WD repeat-containing protein 37

Overview
NameWD repeat-containing protein 37
Smed IDSMED30009068
Length (bp)2002
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of WD repeat-containing protein 37 (SMED30009068) t-SNE clustered cells

Violin plots show distribution of expression levels for WD repeat-containing protein 37 (SMED30009068) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of WD repeat-containing protein 37 (SMED30009068) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for WD repeat-containing protein 37 (SMED30009068) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Homology
BLAST of WD repeat-containing protein 37 vs. Ensembl Human
Match: WDR37 (WD repeat domain 37 [Source:HGNC Symbol;Acc:HGNC:31406])

HSP 1 Score: 252.677 bits (644), Expect = 1.121e-75
Identity = 187/500 (37.40%), Postives = 258/500 (51.60%), Query Frame = 1
Query:  346 GDDGILSQEFKQRLWALFRQIESEFEKECKKIYSENYAIHDRNEKIESSDHEESNFAKKISGSHLXX--XXXXXXXXXXXXXXRLVSTFRDRGSTMPNISNQSHQGSNRHACILCWRVSDHRDGIWEVNCIGRG--LVGTACADGVVRLWNSDNGHCSLVYLGHSGSVNSVRF--KNGIMLTASGDGTAHL----VNLP-PEKISEALSSNEPGKSSVTDSIGHXXXXXXXXXTKRNINSPTEDGAESNPVENTTLILRNPNSMYQTASLYSSFGSYTYKDSAPLSAADFLLNRDQIVTASWDRLGRIYDIATGSEVASLTGHDLPLTDVRTNPVADHALAVTASRDCTFRLWDFR-CSTTEVHVQQGHNGIVSSVSF-VGNSPEKLVSAGADRACKVWDLRNSRNPLHVIRTDSPINRLAVHPNGKIVALPMDNRIVKIFDLNLGTRIARLPRNSNQSHNRIVTSIAWNVDGGGKP--NFFTTGFDQQLIAWHLQLPLL 1800
            G D  L    +  L  LF QIE EFE     +Y EN  +     +I++ +   +   + I G+ LS+     +    + Q + +L +T++   ++   I +     ++R AC L      HRDGIW+V+       ++GTA AD    LW+ + G C + Y GH GSVNS++F     + LTASGD TAH+    V LP P+ +++   S E  +   +D                  + P  DG  S+           P       SL S  G           A+D+L+   Q VTASWDR   +YD+ T   V SLTGHD  LT   T+P     L VT+SRD TFRLWDFR  S   V+V QGH   V+S  F VG++   +VS   DR  KVWDL+N R+P+  IRTDS INR+ V    KI+ALP DNR V++FD++ G R+ARLPR+S Q H R+V   AW+ D    P  N FT GFD+Q I W++ +P L
Sbjct:   45 GQDSKLPSSVRSTLLELFGQIEREFEN----LYIENLEL---RREIDTLNERLAAEGQAIDGAELSKGQLKTKASHSTSQLSQKLKTTYK---ASTSKIVSSFKTTTSRAACQLVKEYIGHRDGIWDVSVAKTQPVVLGTASADHTALLWSIETGKCLVKYAGHVGSVNSIKFHPSEQLALTASGDQTAHIWRYAVQLPTPQPVADTSISGE-DEVECSDK-----------------DEPDLDGDVSSDC---------PTIRVPLTSLKSHQGVVI--------ASDWLVGGKQAVTASWDRTANLYDVETSELVHSLTGHDQELTHCCTHPT--QRLVVTSSRDTTFRLWDFRDPSIHSVNVFQGHTDTVTSAVFTVGDN---VVSGSDDRTVKVWDLKNMRSPIATIRTDSAINRINVCVGQKIIALPHDNRQVRLFDMS-GVRLARLPRSSRQGHRRMVCCSAWSED---HPVCNLFTCGFDRQAIGWNINIPAL 490          
BLAST of WD repeat-containing protein 37 vs. Ensembl Human
Match: WDR37 (WD repeat domain 37 [Source:HGNC Symbol;Acc:HGNC:31406])

HSP 1 Score: 252.677 bits (644), Expect = 1.121e-75
Identity = 187/500 (37.40%), Postives = 258/500 (51.60%), Query Frame = 1
Query:  346 GDDGILSQEFKQRLWALFRQIESEFEKECKKIYSENYAIHDRNEKIESSDHEESNFAKKISGSHLXX--XXXXXXXXXXXXXXRLVSTFRDRGSTMPNISNQSHQGSNRHACILCWRVSDHRDGIWEVNCIGRG--LVGTACADGVVRLWNSDNGHCSLVYLGHSGSVNSVRF--KNGIMLTASGDGTAHL----VNLP-PEKISEALSSNEPGKSSVTDSIGHXXXXXXXXXTKRNINSPTEDGAESNPVENTTLILRNPNSMYQTASLYSSFGSYTYKDSAPLSAADFLLNRDQIVTASWDRLGRIYDIATGSEVASLTGHDLPLTDVRTNPVADHALAVTASRDCTFRLWDFR-CSTTEVHVQQGHNGIVSSVSF-VGNSPEKLVSAGADRACKVWDLRNSRNPLHVIRTDSPINRLAVHPNGKIVALPMDNRIVKIFDLNLGTRIARLPRNSNQSHNRIVTSIAWNVDGGGKP--NFFTTGFDQQLIAWHLQLPLL 1800
            G D  L    +  L  LF QIE EFE     +Y EN  +     +I++ +   +   + I G+ LS+     +    + Q + +L +T++   ++   I +     ++R AC L      HRDGIW+V+       ++GTA AD    LW+ + G C + Y GH GSVNS++F     + LTASGD TAH+    V LP P+ +++   S E  +   +D                  + P  DG  S+           P       SL S  G           A+D+L+   Q VTASWDR   +YD+ T   V SLTGHD  LT   T+P     L VT+SRD TFRLWDFR  S   V+V QGH   V+S  F VG++   +VS   DR  KVWDL+N R+P+  IRTDS INR+ V    KI+ALP DNR V++FD++ G R+ARLPR+S Q H R+V   AW+ D    P  N FT GFD+Q I W++ +P L
Sbjct:   45 GQDSKLPSSVRSTLLELFGQIEREFEN----LYIENLEL---RREIDTLNERLAAEGQAIDGAELSKGQLKTKASHSTSQLSQKLKTTYK---ASTSKIVSSFKTTTSRAACQLVKEYIGHRDGIWDVSVAKTQPVVLGTASADHTALLWSIETGKCLVKYAGHVGSVNSIKFHPSEQLALTASGDQTAHIWRYAVQLPTPQPVADTSISGE-DEVECSDK-----------------DEPDLDGDVSSDC---------PTIRVPLTSLKSHQGVVI--------ASDWLVGGKQAVTASWDRTANLYDVETSELVHSLTGHDQELTHCCTHPT--QRLVVTSSRDTTFRLWDFRDPSIHSVNVFQGHTDTVTSAVFTVGDN---VVSGSDDRTVKVWDLKNMRSPIATIRTDSAINRINVCVGQKIIALPHDNRQVRLFDMS-GVRLARLPRSSRQGHRRMVCCSAWSED---HPVCNLFTCGFDRQAIGWNINIPAL 490          
BLAST of WD repeat-containing protein 37 vs. Ensembl Human
Match: WDR37 (WD repeat domain 37 [Source:HGNC Symbol;Acc:HGNC:31406])

HSP 1 Score: 191.045 bits (484), Expect = 4.248e-52
Identity = 109/214 (50.93%), Postives = 138/214 (64.49%), Query Frame = 1
Query: 1171 AADFLLNRDQIVTASWDRLGRIYDIATGSEVASLTGHDLPLTDVRTNPVADHALAVTASRDCTFRLWDFR-CSTTEVHVQQGHNGIVSSVSF-VGNSPEKLVSAGADRACKVWDLRNSRNPLHVIRTDSPINRLAVHPNGKIVALPMDNRIVKIFDLNLGTRIARLPRNSNQSHNRIVTSIAWNVDGGGKP--NFFTTGFDQQLIAWHLQLPLL 1800
            A+D+L+   Q VTASWDR   +YD+ T   V SLTGHD  LT   T+P     L VT+SRD TFRLWDFR  S   V+V QGH   V+S  F VG++   +VS   DR  KVWDL+N R+P+  IRTDS INR+ V    KI+ALP DNR V++FD++ G R+ARLPR+S Q H R+V   AW+ D    P  N FT GFD+Q I W++ +P L
Sbjct:  368 ASDWLVGGKQAVTASWDRTANLYDVETSELVHSLTGHDQELTHCCTHPT--QRLVVTSSRDTTFRLWDFRDPSIHSVNVFQGHTDTVTSAVFTVGDN---VVSGSDDRTVKVWDLKNMRSPIATIRTDSAINRINVCVGQKIIALPHDNRQVRLFDMS-GVRLARLPRSSRQGHRRMVCCSAWSED---HPVCNLFTCGFDRQAIGWNINIPAL 572          

HSP 2 Score: 85.1149 bits (209), Expect = 1.176e-16
Identity = 67/212 (31.60%), Postives = 106/212 (50.00%), Query Frame = 1
Query:  346 GDDGILSQEFKQRLWALFRQIESEFEKECKKIYSENYAIHDRNEKIESSDHEESNFAKKISGSHLXX--XXXXXXXXXXXXXXRLVSTFRDRGSTMPNISNQSHQGSNRHACILCWRVSDHRDGIWEVNCIGRG--LVGTACADGVVRLWNSDNGHCSLVYLGHSGSVNSVRF--KNGIMLTASGDGTAHL----VNLP-PEKISEALSSNE 948
            G D  L    +  L  LF QIE EFE     +Y EN  +     +I++ +   +   + I G+ LS+     +    + Q + +L +T++   ++   I +     ++R AC L      HRDGIW+V+       ++GTA AD    LW+ + G C + Y GH GSVNS++F     + LTASGD TAH+    V LP P+ +++  +  E
Sbjct:   45 GQDSKLPSSVRSTLLELFGQIEREFEN----LYIENLEL---RREIDTLNERLAAEGQAIDGAELSKGQLKTKASHSTSQLSQKLKTTYK---ASTSKIVSSFKTTTSRAACQLVKEYIGHRDGIWDVSVAKTQPVVLGTASADHTALLWSIETGKCLVKYAGHVGSVNSIKFHPSEQLALTASGDQTAHIWRYAVQLPTPQPVADTSAVQE 246          
BLAST of WD repeat-containing protein 37 vs. Ensembl Human
Match: WDR37 (WD repeat domain 37 [Source:HGNC Symbol;Acc:HGNC:31406])

HSP 1 Score: 88.5817 bits (218), Expect = 5.264e-19
Identity = 68/213 (31.92%), Postives = 106/213 (49.77%), Query Frame = 1
Query:  346 GDDGILSQEFKQRLWALFRQIESEFEKECKKIYSENYAIHDRNEKIESSDHEESNFAKKISGSHLXXXXXXXXXX--XXXXXXRLVSTFRDRGSTMPNISNQSHQGSNRHACILCWRVSDHRDGIWEVNCIGRG--LVGTACADGVVRLWNSDNGHCSLVYLGHSGSVNSVRF--KNGIMLTASGDGTAHL----VNLP-PEKISEALSSNEP 951
            G D  L    +  L  LF QIE EFE     +Y EN  +     +I++ +   +   + I G+ LS+   +      + Q + +L +T++   ++   I +     ++R AC L      HRDGIW+V+       ++GTA AD    LW+ + G C + Y GH GSVNS++F     + LTASGD TAH+    V LP P+ +++   S  P
Sbjct:   45 GQDSKLPSSVRSTLLELFGQIEREFEN----LYIENLEL---RREIDTLNERLAAEGQAIDGAELSKGQLKTKASHSTSQLSQKLKTTYK---ASTSKIVSSFKTTTSRAACQLVKEYIGHRDGIWDVSVAKTQPVVLGTASADHTALLWSIETGKCLVKYAGHVGSVNSIKFHPSEQLALTASGDQTAHIWRYAVQLPTPQPVADTSVSTFP 247          
BLAST of WD repeat-containing protein 37 vs. Ensembl Human
Match: WDR37 (WD repeat domain 37 [Source:HGNC Symbol;Acc:HGNC:31406])

HSP 1 Score: 88.1965 bits (217), Expect = 9.630e-19
Identity = 68/213 (31.92%), Postives = 106/213 (49.77%), Query Frame = 1
Query:  346 GDDGILSQEFKQRLWALFRQIESEFEKECKKIYSENYAIHDRNEKIESSDHEESNFAKKISGSHLXXXXXXXXXX--XXXXXXRLVSTFRDRGSTMPNISNQSHQGSNRHACILCWRVSDHRDGIWEVNCIGRG--LVGTACADGVVRLWNSDNGHCSLVYLGHSGSVNSVRF--KNGIMLTASGDGTAHL----VNLP-PEKISEALSSNEP 951
            G D  L    +  L  LF QIE EFE     +Y EN  +     +I++ +   +   + I G+ LS+   +      + Q + +L +T++   ++   I +     ++R AC L      HRDGIW+V+       ++GTA AD    LW+ + G C + Y GH GSVNS++F     + LTASGD TAH+    V LP P+ +++   S  P
Sbjct:   45 GQDSKLPSSVRSTLLELFGQIEREFEN----LYIENLEL---RREIDTLNERLAAEGQAIDGAELSKGQLKTKASHSTSQLSQKLKTTYK---ASTSKIVSSFKTTTSRAACQLVKEYIGHRDGIWDVSVAKTQPVVLGTASADHTALLWSIETGKCLVKYAGHVGSVNSIKFHPSEQLALTASGDQTAHIWRYAVQLPTPQPVADTSVSTFP 247          
BLAST of WD repeat-containing protein 37 vs. Ensembl Celegans
Match: C05D2.10 (pep chromosome:WBcel235:III:5597947:5600058:-1 gene:WBGene00015470.1 transcript:C05D2.10a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:C05D2.10)

HSP 1 Score: 202.601 bits (514), Expect = 1.585e-57
Identity = 156/492 (31.71%), Postives = 235/492 (47.76%), Query Frame = 1
Query:  373 FKQRLWALFRQIESEFEKECKKIYSENYAIHDRNEKIESSDHEESNF-AKKISG---SHLXXXXXXXXXXXXXXXXRLVSTFRDRGSTMPNISNQSHQGSNRHACILCWRVSDHRDGIWEVNCIG-RGLVGTACADGVVRLWNSDNGHCSLVYLGHSGSVNSVRFKNGIML-TASGDGTAHLVNLPPEKISEALSSNEPGKSSVTDSIGHXXXXXXXXXTKRNINSPTEDGAESNPVENTTLILRNPNSMYQTASLYSSFGSYTYKDS---------------APLSAADFLLNRDQIVTASWDRLGRIYDIATGSEVASLTGHDLPLTDVRTNPVADHALAVTASRDCTFRLWDFRCSTTEVHVQQGHNGIVSSVSFVGNSPEKLVSAGADRACKVWDLRNSRNPLHVIRTDSPINRLAVHPNGKIVALPMDNRIVKIFDLNLGTRIARLPRNSNQSHNRIVTSIAWNVDGGGKPNFFTTGFDQQLIAWHL 1785
            ++ RL+ LF  IE EF+     +Y+EN A+  R  ++  ++ E +N  A+++ G   S  S +   Q  Q  ++  R    FRD              GS      L   +  H+DG+W V     R +  +A AD   R+W+ ++G C   Y GH+GSVN V   N   + +  G G A          S  L +   G  S                       P+ +    +  E      R+PN++      ++ F S + K                 AP+S  ++L    Q+VTASWDR   ++D+  G  V  L+GH+  L    T+  ++  L +T+S+D TFRLWDFR +   V V QGH   V+SVSF  N+  ++VS+  D   K+WDLRN R PL  IR  SP NR+A+  +  ++A+PMDNR V+I+DLN G R+ R+P  + + H R+VT  AW +D     N  T GFD+ + AW +
Sbjct:   45 YRARLYQLFGHIEKEFDT----LYAENCALRARIVQLTQTEGEAANVVAQEVFGVQESGKSSRKAIQMGQKLRTALRGPPVFRD--------------GSKFRLSRL---LEGHKDGVWHVAADSTRNICASASADQTARIWSLESGACLATYTGHTGSVNCVAISNNCAVDSTEGSGPA----------SGLLLATASGDEST-----------------HIWKVPSNNAPSDHSSEEEEEHHRDPNNLLGVVE-HNRFTSSSEKSDGHRIRVPVMRLTGHRAPVSCCEWLAGGQQMVTASWDRTANVWDVEKGEVVNILSGHESELNHCSTH--SNQKLVLTSSKDSTFRLWDFREAIQSVAVFQGHQDSVTSVSF--NTDYRIVSSSDDATVKIWDLRNMRTPLATIRLSSPANRVAISKSHPVIAIPMDNRHVRIYDLN-GNRLPRMP--NRRCHERMVTCCAW-LDEHPANNLLTAGFDRMVAAWKV 479          
BLAST of WD repeat-containing protein 37 vs. Ensembl Celegans
Match: C05D2.10 (pep chromosome:WBcel235:III:5597947:5600058:-1 gene:WBGene00015470.1 transcript:C05D2.10b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:C05D2.10)

HSP 1 Score: 197.978 bits (502), Expect = 7.110e-56
Identity = 156/494 (31.58%), Postives = 235/494 (47.57%), Query Frame = 1
Query:  373 FKQRLWALFRQIESEFEKECKKIYSENYAIHDRNE--KIESSDHEESNF-AKKISG---SHLXXXXXXXXXXXXXXXXRLVSTFRDRGSTMPNISNQSHQGSNRHACILCWRVSDHRDGIWEVNCIG-RGLVGTACADGVVRLWNSDNGHCSLVYLGHSGSVNSVRFKNGIML-TASGDGTAHLVNLPPEKISEALSSNEPGKSSVTDSIGHXXXXXXXXXTKRNINSPTEDGAESNPVENTTLILRNPNSMYQTASLYSSFGSYTYKDS---------------APLSAADFLLNRDQIVTASWDRLGRIYDIATGSEVASLTGHDLPLTDVRTNPVADHALAVTASRDCTFRLWDFRCSTTEVHVQQGHNGIVSSVSFVGNSPEKLVSAGADRACKVWDLRNSRNPLHVIRTDSPINRLAVHPNGKIVALPMDNRIVKIFDLNLGTRIARLPRNSNQSHNRIVTSIAWNVDGGGKPNFFTTGFDQQLIAWHL 1785
            ++ RL+ LF  IE EF+     +Y+EN A+  R    ++  ++ E +N  A+++ G   S  S +   Q  Q  ++  R    FRD              GS      L   +  H+DG+W V     R +  +A AD   R+W+ ++G C   Y GH+GSVN V   N   + +  G G A          S  L +   G  S                       P+ +    +  E      R+PN++      ++ F S + K                 AP+S  ++L    Q+VTASWDR   ++D+  G  V  L+GH+  L    T+  ++  L +T+S+D TFRLWDFR +   V V QGH   V+SVSF  N+  ++VS+  D   K+WDLRN R PL  IR  SP NR+A+  +  ++A+PMDNR V+I+DLN G R+ R+P  + + H R+VT  AW +D     N  T GFD+ + AW +
Sbjct:   45 YRARLYQLFGHIEKEFDT----LYAENCALSVRARIVQLTQTEGEAANVVAQEVFGVQESGKSSRKAIQMGQKLRTALRGPPVFRD--------------GSKFRLSRL---LEGHKDGVWHVAADSTRNICASASADQTARIWSLESGACLATYTGHTGSVNCVAISNNCAVDSTEGSGPA----------SGLLLATASGDEST-----------------HIWKVPSNNAPSDHSSEEEEEHHRDPNNLLGVVE-HNRFTSSSEKSDGHRIRVPVMRLTGHRAPVSCCEWLAGGQQMVTASWDRTANVWDVEKGEVVNILSGHESELNHCSTH--SNQKLVLTSSKDSTFRLWDFREAIQSVAVFQGHQDSVTSVSF--NTDYRIVSSSDDATVKIWDLRNMRTPLATIRLSSPANRVAISKSHPVIAIPMDNRHVRIYDLN-GNRLPRMP--NRRCHERMVTCCAW-LDEHPANNLLTAGFDRMVAAWKV 481          
BLAST of WD repeat-containing protein 37 vs. Ensembl Celegans
Match: prp-4 (Yeast PRP (Splicing factor) related [Source:UniProtKB/TrEMBL;Acc:Q93339])

