEMBL
Match: A0A4Z2CSJ8 (Protein phosphatase 1A isoform 3 OS=Schistosoma japonicum OX=6182 GN=EWB00_007931 PE=3 SV=1)

HSP 1 Score: 296.59 bits (758), Expect = 5.333e-94
Identity = 154/361 (42.66%), Postives = 228/361 (63.16%), Query Frame = 2
Query:  104 MGSYNGKPNTEKYNESGKFGDIYYSSSSMQGMRSHMEDFQCISLNLPYPFEDWAYFAIFDGHGGYRVSELCSXXXXXXXXXXXXFKNINLLN-LDKSQIINGIKKAFISLD-DKISHFSEGTTVSAVFITPNYLIFMNCGDSRSVLIRESDIFFSSIDHKPTNPLEKERILKAGGQITMDRLNGNMSVSRALGDSYYKKDYNLSAFEQLMSAEPDVYIISRNSENDQIIVLACDGVWDVFSNTELKQLLLQRFKCTDDLVKISDELIDAALYKGSKDNISAIIVAFVNAPKVESECQRLDRLLDE---NIINKTMXXXXXXXXXXXXXXLIEYMKNIALENLPPGGIVSKQSIIVNLFEKY 1171
            MG++  KP TEK  + G+   + Y+ SSMQG R  MED       LP PF+DW+YF +FDGH G RVSELC+ +LL+ IL+TEEF+ +N    LD + +  GI   F++ D D  +    G+T    F+TP ++I  NCGDSR++L+R++    ++ DHKP NP+E +RI  AGGQ+ + R+NG+++VSR+LGD  YK+  + +A EQL+S EPDV+I+ R  E+DQII+LACDG+WDVF N  L   +L R  C   L  +  E++D +L+KGS+DN+S ++VA   AP V  E  R +  LD    N+I   +     +S+  ++  +   +KN+ L N PPGG  +K++ + N F  +
Sbjct:    1 MGAFLEKPKTEKVIDVGEGNGLRYAISSMQGWRVEMEDAHVAKSELPSPFQDWSYFGVFDGHAGSRVSELCATKLLDAILDTEEFQKLNPTKELDSTLVKKGIVNGFLTFDRDLAADEKSGSTAVVAFVTPTHIILANCGDSRAILVRDNKTLLATQDHKPYNPIESQRIFDAGGQVILSRVNGSLAVSRSLGDFEYKQVVSRAATEQLVSPEPDVFIVERKRESDQIILLACDGIWDVFENDTLTTYVLHRLCCLPSLADVCSEILDTSLHKGSRDNMSVLLVALDAAPTVNPEAVRKEMELDSSLNNMIVDIINSAGEDSNLLNVDYVASAVKNMNLPNYPPGGFNTKRAYVENFFNTH 361          
BLAST of Protein phosphatase 1B vs. Ensembl Cavefish
Match: ppm1ba (protein phosphatase, Mg2+/Mn2+ dependent 1B [Source:NCBI gene;Acc:103024377])

HSP 1 Score: 284.648 bits (727), Expect = 1.809e-92
Identity = 148/373 (39.68%), Postives = 228/373 (61.13%), Query Frame = 2
Query:  104 MGSYNGKPNTEKYNESGKFGDIYYSSSSMQGMRSHMEDFQCISLNLPYPFEDWAYFAIFDGHGGYRVSELCSXXXXXXXXXXXXFKNINLLNLDKSQ------IINGIKKAFISLDDKISHFSE--------GTTVSAVFITPNYLIFMNCGDSRSVLIRESDIFFSSIDHKPTNPLEKERILKAGGQITMDRLNGNMSVSRALGDSYYKKDYNLSAFEQLMSAEPDVYIISRNSENDQIIVLACDGVWDVFSNTELKQLLLQRFKCTDDLVKISDELIDAALYKGSKDNISAIIVAFVNAPKVESECQRLDRLLDENIINKTMXXXXXXXXXXXXXXLIEYMKNIALE---NLPP-GGIVSKQSIIVNLFEK 1168
            MG++  KP TEK+N  G+   + Y  SSMQG R  MED    ++ LP+  +DW++FA++DGH G RV+  CS  LL  I+     + +        +      + +GI+  F+ +D+ +  F++        G+T  AV ++P ++ F+NCGDSR++L R + + FS++DHKP NP EKERI  AGG + + R+NG+++VSRALGD  YK        EQL+S EP+V+ I R+   D+ +VLACDG+WDV SN EL   +  R + +DDL K+ +E++D  L+KGS+DN+S ++V   NAPKV  E  + D  LD+  +   +E L  ++ +  + DL+  M+N+A E   NLPP GG+ SK S+I  ++ +
Sbjct:    1 MGAFLDKPKTEKHNAHGEGNGLRYGLSSMQGWRVEMEDAHTAAVGLPHGLDDWSFFAVYDGHAGSRVANYCSNHLLEHIVAAGSVEELRKAGAPSPETPAVEAVKSGIRAGFLRIDEHMRSFTDLRNGMDRSGSTAVAVLLSPEHMYFINCGDSRALLCRNAHVCFSTLDHKPCNPREKERIQNAGGSVMIQRVNGSLAVSRALGDYDYKSVEGKGPTEQLVSPEPEVFEIVRSEAEDEFVVLACDGIWDVMSNEELCAFVRARLEVSDDLEKVCNEVVDTCLHKGSRDNMSVVLVCLPNAPKVSEEAVKKDAELDK-FLESRVEELIEKAGEGGIPDLVHVMRNLATENIPNLPPGGGLPSKHSVIEAVYNR 372          
BLAST of Protein phosphatase 1B vs. Ensembl Cavefish
Match: ppm1ba (protein phosphatase, Mg2+/Mn2+ dependent 1B [Source:NCBI gene;Acc:103024377])

HSP 1 Score: 284.648 bits (727), Expect = 2.537e-92
Identity = 148/373 (39.68%), Postives = 228/373 (61.13%), Query Frame = 2
Query:  104 MGSYNGKPNTEKYNESGKFGDIYYSSSSMQGMRSHMEDFQCISLNLPYPFEDWAYFAIFDGHGGYRVSELCSXXXXXXXXXXXXFKNINLLNLDKSQ------IINGIKKAFISLDDKISHFSE--------GTTVSAVFITPNYLIFMNCGDSRSVLIRESDIFFSSIDHKPTNPLEKERILKAGGQITMDRLNGNMSVSRALGDSYYKKDYNLSAFEQLMSAEPDVYIISRNSENDQIIVLACDGVWDVFSNTELKQLLLQRFKCTDDLVKISDELIDAALYKGSKDNISAIIVAFVNAPKVESECQRLDRLLDENIINKTMXXXXXXXXXXXXXXLIEYMKNIALE---NLPP-GGIVSKQSIIVNLFEK 1168
            MG++  KP TEK+N  G+   + Y  SSMQG R  MED    ++ LP+  +DW++FA++DGH G RV+  CS  LL  I+     + +        +      + +GI+  F+ +D+ +  F++        G+T  AV ++P ++ F+NCGDSR++L R + + FS++DHKP NP EKERI  AGG + + R+NG+++VSRALGD  YK        EQL+S EP+V+ I R+   D+ +VLACDG+WDV SN EL   +  R + +DDL K+ +E++D  L+KGS+DN+S ++V   NAPKV  E  + D  LD+  +   +E L  ++ +  + DL+  M+N+A E   NLPP GG+ SK S+I  ++ +
Sbjct:    1 MGAFLDKPKTEKHNAHGEGNGLRYGLSSMQGWRVEMEDAHTAAVGLPHGLDDWSFFAVYDGHAGSRVANYCSNHLLEHIVAAGSVEELRKAGAPSPETPAVEAVKSGIRAGFLRIDEHMRSFTDLRNGMDRSGSTAVAVLLSPEHMYFINCGDSRALLCRNAHVCFSTLDHKPCNPREKERIQNAGGSVMIQRVNGSLAVSRALGDYDYKSVEGKGPTEQLVSPEPEVFEIVRSEAEDEFVVLACDGIWDVMSNEELCAFVRARLEVSDDLEKVCNEVVDTCLHKGSRDNMSVVLVCLPNAPKVSEEAVKKDAELDK-FLESRVEELIEKAGEGGIPDLVHVMRNLATENIPNLPPGGGLPSKHSVIEAVYNR 372          
BLAST of Protein phosphatase 1B vs. Ensembl Cavefish
Match: ppm1ba (protein phosphatase, Mg2+/Mn2+ dependent 1B [Source:NCBI gene;Acc:103024377])

HSP 1 Score: 284.648 bits (727), Expect = 6.349e-92
Identity = 148/373 (39.68%), Postives = 228/373 (61.13%), Query Frame = 2
Query:  104 MGSYNGKPNTEKYNESGKFGDIYYSSSSMQGMRSHMEDFQCISLNLPYPFEDWAYFAIFDGHGGYRVSELCSXXXXXXXXXXXXFKNINLLNLDKSQ------IINGIKKAFISLDDKISHFSE--------GTTVSAVFITPNYLIFMNCGDSRSVLIRESDIFFSSIDHKPTNPLEKERILKAGGQITMDRLNGNMSVSRALGDSYYKKDYNLSAFEQLMSAEPDVYIISRNSENDQIIVLACDGVWDVFSNTELKQLLLQRFKCTDDLVKISDELIDAALYKGSKDNISAIIVAFVNAPKVESECQRLDRLLDENIINKTMXXXXXXXXXXXXXXLIEYMKNIALE---NLPP-GGIVSKQSIIVNLFEK 1168
            MG++  KP TEK+N  G+   + Y  SSMQG R  MED    ++ LP+  +DW++FA++DGH G RV+  CS  LL  I+     + +        +      + +GI+  F+ +D+ +  F++        G+T  AV ++P ++ F+NCGDSR++L R + + FS++DHKP NP EKERI  AGG + + R+NG+++VSRALGD  YK        EQL+S EP+V+ I R+   D+ +VLACDG+WDV SN EL   +  R + +DDL K+ +E++D  L+KGS+DN+S ++V   NAPKV  E  + D  LD+  +   +E L  ++ +  + DL+  M+N+A E   NLPP GG+ SK S+I  ++ +
Sbjct:    1 MGAFLDKPKTEKHNAHGEGNGLRYGLSSMQGWRVEMEDAHTAAVGLPHGLDDWSFFAVYDGHAGSRVANYCSNHLLEHIVAAGSVEELRKAGAPSPETPAVEAVKSGIRAGFLRIDEHMRSFTDLRNGMDRSGSTAVAVLLSPEHMYFINCGDSRALLCRNAHVCFSTLDHKPCNPREKERIQNAGGSVMIQRVNGSLAVSRALGDYDYKSVEGKGPTEQLVSPEPEVFEIVRSEAEDEFVVLACDGIWDVMSNEELCAFVRARLEVSDDLEKVCNEVVDTCLHKGSRDNMSVVLVCLPNAPKVSEEAVKKDAELDK-FLESRVEELIEKAGEGGIPDLVHVMRNLATENIPNLPPGGGLPSKHSVIEAVYNR 372          
BLAST of Protein phosphatase 1B vs. Ensembl Cavefish
Match: ppm1bb (protein phosphatase 1B-like [Source:NCBI gene;Acc:103035481])