HSP 1 Score: 68.9366 bits (167), Expect = 4.962e-12
Identity = 54/207 (26.09%), Postives = 90/207 (43.48%), Query Frame = 1
Query: 1165 LSAADFLLNRDQIVTASWDRLGRIYDIATGSEVASLTGHDLPLTDVRTNPVADHALAVTASRDCTFRLWDFRCSTTEVHVQQGHNGIVSSVSFVGNSPEKLVSAGADRACKVWDLRNSRNPLHVIRTDSPINRLAVHPNGKIVALPMDNRIVKIFD--LNLGTRIARLPRNSNQSHNRIVTSIAWNVDGGGKPNFFTTGFDQQLIAW 1779
            +S   F  N   + TA +D   R+YD+ T  E+    GH   + DV  +P  D ++A+T   DC  R+WD R     +    GH   + SV ++ N  E +++  +D + KVWDLR  RN   +    S + R+     G+ +       +   FD  L + +     P    Q H+  +  +  + DG       ++ FD+    W
Sbjct:  299 VSKVAFHPNGHHLATACFDSTWRMYDLTTKKELLYQEGHSKSVADVAFHP--DGSVALTGGHDCYGRVWDMRTGRC-IMFLDGHTKEIHSVEWMPNGYE-MITGSSDNSMKVWDLRMRRNTYTMPAHTSVVTRVRADAAGQYL-------VSASFDCTLKMWSTTGWQPLRQLQGHDTRILCVDISPDGQW---MCSSAFDRTFKLW 491          

HSP 2 Score: 56.6102 bits (135), Expect = 3.762e-8
Identity = 51/215 (23.72%), Postives = 95/215 (44.19%), Query Frame = 1
Query: 1135 GSYTYKDSAPLSAADFLLNRDQIVTASWDRLGRIYDIATGSEVASLTGHDLPLTDVRTNPVADHALAVTASRDCTFRLWDFRCSTTEVHVQQGHNGIVSSVSFVGNSPEKLVSAGADRACKVWDLRNSRNPLHVIRTDSPINRLAVHPNGKIVALPMDNRIVKIFDLNLGTRIARLPRNSNQSHNRIVTSIAWNVDGGGKPNFFTTGFDQQLIAW 1779
            G++T  D + L+          +V+ S+D    ++ ++  S +  L  H   ++ V  +P   H    TA  D T+R++D   +  E+  Q+GH+  V+ V+F  +    L + G D   +VWD+R  R  + +      I+ +   PNG  +     +  +K++DL +      +P     +H  +VT +    D  G+    +  FD  L  W
Sbjct:  257 GAFTQNDYSSLN----------VVSCSYDGTVLLWSLSQESPIGELEQHPQRVSKVAFHPNGHHL--ATACFDSTWRMYDL-TTKKELLYQEGHSKSVADVAFHPDGSVAL-TGGHDCYGRVWDMRTGRCIMFLDGHTKEIHSVEWMPNGYEMITGSSDNSMKVWDLRMRRNTYTMP-----AHTSVVTRV--RADAAGQ-YLVSASFDCTLKMW 449          

HSP 3 Score: 48.9062 bits (115), Expect = 9.205e-6
Identity = 57/265 (21.51%), Postives = 105/265 (39.62%), Query Frame = 1
Query: 1015 KRNINSPTEDGAESNPVENTTLILRNPNSMYQTASLYSSFGSYTYKDSAPLSAADFLLNRDQIVTASWDRLGRIYDIATGSEVASLTGHDLPLTDVRTNPVA----DHAL--AVTASRDCTFRLWDFRCSTTEVHVQQGHNGIVSSVSFVGNSPEKLVSAGADRACKVWDLRNSRNPLHVIRTDSPINRLAVHPNGKIVALPMDNRIVKIFDLNLGTRIARLPRNSNQSHNRIVTSIAWNVDGGGKPNFFTTGFDQQLIAWHLQL 1791
            K  ++   E+ A   P     L  +  +   Q  +L++S       D+ P++  +F  + + IVTA W     ++     ++     GH       R +P A    D++    V+ S D T  LW     +    ++Q H   VS V+F  N    L +A  D   +++DL   +  L+       +  +A HP+G +      +   +++D+  G  I  L       H + + S+ W  +G       T   D  +  W L++
Sbjct:  163 KLRLDKAREEAA--RPAHEKALARQEAHKWVQQINLHAS----QVADTRPVAFCEFSADSEHIVTAGWSGSVAVWKREQCAQEIKFIGHSSQAGCARFHPGAFTQNDYSSLNVVSCSYDGTVLLWSLSQESPIGELEQ-HPQRVSKVAFHPNG-HHLATACFDSTWRMYDLTTKKELLYQEGHSKSVADVAFHPDGSVALTGGHDCYGRVWDMRTGRCIMFL-----DGHTKEIHSVEWMPNGY---EMITGSSDNSMKVWDLRM 411          
BLAST of WD repeat-containing protein 37 vs. Ensembl Celegans
Match: rack-1 (Guanine nucleotide-binding protein subunit beta-2-like 1 [Source:UniProtKB/Swiss-Prot;Acc:Q21215])

HSP 1 Score: 65.855 bits (159), Expect = 2.242e-11
Identity = 46/157 (29.30%), Postives = 72/157 (45.86%), Query Frame = 1
Query: 1204 VTASWDRLGRIYDIATGSEVASLTGHDLPLTDVRTNPVADHALAVTASRDCTFRLWDFRCSTTEVHVQQGHNGIVSSVSFV-GNSPEKLVSAGADRACKVWDLRNSRNPLHVIRTDSPINRLAVHPNGKIVALPMDNRIVKIFDLNLGTRIARLPRN 1671
            ++ SWD+  R++D+  G        H   +  V  +  AD+   V+ SRD + +LW+             H   VS+V F   N    +VSAG D+  KVW+L N R   + I     +N + V P+G + A    +    ++DLN G  +  LP N
Sbjct:   85 LSGSWDKTLRLWDLNQGVSTRQFISHTKDVLSVAFS--ADNRQIVSGSRDKSIKLWNTLAQCKYTITDDCHTDWVSTVRFSPSNRDPVIVSAGWDKVVKVWNLGNCRLKTNHIGHTGYVNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLPGN 239          
BLAST of WD repeat-containing protein 37 vs. Ensembl Celegans
Match: rack-1 (Guanine nucleotide-binding protein subunit beta-2-like 1 [Source:UniProtKB/Swiss-Prot;Acc:Q21215])

HSP 1 Score: 65.855 bits (159), Expect = 2.242e-11
Identity = 46/157 (29.30%), Postives = 72/157 (45.86%), Query Frame = 1
Query: 1204 VTASWDRLGRIYDIATGSEVASLTGHDLPLTDVRTNPVADHALAVTASRDCTFRLWDFRCSTTEVHVQQGHNGIVSSVSFV-GNSPEKLVSAGADRACKVWDLRNSRNPLHVIRTDSPINRLAVHPNGKIVALPMDNRIVKIFDLNLGTRIARLPRN 1671
            ++ SWD+  R++D+  G        H   +  V  +  AD+   V+ SRD + +LW+             H   VS+V F   N    +VSAG D+  KVW+L N R   + I     +N + V P+G + A    +    ++DLN G  +  LP N
Sbjct:   85 LSGSWDKTLRLWDLNQGVSTRQFISHTKDVLSVAFS--ADNRQIVSGSRDKSIKLWNTLAQCKYTITDDCHTDWVSTVRFSPSNRDPVIVSAGWDKVVKVWNLGNCRLKTNHIGHTGYVNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLPGN 239          
BLAST of WD repeat-containing protein 37 vs. Ensembl Fly
Match: CG12333 (gene:FBgn0038617 transcript:FBtr0083655)

HSP 1 Score: 242.662 bits (618), Expect = 2.790e-72
Identity = 147/368 (39.95%), Postives = 206/368 (55.98%), Query Frame = 1
Query:  700 HRDGIWEVNC-IGRGLVGTACADGVVRLWNSDNGHCSLVYLGHSGSVNSVRF--KNGIMLTASGDGTAHLVNLPPEKISEALSSNEPGKSSVTDSIGHXXXXXXXXXTKRNINSPTEDGAESNPVENTTLILRNPNSMYQTASLYSSFGSYTYKDSAPLSAADFLLNRDQIVTASWDRLGRIYDIATGSEVASLTGHDLPLTDVRTNPVADHALAVTASRDCTFRLWDFRCSTTEVHVQQGHNGIVSSVSFVGNSPEKLVSAGADRACKVWDLRNSRNPLHVIRTDSPINRLAVHPNGKIVALPMDNRIVKIFDLNLGTRIARLPRNSNQSHNRIVTSIAWNVDGGGKPNFFTTGFDQQLIAWHLQLP 1794
            H+DGIW+V    G+ ++GTA AD    +W  ++  C L Y GH+GSVNS++F  +  ++LT SGDGTAH+          A++   P K       GH         ++  ++   E   + + V+     LR P   +     + S           + AAD+L + DQI+T SWDR   ++D+ TG  +  LTGHD  LT V  +P     L VTASRD TFRLWDFR +   V V QGH   V+S  F  +  +K+VS   DR  KVW+LRN R+ L  IRTDS +NRLAV   G I+A+P DNR +++FDLN G R+ARLPR S Q H R+V+S+AW  +     + F+ GFD+++  W + LP
Sbjct:  159 HKDGIWQVAAKAGQPIIGTASADHTACIWGVESARCLLQYQGHAGSVNSIKFHQQRDLVLTGSGDGTAHIWQ-------AAVNWEVPKK-------GHS--------SEEELDDSDEQVEDRDRVDT----LRTPLCEFTGPGGHLSV----------VVAADWLSSMDQIITGSWDRTAILWDVETGLPLQPLTGHDHELTHVSAHPT--QRLVVTASRDTTFRLWDFREAIPAVSVFQGHTETVTSSVFARD--DKVVSGSDDRTIKVWELRNMRSALATIRTDSSVNRLAVSTGG-IIAIPHDNRQIRLFDLN-GQRVARLPRTSRQGHRRMVSSVAWAEEPLLDCDLFSCGFDRRVFGWSIVLP 484          
BLAST of WD repeat-containing protein 37 vs. Ensembl Fly
Match: Rack1 (gene:FBgn0020618 transcript:FBtr0079565)

HSP 1 Score: 66.2402 bits (160), Expect = 1.851e-11
Identity = 50/169 (29.59%), Postives = 79/169 (46.75%), Query Frame = 1
Query: 1174 ADFLLNRD--QIVTASWDRLGRIYDIATGSEVASLTGHDLPLTDVRTNPVADHALAVTASRDCTFRLWDFRCSTTEVHVQQGHNGIVSSVSFVGN-SPEKLVSAGADRACKVWDLRNSRNPLHVIRTDSPINRLAVHPNGKIVALPMDNRIVKIFDLNLGTRIARLPRN 1671
            +D +L+ D    ++ SWD+  R++D+A G       GH   +  V  +  AD+   V+ SRD T +LW+          + GH   VS V F  N S   +VS G DR  KVW+L N +   +    +  +N + V P+G +      +    ++DLN G  +  L  N
Sbjct:   68 SDVVLSSDGNYALSGSWDQTLRLWDLAAGKTTRRFEGHTKDVLSVAFS--ADNRQIVSGSRDKTIKLWNTLAECKFTIQEDGHTDWVSCVRFSPNHSNPIIVSCGWDRTVKVWNLANCKLKNNHHGHNGYLNTVTVSPDGSLCTSGGKDSKALLWDLNDGKNLYTLEHN 234          
BLAST of WD repeat-containing protein 37 vs. Ensembl Fly
Match: Rack1 (gene:FBgn0020618 transcript:FBtr0331238)

HSP 1 Score: 66.2402 bits (160), Expect = 1.851e-11
Identity = 50/169 (29.59%), Postives = 79/169 (46.75%), Query Frame = 1
Query: 1174 ADFLLNRD--QIVTASWDRLGRIYDIATGSEVASLTGHDLPLTDVRTNPVADHALAVTASRDCTFRLWDFRCSTTEVHVQQGHNGIVSSVSFVGN-SPEKLVSAGADRACKVWDLRNSRNPLHVIRTDSPINRLAVHPNGKIVALPMDNRIVKIFDLNLGTRIARLPRN 1671
            +D +L+ D    ++ SWD+  R++D+A G       GH   +  V  +  AD+   V+ SRD T +LW+          + GH   VS V F  N S   +VS G DR  KVW+L N +   +    +  +N + V P+G +      +    ++DLN G  +  L  N
Sbjct:   68 SDVVLSSDGNYALSGSWDQTLRLWDLAAGKTTRRFEGHTKDVLSVAFS--ADNRQIVSGSRDKTIKLWNTLAECKFTIQEDGHTDWVSCVRFSPNHSNPIIVSCGWDRTVKVWNLANCKLKNNHHGHNGYLNTVTVSPDGSLCTSGGKDSKALLWDLNDGKNLYTLEHN 234          
BLAST of WD repeat-containing protein 37 vs. Ensembl Fly
Match: Rack1 (gene:FBgn0020618 transcript:FBtr0345448)

HSP 1 Score: 66.2402 bits (160), Expect = 1.851e-11
Identity = 50/169 (29.59%), Postives = 79/169 (46.75%), Query Frame = 1
Query: 1174 ADFLLNRD--QIVTASWDRLGRIYDIATGSEVASLTGHDLPLTDVRTNPVADHALAVTASRDCTFRLWDFRCSTTEVHVQQGHNGIVSSVSFVGN-SPEKLVSAGADRACKVWDLRNSRNPLHVIRTDSPINRLAVHPNGKIVALPMDNRIVKIFDLNLGTRIARLPRN 1671
            +D +L+ D    ++ SWD+  R++D+A G       GH   +  V  +  AD+   V+ SRD T +LW+          + GH   VS V F  N S   +VS G DR  KVW+L N +   +    +  +N + V P+G +      +    ++DLN G  +  L  N
Sbjct:   68 SDVVLSSDGNYALSGSWDQTLRLWDLAAGKTTRRFEGHTKDVLSVAFS--ADNRQIVSGSRDKTIKLWNTLAECKFTIQEDGHTDWVSCVRFSPNHSNPIIVSCGWDRTVKVWNLANCKLKNNHHGHNGYLNTVTVSPDGSLCTSGGKDSKALLWDLNDGKNLYTLEHN 234          
BLAST of WD repeat-containing protein 37 vs. Ensembl Fly
Match: Lis-1 (gene:FBgn0015754 transcript:FBtr0087241)

HSP 1 Score: 62.3882 bits (150), Expect = 6.490e-10
Identity = 44/146 (30.14%), Postives = 72/146 (49.32%), Query Frame = 1
Query: 1201 IVTASWDRLGRIYDIATGSEVASLTGHDLPLTDVRTNPVADHALAVTASRDCTFRLWDFRCSTTEVHVQQGHNGIVSSVSFVGNSPEKLVSAGADRACKVWDLRNSRNPLHVIRTDSPINRLAVHPNGKIVALPMDNRIVKIFDLN 1638
            +V+AS D   RI+D  TG    SL GH   + DV  +  A   L  + S D + +LWDF+ S   +    GH+  VSSV+FV  + + ++SA  DR  K+W++               +  + VH  G I A   +++ ++++  N
Sbjct:  123 MVSASEDATIRIWDFETGEYERSLKGHTDSVQDVAFD--AQGKLLASCSADLSIKLWDFQQSYECIKTMHGHDHNVSSVAFV-PAGDYVLSASRDRTIKMWEVATGYCVKTYTGHREWVRMVRVHIEGSIFATCSNDQTIRVWLTN 265          

HSP 2 Score: 62.003 bits (149), Expect = 7.213e-10
Identity = 50/175 (28.57%), Postives = 80/175 (45.71%), Query Frame = 1
Query: 1258 EVASLTGHDLPLTDVRTNPVADHALAVTASRDCTFRLWDFRCSTTEVHVQQGHNGIVSSVSFVGNSPEKLVSAGADRACKVWDLRNSRNPLHVIR-TDSPINRLAVHPNGKIVALPMDNRIVKIFDLNLGTRIARLPRNSNQSHNRIVTSIAWNVDGGGKPNFFTTGFDQQLIAW 1779
            E  SLTGH   +T V  +P+   AL V+AS D T R+WDF     E  + +GH   V  V+F     + L S  AD + K+WD + S   +  +   D  ++ +A  P G  V     +R +K++++  G  +      +   H   V  +  +++G     F T   DQ +  W
Sbjct:  100 EKFSLTGHRASITRVIFHPI--FALMVSASEDATIRIWDFETGEYERSL-KGHTDSVQDVAFDAQG-KLLASCSADLSIKLWDFQQSYECIKTMHGHDHNVSSVAFVPAGDYVLSASRDRTIKMWEVATGYCV-----KTYTGHREWVRMVRVHIEGS---IFATCSNDQTIRVW 262          

HSP 3 Score: 52.7582 bits (125), Expect = 6.400e-7
Identity = 52/224 (23.21%), Postives = 97/224 (43.30%), Query Frame = 1
Query: 1165 LSAADFLLNRDQIVTASWDRLGRIYDIATGSEVASLTGHDLPLTDVRTNPVADHALAVTASRDCTFRLWDFRCSTTEVHVQQGHNGIVSSVSFV------------GNSPEK-------LVSAGADRACKVWDLRNSRNPLHVIRTDSPINRLAVHPNGKIVALPMDNRIVKIFDLNLGTRIARLPRNSNQSHNRIVTSIAWNVDGGGKPNFFTTGFDQQLIAW 1779
            +S+  F+   D +++AS DR  +++++ATG  V + TGH   +  VR +   + ++  T S D T R+W       +V ++  H   V  +++             G   +K       L S   D+  ++WD+      L +   D+ +  LA HP GK +    D++ ++++DL     +  L      +H    TSI ++      P   +   DQ +  W
Sbjct:  196 VSSVAFVPAGDYVLSASRDRTIKMWEVATGYCVKTYTGHREWVRMVRVH--IEGSIFATCSNDQTIRVWLTNSKDCKVELRD-HEHTVECIAWAPEAAASAINEAAGADNKKGHHQGPFLASGSRDKTIRIWDVSVGLCLLTLSGHDNWVRGLAFHPGGKYLVSASDDKTIRVWDLRNKRCMKTL-----YAHQHFCTSIDFH---KAHPYVISGSVDQTVKVW 408          
BLAST of WD repeat-containing protein 37 vs. Ensembl Zebrafish
Match: wdr37 (WD repeat domain 37 [Source:ZFIN;Acc:ZDB-GENE-030131-8101])

HSP 1 Score: 261.151 bits (666), Expect = 3.990e-79
Identity = 187/501 (37.33%), Postives = 254/501 (50.70%), Query Frame = 1
Query:  346 GDDGILSQEFKQRLWALFRQIESEFEKECKKIYSENYAIHDRNEKIESSDHEESNFAKKISGSHLXXXXXXXXXX--XXXXXXRLVSTFRDRGSTMPNISNQSHQGSNRHACILCWRVSDHRDGIWE--VNCIGRGLVGTACADGVVRLWNSDNGHCSLVYLGHSGSVNSVRF--KNGIMLTASGDGTAH----LVNLP----PEKISEALSSNEPGKSSVTDSIGHXXXXXXXXXTKRNINSPTEDGAESNPVENTTLILRNPNSMYQTASLYSSFGSYTYKDSAPLSAADFLLNRDQIVTASWDRLGRIYDIATGSEVASLTGHDLPLTDVRTNPVADHALAVTASRDCTFRLWDFR-CSTTEVHVQQGHNGIVSSVSF-VGNSPEKLVSAGADRACKVWDLRNSRNPLHVIRTDSPINRLAVHPNGKIVALPMDNRIVKIFDLNLGTRIARLPRNSNQSHNRIVTSIAWNVDGGGKPNFFTTGFDQQLIAWHLQLPLL 1800
            G D  L    +  L  LF QIE EFE     +Y EN  +     +IES +   S   + + G  LS+   +      + Q + +L +T++   ++   I +     ++R  C L      HRDGIW+  V  +   ++GTA AD    LW+ + G C L Y GH+GSVNS++F     + LTASGD TAH    +V LP    P  IS +L  +                                DG    P E        P     T +L S  G           AAD+L+   Q+VTASWDR   +YD+ T   V +LTGHD  LT   T+P     L VT+SRD TFRLWDFR  S   V+V QGH   V+S  F VG++   +VS   DR  KVWDL+N R+P+  IRTDS +NR++V  N +I+ALP DNR V++FD+N G R+ARLPR++ Q H R+V   AWN +     N FT GFD+Q I W++ +P L
Sbjct:   45 GQDSKLPMALRSNLLDLFGQIEREFEN----LYIENLELR---REIESLNERLSGEGQTVEGGDLSKGALKTKASHSTSQLSQKLKTTYK---ASTSKIVSSFKATTSRAVCQLVKEYVGHRDGIWDLAVTRVQPLVLGTASADHCSMLWSIETGKCLLKYAGHAGSVNSIKFHPTEQMALTASGDQTAHIWRYMVQLPLPQPPADISASLDDDVDFSDKDE-----------------------ADGDADGPNEC-------PTIRVATTTLKSHQGVVI--------AADWLVGGKQVVTASWDRAANLYDVETSELVHTLTGHDQELTHCCTHPT--QRLVVTSSRDTTFRLWDFRDPSIHSVNVFQGHTDTVTSAVFTVGDN---VVSGSDDRTVKVWDLKNMRSPIATIRTDSAVNRISVSANQRIIALPHDNRQVRLFDMN-GVRLARLPRSNRQGHRRMVCCSAWNEENQA-CNLFTCGFDRQAIGWNINIPAL 490          
BLAST of WD repeat-containing protein 37 vs. Ensembl Zebrafish
Match: wdr37 (WD repeat domain 37 [Source:ZFIN;Acc:ZDB-GENE-030131-8101])

HSP 1 Score: 261.151 bits (666), Expect = 3.990e-79
Identity = 187/501 (37.33%), Postives = 254/501 (50.70%), Query Frame = 1
Query:  346 GDDGILSQEFKQRLWALFRQIESEFEKECKKIYSENYAIHDRNEKIESSDHEESNFAKKISGSHLXXXXXXXXXX--XXXXXXRLVSTFRDRGSTMPNISNQSHQGSNRHACILCWRVSDHRDGIWE--VNCIGRGLVGTACADGVVRLWNSDNGHCSLVYLGHSGSVNSVRF--KNGIMLTASGDGTAH----LVNLP----PEKISEALSSNEPGKSSVTDSIGHXXXXXXXXXTKRNINSPTEDGAESNPVENTTLILRNPNSMYQTASLYSSFGSYTYKDSAPLSAADFLLNRDQIVTASWDRLGRIYDIATGSEVASLTGHDLPLTDVRTNPVADHALAVTASRDCTFRLWDFR-CSTTEVHVQQGHNGIVSSVSF-VGNSPEKLVSAGADRACKVWDLRNSRNPLHVIRTDSPINRLAVHPNGKIVALPMDNRIVKIFDLNLGTRIARLPRNSNQSHNRIVTSIAWNVDGGGKPNFFTTGFDQQLIAWHLQLPLL 1800
            G D  L    +  L  LF QIE EFE     +Y EN  +     +IES +   S   + + G  LS+   +      + Q + +L +T++   ++   I +     ++R  C L      HRDGIW+  V  +   ++GTA AD    LW+ + G C L Y GH+GSVNS++F     + LTASGD TAH    +V LP    P  IS +L  +                                DG    P E        P     T +L S  G           AAD+L+   Q+VTASWDR   +YD+ T   V +LTGHD  LT   T+P     L VT+SRD TFRLWDFR  S   V+V QGH   V+S  F VG++   +VS   DR  KVWDL+N R+P+  IRTDS +NR++V  N +I+ALP DNR V++FD+N G R+ARLPR++ Q H R+V   AWN +     N FT GFD+Q I W++ +P L
Sbjct:   45 GQDSKLPMALRSNLLDLFGQIEREFEN----LYIENLELR---REIESLNERLSGEGQTVEGGDLSKGALKTKASHSTSQLSQKLKTTYK---ASTSKIVSSFKATTSRAVCQLVKEYVGHRDGIWDLAVTRVQPLVLGTASADHCSMLWSIETGKCLLKYAGHAGSVNSIKFHPTEQMALTASGDQTAHIWRYMVQLPLPQPPADISASLDDDVDFSDKDE-----------------------ADGDADGPNEC-------PTIRVATTTLKSHQGVVI--------AADWLVGGKQVVTASWDRAANLYDVETSELVHTLTGHDQELTHCCTHPT--QRLVVTSSRDTTFRLWDFRDPSIHSVNVFQGHTDTVTSAVFTVGDN---VVSGSDDRTVKVWDLKNMRSPIATIRTDSAVNRISVSANQRIIALPHDNRQVRLFDMN-GVRLARLPRSNRQGHRRMVCCSAWNEENQA-CNLFTCGFDRQAIGWNINIPAL 490          
BLAST of WD repeat-containing protein 37 vs. Ensembl Zebrafish
Match: daw1 (dynein assembly factor with WDR repeat domains 1 [Source:NCBI gene;Acc:556760])

HSP 1 Score: 66.2402 bits (160), Expect = 4.527e-11
Identity = 48/196 (24.49%), Postives = 90/196 (45.92%), Query Frame = 1
Query: 1141 YTYK-DSAPLSAADFLLNRDQIVTASWDRLGRIYDIATGSEVASLTGHDLPLTDVRTNPVADHALAVTASRDCTFRLWDFRCSTTEVHVQQGHNGIVSSVSFVGNSPEKLVSAGADRACKVWDLRNSRNPLHVIRTDSPINRLAVHPNGKIVALPMDNRIVKIFDLNLGTRIARLPRNSNQSHNRIVTSIAWNVDG 1725
            YT++  +A +    F      + T S D   +++D+ +G EV++L GH   +  +  N   D    VT S D T  LWD   S  +VHV  GH G +S V F  +    + +A  D++CKVWD    +    ++  +  +  +  +  G+++A    +   ++F  +    + +L     + H   ++ + +N  G
Sbjct:  171 YTFRGHTAEIVCLAFNPQSTLVATGSMDTTAKLWDVESGEEVSTLAGHFAEIISLCFNTTGDRL--VTGSFDHTAILWDVP-SGRKVHVLSGHRGEISCVQFNWDCS-LIATASLDKSCKVWDAEGGQCLATLLGHNDEVLDVCFNYTGQLIATASADGTSRVFSTDTFQCLCQL-----EGHKGEISKVCFNAQG 357          

HSP 2 Score: 63.929 bits (154), Expect = 2.689e-10
Identity = 45/171 (26.32%), Postives = 75/171 (43.86%), Query Frame = 1
Query: 1267 SLTGHDLPLTDVRTNPVADHALAVTASRDCTFRLWDFRCSTTEVHVQQGHNGIVSSVSFVGNSPEKLVSAGADRACKVWDLRNSRNPLHVIRTDSPINRLAVHPNGKIVALPMDNRIVKIFDLNLGTRIARLPRNSNQSHNRIVTSIAWNVDGGGKPNFFTTGFDQQLIAW 1779
            +L  H LPLT+V  N     +  +T S D T ++WD   S  E+H  +GH  +V +++F     +K+ +   D+ CK+W     +         + I  LA +P   +VA    +   K++D+  G  ++ L       H   + S+ +N  G       T  FD   I W
Sbjct:   87 ALQAHILPLTNVAFNKSG--SCFITGSYDRTCKIWD-TASGEELHTLEGHRNVVYAIAFNNPYGDKVATGSFDKTCKLWSAETGKCFYTFRGHTAEIVCLAFNPQSTLVATGSMDTTAKLWDVESGEEVSTLA-----GHFAEIISLCFNTTG---DRLVTGSFDHTAILW 246          
BLAST of WD repeat-containing protein 37 vs. Ensembl Zebrafish
Match: daw1 (dynein assembly factor with WDR repeat domains 1 [Source:NCBI gene;Acc:556760])

HSP 1 Score: 65.855 bits (159), Expect = 6.204e-11
Identity = 48/196 (24.49%), Postives = 90/196 (45.92%), Query Frame = 1
Query: 1141 YTYKD-SAPLSAADFLLNRDQIVTASWDRLGRIYDIATGSEVASLTGHDLPLTDVRTNPVADHALAVTASRDCTFRLWDFRCSTTEVHVQQGHNGIVSSVSFVGNSPEKLVSAGADRACKVWDLRNSRNPLHVIRTDSPINRLAVHPNGKIVALPMDNRIVKIFDLNLGTRIARLPRNSNQSHNRIVTSIAWNVDG 1725
            YT++  +A +    F      + T S D   +++D+ +G EV++L GH   +  +  N   D    VT S D T  LWD   S  +VHV  GH G +S V F  +    + +A  D++CKVWD    +    ++  +  +  +  +  G+++A    +   ++F  +    + +L     + H   ++ + +N  G
Sbjct:  171 YTFRGHTAEIVCLAFNPQSTLVATGSMDTTAKLWDVESGEEVSTLAGHFAEIISLCFNTTGDRL--VTGSFDHTAILWDVP-SGRKVHVLSGHRGEISCVQFNWDCS-LIATASLDKSCKVWDAEGGQCLATLLGHNDEVLDVCFNYTGQLIATASADGTSRVFSTDTFQCLCQL-----EGHKGEISKVCFNAQG 357          

HSP 2 Score: 63.5438 bits (153), Expect = 3.990e-10
Identity = 45/171 (26.32%), Postives = 75/171 (43.86%), Query Frame = 1
Query: 1267 SLTGHDLPLTDVRTNPVADHALAVTASRDCTFRLWDFRCSTTEVHVQQGHNGIVSSVSFVGNSPEKLVSAGADRACKVWDLRNSRNPLHVIRTDSPINRLAVHPNGKIVALPMDNRIVKIFDLNLGTRIARLPRNSNQSHNRIVTSIAWNVDGGGKPNFFTTGFDQQLIAW 1779
            +L  H LPLT+V  N     +  +T S D T ++WD   S  E+H  +GH  +V +++F     +K+ +   D+ CK+W     +         + I  LA +P   +VA    +   K++D+  G  ++ L       H   + S+ +N  G       T  FD   I W
Sbjct:   87 ALQAHILPLTNVAFNKSG--SCFITGSYDRTCKIWD-TASGEELHTLEGHRNVVYAIAFNNPYGDKVATGSFDKTCKLWSAETGKCFYTFRGHTAEIVCLAFNPQSTLVATGSMDTTAKLWDVESGEEVSTLA-----GHFAEIISLCFNTTG---DRLVTGSFDHTAILW 246          

HSP 3 Score: 55.8398 bits (133), Expect = 9.814e-8
Identity = 67/270 (24.81%), Postives = 108/270 (40.00%), Query Frame = 1
Query:  745 VGTACADGVVRLWNSDNGHCSLVYLGHSGSVNSVRF--KNGIMLTASGDGTAHLVNLPP-EKISE---------ALSSNEPGKSSVTDSIGHXXXXXXXXXTKRNINSPTEDGAESNPVENTTLILRNPNSMYQTASLYSSFGSYTYKDSAPLSAADFLLNRDQIVTASWDRLGRIYDIATGSEVASLTGHDLPLTDVRTNPVADHALAVTASRDCTFRLWDFRCSTTEVHVQ-QGHNGIVSSVSFVGNSPEKLVSAGADRACKVWDLRN 1515
            V T   D   +LW+++ G C   + GH+  +  + F  ++ ++ T S D TA L ++   E++S          +L  N  G   VT S  H                              T IL +  S  +   L    G         +S   F  +   I TAS D+  +++D   G  +A+L GH+  + DV  N      L  TAS D T R+  F   T +   Q +GH G +S V F      ++++A  D+  +VW ++ 
Sbjct:  150 VATGSFDKTCKLWSAETGKCFYTFRGHTAEIVCLAFNPQSTLVATGSMDTTAKLWDVESGEEVSTLAGHFAEIISLCFNTTGDRLVTGSFDH------------------------------TAILWDVPSGRKVHVLSGHRG--------EISCVQFNWDCSLIATASLDKSCKVWDAEGGQCLATLLGHNDEVLDVCFNYTGQ--LIATASADGTSRV--FSTDTFQCLCQLEGHKGEISKVCFNAQGS-RVLTASVDKTSRVWCVKT 376          
BLAST of WD repeat-containing protein 37 vs. Ensembl Zebrafish
Match: pafah1b1a (platelet-activating factor acetylhydrolase 1b, regulatory subunit 1a [Source:NCBI gene;Acc:394246])

HSP 1 Score: 64.6994 bits (156), Expect = 1.433e-10
Identity = 55/224 (24.55%), Postives = 102/224 (45.54%), Query Frame = 1
Query: 1165 LSAADFLLNRDQIVTASWDRLGRIYDIATGSEVASLTGHDLPLTDVRTNPVADHALAVTASRDCTFRLWDFRCSTTEVHVQQGHNGIVSSVSFV------------GNSPEK-------LVSAGADRACKVWDLRNSRNPLHVIRTDSPINRLAVHPNGKIVALPMDNRIVKIFDLNLGTRIARLPRNSNQSHNRIVTSIAWNVDGGGKPNFFTTGFDQQLIAW 1779
            +S+   + N D IV+AS D+  +++++ATG  V + TGH   +  VR N   D  L  ++S D T R+W       +  +++ H  +V  +S+             G+  +K       L+S   D+  K+WD+      + ++  D+ +  + VHP GK +    D++ ++I+D     R  +    +  +H   VTS+ ++      P   T   DQ +  W
Sbjct:  195 VSSVAIMPNGDHIVSASRDKTIKMWEVATGYCVKTFTGHREWVRMVRPN--QDGTLIASSSNDQTVRVWVVATKECKAELRE-HEHVVECISWAPESAHPTILEATGSETKKSGKPGPFLLSGSRDKTIKMWDVSIGMCLMTLVGHDNWVRGVLVHPGGKYIVSCADDKTLRIWDYK-NKRCTK----TLSAHEHFVTSLDFHKTA---PYVVTGSVDQTVKVW 407          

HSP 2 Score: 51.6026 bits (122), Expect = 2.159e-6
Identity = 46/175 (26.29%), Postives = 83/175 (47.43%), Query Frame = 1
Query: 1201 IVTASWDRLGRIYDIATGSEVASLTGHDLPLTDVRTNPVADHALAVTASRDCTFRLWDFRCSTTEVHVQQGHNGIVSSVSFVGNSPEKLVSAGADRACKVWDLRNSRNPLHVIRTDSPINRLA--VHPN--GKIVALPMDNRIVKIFDLNLGTRIARLPRNSNQSHNRIVTSIAW 1713
            IV+AS D   +++D  TG    +L GH   + D+  +      L  + S D T +LWDF+     +    GH+  VSSV+ + N  + +VSA  D+  K+W++       + ++T +        V PN  G ++A   +++ V+++ +      A L     + H  +V  I+W
Sbjct:  123 IVSASEDATIKVWDHETGDFERTLKGHTDSVQDISFDHTG--KLLASCSADMTIKLWDFQGFEC-IRTMHGHDHNVSSVAIMPNG-DHIVSASRDKTIKMWEVATG----YCVKTFTGHREWVRMVRPNQDGTLIASSSNDQTVRVWVVATKECKAEL-----REHEHVVECISW 284          
BLAST of WD repeat-containing protein 37 vs. Ensembl Xenopus
Match: wdr37 (WD repeat domain 37 [Source:NCBI gene;Acc:100125083])