HSP 1 Score: 268.085 bits (684), Expect = 4.320e-86
Identity = 146/367 (39.78%), Postives = 223/367 (60.76%), Query Frame = 2
Query:  104 MGSYNGKPNTEKYNESGKFGDIYYSSSSMQGMRSHMEDFQCISLNLPYPFEDWAYFAIFDGHGGYRVSELCSXXXXXXXXXXXXFKNINLLNLDKSQIINGIKKAFISLDDKISHFSE--------GTTVSAVFITPNYLIFMNCGDSRSVLIRESDIFFSSIDHKPTNPLEKERILKAGGQITMDRLNGNMSVSRALGDSYYKKDYNLSAFEQLMSAEPDVYIISRNSENDQIIVLACDGVWDVFSNTELKQLLLQRFKCTDDLVKISDELIDAALYKGSKDNISAIIVAFVNAPKVESECQRLDRLLDENIINKTMXXXXXXXXXXXXXXLIEYMKNIALE---NLPP-GGIVSKQSIIVNLFEK 1168
            MG++  KP TEK+N  G    + +  SSMQG R  MED     + LP+  +DW++FA++DGH G RV+  CS  LL  I+     ++          + +GI+  F+ +D+ + +FS+        G+T   V ++P +L F+NCGDSR+VL R + + FS+ DHKP NP EKERI  AGG + + R+NG+++VSRALGD  YK        EQL+S EP+VY I R  + D+ +VLACDG+WDV SN EL + +  R +  +DL K+ + ++D  L+KGS+DN+S ++V F NAPKV  E  + +  LD+  I   +E +  +S +  + DL   M+ ++ E   NLPP GG+ SK+S++  ++ +
Sbjct:    1 MGAFLDKPKTEKHNAHGAGNGLRFGLSSMQGWRVEMEDAHTAVVGLPHGLDDWSFFAVYDGHAGSRVANYCSKHLLEHIITNS--EDFQPGPDSVEGVKSGIRSGFLKIDEYMRNFSDLRNGMDRSGSTAVGVLLSPEHLYFINCGDSRAVLSRAAQVRFSTQDHKPCNPREKERIQNAGGSVMIQRVNGSLAVSRALGDYDYKCVDGKGPTEQLVSPEPEVYEIPRVPDEDEFVVLACDGIWDVMSNEELCEFVRSRLEVWEDLEKVCNSVVDTCLHKGSRDNMSVVLVCFPNAPKVSEEAVKKEAELDK-FIESRVEEIMEKSGEEGIPDLAYIMRTLSAESISNLPPGGGLASKRSVVEAVYNR 364          
BLAST of Protein phosphatase 1B vs. Ensembl Cavefish
Match: ppm1bb (protein phosphatase 1B-like [Source:NCBI gene;Acc:103035481])

HSP 1 Score: 267.7 bits (683), Expect = 7.137e-86
Identity = 146/367 (39.78%), Postives = 223/367 (60.76%), Query Frame = 2
Query:  104 MGSYNGKPNTEKYNESGKFGDIYYSSSSMQGMRSHMEDFQCISLNLPYPFEDWAYFAIFDGHGGYRVSELCSXXXXXXXXXXXXFKNINLLNLDKSQIINGIKKAFISLDDKISHFSE--------GTTVSAVFITPNYLIFMNCGDSRSVLIRESDIFFSSIDHKPTNPLEKERILKAGGQITMDRLNGNMSVSRALGDSYYKKDYNLSAFEQLMSAEPDVYIISRNSENDQIIVLACDGVWDVFSNTELKQLLLQRFKCTDDLVKISDELIDAALYKGSKDNISAIIVAFVNAPKVESECQRLDRLLDENIINKTMXXXXXXXXXXXXXXLIEYMKNIALE---NLPP-GGIVSKQSIIVNLFEK 1168
            MG++  KP TEK+N  G    + +  SSMQG R  MED     + LP+  +DW++FA++DGH G RV+  CS  LL  I+     ++          + +GI+  F+ +D+ + +FS+        G+T   V ++P +L F+NCGDSR+VL R + + FS+ DHKP NP EKERI  AGG + + R+NG+++VSRALGD  YK        EQL+S EP+VY I R  + D+ +VLACDG+WDV SN EL + +  R +  +DL K+ + ++D  L+KGS+DN+S ++V F NAPKV  E  + +  LD+  I   +E +  +S +  + DL   M+ ++ E   NLPP GG+ SK+S++  ++ +
Sbjct:    1 MGAFLDKPKTEKHNAHGAGNGLRFGLSSMQGWRVEMEDAHTAVVGLPHGLDDWSFFAVYDGHAGSRVANYCSKHLLEHIITNS--EDFQPGPDSVEGVKSGIRSGFLKIDEYMRNFSDLRNGMDRSGSTAVGVLLSPEHLYFINCGDSRAVLSRAAQVRFSTQDHKPCNPREKERIQNAGGSVMIQRVNGSLAVSRALGDYDYKCVDGKGPTEQLVSPEPEVYEIPRVPDEDEFVVLACDGIWDVMSNEELCEFVRSRLEVWEDLEKVCNSVVDTCLHKGSRDNMSVVLVCFPNAPKVSEEAVKKEAELDK-FIESRVEEIMEKSGEEGIPDLAYIMRTLSAESISNLPPGGGLASKRSVVEAVYNR 364          
BLAST of Protein phosphatase 1B vs. Ensembl Sea Lamprey
Match: ppm1aa (protein phosphatase, Mg2+/Mn2+ dependent, 1Aa [Source:ZFIN;Acc:ZDB-GENE-991102-15])

HSP 1 Score: 260.766 bits (665), Expect = 3.302e-83
Identity = 144/361 (39.89%), Postives = 214/361 (59.28%), Query Frame = 2
Query:  104 MGSYNGKPNTEKYNESGKFGDIYYSSSSMQGMRSHMEDFQCISLNLPYPFEDWAYFAIFDGHGGYRVSELCSXXXXXXXXXXXXFKNINLLNLDKSQIINGIKKAFISLDDKISHFSE--------GTTVSAVFITPNYLIFMNCGDSRSVLIRESDIFFSSIDHKPTNPLEKERILKAGGQITMDRLNGNMSVSRALGDSYYKKDYNLSAFEQLMSAEPDVYIISRNSENDQIIVLACDGVWDVFSNTELKQLLLQRFKCTDDLVKISDELIDAALYKGSKDNISAIIVAFVNAPKVESECQRLDRLLDENIINKTMXXXXXXXXXXXXXXLIEYMKNIALE---NLPPGGIVSKQSIIV 1153
            MG++  KP TEK+   G    + Y+ SSMQG R  MED     + +P   + W++FA++DGH G RV+  CS  LL  I+  E F+           +  GI+  F+ +D+ +   S+        G+T  AV ++P +L F+NCGDSR+VL R   + F + DHKP NP EKERI + GG + + R+NG+++VSRALGD  YK        EQL+S EP+V  I R S+ D+ +VLACDG+WDV SN EL Q +  R   TDDL KI ++++D  LYKGS+DN+S ++V F NAPKV  E    +  LD+ +  K +E +  + +     DL   ++ +++E   NLPPGG ++ + +++
Sbjct:    1 MGAFLDKPKTEKHTTHGGGNGLRYALSSMQGWRVEMEDAHTAVVGIPRGLKTWSFFAVYDGHAGSRVATFCSEHLLEHIITNEHFECKAGTEPSSEAVEKGIQAGFLQIDEHMRTISDIKNGLDRSGSTAVAVMLSPKHLYFINCGDSRAVLYRNGSVHFCTEDHKPCNPAEKERI-QNGGSVMIQRVNGSLAVSRALGDFDYKCVDGKGPTEQLVSPEPEVRAIER-SDGDEFVVLACDGIWDVMSNEELGQFVHSRLLLTDDLEKICNQVLDTCLYKGSRDNMSIVLVCFPNAPKVTVEAVAREEELDKFLETK-VEEVLEKHTGEVAPDLASVIRAVSVENIPNLPPGGGLASKRVLI 358          
BLAST of Protein phosphatase 1B vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003550.1 (pep scaffold:Pmarinus_7.0:GL496710:143:1226:1 gene:ENSPMAG00000003243.1 transcript:ENSPMAT00000003550.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 126.331 bits (316), Expect = 1.969e-33
Identity = 98/311 (31.51%), Postives = 158/311 (50.80%), Query Frame = 2
Query:  104 MGSYNGKPNTEKYNESGKFGDIYYSSSSMQGMRSHMEDFQCISLNLPYPFEDWAYFAIFDGHGGYRVSELCSXXXXXXXXXXXXFKNINL--------LNLDKSQIINGIKKAFISLDDKISHFSEG-----------TTVSAVFITPNYLIFMNCGDSRSVLIRESDIFFSSIDHKPTNPLEKERILKAGGQITMDRLNGNMSVSRALGDSYYKKDYNLSAFEQLMSAEPDVYIISRNSENDQIIVLACDGVWDVFSNTELKQLLLQRFKCTDDLVK-----ISDELI--DAALYKG-SKDNISAIIVAF 955
            MG Y   P  EK +E G+   + Y ++ MQG R+ MED     L+L +     ++F ++DGHGG  V++     L++ + +   F+  N         ++LD+  ++    K+  + D   S F  G           T VSA+ ITP  +   N GDSR VL  +      S DHKP N LEK+RI +AGG +  +R+ G +++SR++GD  YK + +LS  +Q+++  P+V      +E    ++LACDG+WD  S+ E    + +  K  D  +      I D++I  D A   G   DN++ ++V F
Sbjct:    1 MGPYLTVPRKEKESEDGENTKLRYGATGMQGWRNTMEDSHIACLDLGHGV---SFFGVYDGHGGNEVADFVRDHLVDELKKLPSFQGSNYEQALKDIYIHLDE-MLLTPYGKSKKNNDSGSSLFGRGGSEEIAMGTGCTAVSAI-ITPTDIYVGNSGDSRVVLAVKYHGIEMSEDHKPDNRLEKQRIERAGGFVEDNRVKGVLNLSRSIGDLEYKLNKSLSVDDQMITVVPEVRREKITNET-AFLILACDGIWDCLSSQECTNFVGELLKKKDRRLSSVVEDIFDKIIATDVASSGGIGCDNMTCVVVQF 305          
BLAST of Protein phosphatase 1B vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003549.1 (pep scaffold:Pmarinus_7.0:GL496710:143:1226:1 gene:ENSPMAG00000003243.1 transcript:ENSPMAT00000003549.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 125.561 bits (314), Expect = 4.021e-33
Identity = 98/311 (31.51%), Postives = 156/311 (50.16%), Query Frame = 2
Query:  104 MGSYNGKPNTEKYNESGKFGDIYYSSSSMQGMRSHMEDFQCISLNLPYPFEDWAYFAIFDGHGGYRVSELCSXXXXXXXXXXXXFKNINL--------LNLDKSQIINGIKKAFISLDDKISHFSEG-----------TTVSAVFITPNYLIFMNCGDSRSVLIRESDIFFSSIDHKPTNPLEKERILKAGGQITMDRLNGNMSVSRALGDSYYKKDYNLSAFEQLMSAEPDVYIISRNSENDQIIVLACDGVWDVFSNTELKQLLLQRFKCTDDLVK-----ISDELI--DAALYKG-SKDNISAIIVAF 955
            MG Y   P  EK +E G+   + Y ++ MQG R+ MED     L+L +     ++F ++DGHGG  V++     L++ + +   F+  N         ++LD+  +    K    + D   S F  G           T VSA+ ITP  +   N GDSR VL  +      S DHKP N LEK+RI +AGG +  +R+ G +++SR++GD  YK + +LS  +Q+++  P+V      +E    ++LACDG+WD  S+ E    + +  K  D  +      I D++I  D A   G   DN++ ++V F
Sbjct:    1 MGPYLTVPRKEKESEDGENTKLRYGATGMQGWRNTMEDSHIACLDLGHGV---SFFGVYDGHGGNEVADFVRDHLVDELKKLPSFQGSNYEQALKDIYIHLDEMLLTPYGKSYKKNNDSGSSLFGRGGSEEIAMGTGCTAVSAI-ITPTDIYVGNSGDSRVVLAVKYHGIEMSEDHKPDNRLEKQRIERAGGFVEDNRVKGVLNLSRSIGDLEYKLNKSLSVDDQMITVVPEVRREKITNET-AFLILACDGIWDCLSSQECTNFVGELLKKKDRRLSSVVEDIFDKIIATDVASSGGIGCDNMTCVVVQF 306          
BLAST of Protein phosphatase 1B vs. Ensembl Sea Lamprey
Match: ppm1e (protein phosphatase, Mg2+/Mn2+ dependent, 1E [Source:ZFIN;Acc:ZDB-GENE-070326-2])