HSP 1 Score: 249.98 bits (637), Expect = 1.732e-74
Identity = 183/497 (36.82%), Postives = 259/497 (52.11%), Query Frame = 1
Query:  346 GDDGILSQEFKQRLWALFRQIESEFEKECKKIYSENYAIHDRNEKIESSDHEESNFAKKISGSHLXXXXXXXXXX--XXXXXXRLVSTFRDRGSTMPNISNQSHQGSNRHACILCWRVSDHRDGIWEVNCIGRG--LVGTACADGVVRLWNSDNGHCSLVYLGHSGSVNSVRF--KNGIMLTASGDGTAH----LVNLPPEKISEALSSNEPGKSSVTDSIGHXXXXXXXXXTKRNINSPTEDGAESNPVENTTLILRNPNSMYQTASLYSSFGSYTYKDSAPLSAADFLLNRDQIVTASWDRLGRIYDIATGSEVASLTGHDLPLTDVRTNPVADHALAVTASRDCTFRLWDFR-CSTTEVHVQQGHNGIVSSVSF-VGNSPEKLVSAGADRACKVWDLRNSRNPLHVIRTDSPINRLAVHPNGKIVALPMDNRIVKIFDLNLGTRIARLPRNSNQSHNRIVTSIAWNVDGGGKPNFFTTGFDQQLIAWHLQLPLL 1800
            G D  L    +  L  LF QIE EFE     +Y EN  +     +I++ +   +   + I G+ LS+   +      + Q + +L +T++   ++   I +     ++R  C L      HRDG+W+V+       ++GTA AD    LW+ + G C + Y+GH+GSVNS++F     I LTASGD TAH    +V LP  + + A +S   G+  V  S              ++ N    D +   P     L            +L S  G         + AAD+L+   Q VTASWDR   +YD+ T   V SLTGHD  LT   T+P     L VT+SRD TFRLWDFR  S   V+V QGH   V+S  F VG++   +VS   DR  KVWDL+N R+P+  IRTDS INR++V    +I+ALP DNR V++FD++ G R+ARLPR++ Q H R+V   AW+ D     N FT GFD+Q I W++ +P L
Sbjct:   59 GQDSKLPSSVRNTLLELFGQIEREFEN----LYLENLEL---RREIDTLNDRLAVEGQAIDGAELSKGQMKTKASHSTSQLSQKLKTTYK---ASTSKIVSSFKTTTSRAICQLVKDYVGHRDGLWDVSVTRTQPVVLGTASADHTALLWSIETGKCLIKYVGHAGSVNSIKFHPTEQIALTASGDQTAHIWRYMVQLPTPQPT-ADTSQISGEEEVDFS-------------DKDENDGDGDASSDCPTVRVPL-----------TALKSHQGV--------VIAADWLVGGKQAVTASWDRTANLYDVETSELVHSLTGHDQELTHCCTHPT--QRLVVTSSRDTTFRLWDFRDPSIHSVNVFQGHTDTVTSAVFTVGDN---VVSGSDDRTVKVWDLKNMRSPIATIRTDSAINRISVSVGQRIIALPHDNRQVRLFDMS-GVRLARLPRSNRQGHRRMVCCCAWSED-HPTCNLFTCGFDRQAIGWNINIPAL 505          
BLAST of WD repeat-containing protein 37 vs. Ensembl Xenopus
Match: wdr37 (WD repeat domain 37 [Source:NCBI gene;Acc:100125083])

HSP 1 Score: 249.595 bits (636), Expect = 2.073e-74
Identity = 183/497 (36.82%), Postives = 259/497 (52.11%), Query Frame = 1
Query:  346 GDDGILSQEFKQRLWALFRQIESEFEKECKKIYSENYAIHDRNEKIESSDHEESNFAKKISGSHLXXXXXXXXXX--XXXXXXRLVSTFRDRGSTMPNISNQSHQGSNRHACILCWRVSDHRDGIWEVNCIGRG--LVGTACADGVVRLWNSDNGHCSLVYLGHSGSVNSVRF--KNGIMLTASGDGTAH----LVNLPPEKISEALSSNEPGKSSVTDSIGHXXXXXXXXXTKRNINSPTEDGAESNPVENTTLILRNPNSMYQTASLYSSFGSYTYKDSAPLSAADFLLNRDQIVTASWDRLGRIYDIATGSEVASLTGHDLPLTDVRTNPVADHALAVTASRDCTFRLWDFR-CSTTEVHVQQGHNGIVSSVSF-VGNSPEKLVSAGADRACKVWDLRNSRNPLHVIRTDSPINRLAVHPNGKIVALPMDNRIVKIFDLNLGTRIARLPRNSNQSHNRIVTSIAWNVDGGGKPNFFTTGFDQQLIAWHLQLPLL 1800
            G D  L    +  L  LF QIE EFE     +Y EN  +     +I++ +   +   + I G+ LS+   +      + Q + +L +T++   ++   I +     ++R  C L      HRDG+W+V+       ++GTA AD    LW+ + G C + Y+GH+GSVNS++F     I LTASGD TAH    +V LP  + + A +S   G+  V  S              ++ N    D +   P     L            +L S  G         + AAD+L+   Q VTASWDR   +YD+ T   V SLTGHD  LT   T+P     L VT+SRD TFRLWDFR  S   V+V QGH   V+S  F VG++   +VS   DR  KVWDL+N R+P+  IRTDS INR++V    +I+ALP DNR V++FD++ G R+ARLPR++ Q H R+V   AW+ D     N FT GFD+Q I W++ +P L
Sbjct:   62 GQDSKLPSSVRNTLLELFGQIEREFEN----LYLENLEL---RREIDTLNDRLAVEGQAIDGAELSKGQMKTKASHSTSQLSQKLKTTYK---ASTSKIVSSFKTTTSRAICQLVKDYVGHRDGLWDVSVTRTQPVVLGTASADHTALLWSIETGKCLIKYVGHAGSVNSIKFHPTEQIALTASGDQTAHIWRYMVQLPTPQPT-ADTSQISGEEEVDFS-------------DKDENDGDGDASSDCPTVRVPL-----------TALKSHQGV--------VIAADWLVGGKQAVTASWDRTANLYDVETSELVHSLTGHDQELTHCCTHPT--QRLVVTSSRDTTFRLWDFRDPSIHSVNVFQGHTDTVTSAVFTVGDN---VVSGSDDRTVKVWDLKNMRSPIATIRTDSAINRISVSVGQRIIALPHDNRQVRLFDMS-GVRLARLPRSNRQGHRRMVCCCAWSED-HPTCNLFTCGFDRQAIGWNINIPAL 508          
BLAST of WD repeat-containing protein 37 vs. Ensembl Xenopus
Match: wdr37 (WD repeat domain 37 [Source:NCBI gene;Acc:100125083])

HSP 1 Score: 236.884 bits (603), Expect = 7.590e-70
Identity = 173/491 (35.23%), Postives = 248/491 (50.51%), Query Frame = 1
Query:  346 GDDGILSQEFKQRLWALFRQIESEFEKECKKIYSENYAIHDRNEKIESSDHEESNFAKKISGSHLXXXXXXXXXX--XXXXXXRLVSTFRDRGSTMPNISNQSHQGSNRHACILCWRVSDHRDGIWEVNCIGRG--LVGTACADGVVRLWNSDNGHCSLVYLGHSGSVNSVRFKNGIMLTASGDGTAHLVNLPPEKISEALSSNEPGKSSVTDSIGHXXXXXXXXXTKRNINSPTEDGAESNPVENTTLILRNPNSMYQTASLYSSFGSYTYKDSAPLSAADFLLNRDQIVTASWDRLGRIYDIATGSEVASLTGHDLPLTDVRTNPVADHALAVTASRDCTFRLWDFR-CSTTEVHVQQGHNGIVSSVSF-VGNSPEKLVSAGADRACKVWDLRNSRNPLHVIRTDSPINRLAVHPNGKIVALPMDNRIVKIFDLNLGTRIARLPRNSNQSHNRIVTSIAWNVDGGGKPNFFTTGFDQQLIAWHLQLPLL 1800
            G D  L    +  L  LF QIE EFE     +Y EN  +     +I++ +   +   + I G+ LS+   +      + Q + +L +T++   ++   I +     ++R  C L      HRDG+W+V+       ++GTA AD    LW+ + G C + Y+GH+GSVNS++F     +  +G      +  P    S+ +S  E    S  D                  N    D +   P       +R P       +L S  G         + AAD+L+   Q VTASWDR   +YD+ T   V SLTGHD  LT   T+P     L VT+SRD TFRLWDFR  S   V+V QGH   V+S  F VG++   +VS   DR  KVWDL+N R+P+  IRTDS INR++V    +I+ALP DNR V++FD++ G R+ARLPR++ Q H R+V   AW+ D     N FT GFD+Q I W++ +P L
Sbjct:   45 GQDSKLPSSVRNTLLELFGQIEREFEN----LYLENLEL---RREIDTLNDRLAVEGQAIDGAELSKGQMKTKASHSTSQLSQKLKTTYK---ASTSKIVSSFKTTTSRAICQLVKDYVGHRDGLWDVSVTRTQPVVLGTASADHTALLWSIETGKCLIKYVGHAGSVNSIKFHPTEQIALTGSFQFAKLYKPTISCSQQISGEEEVDFSDKDE-----------------NDGDGDASSDCPT------VRVP-----LTALKSHQGV--------VIAADWLVGGKQAVTASWDRTANLYDVETSELVHSLTGHDQELTHCCTHPT--QRLVVTSSRDTTFRLWDFRDPSIHSVNVFQGHTDTVTSAVFTVGDN---VVSGSDDRTVKVWDLKNMRSPIATIRTDSAINRISVSVGQRIIALPHDNRQVRLFDMS-GVRLARLPRSNRQGHRRMVCCCAWSED-HPTCNLFTCGFDRQAIGWNINIPAL 482          
BLAST of WD repeat-containing protein 37 vs. Ensembl Xenopus
Match: wdr37 (WD repeat domain 37 [Source:NCBI gene;Acc:100125083])

HSP 1 Score: 231.491 bits (589), Expect = 6.736e-68
Identity = 176/496 (35.48%), Postives = 250/496 (50.40%), Query Frame = 1
Query:  346 GDDGILSQEFKQRLWALFRQIESEFEKECKKIYSENYAIHDRNEKIESSDHEESNFAKKISGSHLXXXXXXXXXX--XXXXXXRLVSTFRDRGSTMPNISNQSHQGSNRHACILCWRVSDHRDGIWEVNCIGRG--LVGTACADGVVRLWNSDNGHCSLVYLGHSGSVNSVRFKNGIMLTASGDGTAH----LVNLP-PEKISEALSSNEPGKSSVTDSIGHXXXXXXXXXTKRNINSPTEDGAESNPVENTTLILRNPNSMYQTASLYSSFGSYTYKDSAPLSAADFLLNRDQIVTASWDRLGRIYDIATGSEVASLTGHDLPLTDVRTNPVADHALAVTASRDCTFRLWDFR-CSTTEVHVQQGHNGIVSSVSF-VGNSPEKLVSAGADRACKVWDLRNSRNPLHVIRTDSPINRLAVHPNGKIVALPMDNRIVKIFDLNLGTRIARLPRNSNQSHNRIVTSIAWNVDGGGKPNFFTTGFDQQLIAWHLQLPLL 1800
            G D  L    +  L  LF QIE EFE     +Y EN  +     +I++ +   +   + I G+ LS+   +      + Q + +L +T++   ++   I +     ++R  C L      HRDG+W+V+       ++GTA AD    LW+ + G C + Y+GH+GS             ASGD TAH    +V LP P+  ++   S E                  VD + ++ N    D +   P     L            +L S  G         + AAD+L+   Q VTASWDR   +YD+ T   V SLTGHD  LT   T+P     L VT+SRD TFRLWDFR  S   V+V QGH   V+S  F VG++   +VS   DR  KVWDL+N R+P+  IRTDS INR++V    +I+ALP DNR V++FD++ G R+ARLPR++ Q H R+V   AW+ D     N FT GFD+Q I W++ +P L
Sbjct:   45 GQDSKLPSSVRNTLLELFGQIEREFEN----LYLENLEL---RREIDTLNDRLAVEGQAIDGAELSKGQMKTKASHSTSQLSQKLKTTYK---ASTSKIVSSFKTTTSRAICQLVKDYVGHRDGLWDVSVTRTQPVVLGTASADHTALLWSIETGKCLIKYVGHAGS-------------ASGDQTAHIWRYMVQLPTPQPTADTSISGE----------------EEVDFSDKDENDGDGDASSDCPTVRVPL-----------TALKSHQGV--------VIAADWLVGGKQAVTASWDRTANLYDVETSELVHSLTGHDQELTHCCTHPT--QRLVVTSSRDTTFRLWDFRDPSIHSVNVFQGHTDTVTSAVFTVGDN---VVSGSDDRTVKVWDLKNMRSPIATIRTDSAINRISVSVGQRIIALPHDNRQVRLFDMS-GVRLARLPRSNRQGHRRMVCCCAWSED-HPTCNLFTCGFDRQAIGWNINIPAL 475          
BLAST of WD repeat-containing protein 37 vs. Ensembl Xenopus
Match: wdr37 (WD repeat domain 37 [Source:NCBI gene;Acc:100125083])

HSP 1 Score: 230.335 bits (586), Expect = 8.153e-68
Identity = 181/493 (36.71%), Postives = 244/493 (49.49%), Query Frame = 1
Query:  346 GDDGILSQEFKQRLWALFRQIESEFEKECKKIYSENYAIHDRNEKIESSDHEESNFAKKISGSHLXXXXXXXXXXXXXXXXRLVSTFRDRGSTMPNISNQSHQGSNRHACILCWRVSDHRDGIWEVNCIGRG--LVGTACADGVVRLWNSDNGHCSLVYLGHSGSVNSVRFKNGIMLTASGDGTAH----LVNLPPEKISEALSSNEPGKSSVTDSIGHXXXXXXXXXTKRNINSPTEDGAESNPVENTTLILRNPNSMYQTASLYSSFGSYTYKDSAPLSAADFLLNRDQIVTASWDRLGRIYDIATGSEVASLTGHDLPLTDVRTNPVADHALAVTASRDCTFRLWDFR-CSTTEVHVQQGHNGIVSSVSF-VGNSPEKLVSAGADRACKVWDLRNSRNPLHVIRTDSPINRLAVHPNGKIVALPMDNRIVKIFDLNLGTRIARLPRNSNQSHNRIVTSIAWNVDGGGKPNFFTTGFDQQLIAWHLQLPLL 1800
            G D  L    +  L  LF QIE EFE     +Y EN         +ESS H  S  ++K+  ++            K STS++VS+F+   S              R  C L      HRDG+W+V+       ++GTA AD    LW+ + G C + Y+GH+GS             ASGD TAH    +V LP  + + A +S   G+  V  S              ++ N    D +   P     L            +L S  G         + AAD+L+   Q VTASWDR   +YD+ T   V SLTGHD  LT   T+P     L VT+SRD TFRLWDFR  S   V+V QGH   V+S  F VG++   +VS   DR  KVWDL+N R+P+  IRTDS INR++V    +I+ALP DNR V++FD++ G R+ARLPR++ Q H R+V   AW+ D     N FT GFD+Q I W++ +P L
Sbjct:   45 GQDSKLPSSVRNTLLELFGQIEREFEN----LYLEN---------LESS-HSTSQLSQKLKTTY------------KASTSKIVSSFKTTTS--------------RAICQLVKDYVGHRDGLWDVSVTRTQPVVLGTASADHTALLWSIETGKCLIKYVGHAGS-------------ASGDQTAHIWRYMVQLPTPQPT-ADTSQISGEEEVDFS-------------DKDENDGDGDASSDCPTVRVPL-----------TALKSHQGV--------VIAADWLVGGKQAVTASWDRTANLYDVETSELVHSLTGHDQELTHCCTHPT--QRLVVTSSRDTTFRLWDFRDPSIHSVNVFQGHTDTVTSAVFTVGDN---VVSGSDDRTVKVWDLKNMRSPIATIRTDSAINRISVSVGQRIIALPHDNRQVRLFDMS-GVRLARLPRSNRQGHRRMVCCCAWSED-HPTCNLFTCGFDRQAIGWNINIPAL 444          
BLAST of WD repeat-containing protein 37 vs. Ensembl Mouse
Match: Wdr37 (WD repeat domain 37 [Source:MGI Symbol;Acc:MGI:1920393])

HSP 1 Score: 254.218 bits (648), Expect = 1.974e-76
Identity = 186/499 (37.27%), Postives = 256/499 (51.30%), Query Frame = 1
Query:  346 GDDGILSQEFKQRLWALFRQIESEFEKECKKIYSENYAIHDRNEKIESSDHEESNFAKKISGSHLXX--XXXXXXXXXXXXXXRLVSTFRDRGSTMPNISNQSHQGSNRHACILCWRVSDHRDGIWEVNCIGRG--LVGTACADGVVRLWNSDNGHCSLVYLGHSGSVNSVRF--KNGIMLTASGDGTAHL----VNLPPEKISEALSSNEPGKSSVTDSIGHXXXXXXXXXTKRNINSPTEDGAESNPVENTTLILRNPNSMYQTASLYSSFGSYTYKDSAPLSAADFLLNRDQIVTASWDRLGRIYDIATGSEVASLTGHDLPLTDVRTNPVADHALAVTASRDCTFRLWDFR-CSTTEVHVQQGHNGIVSSVSF-VGNSPEKLVSAGADRACKVWDLRNSRNPLHVIRTDSPINRLAVHPNGKIVALPMDNRIVKIFDLNLGTRIARLPRNSNQSHNRIVTSIAWNVDGGGKP--NFFTTGFDQQLIAWHLQLPLL 1800
            G D  L    +  L  LF QIE EFE     +Y EN  +     +I++ +   +   + I G+ LS+     +    + Q + +L +T++   ++   I +     ++R  C L      HRDGIW+V+       ++GTA AD    LW+ + G C + Y GH GSVNS++F     + LTASGD TAH+    V LP  +     S    G+  +  S               + + P  DG  S+           P       SL S  G         + AAD+L+   Q+VTASWDR   +YD+ T   V SLTGHD  LT   T+P     L VT+SRD TFRLWDFR  S   V+V QGH   V+S  F VG++   +VS   DR  KVWDL+N R+P+  IRTDS INR+ V    KI+ALP DNR V++FD++ G R+ARLPR+S Q H R+V   AW+ D    P  N FT GFD+Q I W++ +P L
Sbjct:   45 GQDSKLPSSVRSTLLELFGQIEREFEN----LYIENLEL---RREIDTLNERLAGEGQAIDGAELSKGQLKTKASHSTSQLSQKLKTTYK---ASTSKIVSSFKTTTSRAICQLVKEYIGHRDGIWDVSVTRTQPIVLGTASADHTALLWSIETGKCLVKYAGHVGSVNSIKFHPSEQLALTASGDQTAHIWRYVVQLPTPQPVADTSQQISGEDEIECS---------------DKDEPDIDGDVSSDC---------PTVRVPLTSLKSHQGV--------VIAADWLVGGKQVVTASWDRTANLYDVETSELVHSLTGHDQELTHCCTHPT--QRLVVTSSRDTTFRLWDFRDPSIHSVNVFQGHTDTVTSAVFTVGDN---VVSGSDDRTVKVWDLKNMRSPIATIRTDSAINRINVCVGQKIIALPHDNRQVRLFDMS-GVRLARLPRSSRQGHRRMVCCSAWSED---HPICNLFTCGFDRQAIGWNINIPAL 492          
BLAST of WD repeat-containing protein 37 vs. Ensembl Mouse
Match: Wdr37 (WD repeat domain 37 [Source:MGI Symbol;Acc:MGI:1920393])

HSP 1 Score: 254.218 bits (648), Expect = 1.974e-76
Identity = 186/499 (37.27%), Postives = 256/499 (51.30%), Query Frame = 1
Query:  346 GDDGILSQEFKQRLWALFRQIESEFEKECKKIYSENYAIHDRNEKIESSDHEESNFAKKISGSHLXX--XXXXXXXXXXXXXXRLVSTFRDRGSTMPNISNQSHQGSNRHACILCWRVSDHRDGIWEVNCIGRG--LVGTACADGVVRLWNSDNGHCSLVYLGHSGSVNSVRF--KNGIMLTASGDGTAHL----VNLPPEKISEALSSNEPGKSSVTDSIGHXXXXXXXXXTKRNINSPTEDGAESNPVENTTLILRNPNSMYQTASLYSSFGSYTYKDSAPLSAADFLLNRDQIVTASWDRLGRIYDIATGSEVASLTGHDLPLTDVRTNPVADHALAVTASRDCTFRLWDFR-CSTTEVHVQQGHNGIVSSVSF-VGNSPEKLVSAGADRACKVWDLRNSRNPLHVIRTDSPINRLAVHPNGKIVALPMDNRIVKIFDLNLGTRIARLPRNSNQSHNRIVTSIAWNVDGGGKP--NFFTTGFDQQLIAWHLQLPLL 1800
            G D  L    +  L  LF QIE EFE     +Y EN  +     +I++ +   +   + I G+ LS+     +    + Q + +L +T++   ++   I +     ++R  C L      HRDGIW+V+       ++GTA AD    LW+ + G C + Y GH GSVNS++F     + LTASGD TAH+    V LP  +     S    G+  +  S               + + P  DG  S+           P       SL S  G         + AAD+L+   Q+VTASWDR   +YD+ T   V SLTGHD  LT   T+P     L VT+SRD TFRLWDFR  S   V+V QGH   V+S  F VG++   +VS   DR  KVWDL+N R+P+  IRTDS INR+ V    KI+ALP DNR V++FD++ G R+ARLPR+S Q H R+V   AW+ D    P  N FT GFD+Q I W++ +P L
Sbjct:   45 GQDSKLPSSVRSTLLELFGQIEREFEN----LYIENLEL---RREIDTLNERLAGEGQAIDGAELSKGQLKTKASHSTSQLSQKLKTTYK---ASTSKIVSSFKTTTSRAICQLVKEYIGHRDGIWDVSVTRTQPIVLGTASADHTALLWSIETGKCLVKYAGHVGSVNSIKFHPSEQLALTASGDQTAHIWRYVVQLPTPQPVADTSQQISGEDEIECS---------------DKDEPDIDGDVSSDC---------PTVRVPLTSLKSHQGV--------VIAADWLVGGKQVVTASWDRTANLYDVETSELVHSLTGHDQELTHCCTHPT--QRLVVTSSRDTTFRLWDFRDPSIHSVNVFQGHTDTVTSAVFTVGDN---VVSGSDDRTVKVWDLKNMRSPIATIRTDSAINRINVCVGQKIIALPHDNRQVRLFDMS-GVRLARLPRSSRQGHRRMVCCSAWSED---HPICNLFTCGFDRQAIGWNINIPAL 492          
BLAST of WD repeat-containing protein 37 vs. Ensembl Mouse
Match: Wdr37 (WD repeat domain 37 [Source:MGI Symbol;Acc:MGI:1920393])

HSP 1 Score: 105.531 bits (262), Expect = 1.431e-25
Identity = 77/188 (40.96%), Postives = 101/188 (53.72%), Query Frame = 1
Query: 1111 TASLYSSFGSYTYKDSAPLSAADFLLNRDQIV-------------TASWDRLGRIYDIATGSEVASL-----TGHDLPLTDVRTNPVADHALAVTASRDCTFRLWDFR-CSTTEVHVQQGHNGIVSSVSF-VGNSPEKLVSAGADRACKVWDLRNSRNPLHVIRTDSPINRLAVHPNGKIVALPMDNR 1614
            T+ + SSF + T +    L   +++ +RD I              TAS D    ++ I TG  +        +GHD  LT   T+P     L VT+SRD TFRLWDFR  S   V+V QGH   V+S  F VG++   +VS   DR  KVWDL+N R+P+  IRTDS INR+ V    KI+ALP DNR
Sbjct:   11 TSKIVSSFKTTTSRAICQL-VKEYIGHRDGIWDVSVTRTQPIVLGTASADHTALLWSIETGKCLVKYAGHVGSGHDQELTHCCTHPT--QRLVVTSSRDTTFRLWDFRDPSIHSVNVFQGHTDTVTSAVFTVGDN---VVSGSDDRTVKVWDLKNMRSPIATIRTDSAINRINVCVGQKIIALPHDNR 192          
BLAST of WD repeat-containing protein 37 vs. Ensembl Mouse
Match: Wdr37 (WD repeat domain 37 [Source:MGI Symbol;Acc:MGI:1920393])

HSP 1 Score: 78.9518 bits (193), Expect = 1.964e-16
Identity = 60/189 (31.75%), Postives = 94/189 (49.74%), Query Frame = 1
Query:  352 DGILSQEFKQRLWALFRQIESEFEKECKKIYSENYAIHDRNEKIESSDHEESNFAKKISGSHLXXXXXXXXXX--XXXXXXRLVSTFRDRGSTMPNISNQSHQGSNRHACILCWRVSDHRDGIWEVNCIGRG--LVGTACADGVVRLWNSDNGHCSLVYLGHSGSVNSVRF--KNGIMLTASGDGTAHL 900
            D  L    +  L  LF QIE EFE     +Y EN  +     +I++ +   +   + I G+ LS+   +      + Q + +L +T++   ++   I +     ++R  C L      HRDGIW+V+       ++GTA AD    LW+ + G C + Y GH GSVNS++F     + LTASGD TAH+
Sbjct:    2 DSKLPSSVRSTLLELFGQIEREFEN----LYIENLEL---RREIDTLNERLAGEGQAIDGAELSKGQLKTKASHSTSQLSQKLKTTYK---ASTSKIVSSFKTTTSRAICQLVKEYIGHRDGIWDVSVTRTQPIVLGTASADHTALLWSIETGKCLVKYAGHVGSVNSIKFHPSEQLALTASGDQTAHI 180          
BLAST of WD repeat-containing protein 37 vs. Ensembl Mouse
Match: Poc1a (POC1 centriolar protein A [Source:MGI Symbol;Acc:MGI:1917485])

HSP 1 Score: 72.0182 bits (175), Expect = 2.889e-13
Identity = 60/208 (28.85%), Postives = 96/208 (46.15%), Query Frame = 1
Query: 1156 SAPLSAADFLLNRDQIVTASWDRLGRIYDIATGSEVASLTGHDLPLTDVRTNPVADHALAVTASRDCTFRLWDFRCSTTEVHVQQGHNGIVSSVSFVGNSPEKLVSAGADRACKVWDLRNSRNPLHVIRTDSPINRLAVHPNGKIVALPMDNRIVKIFDLNLGTRIARLPRNSNQSHNRIVTSIAWNVDGGGKPNFFTTGFDQQLIAW 1779
            +A + +  F  +   +VTAS D+  +++       + SLT H   +   + +P  D  L V+AS D T +LWD + S   +H    H G V+ V F   S   + +AG D   KVWD R  R   H     + +N L+ HP+G  +     +  +KI DL  G  +  L       H    T++A++  G     F + G D+Q++ W
Sbjct:   65 TATVRSVHFCSDGQSLVTASDDKTVKVWSTHRQRFLFSLTQHINWVRCAKFSP--DGRLIVSASDDKTVKLWD-KTSRECIHSYCEHGGFVTYVDF-HPSGTCIAAAGMDNTVKVWDARTHRLLQHYQLHSAAVNALSFHPSGNYLITASSDSTLKILDLMEGRLLYTL-----HGHQGPATTVAFSRTG---EYFASGGSDEQVMVW 260          
BLAST of WD repeat-containing protein 37 vs. UniProt/SwissProt
Match: sp|Q5R650|WDR37_PONAB (WD repeat-containing protein 37 OS=Pongo abelii OX=9601 GN=WDR37 PE=2 SV=1)

HSP 1 Score: 255.758 bits (652), Expect = 3.600e-76
Identity = 189/500 (37.80%), Postives = 260/500 (52.00%), Query Frame = 1
Query:  346 GDDGILSQEFKQRLWALFRQIESEFEKECKKIYSENYAIHDRNEKIESSDHEESNFAKKISGSHLXX--XXXXXXXXXXXXXXRLVSTFRDRGSTMPNISNQSHQGSNRHACILCWRVSDHRDGIWEVNCIGRG--LVGTACADGVVRLWNSDNGHCSLVYLGHSGSVNSVRF--KNGIMLTASGDGTAHL----VNLP-PEKISEALSSNEPGKSSVTDSIGHXXXXXXXXXTKRNINSPTEDGAESNPVENTTLILRNPNSMYQTASLYSSFGSYTYKDSAPLSAADFLLNRDQIVTASWDRLGRIYDIATGSEVASLTGHDLPLTDVRTNPVADHALAVTASRDCTFRLWDFR-CSTTEVHVQQGHNGIVSSVSF-VGNSPEKLVSAGADRACKVWDLRNSRNPLHVIRTDSPINRLAVHPNGKIVALPMDNRIVKIFDLNLGTRIARLPRNSNQSHNRIVTSIAWNVDGGGKP--NFFTTGFDQQLIAWHLQLPLL 1800
            G D  L    +  L  LF QIE EFE     +Y EN  +     +I++ +   +   + I G+ LS+     +    + Q + +L +T++   ++   I +     ++R AC L      HRDGIW+V+       ++GTA AD    LW+ + G C + Y GH GSVNS++F     + LTASGD TAH+    V LP P+ +++  +S   G+  V  S               + + P  DG  S+           P       SL S  G           AAD+L+   Q VTASWDR   +YD+ T   V SLTGHD  LT   T+P     L VT+SRD TFRLWDFR  S   V+V QGH   V+S  F VG++   +VS   DR  KVWDL+N R+P+  IRTDS INR+ V    KI+ALP DNR V++FD++ G R+ARLPR+S Q H R+V   AW+ D    P  N FT GFD+Q I W++ +P L
Sbjct:   45 GQDSKLPSSVRSTLLELFGQIEREFEN----LYIENLEL---RREIDTLNERLAAEGQAIDGAELSKGQLKTKASHSTSQLSQKLKTTYK---ASTSKIVSSFKTTTSRAACQLVKEYIGHRDGIWDVSVAKTQPVVLGTASADHTALLWSIETGKCLVKYAGHVGSVNSIKFHPSEQLALTASGDQTAHIWRYAVQLPTPQPVAD--TSQISGEDEVECS---------------DKDEPDLDGDVSSDC---------PTIRVPLTSLKSHQGVVI--------AADWLVGGKQAVTASWDRTANLYDVETSELVHSLTGHDQELTHCCTHPT--QRLVVTSSRDTTFRLWDFRDPSIHSVNVFQGHTDTVTSAVFTVGDN---VVSGSDDRTVKVWDLKNMRSPIATIRTDSAINRINVCVGQKIIALPHDNRQVRLFDMS-GVRLARLPRSSRQGHRRMVCCSAWSED---HPVCNLFTCGFDRQAIGWNINIPAL 491          
BLAST of WD repeat-containing protein 37 vs. UniProt/SwissProt
Match: sp|Q8CBE3|WDR37_MOUSE (WD repeat-containing protein 37 OS=Mus musculus OX=10090 GN=Wdr37 PE=1 SV=1)

HSP 1 Score: 254.218 bits (648), Expect = 1.381e-75
Identity = 186/499 (37.27%), Postives = 256/499 (51.30%), Query Frame = 1
Query:  346 GDDGILSQEFKQRLWALFRQIESEFEKECKKIYSENYAIHDRNEKIESSDHEESNFAKKISGSHLXX--XXXXXXXXXXXXXXRLVSTFRDRGSTMPNISNQSHQGSNRHACILCWRVSDHRDGIWEVNCIGRG--LVGTACADGVVRLWNSDNGHCSLVYLGHSGSVNSVRF--KNGIMLTASGDGTAHL----VNLPPEKISEALSSNEPGKSSVTDSIGHXXXXXXXXXTKRNINSPTEDGAESNPVENTTLILRNPNSMYQTASLYSSFGSYTYKDSAPLSAADFLLNRDQIVTASWDRLGRIYDIATGSEVASLTGHDLPLTDVRTNPVADHALAVTASRDCTFRLWDFR-CSTTEVHVQQGHNGIVSSVSF-VGNSPEKLVSAGADRACKVWDLRNSRNPLHVIRTDSPINRLAVHPNGKIVALPMDNRIVKIFDLNLGTRIARLPRNSNQSHNRIVTSIAWNVDGGGKP--NFFTTGFDQQLIAWHLQLPLL 1800
            G D  L    +  L  LF QIE EFE     +Y EN  +     +I++ +   +   + I G+ LS+     +    + Q + +L +T++   ++   I +     ++R  C L      HRDGIW+V+       ++GTA AD    LW+ + G C + Y GH GSVNS++F     + LTASGD TAH+    V LP  +     S    G+  +  S               + + P  DG  S+           P       SL S  G         + AAD+L+   Q+VTASWDR   +YD+ T   V SLTGHD  LT   T+P     L VT+SRD TFRLWDFR  S   V+V QGH   V+S  F VG++   +VS   DR  KVWDL+N R+P+  IRTDS INR+ V    KI+ALP DNR V++FD++ G R+ARLPR+S Q H R+V   AW+ D    P  N FT GFD+Q I W++ +P L
Sbjct:   45 GQDSKLPSSVRSTLLELFGQIEREFEN----LYIENLEL---RREIDTLNERLAGEGQAIDGAELSKGQLKTKASHSTSQLSQKLKTTYK---ASTSKIVSSFKTTTSRAICQLVKEYIGHRDGIWDVSVTRTQPIVLGTASADHTALLWSIETGKCLVKYAGHVGSVNSIKFHPSEQLALTASGDQTAHIWRYVVQLPTPQPVADTSQQISGEDEIECS---------------DKDEPDIDGDVSSDC---------PTVRVPLTSLKSHQGV--------VIAADWLVGGKQVVTASWDRTANLYDVETSELVHSLTGHDQELTHCCTHPT--QRLVVTSSRDTTFRLWDFRDPSIHSVNVFQGHTDTVTSAVFTVGDN---VVSGSDDRTVKVWDLKNMRSPIATIRTDSAINRINVCVGQKIIALPHDNRQVRLFDMS-GVRLARLPRSSRQGHRRMVCCSAWSED---HPICNLFTCGFDRQAIGWNINIPAL 492          
BLAST of WD repeat-containing protein 37 vs. UniProt/SwissProt
Match: sp|Q9Y2I8|WDR37_HUMAN (WD repeat-containing protein 37 OS=Homo sapiens OX=9606 GN=WDR37 PE=1 SV=2)

HSP 1 Score: 252.677 bits (644), Expect = 5.381e-75
Identity = 187/500 (37.40%), Postives = 258/500 (51.60%), Query Frame = 1
Query:  346 GDDGILSQEFKQRLWALFRQIESEFEKECKKIYSENYAIHDRNEKIESSDHEESNFAKKISGSHLXX--XXXXXXXXXXXXXXRLVSTFRDRGSTMPNISNQSHQGSNRHACILCWRVSDHRDGIWEVNCIGRG--LVGTACADGVVRLWNSDNGHCSLVYLGHSGSVNSVRF--KNGIMLTASGDGTAHL----VNLP-PEKISEALSSNEPGKSSVTDSIGHXXXXXXXXXTKRNINSPTEDGAESNPVENTTLILRNPNSMYQTASLYSSFGSYTYKDSAPLSAADFLLNRDQIVTASWDRLGRIYDIATGSEVASLTGHDLPLTDVRTNPVADHALAVTASRDCTFRLWDFR-CSTTEVHVQQGHNGIVSSVSF-VGNSPEKLVSAGADRACKVWDLRNSRNPLHVIRTDSPINRLAVHPNGKIVALPMDNRIVKIFDLNLGTRIARLPRNSNQSHNRIVTSIAWNVDGGGKP--NFFTTGFDQQLIAWHLQLPLL 1800
            G D  L    +  L  LF QIE EFE     +Y EN  +     +I++ +   +   + I G+ LS+     +    + Q + +L +T++   ++   I +     ++R AC L      HRDGIW+V+       ++GTA AD    LW+ + G C + Y GH GSVNS++F     + LTASGD TAH+    V LP P+ +++   S E  +   +D                  + P  DG  S+           P       SL S  G           A+D+L+   Q VTASWDR   +YD+ T   V SLTGHD  LT   T+P     L VT+SRD TFRLWDFR  S   V+V QGH   V+S  F VG++   +VS   DR  KVWDL+N R+P+  IRTDS INR+ V    KI+ALP DNR V++FD++ G R+ARLPR+S Q H R+V   AW+ D    P  N FT GFD+Q I W++ +P L
Sbjct:   45 GQDSKLPSSVRSTLLELFGQIEREFEN----LYIENLEL---RREIDTLNERLAAEGQAIDGAELSKGQLKTKASHSTSQLSQKLKTTYK---ASTSKIVSSFKTTTSRAACQLVKEYIGHRDGIWDVSVAKTQPVVLGTASADHTALLWSIETGKCLVKYAGHVGSVNSIKFHPSEQLALTASGDQTAHIWRYAVQLPTPQPVADTSISGE-DEVECSDK-----------------DEPDLDGDVSSDC---------PTIRVPLTSLKSHQGVVI--------ASDWLVGGKQAVTASWDRTANLYDVETSELVHSLTGHDQELTHCCTHPT--QRLVVTSSRDTTFRLWDFRDPSIHSVNVFQGHTDTVTSAVFTVGDN---VVSGSDDRTVKVWDLKNMRSPIATIRTDSAINRINVCVGQKIIALPHDNRQVRLFDMS-GVRLARLPRSSRQGHRRMVCCSAWSED---HPVCNLFTCGFDRQAIGWNINIPAL 490          
BLAST of WD repeat-containing protein 37 vs. UniProt/SwissProt
Match: sp|A4IIX9|WDR37_XENTR (WD repeat-containing protein 37 OS=Xenopus tropicalis OX=8364 GN=wdr37 PE=2 SV=1)