HSP 1 Score: 88.5817 bits (218), Expect = 8.717e-20
Identity = 78/282 (27.66%), Postives = 123/282 (43.62%), Query Frame = 2
Query:  176 SSSSMQGMRSHMEDFQCISLNLPYPF------EDWAYFAIFDGHGGYRVSELCSXXXXXXXXXXXXFKNINLLNLDKSQIINGIKKAFISLDDKI------SHFSEGTTVSAVFITPNYLIFMNCGDSRSVLIRESDIFFSSIDHKPTNPLEKERILKAGGQITM---DRLNGNMSVSRALGDSYYKKDYNLSAFEQLMSAEPDVYIISRNSENDQIIVLACDGVWDVFSNTELKQLLLQRFKCTD-DLVKISDELIDAALYKGSKDNISAIIVAFVNAPKV 973
            S  +++  R  MED   I  +L   F      +D AYFAIFDGHGG   +   +  L   +     F+   L           +++AF   D +        ++  G+T     I  N L     GDS+ +L+R+         HKP    EK+RI   GG +      R+NG +SVSRA+GD  +K           +S + D      +   D ++ LACDG +D     E  +++ +  +  D D   ++  L+ +A   GS DNI+ ++V   +A  V
Sbjct:   82 SLHAIKNTRRKMEDRHVIFQDLNALFTSEEEEDDQAYFAIFDGHGGVDAAIYAATHLHVSLAREGSFRRDPL---------EALRRAFCQTDQRFVLKARQENWRCGSTGVVTLIRGNELHVAWLGDSQVILVRKGSPVELMSPHKPDREDEKKRIEALGGCVIWFGAWRVNGTLSVSRAIGDMEHKP---------YVSCDADCATFPLDGSEDYLL-LACDGFYDTVQPDEAARIVGEHLRENDGDPAMLAHRLVASARDAGSSDNITVLVVFLRDARDV 344          
BLAST of Protein phosphatase 1B vs. Ensembl Sea Lamprey
Match: ppm1e (protein phosphatase, Mg2+/Mn2+ dependent, 1E [Source:ZFIN;Acc:ZDB-GENE-070326-2])

HSP 1 Score: 82.4185 bits (202), Expect = 1.857e-18
Identity = 67/241 (27.80%), Postives = 106/241 (43.98%), Query Frame = 2
Query:  263 AYFAIFDGHGGYRVSELCSXXXXXXXXXXXXFKNINLLNLDKSQIINGIKKAFISLDDKI--------SHFSEGTTVSAVFITPNYLIFMNCGDSRSVLIRESDIFFSSIDHKPTNPLEKERILKAGGQITM---DRLNGNMSVSRALGDSYYKKDYNLSAFEQLMSAEPDVYIISRNSENDQIIVLACDGVWDVFSNTELKQLLLQRFKCTD-DLVKISDELIDAALYKGSKDNISAIIV 949
            AYFAIFDGHGG   +   +  L   +     F+   L           +++AF   D +          ++  G+T     I  N L     GDS+ +L+R+         HKP    EK+RI   GG +      R+NG +SVSRA+GD  +K           +S + D      +   D ++ LACDG +D     E  +++ +  +  D D   ++  L+ +A   GS DNI+ ++V
Sbjct:    1 AYFAIFDGHGGVDAAIYAATHLHVSLAREGSFRRDPL---------EALRRAFCQTDQRFVLKARQEQKNWRCGSTGVVTLIRGNELHVAWLGDSQVILVRKGSPVELMSPHKPDREDEKKRIEALGGCVIWFGAWRVNGTLSVSRAIGDMEHKP---------YVSCDADCATFPLDGSEDYLL-LACDGFYDTVQPDEAARIVGEHLRENDGDPAMLAHRLVASARDAGSSDNITVLVV 222          
BLAST of Protein phosphatase 1B vs. Ensembl Yeast
Match: PTC3 (Type 2C protein phosphatase (PP2C); dephosphorylates Hog1p (see also Ptc2p) to limit maximal kinase activity induced by osmotic stress; dephosphorylates T169 phosphorylated Cdc28p (see also Ptc2p); role in DNA damage checkpoint inactivation; PTC3 has a paralog, PTC2, that arose from the whole genome duplication [Source:SGD;Acc:S000000152])

HSP 1 Score: 144.05 bits (362), Expect = 6.147e-39
Identity = 104/319 (32.60%), Postives = 165/319 (51.72%), Query Frame = 2
Query:  104 MGSYNGKPNTEKYNESGKFGDIYYSSSSMQGMRSHMEDFQCISLNL--PYPFEDWAYFAIFDGHGGYRVSELCSXXXXXXXXXXXXFKNINLLNLDKSQIINGIKKAFISL--DDKISHFSEGTTVSAVFIT--PNYLIFMNCGDSRSVLIRESDIFFSSIDHKPTNPLEKERILKAGGQITMDRLNGNMSVSRALGDSYYKKDYNLSAFEQLMSAEPDVYIISRNSENDQIIVLACDGVWDVFSNTELKQLL---LQRFKCTDDLVKISDELIDAALYKGSK------DNISAIIVAFVNAPKVESECQRLDRLLDEN 1015
            MG     P  +K + SG      +   +MQG R  MED   +  NL      E  A++ IFDGHGG  V+E C  ++++I+ + E FK+  L    +  +I+      + L  D+K+     G T + + ++     LI  N GDSR+VL    +    S DHKPT   EK RI+ A G + MDR+NGN+++SRA+GD  +K +  L   EQ+++  PD+   + N + D+ ++LACDG+WD  ++ E   L+   + +   T  L  IS  ++D      ++      DN+S  IVA +   + ESE Q  +R+  +N
Sbjct:    1 MGQILSNPIIDKEHHSGTDCLTAFGLCAMQGWRMSMEDAHIVEPNLLAESDEEHLAFYGIFDGHGGSSVAEFCGSKMISILKKQESFKSGML----EQCLIDTFLATDVELLKDEKLKDDHSGCTATVILVSQLKKLLICANSGDSRTVLSTGGNSKAMSFDHKPTLLSEKSRIVAADGFVEMDRVNGNLALSRAIGDFEFKSNTKLGPHEQVVTCVPDIICHNLNYDEDEFVILACDGIWDCLTSQECVDLVHYGISQGNMT--LSDISSRIVDVCCSPTTEGSGIGCDNMSISIVALLK--ENESESQWFERMRSKN 311          
BLAST of Protein phosphatase 1B vs. Ensembl Yeast
Match: PTC2 (Type 2C protein phosphatase (PP2C); dephosphorylates Hog1p to limit maximal osmostress induced kinase activity; dephosphorylates Ire1p to downregulate the unfolded protein response; dephosphorylates Cdc28p; inactivates the DNA damage checkpoint; PTC2 has a paralog, PTC3, that arose from the whole genome duplication [Source:SGD;Acc:S000000891])

HSP 1 Score: 142.51 bits (358), Expect = 2.471e-38
Identity = 100/310 (32.26%), Postives = 160/310 (51.61%), Query Frame = 2
Query:  104 MGSYNGKPNTEKYNESGKFGDIYYSSSSMQGMRSHMEDFQCISLNL--PYPFEDWAYFAIFDGHGGYRVSELCSXXXXXXXXXXXXFKNINLLNLDKSQIINGIKKAFISLDDKISHFSEGTTVSAVFITP--NYLIFMNCGDSRSVLIRESDIFFSSIDHKPTNPLEKERILKAGGQITMDRLNGNMSVSRALGDSYYKKDYNLSAFEQLMSAEPDVYIISRNSENDQIIVLACDGVWDVFSNTELKQLLLQRFKCTDDLVKISDELID---AALYKGSK---DNISAIIVAFVNAPKVESECQRLDRL 1003
            MG     P  +K + SG      +   +MQG R  MED   +  N+      +  A++ IFDGHGG +V+E C  +++ I+ E + F   NL        IN   K     D  +     G T +++ ++   N L+  N GDSR+VL  + +    S DHKPT   EK RI+ A G + MDR+NGN+++SRA+GD  +K +  L   EQ+++  PD+   S + + D+ ++LACDG+WD  ++ +   L+    +    L +IS  +ID   A   +G+    DN+S ++VA +   + E   Q  DR+
Sbjct:    1 MGQILSNPVIDKESHSGADSLTAFGLCAMQGWRMSMEDSHILEPNVLTKSDKDHIAFYGIFDGHGGAKVAEYCGNKIVEILQEQKSFHEGNLPRALIDTFINTDVKLL--QDPVMKEDHSGCTATSILVSKSQNLLVCGNAGDSRTVLATDGNAKALSYDHKPTLASEKSRIVAADGFVEMDRVNGNLALSRAIGDFEFKSNPKLGPEEQIVTCVPDILEHSLDYDRDEFVILACDGIWDCLTSQDCVDLVHLGLREGKTLNEISSRIIDVCCAPTTEGTGIGCDNMSIVVVALLK--EGEDVAQWSDRM 306          
BLAST of Protein phosphatase 1B vs. Ensembl Yeast
Match: PTC1 (Type 2C protein phosphatase (PP2C); dephosphorylates Hog1p, inactivating osmosensing MAPK cascade; involved in Fus3p activation during pheromone response; deletion affects precursor tRNA splicing, mitochondrial inheritance, and sporulation [Source:SGD;Acc:S000002164])