HSP 1 Score: 249.98 bits (637), Expect = 6.271e-74
Identity = 183/498 (36.75%), Postives = 259/498 (52.01%), Query Frame = 1
Query:  346 GDDGILSQEFKQRLWALFRQIESEFEKECKKIYSENYAIHDRNEKIESSDHEESNFAKKISGSHLXXXXXXXXXX--XXXXXXRLVSTFRDRGSTMPNISNQSHQGSNRHACILCWRVSDHRDGIWEVNCIGRG--LVGTACADGVVRLWNSDNGHCSLVYLGHSGSVNSVRF--KNGIMLTASGDGTAH----LVNLP-PEKISEALSSNEPGKSSVTDSIGHXXXXXXXXXTKRNINSPTEDGAESNPVENTTLILRNPNSMYQTASLYSSFGSYTYKDSAPLSAADFLLNRDQIVTASWDRLGRIYDIATGSEVASLTGHDLPLTDVRTNPVADHALAVTASRDCTFRLWDFR-CSTTEVHVQQGHNGIVSSVSF-VGNSPEKLVSAGADRACKVWDLRNSRNPLHVIRTDSPINRLAVHPNGKIVALPMDNRIVKIFDLNLGTRIARLPRNSNQSHNRIVTSIAWNVDGGGKPNFFTTGFDQQLIAWHLQLPLL 1800
            G D  L    +  L  LF QIE EFE     +Y EN  +     +I++ +   +   + I G+ LS+   +      + Q + +L +T++   ++   I +     ++R  C L      HRDG+W+V+       ++GTA AD    LW+ + G C + Y+GH+GSVNS++F     I LTASGD TAH    +V LP P+  ++   S E                  VD + ++ N    D +   P     L            +L S  G         + AAD+L+   Q VTASWDR   +YD+ T   V SLTGHD  LT   T+P     L VT+SRD TFRLWDFR  S   V+V QGH   V+S  F VG++   +VS   DR  KVWDL+N R+P+  IRTDS INR++V    +I+ALP DNR V++FD++ G R+ARLPR++ Q H R+V   AW+ D     N FT GFD+Q I W++ +P L
Sbjct:   45 GQDSKLPSSVRNTLLELFGQIEREFEN----LYLENLEL---RREIDTLNDRLAVEGQAIDGAELSKGQMKTKASHSTSQLSQKLKTTYK---ASTSKIVSSFKTTTSRAICQLVKDYVGHRDGLWDVSVTRTQPVVLGTASADHTALLWSIETGKCLIKYVGHAGSVNSIKFHPTEQIALTASGDQTAHIWRYMVQLPTPQPTADTSISGE----------------EEVDFSDKDENDGDGDASSDCPTVRVPL-----------TALKSHQGV--------VIAADWLVGGKQAVTASWDRTANLYDVETSELVHSLTGHDQELTHCCTHPT--QRLVVTSSRDTTFRLWDFRDPSIHSVNVFQGHTDTVTSAVFTVGDN---VVSGSDDRTVKVWDLKNMRSPIATIRTDSAINRISVSVGQRIIALPHDNRQVRLFDMS-GVRLARLPRSNRQGHRRMVCCCAWSED-HPTCNLFTCGFDRQAIGWNINIPAL 490          
BLAST of WD repeat-containing protein 37 vs. UniProt/SwissProt
Match: sp|Q6DDF0|WDR37_XENLA (WD repeat-containing protein 37 OS=Xenopus laevis OX=8355 GN=wdr37 PE=2 SV=1)

HSP 1 Score: 248.054 bits (632), Expect = 3.047e-73
Identity = 181/498 (36.35%), Postives = 261/498 (52.41%), Query Frame = 1
Query:  346 GDDGILSQEFKQRLWALFRQIESEFEKECKKIYSENYAIHDRNEKIESSDHEESNFAKKISGSHLXXXXXXXXXX--XXXXXXRLVSTFRDRGSTMPNISNQSHQGSNRHACILCWRVSDHRDGIWEVNCIGRG--LVGTACADGVVRLWNSDNGHCSLVYLGHSGSVNSVRF--KNGIMLTASGDGTAH----LVNLP-PEKISEALSSNEPGKSSVTDSIGHXXXXXXXXXTKRNINSPTEDGAESNPVENTTLILRNPNSMYQTASLYSSFGSYTYKDSAPLSAADFLLNRDQIVTASWDRLGRIYDIATGSEVASLTGHDLPLTDVRTNPVADHALAVTASRDCTFRLWDFR-CSTTEVHVQQGHNGIVSSVSF-VGNSPEKLVSAGADRACKVWDLRNSRNPLHVIRTDSPINRLAVHPNGKIVALPMDNRIVKIFDLNLGTRIARLPRNSNQSHNRIVTSIAWNVDGGGKPNFFTTGFDQQLIAWHLQLPLL 1800
            G D  L    +  L  LF QIE EFE     +Y EN  +     +I++ +   +   + I G+ LS+   +      + Q + +L +T++   ++   I +     ++R  C L      HRDG+W+V+       ++GTA AD    LW+ + G C + Y+GH+GSVNS++F     I LTASGD TAH    +V LP P+ +++  +S   G+  V  S              ++ N    D +   P     L            +L S  G         + AAD+L+   Q VTASWDR   +YD+ T   V SLTGHD  LT   T+P     L VT+SRD TFRLWDFR  S   V+V QGH   V+S  F VG++   +VS   DR  KVWDL+N R+P+  IRTDS +NR++V    +I+ALP DNR V++FD++ G R+ARLPR++ Q H R+V   AW+ D     N F+ GFD+Q I W++ +P L
Sbjct:   45 GQDSKLPPSVRNTLLELFGQIEREFEN----LYLENLEL---RREIDTLNDRLAVEGQAIDGAELSKGQMKTKASHSTSQLSQKLKTTYK---ASTSKIVSSFKTTTSRAICQLVKDYVGHRDGLWDVSVTRTQPVVLGTASADHTALLWSIETGKCLIKYVGHAGSVNSIKFHPTEQIALTASGDQTAHIWRYMVQLPTPQPMAD--TSQISGEEEVDFS-------------DKDENDGDGDASSDCPTVRVPL-----------TALKSHQGV--------VIAADWLVGGKQAVTASWDRTANLYDVETSELVHSLTGHDQELTHCCTHPT--QRLVVTSSRDTTFRLWDFRDPSIHSVNVFQGHTDTVTSAVFTVGDN---VVSGSDDRTVKVWDLKNMRSPIATIRTDSAVNRISVSVGQRIIALPHDNRQVRLFDIS-GVRLARLPRSNRQGHRRMVCCCAWSED-HPTCNLFSCGFDRQAIGWNINIPAL 491          
BLAST of WD repeat-containing protein 37 vs. TrEMBL
Match: A0A0X3PLG9 (WD repeat-containing protein 37 (Fragment) OS=Schistocephalus solidus OX=70667 GN=WDR37 PE=4 SV=1)

HSP 1 Score: 362.073 bits (928), Expect = 2.696e-113
Identity = 240/574 (41.81%), Postives = 322/574 (56.10%), Query Frame = 1
Query:  352 DGILSQEFKQRLWALFRQIESEFEKECKKIYSENYAIHDRNEKIESSDH-EESNFAKKISGSHLXXXXXXXXXXXXXXXXRLVSTFRDRG-----------------------STMPNISNQSH------QGSNRHACILCWRVSDHRDGIWEVNCIGRGLVGTACADGVVRLW-NSDNGHCSLVYLGHSGSVNSVRFK--NGIMLTASGDGTAHLVNLPPE--KISEA--LSSNEPGKSSVTDSIGHXXXXXXXXXTKRNINSPTEDGAESNPVENTTLILRNPNSMYQTASLYSSFG----------SYTYKDSAPLSAADFLLNRDQIVTASWDRLGRIYDIATGSEVASLTGHDLPLTDVRTNPVADHALAVTASRDCTFRLWDFRCSTTEVHVQQGHNGIVSSVSFVGN-SPEKLVSAGADRACKVWDLRNSRNPLHVIRTDSPINRLAVHPNGK----------------------------------------------IVALPMDNRIVKIFDLNLGTRIARLPRNSNQSHNRIVTSIAWNVDGGGKPNFFTTGFDQQLIAWHLQL 1791
            D  L +E + R+  LF +IE EFE+E +K+ +ENYA+ ++ EK E  DH E SNF+KK++ S LS +IKQQYKQS     RLVST R  G                       STM + +N +        G NR +  L  R   HRDG+WEV    + LV TA AD  VRLW NS+  +C LVY GHSGSVNSVRF+  + +MLT SGDGTAHL+ LP +  ++S+A   S+ EP   +   +  H   + +   T    ++        N V +T +++R+P S++Q+A+L  SFG          +    +SAPL+AADFL  R+ +VTASWDRLGR+YD+ TG EV SLTGHD  LTDVR        + VT++RD TFRLWDFR    ++HVQQ H+  VS+  F+ +  P+ L+SAG DR C++WDLR  R+PL  IRTD+ INRLAV  +G                                               I ALP+DNR V+  D++ G+RI+R+ RNS Q H R +TS+AW   G G  + FT GFD QL+AW LQ+
Sbjct:   23 DSALPRELRNRIHNLFDRIEREFEREYQKLCAENYALQEKLEKFEEGDHNESSNFSKKLTASQLSHRIKQQYKQSTS---RLVSTLRPIGGVLALPAPTGGGSGSNASVGAGESTMRSSANTAATASWGAAGYNR-SWKLANRFVGHRDGLWEVTTF-QNLVATASADTTVRLWSNSELANCLLVYSGHSGSVNSVRFRAADQLMLTCSGDGTAHLIRLPQKFFEVSQAGETSAVEPSNDTPAANKSHPSAEPLPSLTASQHDTEANADVPGNSVASTPMVIRDPTSVFQSATL--SFGDGGNSTSLALAEGVVESAPLAAADFLSGRNHLVTASWDRLGRLYDVNTGQEVHSLTGHDHQLTDVRC--AEQLPVVVTSARDSTFRLWDFRTPRLQIHVQQAHSRTVSTAQFLPSCPPDLLISAGTDRICRLWDLRKCRSPLFTIRTDAGINRLAVLQSGALLDARRRTSLPSTVADTSTALSAPDLVPSTSTSSAAAAASATALSCIFALPLDNRTVRFIDIS-GSRISRISRNSAQGHTRAITSVAWA--GTGAYDLFTAGFDHQLLAWQLQI 584          
BLAST of WD repeat-containing protein 37 vs. TrEMBL
Match: A0A158QVL1 (Uncharacterized protein OS=Mesocestoides corti OX=53468 GN=MCOS_LOCUS8109 PE=4 SV=1)

HSP 1 Score: 344.354 bits (882), Expect = 7.340e-107
Identity = 237/561 (42.25%), Postives = 324/561 (57.75%), Query Frame = 1
Query:  298 AGITSFCAPQSCTNPL-------GDDGILSQEFKQRLWALFRQIESEFEKECKKIYSENYAIHDRNEKIESSDHEESN-FAKKISGSHLXXXXXXXXXXXXXXXXRLVSTFRDRGSTMPNISNQSHQGSNRHACIL-CWRV----SDHRDGIWEVNCIGRGLVGTACADGVVRLWN-SDNGHCSLVYLGHSGSVNSVRFKN--GIMLTASGDGTAHLVNLPP---EKISEALSSNEPGKSSVTDSIGHXXXXXXXXXTKRNINSPTE-DGAESNPVENTTLILRNPNSMYQTASLYSSFGS--------YTYKDSAPLSAADFLLNRDQIVTASWDRLGRIYDIATGSEVASLTGHDLPLTDVRTNPVADHALAVTASRDCTFRLWDFRCSTTEVHVQQGHNGIVSSVSFV-GNSPEKLVSAGADRACKVWDLRNSRNPLHVIRTDSPINRLAVHPNGK----------------------------------IVALPMDNRIVKIFDLNLGTRIARLPRNSNQSHNRIVTSIAWNVDGGGKPNFFTTGFDQQLIAWHLQL 1791
            + +TS C      N         G +  L ++F+ RL  +F +IE EFE+E +K+ +ENYA+ ++ EK E  +H ESN F+KK+  S LS ++K QYKQS     RLVS+FR     +   ++ +  GSN        W+     + HRDGIWEV C  R LV TA AD  VR+WN S   +C LVY GHSGSVNSVRF+    +MLT SGDGTAHL++LPP   E  ++  S+ +P + +  D    ++    +D T   I++    DG+   PV     +LR+P++++Q+ASL+ S  S         +  DS PL+AADFL  RDQ+VTASWDRLGR+YD+ TG E+ SL GHD  LTDVR    ++  + VT++RD TFR+WDFR    EVHVQQ H+  VS+  F+ G S   +VSAG DR+C++WDLRN R+P+  IRTD+ INRLA+   G                                   I ALP+DNR V++   N G+RI R+PRN    H  ++TS  W  +  G  N FT+GFDQQL+ W LQ+
Sbjct:    6 SAVTSVCTASQTDNDFLAEFALDGSESALPRDFRNRLHKMFERIEREFEREYQKLCAENYALQEKLEKFEDVEHPESNIFSKKLMASQLSHRLKLQYKQSTS---RLVSSFRPVSGGLSLTASGTGPGSNPDPSRSGSWKFIHSFTGHRDGIWEVTCF-RNLVATASADATVRVWNNSKFANCLLVYSGHSGSVNSVRFRERGNLMLTCSGDGTAHLIHLPPVFFEDAAQHPSACQPPQGACAD----LETGNQLDATSGGIDTDAPIDGSLHTPV-----LLRDPSAVFQSASLFPSEVSPSGVICEGSSSLDSLPLAAADFLSGRDQLVTASWDRLGRLYDLNTGQEIQSLAGHDHELTDVRCCRDSNLPVVVTSARDSTFRVWDFRQPRLEVHVQQAHSRPVSTAQFLSGRSFYHVVSAGTDRSCRLWDLRNLRSPIFTIRTDASINRLAISRAGALQRKWGAAPPANEASTTSAPTTTPADAPPTAMPCIFALPLDNRTVRLVAAN-GSRIGRIPRNIAYGHTSVITSAEWADE--GLCNLFTSGFDQQLLGWQLQI 550          
BLAST of WD repeat-containing protein 37 vs. TrEMBL
Match: A0A5K3F3Q1 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 343.969 bits (881), Expect = 5.303e-106
Identity = 237/561 (42.25%), Postives = 324/561 (57.75%), Query Frame = 1
Query:  298 AGITSFCAPQSCTNPL-------GDDGILSQEFKQRLWALFRQIESEFEKECKKIYSENYAIHDRNEKIESSDHEESN-FAKKISGSHLXXXXXXXXXXXXXXXXRLVSTFRDRGSTMPNISNQSHQGSNRHACIL-CWRV----SDHRDGIWEVNCIGRGLVGTACADGVVRLWN-SDNGHCSLVYLGHSGSVNSVRFKN--GIMLTASGDGTAHLVNLPP---EKISEALSSNEPGKSSVTDSIGHXXXXXXXXXTKRNINSPTE-DGAESNPVENTTLILRNPNSMYQTASLYSSFGS--------YTYKDSAPLSAADFLLNRDQIVTASWDRLGRIYDIATGSEVASLTGHDLPLTDVRTNPVADHALAVTASRDCTFRLWDFRCSTTEVHVQQGHNGIVSSVSFV-GNSPEKLVSAGADRACKVWDLRNSRNPLHVIRTDSPINRLAVHPNGK----------------------------------IVALPMDNRIVKIFDLNLGTRIARLPRNSNQSHNRIVTSIAWNVDGGGKPNFFTTGFDQQLIAWHLQL 1791
            + +TS C      N         G +  L ++F+ RL  +F +IE EFE+E +K+ +ENYA+ ++ EK E  +H ESN F+KK+  S LS ++K QYKQS     RLVS+FR     +   ++ +  GSN        W+     + HRDGIWEV C  R LV TA AD  VR+WN S   +C LVY GHSGSVNSVRF+    +MLT SGDGTAHL++LPP   E  ++  S+ +P + +  D    ++    +D T   I++    DG+   PV     +LR+P++++Q+ASL+ S  S         +  DS PL+AADFL  RDQ+VTASWDRLGR+YD+ TG E+ SL GHD  LTDVR    ++  + VT++RD TFR+WDFR    EVHVQQ H+  VS+  F+ G S   +VSAG DR+C++WDLRN R+P+  IRTD+ INRLA+   G                                   I ALP+DNR V++   N G+RI R+PRN    H  ++TS  W  +  G  N FT+GFDQQL+ W LQ+
Sbjct:   68 SAVTSVCTASQTDNDFLAEFALDGSESALPRDFRNRLHKMFERIEREFEREYQKLCAENYALQEKLEKFEDVEHPESNIFSKKLMASQLSHRLKLQYKQSTS---RLVSSFRPVSGGLSLTASGTGPGSNPDPSRSGSWKFIHSFTGHRDGIWEVTCF-RNLVATASADATVRVWNNSKFANCLLVYSGHSGSVNSVRFRERGNLMLTCSGDGTAHLIHLPPVFFEDAAQHPSACQPPQGACAD----LETGNQLDATSGGIDTDAPIDGSLHTPV-----LLRDPSAVFQSASLFPSEVSPSGVICEGSSSLDSLPLAAADFLSGRDQLVTASWDRLGRLYDLNTGQEIQSLAGHDHELTDVRCCRDSNLPVVVTSARDSTFRVWDFRQPRLEVHVQQAHSRPVSTAQFLSGRSFYHVVSAGTDRSCRLWDLRNLRSPIFTIRTDASINRLAISRAGALQRKWGAAPPANEASTTSAPTTTPADAPPTAMPCIFALPLDNRTVRLVAAN-GSRIGRIPRNIAYGHTSVITSAEWADE--GLCNLFTSGFDQQLLGWQLQI 612          
BLAST of WD repeat-containing protein 37 vs. TrEMBL
Match: A0A0R3X322 (Uncharacterized protein OS=Hydatigena taeniaeformis OX=6205 GN=TTAC_LOCUS7705 PE=4 SV=1)