HSP 1 Score: 104.76 bits (260), Expect = 4.897e-26
Identity = 77/270 (28.52%), Postives = 130/270 (48.15%), Query Frame = 2
Query:  200 RSHMEDFQCISLNLPYPFEDWAYFAIFDGHGGYRVSELCSXXXXXXXXXXXXFKNINLLNLDKSQIINGIKKAFISLDDKISH---FSEGTTVSAVFIT-----------------PNYLIFMNCGDSRSVLIRESDIFFSSIDHKPTNPLEKERILKAGGQITMDRLNGNMSVSRALGDSYYKKDYNLSAFEQLMSAEPDVYIISRNSENDQIIVLACDGVWDVFSNTELKQLLLQRFKCTDDLVKISDELIDAALYKGSKDNISAIIV 949
            R  MED      N      DW YFA+FDGH G + S+ C   L  II +       N+L  +   + + +  +F+++D++I+     + G T +   +                     L   N GDSR VL R  +    + DHK ++ LE +R+ +AGG I   R+NG ++V+R+LGD +         F+ L+   P    +   SE D+ ++LACDG+WDV  + +  + L++     ++  K+   L+  AL  G+ DN++ ++V
Sbjct:   32 RRTMEDVHTYVKNFASRL-DWGYFAVFDGHAGIQASKWCGKHLHTIIEQ-------NILADETRDVRDVLNDSFLAIDEEINTKLVGNSGCTAAVCVLRWELPDSVSDDSMDLAQHQRKLYTANVGDSRIVLFRNGNSIRLTYDHKASDTLEMQRVEQAGGLIMKSRVNGMLAVTRSLGDKF---------FDSLVVGSPFTTSVEITSE-DKFLILACDGLWDVIDDQDACE-LIKDITEPNEAAKV---LVRYALENGTTDNVTVMVV 279          
BLAST of Protein phosphatase 1B vs. Ensembl Yeast
Match: PTC4 (Cytoplasmic type 2C protein phosphatase (PP2C); identified as a high-copy number suppressor of cnb1 mpk1 synthetic lethality; overexpression decreases high-osmolarity induced Hog1p phosphorylation and kinase activity [Source:SGD;Acc:S000000329])

HSP 1 Score: 97.0561 bits (240), Expect = 1.045e-22
Identity = 103/368 (27.99%), Postives = 149/368 (40.49%), Query Frame = 2
Query:  104 MGSYNGKPNTEK---YNE-------SGKFGDIYYSSSSMQGMRSHMEDFQCIS-------LNLPYPFED------WAYFAIFDGHGGYRVSELCSXXXXXXXXXXXX-----------------FKN---INLLNLDKSQI------INGI-----KKAFISLDDKI-SHFSEG----TTVSAVFITPNYLIFMNCGDSRSVLIRESD-IFFSSIDHKPTNPLEKERILKAGGQITMDRLNGNMSVSRALGDSYYKKD------------------YNLSAFEQLMSAEPDVYIISRNSENDQIIVLACDGVWDVFSNTELKQLLLQRFKCTDDLVKISDELIDAALYKGSK------DNISAIIVAF 955
            MG     P TEK   YNE       +G     Y    SMQG R   ED   I        +    PF D         FA+FDGHGG   S+  S    +                        F+N    +  N D S+       + G+     K AFI  D+++  HF+      T V A  I    L   NCGDSR +L  +S+ I   S DHKP +  E  RI   GG +++ R+ G +++SRA  D  +K+                   Y     E  ++ EPDV +   +   D+ +VLACDG+WD+++N +L   +         L  I  +L+D  + + +       DN++AIIV  
Sbjct:    1 MGQLLSHPLTEKTIEYNEYKNNQASTGIVPRFYNCVGSMQGYRLTQEDAHLIRNENSVVYVRFFNPFIDKYETLSLNVFAVFDGHGGDDCSKFLSGGRHHRDGNGSSNGNGEPNAGLIKWIAYSFENHHYTSTTNNDSSKFKRSFNTLEGLVSQIFKDAFILQDEELYRHFANSSCGSTAVVACIINEESLYVANCGDSRCILSSKSNGIKTMSFDHKPQHIGELIRINDNGGTVSLGRVGGVLALSRAFSDFQFKRGVTYPHRRTKLTNITQNLTYGTPPQEAQVTVEPDVLMHKIDYSKDEFLVLACDGIWDIYNNKQLIHFIKYHLVSGTKLDTIITKLLDHGIAQANSNTGVGFDNMTAIIVVL 368          
BLAST of Protein phosphatase 1B vs. Ensembl Yeast
Match: CYR1 (Adenylate cyclase; required for cAMP production and cAMP-dependent protein kinase signaling; the cAMP pathway controls a variety of cellular processes, including metabolism, cell cycle, stress response, stationary phase, and sporulation [Source:SGD;Acc:S000003542])

HSP 1 Score: 51.9878 bits (123), Expect = 1.259e-7
Identity = 49/188 (26.06%), Postives = 91/188 (48.40%), Query Frame = 2
Query:  401 NGIKKAFISLDDKISHFSEGTTVSAVFITPNYLIFMNCGDSRSVLIRESDIFFS-SIDHKPTNPLEKERILKAGGQITMDRLNGNMSVSRALGDSYYKKDYNLSAFEQL--MSAEPDVYIISRNSENDQIIVLACDGVWDVFSNTELKQLLLQRFKCTDDLVKISDELIDAALYKGSKDNISAIIVAF 955
            NG   A +S  D +S    G   + ++I    L   N GD  ++L + +  + + +  H PT   E ERI  +GG +   +L+G + VSRA+G            F+ L  + A PD+ +++  ++ D+++++A   +W+      +    + R   TD L + + EL D A+  G  +NI+ + +A 
Sbjct: 1456 NGADVANLSYADLLS----GACSTVIYIRGKKLFAANLGDCMAILSKNNGDYQTLTKQHLPTKREEYERIRISGGYVNNGKLDGVVDVSRAVG-----------FFDLLPHIHASPDISVVTL-TKADEMLIVATHKLWEYMDVDTVCD--IARENSTDPL-RAAAELKDHAMAYGCTENITILCLAL 1624          
BLAST of Protein phosphatase 1B vs. Ensembl Nematostella
Match: EDO36040 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJS2])

HSP 1 Score: 255.373 bits (651), Expect = 7.106e-82
Identity = 135/356 (37.92%), Postives = 212/356 (59.55%), Query Frame = 2
Query:  104 MGSYNGKPNTEKYNESGKFGDIYYSSSSMQGMRSHMEDFQCISLNLPYPFEDWAYFAIFDGHGGYRVSELCSXXXXXXXXXXXXFKNI---NLLNLDKSQIINGIKKAFISLDDKISHFSE--------GTTVSAVFITPNYLIFMNCGDSRSVLIRESDIFFSSIDHKPTNPLEKERILKAGGQITMDRLNGNMSVSRALGDSYYKKDYNLSAFEQLMSAEPDVYIISRNSENDQIIVLACDGVWDVFSNTELKQLLLQRFKCTDDLVKISDELIDAALYKGSKDNISAIIVAFVNAPKVESEC----QRLDRLLDENIINKTMXXXXXXXXXXXXXXLIEYMKNIALENLPPGG 1126
            MG++  KP TEK  ++G+   + Y  ++MQG R  MED     + L    +DW++FA+FDGH G  VS+ CS  L   +L+ + F+     +  + D  Q+ +G++ AF+ LD  +    +        G+T  A+ +TP Y IF NCGDSR +L    ++ ++++DHKP NP EK RI  AGG + + R+NG ++VSRALGD  YK D +L A +QL+S EPD++  SR S+ D+ IVLACDGVWDV +N E+   +  R + TDDL ++S EL+D  L KGS+DN+S II++   +PKV  E     Q+++  L+  +  + +    +  ++  +   ++ +    ++ LPPGG
Sbjct:    1 MGAFLDKPRTEKETKTGEGNGLRYGLAAMQGWRVEMEDAHTAVIGLSDHLKDWSFFAVFDGHAGENVSKYCSSNLHETLLKHQSFEAAIKESSDSPDLDQLRSGLRDAFLELDSTMQKLPKWSSGEDKSGSTAIALLVTPKYYIFANCGDSRGILSHNGEVIYNTVDHKPGNPDEKTRIENAGGSVMIQRVNGALAVSRALGDFEYKLDSSLHATKQLVSPEPDIFFQSR-SDQDEFIVLACDGVWDVMTNDEVGAFVRSRLQITDDLQRVSCELLDTCLTKGSRDNMSVIIISLPGSPKVTDEAIKNEQKVEAELEAKL--EALLEEETNLAEVDVSYAMQSLSQEEIQGLPPGG 353          
BLAST of Protein phosphatase 1B vs. Ensembl Nematostella
Match: EDO40449 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S778])

HSP 1 Score: 151.369 bits (381), Expect = 1.974e-42
Identity = 104/308 (33.77%), Postives = 157/308 (50.97%), Query Frame = 2
Query:  104 MGSYNGKPNTEKYNESGKFGDIYYSSSSMQGMRSHMEDFQCISLNLPYPFEDWAYFAIFDGHGGYRVSELCSXXXXXXXXXXXXFKNINLLNLDKSQIINGIKKAFISLD------DKISHFSEGTTVSAVFITPNYLIFMNCGDSRSVLIRESDIFFSSIDHKPTNPLEKERILKAGGQITMDRLNGNMSVSRALGDSYYKKDYNLSAFEQLMSAEPDVYIISRNSENDQIIVLACDGVWDVFSNTELKQLLLQRFKCTDDLVKISDELIDAALYKGSK------DNISAIIVAFVNAPKVESECQR 991
            MG    +P T K   S        +SS MQG R +MED     L+L    ++ A+  ++DGHGG RV++     L   I     +         K  +I  +KK F+S D      +++     GTT   V I  N L   N GDSR++  ++  +   S DHKP+N  E  RI+ AGG +  +R+NGN+++SRALGD  +KK+      EQ+++A PDV I+   + + + +VLACDG+WDV SN E+   +  R     +L +I +EL+   L    +      DN++ II+ F+N    E  C R
Sbjct:    1 MGQTLSEPVTTKETSSCSNKSYKLASSCMQGWRINMEDAHTEILSLKED-KNTAFLGVYDGHGGARVAQYVGQNLQKKIASQPAWA--------KGNVIEALKKGFLSCDTDMLKDEQMKDEVAGTTAVVVVIKNNKLYCANVGDSRAIACKKGLVEQLSFDHKPSNEEETRRIIAAGGWVEFNRVNGNLALSRALGDFCFKKNDKKPPEEQIVTAMPDV-IVKDLTPDHEFLVLACDGIWDVLSNQEVVDFIRSRLAQRMELEQICEELLTRCLAPDCQMGGLGCDNMTVIILTFLNGGTYEELCDR 298          
BLAST of Protein phosphatase 1B vs. Ensembl Nematostella
Match: EDO31490 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SXS4])

HSP 1 Score: 118.242 bits (295), Expect = 5.630e-30
Identity = 68/177 (38.42%), Postives = 101/177 (57.06%), Query Frame = 2
Query:  449 FSEGTTVSAVFITPNYLIFMNCGDSRSVLIRESDIFFSSIDHKPTNPLEKERILKAGGQITMD-RLNGNMSVSRALGDSYYKKDYNLSAFEQLMSAEPDVYIISRNSENDQIIVLACDGVWDVFSNTELKQLLLQRFK-CTDDLVKISDELIDAALYKGSK------DNISAIIVAF 955
            +  GTT     +  N L   N GDSR VL R       SIDHKP +  E  RI KAGG++T + R+NG +++SRALGD  YK    L A EQ ++A PD+   +  +E D+ +V+ACDG+W+V ++ E+   + Q  K   ++L  I ++L DA L   +       DN++ +IV+F
Sbjct:  159 YDSGTTAIVALVKDNNLTVANVGDSRCVLCRNGIALDMSIDHKPEDEKELNRIHKAGGKVTCEGRVNGGLNLSRALGDHSYKGQSELGAHEQQITAMPDIRQTTL-TEADEFMVIACDGIWNVKNSQEVVDFVKQEMKNGEENLSSICEKLFDACLAPDTSGDGAGCDNMTCVIVSF 334          