HSP 1 Score: 333.183 bits (853), Expect = 2.127e-102
Identity = 227/576 (39.41%), Postives = 324/576 (56.25%), Query Frame = 1
Query:  298 AGITSFCAPQSC-------TNPLGDDGILSQEFKQRLWALFRQIESEFEKECKKIYSENYAIHDRNEKIESSDHEESN-FAKKISGSHLXXXXXXXXXXXXXXXXRLVSTFRDRGSTMPNISNQSHQGSNR-HACILCWRVSDHRDGIWEVNCIGRGLVGTACADGVVRLWNSDNGH-CSLVYLGHSGSVNSVRFKN--GIMLTASGDGTAHLVNLPPEKISEALSSNEPGKSSVTDSIGHXXXXXXXXXTKRNINSPTEDGAESNPVENTTLILRNPNSMYQTASLYSSFG--------------SYTYKDSAPLSAADFLLNRDQIVTASWDRLGRIYDIATGSEVASLTGHDLPLTDVRTNPVADHALAVTASRDCTFRLWDFRCSTTEVHVQQGHNGIVSSVSFV-GNSPEKLVSAGADRACKVWDLRNSRNPLHVIRTDSPINRLAVHPNGK---------------------------------------------------IVALPMDNRIVKIFDLNLGTRIARLPRNSNQSHNRIVTSIAWNVDGGGKPNFFTTGFDQQLIAWHLQL 1791
            AGI+S CA           T P   +  L +EF+ RL  +F ++E EFE+E +K+ +ENYA+ ++ EK E ++H ES+ F +K++ S LS +IKQQYKQS     RLVS+ R     +   S  S+  S+R  +     R + HRDG+WEV C    L+ TA AD  VRLWN+   H C L+Y GHSGSVNSVRF++   +MLT SGDGTAHL+ LP   + EA++       +V  + G +D+    + T   I + ++      PV+     LR+P++++Q+ASL+ +                S +  DS PL+AADF+  R+Q++TASWDRLG +YD+ TG EV SL GHD  LTDVR    ++  +  T++RD TFR+WDFR    EVHVQQ H+  VS+  F+ G+ P+++VSAG DR C++WDLR+ R+P+  +RTD+ INRLA+   G                                                    ++ALP+DNR +++   N G+RI R+PRN    H   +TS AW  +  G+ N FTTGFDQQL+ W LQ+
Sbjct:    6 AGISSACAASQTDGDWPIFTAPDVSESTLPREFRSRLHKMFERVEREFEREYQKLCAENYALQEKLEKFEDAEHPESSLFTRKLTASQLSHRIKQQYKQSTS---RLVSSLRPASGGLALPSPGSNPDSSRCGSWKFVHRFTGHRDGVWEVTCF-HNLIATASADATVRLWNNSERHNCLLIYSGHSGSVNSVRFRDRDNLMLTCSGDGTAHLIALP-SALFEAVAPAH----AVQGASGDLDNGHQSEGTNTGIEADSQAEGVQLPVQ-----LRDPSAVFQSASLFVAEAGVVGGISSGLLACDSVSSLDSYPLAAADFVCGREQLITASWDRLGHLYDLNTGQEVQSLAGHDRELTDVRCCWDSNLPVVATSARDSTFRVWDFRQPRLEVHVQQAHSRTVSTAQFLPGSGPDQIVSAGTDRCCRLWDLRSLRSPIFTVRTDASINRLAISRAGLLQYRQAVAVSGFAAQSGGEGWSAGCSTGVVGGTGGNTTAPTLGTDAVTHSCVLALPLDNRTLRLLAAN-GSRIGRIPRNIAHGHTSAITSAAWATE--GQCNLFTTGFDQQLLGWQLQI 564          
BLAST of WD repeat-containing protein 37 vs. TrEMBL
Match: A0A0R3W5I0 (Uncharacterized protein OS=Taenia asiatica OX=60517 GN=TASK_LOCUS5378 PE=4 SV=1)

HSP 1 Score: 328.561 bits (841), Expect = 1.476e-100
Identity = 225/583 (38.59%), Postives = 318/583 (54.55%), Query Frame = 1
Query:  298 AGITSFCAPQSC-------TNPLGDDGILSQEFKQRLWALFRQIESEFEKECKKIYSENYAIHDRNEKIESSDHEESN-FAKKISGSHLXXXXXXXXXXXXXXXXRLVSTFRDRGSTMPNISNQSHQGSNR-HACILCWRVSDHRDGIWEVNCIGRGLVGTACADGVVRLWNSDNGH-CSLVYLGHSGSVNSVRFKN--GIMLTASGDGTAHLVNLPPEKISEALSSNEPGKSSVTDSIGHXXXXXXXXXTKRNINSPTEDGAESNPVENTTLILRNPNSMYQTASLYSSFG--------------SYTYKDSAPLSAADFLLNRDQIVTASWDRLGRIYDIATGSEVASLTGHDLPLTDVRTNPVADHALAVTASRDCTFRLWDFRCSTTEVHVQQGHNGIVSSVSFV-GNSPEKLVSAGADRACKVWDLRNSRNPLHVIRTDSPINRLAV--------------------------HPNGKIVALP--------------------------------MDNRIVKIFDLNLGTRIARLPRNSNQSHNRIVTSIAWNVDGGGKPNFFTTGFDQQLIAWHLQL 1791
            AG++S CA           T P   +  L +EF+ RL  +F ++E EFE+E +K+ +ENYA+ ++ EK E ++H ES+ F +K++ S LS +IKQQYKQS     RLVS+ R     +   S  S+  S+R  +     R + HRDG+WE  C    L+ TA AD  VRLWN+   H C L+Y GHSGSVNSVRF++   +MLT SGDGTAHL+ LPP        ++    +S     GH              N+  E  +++  V+   + LRNP++++Q+ASL+ +                S +  DS PL+AADF+  R+Q+VTASWDRLG +YD++TG EV SL GHD  LTDVR    ++  + VT++RD TFR+WDFR    EVHVQQ H+  VS+  F+ G+ P+++VSAG DR C++WDLR+ R+P+  +RTD+ INRLA+                             G + A P                                +DNR +++   N G+RI R+PRN    H   +TS AW  +  G+ N FTTGFDQQL+ W LQ+
Sbjct:    6 AGVSSVCAASQTDGEWPVITAPDIPESTLPREFRSRLHKMFERVEREFEREYQKLCAENYALQEKLEKFEDAEHPESSIFTRKLTASQLSHRIKQQYKQSTS---RLVSSLRPASGGLALPSPGSNPDSSRCGSWKFVHRFTGHRDGVWEATCF-HSLIATASADTTVRLWNNSERHNCLLIYSGHSGSVNSVRFRDRDNLMLTCSGDGTAHLIALPPALFDAVAPAHSIQGASGDLDNGHQ---------SEGTNTGAEADSQTEGVQ-PPMQLRNPSAVFQSASLFVAEAGIVGGMSSGLLACDSASSLDSYPLAAADFVCGREQLVTASWDRLGHLYDLSTGQEVQSLAGHDRELTDVRCCWDSNLPVVVTSARDSTFRVWDFRQPRLEVHVQQAHSRTVSTAQFLPGSGPDQIVSAGTDRCCRLWDLRSLRSPIFTVRTDASINRLAISRAGLLQYRQAVAGSGFASQSGGEGWSAGGSVAAAPMVMGVVGGAGGNAIASTLGADAIAHSCVLALPLDNRTLRLLAAN-GSRIGRIPRNIAHGHTSAITSAAWAPE--GQCNLFTTGFDQQLLGWQLQI 571          
BLAST of WD repeat-containing protein 37 vs. Ensembl Cavefish
Match: wdr37 (WD repeat domain 37 [Source:ZFIN;Acc:ZDB-GENE-030131-8101])

HSP 1 Score: 188.734 bits (478), Expect = 4.918e-53
Identity = 160/499 (32.06%), Postives = 221/499 (44.29%), Query Frame = 1
Query:  352 DGILSQEFKQRLWALFRQIESEFEKECKKIYSENYAIHDRNEKIESSDHEESNFAKKISGSHLXXXXXXXXXX--XXXXXXRLVSTFRDRGSTMPNISNQSHQGSNRHACILCWRVSDHRDGIWEVNCIGRG--LVGTACADGVVRLWNSDNGHCSLVYLGHSGSVNSVRF--KNGIMLTASGDGTAH----LVNLP----PEKISEALSSNEPGKSSVTDSIGHXXXXXXXXXTKRNINSPTEDGAESNPVENTTLILRNPNSMYQTASLYSSFGSYTYKDSAPLSAADFLLNRDQIVTASWDRLGRIYDIATGSEVASLTGHDLPLTDVRTNPVADHALAVTASRDCTFRLWDFR-CSTTEVHVQQGHNGIVSSVSF-VGNSPEKLVSAGADRACKVWDLRNSRNPLHVIRTDSPINRLAVHPNGKIVALPMDNRIVKIFDLNLGTRIARLPRNSNQSHNRIVTSIAWNVDGGGKPNFFTTGFDQQLIAWHLQLPLL 1800
            D  L    +  L  LF QIE EFE     +Y EN  +     +IES +   +   + + G  L++   +      + Q + +L +T++   ++   I +     ++R  C L      HRDGIW+++       ++GTA AD    LW+ + G C L Y GH+GSVNS++F     + LTASGD TAH    +V LP    P  IS +L  +                           +    DG    P E        P     T +L S  G         + AAD+L+   Q+VTASWDR   +YD+ T   V +LTGHD  LT   T+P     L VT+SRD TFRLWDFR  S   V+V QGH   V+S  F VG++   +VS   DR  KVWDL+N R+P+  IRTDS                                            H R+V   AWN +     N FT GFD+Q I W++ +P L
Sbjct:    1 DSKLPMALRSNLLDLFGQIEREFEN----LYLENIEL---RREIESLNERLAGEGQTVDGGDLTKGALKTKASHSTSQLSQKLKTTYK---ASTSKIVSSFKATTSRAVCQLVKEYVGHRDGIWDLSVTRTQPLVLGTASADHCAMLWSIETGKCLLKYAGHAGSVNSIKFHPTEQMALTASGDQTAHIWRYMVQLPLPQPPADISASLDDD-----------------------VDFSDKDEADGEADGPNEC-------PTVRVATTTLKSHQGV--------VIAADWLVGGKQVVTASWDRAANLYDVETSELVHTLTGHDQELTHCCTHPT--QRLVVTSSRDTTFRLWDFRDPSIHSVNVFQGHTDTVTSAVFTVGDN---VVSGSDDRTVKVWDLKNMRSPIATIRTDSA------------------------------------------GHRRMVCCSAWNEENQA-CNLFTCGFDRQAIGWNINIPAL 403          
BLAST of WD repeat-containing protein 37 vs. Ensembl Cavefish
Match: ENSAMXT00000007662.2 (receptor of activated protein C kinase 1 [Source:NCBI gene;Acc:103033914])

HSP 1 Score: 67.3958 bits (163), Expect = 7.775e-12
Identity = 47/154 (30.52%), Postives = 74/154 (48.05%), Query Frame = 1
Query: 1204 VTASWDRLGRIYDIATGSEVASLTGHDLPLTDVRTNPVADHALAVTASRDCTFRLWDFRCSTTEVHVQQGHNGIVSSVSFVGNSPEKL-VSAGADRACKVWDLRNSRNPLHVIRTDSPINRLAVHPNGKIVALPMDNRIVKIFDLNLGTRIARL 1662
            ++ SWD   R++D+ TG+      GH   +  V  +  AD+   V+ SRD T +LW+           +GH+  VS V F  NS   + VS G D+  KVW+L N +   + I     +N + V P+G + A    +    ++DLN G  +  L
Sbjct:   79 LSGSWDGTLRLWDLTTGTTTRRFVGHTKDVLSVAFS--ADNRQIVSGSRDKTIKLWNTLGVCKYTIQDEGHSEWVSCVRFSPNSSNPIIVSCGWDKMVKVWNLANCKLKTNHIGHTGFLNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTL 230          
BLAST of WD repeat-containing protein 37 vs. Ensembl Cavefish
Match: ENSAMXT00000047239.1 (receptor of activated protein C kinase 1 [Source:NCBI gene;Acc:103033914])

HSP 1 Score: 67.3958 bits (163), Expect = 9.022e-12
Identity = 47/154 (30.52%), Postives = 74/154 (48.05%), Query Frame = 1
Query: 1204 VTASWDRLGRIYDIATGSEVASLTGHDLPLTDVRTNPVADHALAVTASRDCTFRLWDFRCSTTEVHVQQGHNGIVSSVSFVGNSPEKL-VSAGADRACKVWDLRNSRNPLHVIRTDSPINRLAVHPNGKIVALPMDNRIVKIFDLNLGTRIARL 1662
            ++ SWD   R++D+ TG+      GH   +  V  +  AD+   V+ SRD T +LW+           +GH+  VS V F  NS   + VS G D+  KVW+L N +   + I     +N + V P+G + A    +    ++DLN G  +  L
Sbjct:   79 LSGSWDGTLRLWDLTTGTTTRRFVGHTKDVLSVAFS--ADNRQIVSGSRDKTIKLWNTLGVCKYTIQDEGHSEWVSCVRFSPNSSNPIIVSCGWDKMVKVWNLANCKLKTNHIGHTGFLNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTL 230          
BLAST of WD repeat-containing protein 37 vs. Ensembl Cavefish
Match: ENSAMXT00000032472.1 (receptor of activated protein C kinase 1 [Source:NCBI gene;Acc:103033914])

HSP 1 Score: 65.0846 bits (157), Expect = 2.207e-11
Identity = 45/157 (28.66%), Postives = 76/157 (48.41%), Query Frame = 1
Query: 1204 VTASWDRLGRIYDIATGSEVASLTGHDLPLTDVRTNPVADHALAVTASRDCTFRLWDFRCSTTEVHVQQGHNGIVSSVSFVGNSPEKL-VSAGADRACKVWDLRNSRNPLHVIRTDSPINRLAVHPNGKIVA-------LPMDNRIVKIFDLNLGTR 1650
            ++ SWD   R++D+ TG+      GH   +  V  +  AD+   V+ SRD T +LW+           +GH+  VS V F  NS   + VS G D+  KVW+L N +   + I     +N + V P+G + A           + +++++ + +GTR
Sbjct:   79 LSGSWDGTLRLWDLTTGTTTRRFVGHTKDVLSVAFS--ADNRQIVSGSRDKTIKLWNTLGVCKYTIQDEGHSEWVSCVRFSPNSSNPIIVSCGWDKMVKVWNLANCKLKTNHIGHTGFLNTVTVSPDGSLCASGGKTLFAGYTDNLIRVWQVTIGTR 233          
BLAST of WD repeat-containing protein 37 vs. Ensembl Cavefish
Match: taf5l (TATA-box binding protein associated factor 5 like [Source:NCBI gene;Acc:103041723])

HSP 1 Score: 67.3958 bits (163), Expect = 3.194e-11
Identity = 53/189 (28.04%), Postives = 89/189 (47.09%), Query Frame = 1
Query: 1162 PLSAADFLLNRDQIVTASWDRLGRIYDIATGSEVASLTGHDLPLTDVRTNPVADHALAVTASRDCTFRLWDFRCSTTEVHVQQGHNGIVSSVSFVGNSPEKLVSAGADRACKVWDLRNSRNPLHVIRTDSPINRLAVHPNGKIVALPMDNRIVKIFDLNLGTRIARLPRNSNQSHNRIVTSIAWNVDGG 1728
            P+    FL +   +++ S D   R +D+ + + VA   GH  P+ DV  +P + +    TAS+D T RLW F+  T  + +  GH   V  V F  NS   + +   D+  ++W  +   +         P+  LA  PNGK +A   +++ VK++DL  GT    L     + H   V S++++ D  
Sbjct:  356 PVYRTAFLTDSSGLLSCSEDSTVRYWDLNSFTNVALYRGHAYPVWDVDVSPCSLYF--CTASQDRTARLWTFQ-RTYPLRLYAGHLADVDCVKFHPNS-NYIATGSTDKTVRLWSTQQGSSVRLFTGHRGPVLSLAFSPNGKYLASAGEDQRVKLWDLASGTLFKDL-----RGHTDSVMSLSFSPDSA 535          

HSP 2 Score: 49.6766 bits (117), Expect = 8.740e-6
Identity = 38/119 (31.93%), Postives = 56/119 (47.06%), Query Frame = 1
Query: 1159 APLSAADFLLNRDQIVTASWDRLGRIYDIATGSEVASLTGHDLPLTDVRTNPVADHALAVTASRDCTFRLWDFRCSTTEVHVQQGHNGIVSSVSFVGNSPEKLVSAGADRACKVWDLRN 1515
            A +    F  N + I T S D+  R++    GS V   TGH  P+  +  +P   +    +A  D   +LWD   S T     +GH   V S+SF  +S   + SA  D + +VWD+RN
Sbjct:  439 ADVDCVKFHPNSNYIATGSTDKTVRLWSTQQGSSVRLFTGHRGPVLSLAFSPNGKYL--ASAGEDQRVKLWDL-ASGTLFKDLRGHTDSVMSLSFSPDSA-LVASAALDNSVRVWDIRN 553          
BLAST of WD repeat-containing protein 37 vs. Ensembl Sea Lamprey
Match: wdr37 (WD repeat domain 37 [Source:ZFIN;Acc:ZDB-GENE-030131-8101])

HSP 1 Score: 260.381 bits (664), Expect = 2.161e-79
Identity = 182/500 (36.40%), Postives = 261/500 (52.20%), Query Frame = 1
Query:  346 GDDGILSQEFKQRLWALFRQIESEFEKECKKIYSENYAIHDRNEKIESSDHEESNFAKKISGSHLXXXXXXXXX--XXXXXXXRLVSTFRDRGSTMPNISNQSHQGSNRHACILCWRVSDHRDGIWEVNC--IGRGLVGTACADGVVRLWNSDNGHCSLVYLGHSGSVNSVRF--KNGIMLTASGDGTAH----LVNLPPEKISEALSSNEPGKSSVTDSIGHXXXXXXXXXTKRNINSPTEDGAE----SNPVENTTLILRNPNSMYQTASLYSSFGSYTYKDSAPLSAADFLLNRDQIVTASWDRLGRIYDIATGSEVASLTGHDLPLTDVRTNPVADHALAVTASRDCTFRLWDFR-CSTTEVHVQQGHNGIVSSVSFVGNSPEKLVSAGADRACKVWDLRNSRNPLHVIRTDSPINRLAVHPNGKIVALPMDNRIVKIFDLNLGTRIARLPRNSNQSHNRIVTSIAWNVDGGGKPNFFTTGFDQQLIAWHLQLPLL 1800
            G D  L    +Q L  LF QIE EFE     +Y EN  +    ++I+S +   ++      GS LS+ + +      + Q + +L +T++   ++   I +     + R  C L    + HRDG+W+V    I   ++GTA AD    LW+ + G C L Y+GH+GSVNS++F   + + LTASGD +AH    LV LP  + S  + SN  G S                  +  +++  +D AE    +       L +R P +  +                  + AAD+L+   Q++TASWDR   +YD  T   + SLTGHD  LT   T+P     L VT+SRD TFRLWDFR  S   V+V QGH   V+S  F   S E +VS   DR  KVWDL+N R+P+  IRTDS +NRL+V P  KI+ALP DNR V++FD++ G R+ARLPR++ Q H R+V S  W+ +     N FT GFD+Q + W++    L
Sbjct:   50 GQDSRLPPAIRQTLLELFGQIEKEFEV----LYVENVEL---RKEIDSLNERLASEGAVTDGSELSKGVFKTKTGHSTSQLSQKLKTTYK---ASTSKIVSSFKATTTRAVCQLQKEYAGHRDGLWDVAATRIAPVVLGTASADHTAMLWSIETGKCILKYVGHAGSVNSIKFHPTDQLALTASGDHSAHVWRYLVQLPLTQTS--IDSNSRGPSG-----------------EDEVDASDKDEAEGLDAAEAASEAALTVRAPVTALK-------------GHQGVIIAADWLVGGKQLITASWDRTANVYDAETSELLHSLTGHDQELTHCSTHPA--QRLVVTSSRDTTFRLWDFRDPSIHSVNVFQGHTDTVTSAVFA--SSENVVSGSDDRTVKVWDLKNMRSPIATIRTDSAVNRLSVSPTHKIIALPHDNRHVRLFDMS-GVRLARLPRSNRQGHRRMVCSAVWS-EENSTCNLFTCGFDRQALGWNINTTAL 501          
BLAST of WD repeat-containing protein 37 vs. Ensembl Sea Lamprey
Match: wdr37 (WD repeat domain 37 [Source:ZFIN;Acc:ZDB-GENE-030131-8101])