HSP 2 Score: 53.5286 bits (127), Expect = 6.258e-8
Identity = 29/72 (40.28%), Postives = 40/72 (55.56%), Query Frame = 2
Query:  104 MGSYNGKPNTEKYNESGKFGDIYYSSSSMQGMRSHMEDFQCISLNLPYPFEDWAYFAIFDGHGGYRVSELCS 319
            MG+Y  KP TE  + +     + Y +S+MQG R  MED     L+     ED + FA++DGHGG  V+E  S
Sbjct:    1 MGAYLSKPKTEMNSVTESNSKMSYGASAMQGWRVSMEDAHTCLLDFD---EDTSLFAVYDGHGGQEVAEYVS 69          
BLAST of Protein phosphatase 1B vs. Ensembl Nematostella
Match: EDO44137 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RWJ9])

HSP 1 Score: 103.99 bits (258), Expect = 3.723e-25
Identity = 75/266 (28.20%), Postives = 124/266 (46.62%), Query Frame = 2
Query:  185 SMQGMRSHMEDFQCIS------LNLPYPFEDWAYFAIFDGHGGYRVSELCSXXXXXXXXXXXXFKNINLLNLDKSQIINGIKKAFISLDDKI--SHFSEGTTVSAVFITPNYLIFMNCGDSRSVLIRESDIFFSSIDHKPTNPLEKERILKAGGQITM---DRLNGNMSVSRALGDSYYKKDYNLSAFEQLMSAEPDVYIISRNSENDQIIVLACDGVWDVFSNTELKQLLLQRFKCTDDLVKISDELIDAALYKGSKDNISAIIV 949
            +++  R  MED   I         LP    ++AYFA+FDGHGG   +   +  L   +      +N +L+      +    +    S   +        G T  ++ IT   L     GDS+++L ++ +       HKP    EK+RI   GG +      R+NG++SVSRA+GD+ +K           +S EPDV   + + E  + ++LACDG+WD     +  +L+ +     +D   ++  L+D A  +GS DNIS ++V
Sbjct:   45 AIKNTRRKMEDKHVIMPHFNSLFGLPKDSPNYAYFAVFDGHGGIDAATFAATHLHCFLA-----QNEHLIKDPGLALHETFQNTDCSFGARAISEGLRSGCTAVSILITNEALYLAWLGDSQAILCKDGEFIELMQPHKPERQDEKDRIEGLGGCVVWFGAWRVNGSLSVSRAIGDAEHKP---------FISGEPDVAEYALDGEQ-EFVILACDGLWDTVKPEQAIKLVKEHIASGNDRCDVAKVLVDEAKQEGSSDNISVLVV 295          
BLAST of Protein phosphatase 1B vs. Ensembl Nematostella
Match: EDO46288 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQH7])

HSP 1 Score: 93.5893 bits (231), Expect = 9.671e-22
Identity = 80/270 (29.63%), Postives = 131/270 (48.52%), Query Frame = 2
Query:  185 SMQGMRSHMED-FQCISLNLPYPFEDWAYFAIFDGHGGYRVSELCSXXXXXXXXXXXXFKNINLLNLDKSQIINGIKKAFISLDDKISHF------SEGTTVSAVFITPNY-LIFMNCGDSRSVLIRESDIFFSSIDHKPTNPLEKERILKAGGQIT-----MDRLNGNMSVSRALGDSYYKKDYNLSAFEQLMSAEPDVYIISRNSENDQIIVLACDGVWDVFSNTELKQLLLQRFKCTDDLVKISDELIDAALYKGSKDNISAIIVAF 955
            S+QG +S  ED F+ + L+      D+ YFA+FDGHGG   +E    +L  I+         +L  +    ++   ++    L   + H       S GTT + V +     L   + GDSR+VL R  +    + DH P+   E++RIL   G+I      + R+NG ++++R+LG      D++L  +  +  A PD  ++  +   D  IVL  DG+ DV S+ EL  L+     CTD   + +  L   A+  GS DN++A++V  
Sbjct:   11 SLQGKKSVNEDRFKLLELD-----PDFYYFAVFDGHGGVSSAEFAHDKLHEIVRRLHRDGENDLEEI----LVQAFEECDTELKRHLEHLVSEKELSSGTTATVVLLRDGTDLAIASTGDSRAVLCRNGETSCITRDHHPSLEEEQQRILSCNGRIESTSSDLLRVNGRLAMTRSLG------DFDLKPYGVI--ATPDTKLLKVDHNADAFIVLITDGISDVISSYELGFLVRM---CTDP-EQAAHSLTCCAMQYGSDDNVTAVVVPL 259          
BLAST of Protein phosphatase 1B vs. Ensembl Medaka
Match: ENSORLT00000039194.1 (protein phosphatase 1B [Source:NCBI gene;Acc:101156612])

HSP 1 Score: 272.322 bits (695), Expect = 9.105e-88
Identity = 146/367 (39.78%), Postives = 226/367 (61.58%), Query Frame = 2
Query:  104 MGSYNGKPNTEKYNESGKFGDIYYSSSSMQGMRSHMEDFQCISLNLPYPFEDWAYFAIFDGHGGYRVSELCSXXXXXXXXXXXXFKNINLLNLDKSQIINGIKKAFISLDDKISHFSE--------GTTVSAVFITPNYLIFMNCGDSRSVLIRESDIFFSSIDHKPTNPLEKERILKAGGQITMDRLNGNMSVSRALGDSYYKKDYNLSAFEQLMSAEPDVYIISRNSENDQIIVLACDGVWDVFSNTELKQLLLQRFKCTDDLVKISDELIDAALYKGSKDNISAIIVAFVNAPKVESECQRLDRLLDENIINKTMXXXXXXXXXXXXXXLIEYMKNIALE---NLPP-GGIVSKQSIIVNLFEK 1168
            MG++  KP TEK++  G+   ++Y  SSMQG R  MED     + LP+   DW++FA++DGH G RV+  CS  LL  IL           +++   + +GI+  F+++D+ + +FS+        G+T   V ++P +L F+NCGDSR+VL R+  + FS+ DHKP NP EKERI  AGG + + R+NG+++VSRALGD  YK        EQL+S EP+V ++ R +E D+ +VLACDG+WDV SN EL + +  R    DDL K+ + ++D  L+KGS+DN+S ++V F  APK+  E  + +  LD+ +  + +E L     ++   DL+  +++IA E   NLPP GG+ SK+S+I  ++ +
Sbjct:    1 MGAFLDKPKTEKHSAHGEGNGLHYGLSSMQGWRVEMEDAHTAVVGLPHGLTDWSFFAVYDGHAGSRVANYCSAHLLEHILSGGAEFGQGPSSVEG--VKDGIRSGFLNIDEYMRNFSDLRQGLDRSGSTAVCVLLSPTHLYFINCGDSRAVLSRDGKVGFSTQDHKPCNPREKERIQNAGGSVMIQRVNGSLAVSRALGDYDYKCVDGKGPTEQLVSPEPEVCVLERAAEGDEFVVLACDGIWDVMSNEELCEFVRSRLLVCDDLEKVCNSVVDTCLHKGSRDNMSVVLVCFPGAPKISEEAVKKEEELDKYLETR-VEELLGTCGETGAPDLVSVLRSIASENIPNLPPGGGLASKRSVIEAVYNR 364          
BLAST of Protein phosphatase 1B vs. Ensembl Medaka
Match: ppm1aa (protein phosphatase, Mg2+/Mn2+ dependent 1A [Source:NCBI gene;Acc:101155070])

HSP 1 Score: 271.937 bits (694), Expect = 1.819e-87
Identity = 146/372 (39.25%), Postives = 226/372 (60.75%), Query Frame = 2
Query:  104 MGSYNGKPNTEKYNESGKFGDIYYSSSSMQGMRSHMEDFQCISLNLPYPFEDWAYFAIFDGHGGYRVSELCSXXXXXXXXXXXXF----KNINLLNLDKSQIINGIKKAFISLDDKISHFSE--------GTTVSAVFITPNYLIFMNCGDSRSVLIRESDIFFSSIDHKPTNPLEKERILKAGGQITMDRLNGNMSVSRALGDSYYKKDYNLSAFEQLMSAEPDVYIISRNSENDQIIVLACDGVWDVFSNTELKQLLLQRFKCTDDLVKISDELIDAALYKGSKDNISAIIVAFVNAPKVESEC----QRLDRLLDENIINKTMXXXXXXXXXXXXXXLIEYMKNIALENLPPGG-IVSKQSIIVNLFEK 1168
            MG++  KP  EK+N SG+  ++ +  SSMQG R  MED     ++LP P + W++FA++DGH G +V++ C   LL  I  ++ F    K  +   +DK  + +GI+  F+  D+ I + SE        G+T   V I+P++L F+NCGDSR +L R   + F + DHKP+NPLEKERI  AGG + + R+NG+++VSRALGD  YK        EQL+S EP+VY I R+ ++D+ I+LACDG+WDV  N E+   +  R + TDDL ++ +E++D  LYKGS+DN+S +++ F  APKV  E       LD+ L+  +  + +     +     LV+++  + +  + NLPPGG + SK+S+I  +F +
Sbjct:    1 MGAFLDKPKMEKHNNSGEGNELRFGLSSMQGWRVEMEDAHTAVVSLPSPLQCWSFFAVYDGHAGSQVAKYCCEHLLEHITSSQGFQSALKEKSESTVDK--VKDGIRSGFLMFDEHIRNLSEKKHSNDRSGSTAVGVMISPSHLYFINCGDSRGILSRSGLVKFFTEDHKPSNPLEKERIQNAGGSVMIQRVNGSLAVSRALGDFDYKCVDGKGPTEQLVSPEPEVYAIERSEKDDEFIILACDGIWDVMGNEEVCSFVRSRLEVTDDLERVCNEIVDTCLYKGSRDNMSVVLICFPGAPKVSQEAVMREMELDKFLEARV--EEILKTEWDKGTPDLVNVMRMLTSETIPNLPPGGELASKRSLIEAVFNR 368          
BLAST of Protein phosphatase 1B vs. Ensembl Medaka
Match: ppm1aa (protein phosphatase, Mg2+/Mn2+ dependent 1A [Source:NCBI gene;Acc:101155070])

HSP 1 Score: 271.552 bits (693), Expect = 2.345e-87
Identity = 146/372 (39.25%), Postives = 226/372 (60.75%), Query Frame = 2
Query:  104 MGSYNGKPNTEKYNESGKFGDIYYSSSSMQGMRSHMEDFQCISLNLPYPFEDWAYFAIFDGHGGYRVSELCSXXXXXXXXXXXXF----KNINLLNLDKSQIINGIKKAFISLDDKISHFSE--------GTTVSAVFITPNYLIFMNCGDSRSVLIRESDIFFSSIDHKPTNPLEKERILKAGGQITMDRLNGNMSVSRALGDSYYKKDYNLSAFEQLMSAEPDVYIISRNSENDQIIVLACDGVWDVFSNTELKQLLLQRFKCTDDLVKISDELIDAALYKGSKDNISAIIVAFVNAPKVESEC----QRLDRLLDENIINKTMXXXXXXXXXXXXXXLIEYMKNIALENLPPGG-IVSKQSIIVNLFEK 1168
            MG++  KP  EK+N SG+  ++ +  SSMQG R  MED     ++LP P + W++FA++DGH G +V++ C   LL  I  ++ F    K  +   +DK  + +GI+  F+  D+ I + SE        G+T   V I+P++L F+NCGDSR +L R   + F + DHKP+NPLEKERI  AGG + + R+NG+++VSRALGD  YK        EQL+S EP+VY I R+ ++D+ I+LACDG+WDV  N E+   +  R + TDDL ++ +E++D  LYKGS+DN+S +++ F  APKV  E       LD+ L+  +  + +     +     LV+++  + +  + NLPPGG + SK+S+I  +F +
Sbjct:    1 MGAFLDKPKMEKHNNSGEGNELRFGLSSMQGWRVEMEDAHTAVVSLPSPLQCWSFFAVYDGHAGSQVAKYCCEHLLEHITSSQGFQSALKEKSESTVDK--VKDGIRSGFLMFDEHIRNLSEKKHSNDRSGSTAVGVMISPSHLYFINCGDSRGILSRSGLVKFFTEDHKPSNPLEKERIQNAGGSVMIQRVNGSLAVSRALGDFDYKCVDGKGPTEQLVSPEPEVYAIERSEKDDEFIILACDGIWDVMGNEEVCSFVRSRLEVTDDLERVCNEIVDTCLYKGSRDNMSVVLICFPGAPKVSQEAVMREMELDKFLEARV--EEILKTEWDKGTPDLVNVMRMLTSETIPNLPPGGELASKRSLIEAVFNR 368          
BLAST of Protein phosphatase 1B vs. Ensembl Medaka
Match: ENSORLT00000012921.2 (protein phosphatase 1B [Source:NCBI gene;Acc:101156612])

HSP 1 Score: 273.092 bits (697), Expect = 6.567e-87
Identity = 146/367 (39.78%), Postives = 226/367 (61.58%), Query Frame = 2
Query:  104 MGSYNGKPNTEKYNESGKFGDIYYSSSSMQGMRSHMEDFQCISLNLPYPFEDWAYFAIFDGHGGYRVSELCSXXXXXXXXXXXXFKNINLLNLDKSQIINGIKKAFISLDDKISHFSE--------GTTVSAVFITPNYLIFMNCGDSRSVLIRESDIFFSSIDHKPTNPLEKERILKAGGQITMDRLNGNMSVSRALGDSYYKKDYNLSAFEQLMSAEPDVYIISRNSENDQIIVLACDGVWDVFSNTELKQLLLQRFKCTDDLVKISDELIDAALYKGSKDNISAIIVAFVNAPKVESECQRLDRLLDENIINKTMXXXXXXXXXXXXXXLIEYMKNIALE---NLPP-GGIVSKQSIIVNLFEK 1168
            MG++  KP TEK++  G+   ++Y  SSMQG R  MED     + LP+   DW++FA++DGH G RV+  CS  LL  IL           +++   + +GI+  F+++D+ + +FS+        G+T   V ++P +L F+NCGDSR+VL R+  + FS+ DHKP NP EKERI  AGG + + R+NG+++VSRALGD  YK        EQL+S EP+V ++ R +E D+ +VLACDG+WDV SN EL + +  R    DDL K+ + ++D  L+KGS+DN+S ++V F  APK+  E  + +  LD+ +  + +E L     ++   DL+  +++IA E   NLPP GG+ SK+S+I  ++ +
Sbjct:    1 MGAFLDKPKTEKHSAHGEGNGLHYGLSSMQGWRVEMEDAHTAVVGLPHGLTDWSFFAVYDGHAGSRVANYCSAHLLEHILSGGAEFGQGPSSVEG--VKDGIRSGFLNIDEYMRNFSDLRQGLDRSGSTAVCVLLSPTHLYFINCGDSRAVLSRDGKVGFSTQDHKPCNPREKERIQNAGGSVMIQRVNGSLAVSRALGDYDYKCVDGKGPTEQLVSPEPEVCVLERAAEGDEFVVLACDGIWDVMSNEELCEFVRSRLLVCDDLEKVCNSVVDTCLHKGSRDNMSVVLVCFPGAPKISEEAVKKEEELDKYLETR-VEELLGTCGETGAPDLVSVLRSIASENIPNLPPGGGLASKRSVIEAVYNR 364          
BLAST of Protein phosphatase 1B vs. Ensembl Medaka
Match: ppm1na (protein phosphatase 1A [Source:NCBI gene;Acc:101159369])

HSP 1 Score: 255.758 bits (652), Expect = 1.279e-80
Identity = 153/366 (41.80%), Postives = 212/366 (57.92%), Query Frame = 2
Query:  113 YNGKPNTEKY-NESGKFGDIYYSSSSMQGMRSHMEDFQCISLNLPYPFEDWAYFAIFDGHGGYRVSELCSXXXXXXXXXXXXFKNINLLNLDKSQIINGIKKAFISLDDKISHFSE-------GTTVSAVFITPNYLIFMNCGDSRSVLIRESDIFFSSIDHKPTNPLEKERILKAGGQITMDRLNGNMSVSRALGDSYYKKDYNLSAFEQLMSAEPDVYIISRNSENDQIIVLACDGVWDVFSNTELKQLLLQRFKCTDDLVKISDELIDAALYKGSKDNISAIIVAFVNAPKVESECQRLDRLLDENIINKTMXXXXXXXXXXXXXXLIEYMKNIALE---NLPP-GGIVSKQSIIVNLFEKYV 1174
            Y  +P  EK+ +E G    + Y+ +SMQG R+ MED       L    EDWAYFA+FDGH G  V++ CS  LL+ IL T   K     N D  Q+  GI++ F+ +D  +   S        GTT + V I+P ++ F+NCGDSR++L  +  + F + DHKP NP EKERI  AGG +T+ R+NG+++VSRALGD  +K+       EQL+S EP+VY + R  E D+ ++LACDGVWD   N EL   +  R +  DDL  I  ++ID  LYKGS DNIS IIV F  AP+V  E  + +  L+  I  K  E +    S     DL+  +K +A E    LPP GGI SK+  I++ ++K+V
Sbjct:   56 YLERPILEKHTSEGGNDLGLNYAVASMQGWRAQMEDAHTCMSQLRGDLEDWAYFAVFDGHAGITVAQYCSKNLLDHILATGGIK----ANEDPEQVKEGIREGFLKIDSHMHKLSREDSWERSGTTAAGVLISPRHIYFINCGDSRTLLCHDGQVVFYTEDHKPFNPREKERIQNAGGSVTLQRINGSLAVSRALGDFDFKEADWRPQTEQLVSPEPEVYKLERTPE-DEFLILACDGVWDAIGNEELCAFVRNRMQVCDDLRDICAQVIDLCLYKGSLDNISIIIVCFPGAPQVSQEALQQEAELEHQIDVKVEEIIQMMRSKEEDPDLLYVIKFLAAEEMPGLPPGGGITSKRDCIISSYQKHV 416          
BLAST of Protein phosphatase 1B vs. Planmine SMEST
Match: SMESG000027796.1 (SMESG000027796.1)

HSP 1 Score: 719.153 bits (1855), Expect = 0.000e+0
Identity = 380/380 (100.00%), Postives = 380/380 (100.00%), Query Frame = 2
Query:  104 MGSYNGKPNTEKYNESGKFGDIYYSSSSMQGMRSHMEDFQCISLNLPYPFEDWAYFAIFDGHGGYRVSELCSXXXXXXXXXXXXFKNINLLNLDKSQIINGIKKAFISLDDKISHFSEGTTVSAVFITPNYLIFMNCGDSRSVLIRESDIFFSSIDHKPTNPLEKERILKAGGQITMDRLNGNMSVSRALGDSYYKKDYNLSAFEQLMSAEPDVYIISRNSENDQIIVLACDGVWDVFSNTELKQLLLQRFKCTDDLVKISDELIDAALYKGSKDNISAIIVAFVNAPKVESECQRLDRLLDENIINKTMXXXXXXXXXXXXXXLIEYMKNIALENLPPGGIVSKQSIIVNLFEKYVSVKSHCSDEFNIATKKLLNSKEM 1243
            MGSYNGKPNTEKYNESGKFGDIYYSSSSMQGMRSHMEDFQCISLNLPYPFEDWAYFAIFDGHGGYRVSELCSIELLNIILETEEFKNINLLNLDKSQIINGIKKAFISLDDKISHFSEGTTVSAVFITPNYLIFMNCGDSRSVLIRESDIFFSSIDHKPTNPLEKERILKAGGQITMDRLNGNMSVSRALGDSYYKKDYNLSAFEQLMSAEPDVYIISRNSENDQIIVLACDGVWDVFSNTELKQLLLQRFKCTDDLVKISDELIDAALYKGSKDNISAIIVAFVNAPKVESECQRLDRLLDENIINKTMEYLYSESSDSSLVDLIEYMKNIALENLPPGGIVSKQSIIVNLFEKYVSVKSHCSDEFNIATKKLLNSKEM
Sbjct:    1 MGSYNGKPNTEKYNESGKFGDIYYSSSSMQGMRSHMEDFQCISLNLPYPFEDWAYFAIFDGHGGYRVSELCSIELLNIILETEEFKNINLLNLDKSQIINGIKKAFISLDDKISHFSEGTTVSAVFITPNYLIFMNCGDSRSVLIRESDIFFSSIDHKPTNPLEKERILKAGGQITMDRLNGNMSVSRALGDSYYKKDYNLSAFEQLMSAEPDVYIISRNSENDQIIVLACDGVWDVFSNTELKQLLLQRFKCTDDLVKISDELIDAALYKGSKDNISAIIVAFVNAPKVESECQRLDRLLDENIINKTMEYLYSESSDSSLVDLIEYMKNIALENLPPGGIVSKQSIIVNLFEKYVSVKSHCSDEFNIATKKLLNSKEM 380          
BLAST of Protein phosphatase 1B vs. Planmine SMEST
Match: SMESG000032910.1 (SMESG000032910.1)

HSP 1 Score: 306.22 bits (783), Expect = 4.599e-101
Identity = 162/381 (42.52%), Postives = 251/381 (65.88%), Query Frame = 2
Query:  104 MGSYNGKPNTEKYNESGKFGDIYYSSSSMQGMRSHMEDFQCISLNLPYPFEDWAYFAIFDGHGGYRVSELCSXXXXXXXXXXXXFKNINL-LNLDKSQIINGIKKAFISLDDKISHFSEG--------TTVSAVFITPNYLIFMNCGDSRSVLIRESDIFFSSIDHKPTNPLEKERILKAGGQITMDRLNGNMSVSRALGDSYYKKDYNLSAFEQLMSAEPDVYIISRNSENDQIIVLACDGVWDVFSNTELKQLLLQRFKCTDDLVKISDELIDAALYKGSKDNISAIIVAFVNAPKVE----SECQRLDRLLDENIINKTMXXXXXXXXXXXXXXLIEYMKNIALENLPPGGIVSKQSIIVNLFEKYVSVKSHCSDEFN 1207
            MG++  KP T+K+NESG    + +  +SMQG R  MED  C    L      W++FA+FDGH G RVSE+C+ +LL  I+ETEEFKNI+  +     +I +GI++ F++LD++I    EG        +T   V ++P ++ F NCGDSR++LIR+  + F+++DHKP NP+EKERI  AGG + + R+NG+++VSRA+GD  YK        EQL+S EP+V ++ R++ ND+++VLACDG+WDV +N ++ Q L  R +C+DDL+KI +E ID  LYKGS+DN+S ++VAF NAPK++    S+ + LD+LL E I +       +++ D+ L  ++ +++N+ L N PPGGI SK+ +I  ++ + +S +  C  + N
Sbjct:    1 MGAFLDKPKTDKHNESGIGNGLRFGLASMQGWRIEMEDAHCAITQLSGNLGGWSFFAVFDGHAGARVSEICAAQLLKNIVETEEFKNIDPEMAPSVQEIRDGIREGFLTLDERIRKMIEGELSDDKSGSTAVCVLVSPKHIFFANCGDSRALLIRDGKVCFATVDHKPANPVEKERIQNAGGSVMIQRVNGSLAVSRAIGDFEYKNVDGKGPTEQLVSPEPEVTVLDRDNNNDELLVLACDGIWDVMTNDDICQFLQHRIRCSDDLMKICNETIDTCLYKGSRDNMSIVLVAFENAPKLDESYASKDKELDKLLQEGIKD-----YLAKTEDADLNAVVNHIQNLKLLNFPPGGIHSKRHLIDKIYNE-LSKRDDCPRKVN 375          
BLAST of Protein phosphatase 1B vs. Planmine SMEST
Match: SMESG000072821.1 (SMESG000072821.1)

HSP 1 Score: 299.671 bits (766), Expect = 6.238e-98
Identity = 163/366 (44.54%), Postives = 237/366 (64.75%), Query Frame = 2
Query:  104 MGSYNGKPNTEKYNESGKFGDIYYSSSSMQGMRSHMEDFQCISLNLPYPFEDWAYFAIFDGHGGYRVSELCSXXXXXXXXXXXXFKNINLLN----LDKSQIINGIKKAFISLDDKISHFSE--------GTTVSAVFITPNYLIFMNCGDSRSVLIRESDIFFSSIDHKPTNPLEKERILKAGGQITMDRLNGNMSVSRALGDSYYKKDYNLSAFEQLMSAEPDVYIISRNSENDQIIVLACDGVWDVFSNTELKQLLLQRFKCTDDLVKISDELIDAALYKGSKDNISAIIVAFVNAPKVESECQRLDRLLDENIINKTMXXXXXXXXXXXXXXLIEYMKNIALENLPPGGIVSKQSIIVNLFE 1165
            MG++  KP TEK + S    ++ Y  S+MQG R  MED     L+LP PF+ WAYF ++DGH G  VSE+CS +LL  IL T EFK + L +    +D      GI+  F+ LD  I    E        G+TV +VF+TP Y+IF NCGDSR VLIR + + FS+ DHKP NP+E++RI+KAGG + + R+NG+++VSR+LGD  YKK  +    EQL+S +P++ +I + ++ DQ+IVLACDGVWDV SN EL + ++ R +   DL KI++E+ID  LYKGS+DN+S +I++  NAP  + E    D  L+E I  K  EY+  + ++  +  L+ ++++  L++LPPGG+ +K+ II  LFE
Sbjct:    1 MGAFLEKPKTEKSSHSESGQNLSYGLSAMQGWRIDMEDAHTSILSLPAPFKSWAYFGVYDGHAGSSVSEICSQKLLPSILNTSEFKKMELDDFGNPVDVELAKRGIRNGFLELDKTIGQSHEVETGEDKSGSTVISVFVTPKYVIFANCGDSRGVLIRSNTVHFSTEDHKPMNPIERDRIIKAGGTVMIQRINGSLAVSRSLGDFDYKKVDSKGPTEQLVSPDPEITVIEKVNDEDQLIVLACDGVWDVMSNEELGEFVIHRCQRVKDLSKIAEEVIDNCLYKGSRDNMSVVIISTKNAPNFDRELASKDVKLNELIERKVQEYVNGDGNEMDINSLLMWLQSANLQDLPPGGLTAKRFIIDPLFE 366          
BLAST of Protein phosphatase 1B vs. Planmine SMEST
Match: SMESG000032910.1 (SMESG000032910.1)

HSP 1 Score: 237.654 bits (605), Expect = 1.178e-75
Identity = 118/284 (41.55%), Postives = 191/284 (67.25%), Query Frame = 2
Query:  392 QIINGIKKAFISLDDKISHFSEG--------TTVSAVFITPNYLIFMNCGDSRSVLIRESDIFFSSIDHKPTNPLEKERILKAGGQITMDRLNGNMSVSRALGDSYYKKDYNLSAFEQLMSAEPDVYIISRNSENDQIIVLACDGVWDVFSNTELKQLLLQRFKCTDDLVKISDELIDAALYKGSKDNISAIIVAFVNAPKVE----SECQRLDRLLDENIINKTMXXXXXXXXXXXXXXLIEYMKNIALENLPPGGIVSKQSIIVNLFEKYVSVKSHCSDEFN 1207
            +I +GI++ F++LD++I    EG        +T   V ++P ++ F NCGDSR++LIR+  + F+++DHKP NP+EKERI  AGG + + R+NG+++VSRA+GD  YK        EQL+S EP+V ++ R++ ND+++VLACDG+WDV +N ++ Q L  R +C+DDL+KI +E ID  LYKGS+DN+S ++VAF NAPK++    S+ + LD+LL E I +       +++ D+ L  ++ +++N+ L N PPGGI SK+ +I  ++ + +S +  C  + N
Sbjct:    7 EIRDGIREGFLTLDERIRKMIEGELSDDKSGSTAVCVLVSPKHIFFANCGDSRALLIRDGKVCFATVDHKPANPVEKERIQNAGGSVMIQRVNGSLAVSRAIGDFEYKNVDGKGPTEQLVSPEPEVTVLDRDNNNDELLVLACDGIWDVMTNDDICQFLQHRIRCSDDLMKICNETIDTCLYKGSRDNMSIVLVAFENAPKLDESYASKDKELDKLLQEGIKD-----YLAKTEDADLNAVVNHIQNLKLLNFPPGGIHSKRHLIDKIYNE-LSKRDDCPRKVN 284          
BLAST of Protein phosphatase 1B vs. Planmine SMEST
Match: SMESG000007683.1 (SMESG000007683.1)

HSP 1 Score: 163.31 bits (412), Expect = 1.315e-47
Identity = 91/224 (40.62%), Postives = 132/224 (58.93%), Query Frame = 2
Query:  104 MGSYNGKPNTEKYNESGKFGDIYYSSSSMQGMRSHMEDFQCISLNLPYPFEDWAYFAIFDGHGGYRVSELCSXXXXXXXXXXXXFKNINLLNLDKSQII----NGIKKAFISLDDKISHFS--------EGTTVSAVFITPNYLIFMNCGDSRSVLIRESDIFFSSIDHKPTNPLEKERILKAGGQITMDRLNGNMSVSRALGDSYYKKDYNLSAFEQLMSAEP 739
            MG+   KP  +K+    K  ++    SSMQG R  MED     +N+ YPF  W+YF ++DGH G   +  CS  LL +IL+T EF+ +   ++   + I    NGI++ F+  D+ +             G+T + VFITP Y +F+NCGDSR +LIR   ++FS+ DHKP N  EK RI KAGG +  +R+NG ++VSR+LGD  YKK  N    EQ++S++P
Sbjct:    1 MGALLAKPKVDKFTIGYKNENLIIGLSSMQGWRVEMEDSHSAIINMEYPFSRWSYFGVYDGHNGGSTALNCSKFLLQMILQTPEFQTMKFDDIGNPKNIGILRNGIRRGFLQFDEFLRSLPNVFSGIDRSGSTATCVFITPRYYVFINCGDSRGILIRNKGVYFSTEDHKPKNVDEKNRIEKAGGLVIGERINGCLAVSRSLGDFAYKKVVNKPPIEQMVSSDP 224          
The following BLAST results are available for this feature:
BLAST of Protein phosphatase 1B vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PPM1A1.974e-8940.91protein phosphatase, Mg2+/Mn2+ dependent 1A [Sourc... [more]
PPM1B2.280e-8941.24protein phosphatase, Mg2+/Mn2+ dependent 1B [Sourc... [more]
PPM1B2.288e-8941.24protein phosphatase, Mg2+/Mn2+ dependent 1B [Sourc... [more]
AC013717.12.336e-8941.24novel protein, PPM1B-SLC3A1 readthrough[more]
PPM1B3.210e-8941.24protein phosphatase, Mg2+/Mn2+ dependent 1B [Sourc... [more]
back to top
BLAST of Protein phosphatase 1B vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ppm-1.A2.672e-6840.20Protein phosphatase ppm-1 [Source:UniProtKB/Swiss... [more]
ppm-1.A2.672e-6840.20Protein phosphatase ppm-1 [Source:UniProtKB/Swiss... [more]
ppm-1.A1.981e-6740.20Protein phosphatase ppm-1 [Source:UniProtKB/Swiss... [more]
ppm-1.A1.689e-6240.28Protein phosphatase ppm-1 [Source:UniProtKB/Swiss... [more]
ppm-22.385e-3933.44Probable protein phosphatase 2C T23F11.1 [Source:... [more]
back to top
BLAST of Protein phosphatase 1B vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG60364.200e-7738.20gene:FBgn0039421 transcript:FBtr0085027[more]
alph9.024e-7438.80gene:FBgn0086361 transcript:FBtr0085442[more]
alph9.024e-7438.80gene:FBgn0086361 transcript:FBtr0085445[more]
alph9.024e-7438.80gene:FBgn0086361 transcript:FBtr0085446[more]
alph1.272e-7338.80gene:FBgn0086361 transcript:FBtr0085443[more]
back to top
BLAST of Protein phosphatase 1B vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ppm1aa2.350e-8739.68protein phosphatase, Mg2+/Mn2+ dependent, 1Aa [Sou... [more]
ppm1aa3.487e-8739.68protein phosphatase, Mg2+/Mn2+ dependent, 1Aa [Sou... [more]
ppm1aa5.646e-8739.68protein phosphatase, Mg2+/Mn2+ dependent, 1Aa [Sou... [more]
ppm1aa8.281e-8739.68protein phosphatase, Mg2+/Mn2+ dependent, 1Aa [Sou... [more]
ppm1ba2.080e-8637.27protein phosphatase, Mg2+/Mn2+ dependent, 1Ba [Sou... [more]
back to top
BLAST of Protein phosphatase 1B vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ppm1a1.353e-9040.64protein phosphatase, Mg2+/Mn2+ dependent 1A [Sourc... [more]
ppm1b2.714e-8840.70protein phosphatase, Mg2+/Mn2+ dependent 1B [Sourc... [more]
ppm1b1.230e-8641.57protein phosphatase, Mg2+/Mn2+ dependent 1B [Sourc... [more]
ppm1b1.732e-8641.11protein phosphatase, Mg2+/Mn2+ dependent 1B [Sourc... [more]
ppm1b2.283e-8640.75protein phosphatase, Mg2+/Mn2+ dependent 1B [Sourc... [more]
back to top
BLAST of Protein phosphatase 1B vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ppm1a4.073e-8940.37protein phosphatase 1A, magnesium dependent, alpha... [more]
Ppm1b9.855e-8839.89protein phosphatase 1B, magnesium dependent, beta ... [more]
Ppm1b9.855e-8839.89protein phosphatase 1B, magnesium dependent, beta ... [more]
Ppm1b1.146e-8739.89protein phosphatase 1B, magnesium dependent, beta ... [more]
Ppm1b1.696e-8739.89protein phosphatase 1B, magnesium dependent, beta ... [more]
back to top
BLAST of Protein phosphatase 1B vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P20650|PPM1A_RAT7.916e-9040.60Protein phosphatase 1A OS=Rattus norvegicus OX=101... [more]
sp|O62829|PPM1A_BOVIN1.449e-8940.91Protein phosphatase 1A OS=Bos taurus OX=9913 GN=PP... [more]
sp|P35813|PPM1A_HUMAN9.478e-8940.91Protein phosphatase 1A OS=Homo sapiens OX=9606 GN=... [more]
sp|P35814|PPM1A_RABIT1.459e-8840.33Protein phosphatase 1A OS=Oryctolagus cuniculus OX... [more]
sp|P49443|PPM1A_MOUSE2.849e-8840.37Protein phosphatase 1A OS=Mus musculus OX=10090 GN... [more]
back to top
BLAST of Protein phosphatase 1B vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2H1CX618.147e-9742.78Protein phosphatase 2C OS=Fasciola hepatica OX=619... [more]
A0A504YFS79.793e-9742.78Protein phosphatase type 2C alpha 2 OS=Fasciola gi... [more]
A0A0X3P3S79.959e-9642.75PPM-type phosphatase domain-containing protein OS=... [more]
A0A4Z2CS704.341e-9442.66Protein phosphatase 1A isoform 4 OS=Schistosoma ja... [more]
A0A4Z2CSJ85.333e-9442.66Protein phosphatase 1A isoform 3 OS=Schistosoma ja... [more]
back to top
BLAST of Protein phosphatase 1B vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ppm1ba1.809e-9239.68protein phosphatase, Mg2+/Mn2+ dependent 1B [Sourc... [more]
ppm1ba2.537e-9239.68protein phosphatase, Mg2+/Mn2+ dependent 1B [Sourc... [more]
ppm1ba6.349e-9239.68protein phosphatase, Mg2+/Mn2+ dependent 1B [Sourc... [more]
ppm1bb4.320e-8639.78protein phosphatase 1B-like [Source:NCBI gene;Acc:... [more]
ppm1bb7.137e-8639.78protein phosphatase 1B-like [Source:NCBI gene;Acc:... [more]
back to top
BLAST of Protein phosphatase 1B vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ppm1aa3.302e-8339.89protein phosphatase, Mg2+/Mn2+ dependent, 1Aa [Sou... [more]
ENSPMAT00000003550.11.969e-3331.51pep scaffold:Pmarinus_7.0:GL496710:143:1226:1 gene... [more]
ENSPMAT00000003549.14.021e-3331.51pep scaffold:Pmarinus_7.0:GL496710:143:1226:1 gene... [more]
ppm1e8.717e-2027.66protein phosphatase, Mg2+/Mn2+ dependent, 1E [Sour... [more]
ppm1e1.857e-1827.80protein phosphatase, Mg2+/Mn2+ dependent, 1E [Sour... [more]
back to top
BLAST of Protein phosphatase 1B vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
PTC36.147e-3932.60Type 2C protein phosphatase (PP2C); dephosphorylat... [more]
PTC22.471e-3832.26Type 2C protein phosphatase (PP2C); dephosphorylat... [more]
PTC14.897e-2628.52Type 2C protein phosphatase (PP2C); dephosphorylat... [more]
PTC41.045e-2227.99Cytoplasmic type 2C protein phosphatase (PP2C); id... [more]
CYR11.259e-726.06Adenylate cyclase; required for cAMP production an... [more]
back to top
BLAST of Protein phosphatase 1B vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO360407.106e-8237.92Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO404491.974e-4233.77Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO314905.630e-3038.42Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO441373.723e-2528.20Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO462889.671e-2229.63Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Protein phosphatase 1B vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000039194.19.105e-8839.78protein phosphatase 1B [Source:NCBI gene;Acc:10115... [more]
ppm1aa1.819e-8739.25protein phosphatase, Mg2+/Mn2+ dependent 1A [Sourc... [more]
ppm1aa2.345e-8739.25protein phosphatase, Mg2+/Mn2+ dependent 1A [Sourc... [more]
ENSORLT00000012921.26.567e-8739.78protein phosphatase 1B [Source:NCBI gene;Acc:10115... [more]
ppm1na1.279e-8041.80protein phosphatase 1A [Source:NCBI gene;Acc:10115... [more]
back to top
BLAST of Protein phosphatase 1B vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000027796.10.000e+0100.00SMESG000027796.1[more]
SMESG000032910.14.599e-10142.52SMESG000032910.1[more]
SMESG000072821.16.238e-9844.54SMESG000072821.1[more]
SMESG000032910.11.178e-7541.55SMESG000032910.1[more]
SMESG000007683.11.315e-4740.63SMESG000007683.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30009072 ID=SMED30009072|Name=Protein phosphatase 1B|organism=Schmidtea mediterranea sexual|type=transcript|length=1270bp
CAGCCTATATATTTATTAGTCTGAAAGTATGAAATTGATCTTTAGTTAAA
ATATGGCACATTAGTAGTATTAATTCCTCTTAACGTATTGGAATATAAAT
CATATGGGGTCTTATAATGGAAAACCAAATACTGAAAAATACAATGAATC
TGGAAAATTCGGAGACATTTATTACAGTTCTAGCAGTATGCAGGGCATGA
GAAGTCACATGGAAGACTTTCAATGTATATCATTAAACTTACCTTATCCA
TTTGAAGATTGGGCCTATTTTGCAATTTTTGATGGTCATGGTGGCTATCG
AGTATCAGAACTATGTTCAATTGAATTATTAAACATTATACTCGAGACTG
AAGAATTTAAAAATATTAATCTCCTTAATCTTGACAAATCCCAAATAATT
AATGGAATTAAAAAGGCATTTATTAGCCTAGATGATAAAATTTCTCATTT
TTCTGAAGGAACTACGGTATCCGCGGTATTTATAACTCCGAACTATCTGA
TTTTCATGAATTGTGGAGACTCTAGAAGTGTATTAATAAGAGAATCAGAC
ATATTTTTCTCTAGTATTGATCACAAGCCAACTAATCCACTAGAAAAAGA
ACGCATCCTGAAGGCCGGTGGCCAAATTACAATGGACAGATTAAATGGAA
ATATGTCGGTTTCAAGAGCACTTGGAGATTCATATTACAAAAAAGATTAT
AATTTATCAGCATTTGAACAACTGATGTCAGCTGAACCAGATGTTTATAT
TATTTCTAGAAACTCCGAAAATGACCAAATCATTGTTTTGGCATGTGACG
GAGTTTGGGATGTGTTTAGTAACACGGAATTAAAACAGCTACTTTTGCAA
AGATTCAAATGTACCGATGACCTTGTCAAAATAAGTGACGAATTAATAGA
CGCTGCATTGTATAAGGGTAGTAAAGATAATATTTCAGCAATAATTGTTG
CATTTGTCAATGCTCCAAAAGTGGAAAGTGAATGTCAAAGACTAGATAGA
CTTCTAGATGAAAATATAATAAATAAAACAATGGAATATTTATATTCTGA
AAGCTCTGATTCTTCTCTGGTAGATTTAATTGAATATATGAAAAATATTG
CTCTAGAAAATCTGCCACCAGGTGGTATTGTCTCAAAACAATCAATAATT
GTCAATTTATTCGAAAAATACGTGTCTGTTAAATCACACTGCTCAGATGA
ATTTAACATTGCAACAAAAAAACTACTCAATTCTAAAGAAATGTAAAATT
TACATGGCATTATTTTTGTT
back to top

protein sequence of SMED30009072-orf-1

>SMED30009072-orf-1 ID=SMED30009072-orf-1|Name=SMED30009072-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=381bp
MGSYNGKPNTEKYNESGKFGDIYYSSSSMQGMRSHMEDFQCISLNLPYPF
EDWAYFAIFDGHGGYRVSELCSIELLNIILETEEFKNINLLNLDKSQIIN
GIKKAFISLDDKISHFSEGTTVSAVFITPNYLIFMNCGDSRSVLIRESDI
FFSSIDHKPTNPLEKERILKAGGQITMDRLNGNMSVSRALGDSYYKKDYN
LSAFEQLMSAEPDVYIISRNSENDQIIVLACDGVWDVFSNTELKQLLLQR
FKCTDDLVKISDELIDAALYKGSKDNISAIIVAFVNAPKVESECQRLDRL
LDENIINKTMEYLYSESSDSSLVDLIEYMKNIALENLPPGGIVSKQSIIV
NLFEKYVSVKSHCSDEFNIATKKLLNSKEM*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
Vocabulary: INTERPRO
TermDefinition
IPR036457PPM-type_dom_sf
IPR036580PP2C_C_sf
IPR015655PP2C
IPR001932PPM-type_phosphatase_dom
IPR012911PP2C_C
IPR000222PP2C_BS
Vocabulary: molecular function
TermDefinition
GO:0003824catalytic activity
GO:0000287magnesium ion binding
GO:0030145manganese ion binding
GO:0004721phosphoprotein phosphatase activity
GO:0043169cation binding
GO:0008022protein C-terminus binding
GO:0016787hydrolase activity
GO:0046872metal ion binding
GO:0070412R-SMAD binding
GO:0004722protein serine/threonine phosphatase activity
GO:0005515protein binding
Vocabulary: biological process
TermDefinition
GO:0006499N-terminal protein myristoylation
GO:0042347negative regulation of NF-kappaB import into nucleus
GO:0043124negative regulation of I-kappaB kinase/NF-kappaB signaling
GO:0006470protein dephosphorylation
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0043005neuron projection
GO:0005634nucleus
GO:0005737cytoplasm
GO:0005829cytosol
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001932PPM-type phosphatase domainSMARTSM00332PP2C_4coord: 13..282
e-value: 1.9E-72
score: 256.6
IPR001932PPM-type phosphatase domainPFAMPF00481PP2Ccoord: 24..277
e-value: 3.5E-58
score: 197.3
IPR001932PPM-type phosphatase domainPROSITEPS51746PPM_2coord: 23..284
score: 42.456
IPR001932PPM-type phosphatase domainCDDcd00143PP2Cccoord: 22..284
e-value: 1.64239E-79
score: 242.617
IPR036457PPM-type phosphatase domain superfamilyGENE3DG3DSA:3.60.40.10coord: 1..290
e-value: 4.5E-88
score: 297.3
IPR036457PPM-type phosphatase domain superfamilySUPERFAMILYSSF81606PP2C-likecoord: 5..284
IPR012911Protein serine/threonine phosphatase 2C, C-terminalPFAMPF07830PP2C_Ccoord: 278..353
e-value: 3.4E-12
score: 46.7
IPR036580Phosphatase 2C, C-terminal domain superfamilyGENE3DG3DSA:1.10.10.430coord: 291..357
e-value: 6.2E-6
score: 27.7
IPR036580Phosphatase 2C, C-terminal domain superfamilySUPERFAMILYSSF81601Protein serine/threonine phosphatase 2C, C-terminal domaincoord: 292..357
IPR015655Protein phosphatase 2C familyPANTHERPTHR13832PROTEIN PHOSPHATASE 2Ccoord: 1..318
NoneNo IPR availablePANTHERPTHR13832:SF244PROTEIN PHOSPHATASE 1Bcoord: 1..318
IPR000222PPM-type phosphatase, divalent cation bindingPROSITEPS01032PPM_1coord: 55..63