HSP 1 Score: 259.61 bits (662), Expect = 3.557e-79
Identity = 181/495 (36.57%), Postives = 259/495 (52.32%), Query Frame = 1
Query:  346 GDDGILSQEFKQRLWALFRQIESEFEKECKKIYSENYAIHDRNEKIESSDHEESNFAKKISGSHLXXXXXXXXX--XXXXXXXRLVSTFRDRGSTMPNISNQSHQGSNRHACILCWRVSDHRDGIWEVNC--IGRGLVGTACADGVVRLWNSDNGHCSLVYLGHSGSVNSVRF--KNGIMLTASGDGTAH----LVNLPPEKISEALSSNEPGKSSVTDSIGHXXXXXXXXXTKRNINSPTEDGAE----SNPVENTTLILRNPNSMYQTASLYSSFGSYTYKDSAPLSAADFLLNRDQIVTASWDRLGRIYDIATGSEVASLTGHDLPLTDVRTNPVADHALAVTASRDCTFRLWDFR-CSTTEVHVQQGHNGIVSSVSFVGNSPEKLVSAGADRACKVWDLRNSRNPLHVIRTDSPINRLAVHPNGKIVALPMDNRIVKIFDLNLGTRIARLPRNSNQSHNRIVTSIAWNVDGGGKPNFFTTGFDQQLIAWHL 1785
            G D  L    +Q L  LF QIE EFE     +Y EN  +    ++I+S +   ++      GS LS+ + +      + Q + +L +T++   ++   I +     + R  C L    + HRDG+W+V    I   ++GTA AD    LW+ + G C L Y+GH+GSVNS++F   + + LTASGD +AH    LV LP  + S  + SN  G+  V                    ++  +D AE    +       L +R P +  +                  + AAD+L+   Q++TASWDR   +YD  T   + SLTGHD  LT   T+P     L VT+SRD TFRLWDFR  S   V+V QGH   V+S  F   S E +VS   DR  KVWDL+N R+P+  IRTDS +NRL+V P  KI+ALP DNR V++FD++ G R+ARLPR++ Q H R+V S  W+ +     N FT GFD+Q + W++
Sbjct:   50 GQDSRLPPAIRQTLLELFGQIEKEFEV----LYVENVEL---RKEIDSLNERLASEGAVTDGSELSKGVFKTKTGHSTSQLSQKLKTTYK---ASTSKIVSSFKATTTRAVCQLQKEYAGHRDGLWDVAATRIAPVVLGTASADHTAMLWSIETGKCILKYVGHAGSVNSIKFHPTDQLALTASGDHSAHVWRYLVQLPLTQTS--IDSNPSGEDEV--------------------DASDKDEAEGLDAAEAASEAALTVRAPVTALK-------------GHQGVIIAADWLVGGKQLITASWDRTANVYDAETSELLHSLTGHDQELTHCSTHPA--QRLVVTSSRDTTFRLWDFRDPSIHSVNVFQGHTDTVTSAVFA--SSENVVSGSDDRTVKVWDLKNMRSPIATIRTDSAVNRLSVSPTHKIIALPHDNRHVRLFDMS-GVRLARLPRSNRQGHRRMVCSAVWS-EENSTCNLFTCGFDRQALGWNI 493          
BLAST of WD repeat-containing protein 37 vs. Ensembl Sea Lamprey
Match: POC1A (POC1 centriolar protein A [Source:HGNC Symbol;Acc:HGNC:24488])

HSP 1 Score: 68.5514 bits (166), Expect = 1.712e-12
Identity = 58/209 (27.75%), Postives = 97/209 (46.41%), Query Frame = 1
Query: 1156 SAPLSAADFLLNRDQIVTASWDRLGRIYDIATGSEVASLTGHDLPLTDVRTNPVADHALAVTASRDCTFRLWDFRCSTTEVHVQQGHNGIVSSVSFVGNSPEKLVSAGADRACKVWDLRNSRNPLHVIRTDSPINRLAVHPNGKIVALPMDNRIVKIFDLNLGTRIARLPRNSNQSHNRIVTSIAWNVDGGGKPNFFTT-GFDQQLIAW 1779
            +A + +  F  +   +VTAS D+  +++ +     + SL  H   +   + +P  D  L V+ S D T R+WD   S   VH    H G V+ V F   S   + +AG D   KVWD+R ++   H     + +N L+ HP G  +    ++  +K+ DL  G     L       H    T++A++  G    +FF + G D+Q++ W
Sbjct:  102 TATVRSVSFSADGQSLVTASDDKSIKVWTVHRQKFLYSLNQHSNWVRSAKFSP--DGRLIVSGSDDRTVRVWDSN-SRECVHTFYEHGGFVNQVDF-HPSGTCIAAAGTDNTVKVWDIRMNKLLQHYQVHGAAVNSLSFHPTGNYLITASNDSTLKVLDLVEGRLFYTL-----HGHQGPATAVAFSRAG----DFFASGGSDEQVMVW 297          

HSP 2 Score: 61.6178 bits (148), Expect = 2.743e-10
Identity = 42/158 (26.58%), Postives = 75/158 (47.47%), Query Frame = 1
Query: 1165 LSAADFLLNRDQIVTASWDRLGRIYDIATGSEVASLTGHDLPLTDVRTNPVADHALAVTASRDCTFRLWDFRCSTTEVHVQQGHNGIVSSVSFVGNSPEKLVSAGADRACKVWDLRNSRNPLHVIRTDSPINRLAVHPNGKIVALPMDNRIVKIFDLN 1638
            +++ DF  N  Q+ + S D    +++    +      GH   +  V+ +P     L V+ASRD T RLW       E  V + H   V SVSF  +  + LV+A  D++ KVW +   +    + +  + +      P+G+++    D+R V+++D N
Sbjct:   21 ITSVDFNPNMKQLASGSMDACLMVWNFKPQTRAYRFVGHKDAVMSVQFSPSGH--LVVSASRDKTVRLW-VPSVKGESTVFKAHTATVRSVSFSADG-QSLVTASDDKSIKVWTVHRQKFLYSLNQHSNWVRSAKFSPDGRLIVSGSDDRTVRVWDSN 174          
BLAST of WD repeat-containing protein 37 vs. Ensembl Sea Lamprey
Match: pafah1b1b (platelet-activating factor acetylhydrolase 1b, regulatory subunit 1b [Source:NCBI gene;Acc:394247])

HSP 1 Score: 66.2402 bits (160), Expect = 5.546e-12
Identity = 54/227 (23.79%), Postives = 102/227 (44.93%), Query Frame = 1
Query: 1165 LSAADFLLNRDQIVTASWDRLGRIYDIATGSEVASLTGHDLPLTDVRTNPVADHALAVTASRDCTFRLWDFRCSTTEVHVQQGHNGIVSSVSFVGN--SPEKLVSAGA-----------------DRACKVWDLRNSRNPLHVIRTDSPINRLAVHPNGKIVALPMDNRIVKIFDLNLGTRIARLPRNSNQSHNRIVTSIAWNVDGGGKPNFFTTGFDQQLIAWHLQ 1788
            +S+  F+ N D +V+AS D+  +++++ TG  V + TGH   +  VR N   D +L  + S D T R+W       +  +++ H  +V  VS+  +  SP  L + GA                 D+  K+WD+      + ++  D+ +  +  HP GK +    D++ ++++D        +  + S  +H   VTS+ ++      P   T   DQ +  W  +
Sbjct:  134 VSSVAFMPNGDHLVSASRDKTMKMWEVQTGYCVKTFTGHREWVRMVRPN--QDGSLIASCSNDQTVRVWVTATKECKAELRE-HEHVVECVSWAPDAASPVILEATGAEAKKGGKPGPYLLSGSRDKTIKMWDISTGICVITLVGHDNWVRGVLFHPGGKFILSCADDKTLRVWDYK-----NKRCQKSLAAHEHFVTSLDFHKTA---PYVITGSVDQSVKVWECR 349          
BLAST of WD repeat-containing protein 37 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002506.1 (pep scaffold:Pmarinus_7.0:GL479076:26529:32136:-1 gene:ENSPMAG00000002224.1 transcript:ENSPMAT00000002506.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 65.855 bits (159), Expect = 7.160e-12
Identity = 46/154 (29.87%), Postives = 73/154 (47.40%), Query Frame = 1
Query: 1204 VTASWDRLGRIYDIATGSEVASLTGHDLPLTDVRTNPVADHALAVTASRDCTFRLWDFRCSTTEVHVQQGHNGIVSSVSFVGNSPEKL-VSAGADRACKVWDLRNSRNPLHVIRTDSPINRLAVHPNGKIVALPMDNRIVKIFDLNLGTRIARL 1662
            ++ SWD   R++D+ TG+      GH   +  V  +  AD+   V+ SRD T +LW+          + GH   VS V F  N+   + VS G D+  KVW+L N +   + I     +N + V P+G + A    +    ++DLN G  +  L
Sbjct:   79 LSGSWDGTLRLWDLTTGTTTRRFVGHTKDVLSVAFS--ADNRQIVSGSRDKTIKLWNTLGVCKYTIQEDGHTEWVSCVRFSPNNNNPIIVSCGWDKLVKVWNLTNCKLKTNHIGHTGYLNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTL 230          
BLAST of WD repeat-containing protein 37 vs. Ensembl Yeast
Match: ASC1 (G-protein beta subunit and guanine dissociation inhibitor for Gpa2p; ortholog of RACK1 that inhibits translation; core component of the small (40S) ribosomal subunit; required to prevent frameshifting at ribosomes stalled at repeated CGA codons; regulates P-body formation induced by replication stress; represses Gcn4p in the absence of amino acid starvation [Source:SGD;Acc:S000004722])

HSP 1 Score: 66.6254 bits (161), Expect = 2.483e-12
Identity = 43/138 (31.16%), Postives = 68/138 (49.28%), Query Frame = 1
Query: 1204 VTASWDRLGRIYDIATGSEVASLTGHDLPLTDVRTNPVADHALAVTASRDCTFRLWDFR--CSTTEVHVQQGHNGIVSSVSFVGNSPEK-----LVSAGADRACKVWDLRNSRNPLHVIRTDSPINRLAVHPNGKIVA 1596
            ++ASWD+  R++D+ATG       GH   +  V  +  A  ++ ++ SRD T ++W  +  C  T +    GHN  VS V  V N         ++SAG D+  K W+L   +     I  +S IN L   P+G ++A
Sbjct:   81 LSASWDKTLRLWDVATGETYQRFVGHKSDVMSVDIDKKA--SMIISGSRDKTIKVWTIKGQCLATLL----GHNDWVSQVRVVPNEKADDDSVTIISAGNDKMVKAWNLNQFQIEADFIGHNSNINTLTASPDGTLIA 212          
BLAST of WD repeat-containing protein 37 vs. Ensembl Yeast
Match: PRP4 (Splicing factor; component of the U4/U6-U5 snRNP complex [Source:SGD;Acc:S000006382])

HSP 1 Score: 66.6254 bits (161), Expect = 4.228e-12
Identity = 50/169 (29.59%), Postives = 84/169 (49.70%), Query Frame = 1
Query: 1261 VASLTGHDLPLTDVRTNPVADHALAVTASRDCTFRLWDFRCSTTEVHVQQGHNGIVSSVSFVGNSPEKLVSAGADRACKVWDLRNSRNPLHVIRTDSPINRLAVHPNGKIVALPMDNRIVKIFDLNLGTRIARLPRNSNQ--SHNRIVTSIAWNVDGGGKPNFFTTGFD 1761
            +  L GH+  ++DV+ +P        +AS D T+RLWD   +  E+ +Q+GH+  V S+SF  +    + S G D    +WD+R+    + +     PI  +A  PNG  VA    + I+ ++D+       R     NQ  +H  IVT + ++ + GGK    + G+D
Sbjct:  258 LGDLVGHERRISDVKYHPSG--KFIGSASHDMTWRLWD-ASTHQELLLQEGHDKGVFSLSFQCDGS-LVCSGGMDSLSMLWDIRSGSKVMTLAGHSKPIYTVAWSPNGYQVATGGGDGIINVWDIR-----KRDEGQLNQILAHRNIVTQVRFSKEDGGK-KLVSCGYD 416          
BLAST of WD repeat-containing protein 37 vs. Ensembl Yeast
Match: TAF5 (Subunit (90 kDa) of TFIID and SAGA complexes; involved in RNA polymerase II transcription initiation and in chromatin modification [Source:SGD;Acc:S000000402])

HSP 1 Score: 63.929 bits (154), Expect = 4.567e-11
Identity = 51/213 (23.94%), Postives = 105/213 (49.30%), Query Frame = 1
Query: 1156 SAPLSAADFLLNRDQIVTASWDRLGRIYDIATGSEVASLTGHDLPLTDVRTNPVADHALAVTASRDCTFRLWDFRCS-TTEVHVQQGHNGIVSSVSFVGNSPEKLVSAGADRACKVWDLRNSRNPLHVIRTDSPINRLAVHPNGKIVALPMDNRIVKIFDLNLGTRIARLPRNSNQSHNR-IVTSIAWNVDGGGKPNFFTTGFDQQLIAWHLQ 1788
            S  + +  F  +   +++ S D+  R++ + T + + S  GH+ P+ DV  +P+  H  A TAS D T RLW   C     + +  GH   V  VSF  N    + +  +D+ C++WD+    +    +   +P+  +AV P+G+ ++   ++ I+ ++D+  G R+ ++     + H +  + S++++ +G       + G D  +  W L+
Sbjct:  525 SGTVYSTSFSPDNKYLLSGSEDKTVRLWSMDTHTALVSYKGHNHPVWDVSFSPLG-HYFA-TASHDQTARLWS--CDHIYPLRIFAGHLNDVDCVSFHPNGC-YVFTGSSDKTCRMWDVSTGDSVRLFLGHTAPVISIAVCPDGRWLSTGSEDGIINVWDIGTGKRLKQM-----RGHGKNAIYSLSYSKEGNV---LISGGADHTVRVWDLK 724          

HSP 2 Score: 50.447 bits (119), Expect = 8.394e-7
Identity = 35/108 (32.41%), Postives = 50/108 (46.30%), Query Frame = 1
Query: 1201 IVTASWDRLGRIYDIATGSEVASLTGHDLPLTDVRTNPVADHALAVTASRDCTFRLWDFRCSTTEVHVQ-QGHNGIVS-SVSFVGNSPEKLVSAGADRACKVWDLRNS 1518
            + T S D+  R++D++TG  V    GH  P+  +   P  D     T S D    +WD         ++  G N I S S S  GN    L+S GAD   +VWDL+ +
Sbjct:  624 VFTGSSDKTCRMWDVSTGDSVRLFLGHTAPVISIAVCP--DGRWLSTGSEDGIINVWDIGTGKRLKQMRGHGKNAIYSLSYSKEGNV---LISGGADHTVRVWDLKKA 726          
BLAST of WD repeat-containing protein 37 vs. Ensembl Yeast
Match: PFS2 (Integral subunit of the pre-mRNA CPF complex; the cleavage and polyadenylation factor (CPF) complex plays an essential role in mRNA 3'-end formation by bridging different processing factors and thereby promoting the assembly of the processing complex [Source:SGD;Acc:S000005261])

HSP 1 Score: 62.7734 bits (151), Expect = 8.800e-11
Identity = 53/209 (25.36%), Postives = 97/209 (46.41%), Query Frame = 1
Query: 1180 FLLNRDQIVTASWDRLGRIYDIATGSEVASLTGHDLPLTDVRTNPVADHALAVTASRDCTFRLWDFRCSTTEVHVQQGHNGIVSSVSFVGNSPEKLVSAGADRACKVWDLRNSRNPLHVIRTDSPINRLAVHP-NGKIVALPMDNRIVKIFDL--NLGTRIARLPRNSNQSHNRIVTSIAWNVDGGGKPNFFTTGFDQQLIAWHLQLPL 1797
            F  N  + VT S D + +I++ + G +   L+GH   +     +P  +  L  +AS+D   +LWD R       + +  + ++ +  F       L++   D++C+V+D+R S   L  +R ++    L  HP N  +  L   +  +K FDL  NL   I  +P     +H++ +TS+++N  G     F T   D+ +  W    P+
Sbjct:  185 FSSNDSKFVTCSDDNILKIWNFSNGKQERVLSGHHWDVKSCDWHP--EMGLIASASKDNLVKLWDPRSGNCISSILKFKHTVLKT-RFQPTKGNLLMAISKDKSCRVFDIRYSMKELMCVRDETDYMTLEWHPINESMFTLACYDGSLKHFDLLQNLNEPILTIP----YAHDKCITSLSYNPVGHI---FATAAKDRTIRFWTRARPI 383          
BLAST of WD repeat-containing protein 37 vs. Ensembl Yeast
Match: TUP1 (General repressor of transcription; forms complex with Cyc8p, involved in the establishment of repressive chromatin structure through interactions with histones H3 and H4, appears to enhance expression of some genes [Source:SGD;Acc:S000000680])

HSP 1 Score: 60.8474 bits (146), Expect = 4.801e-10
Identity = 45/159 (28.30%), Postives = 73/159 (45.91%), Query Frame = 1
Query: 1321 DHALAVTASRDCTFRLWDFRCSTTEVHVQQGHNGIVSSVSFVGNSPEKLVSAGADRACKVWDLRNSRNPLHVIRTDSPINRLAVHP-NGKIVALPMDNRIVKIFDLNLGTRIARL--PRNSNQSHNRIVTSIAWNVDGGGKPNFFTTGFDQQLIAWHLQ 1788
            D     T + D   R+WD       V + QGH   + S+ +   S +KLVS   DR  ++WDLR  +  L  +  +  +  +AV P +GK +A    +R V+++D   G  + RL     S   H   V S+ +  DG    +  +   D+ +  W+LQ
Sbjct:  454 DGKFLATGAEDRLIRIWDIENRKI-VMILQGHEQDIYSLDYFP-SGDKLVSGSGDRTVRIWDLRTGQCSL-TLSIEDGVTTVAVSPGDGKYIAAGSLDRAVRVWDSETGFLVERLDSENESGTGHKDSVYSVVFTRDGQ---SVVSGSLDRSVKLWNLQ 606          

HSP 2 Score: 50.0618 bits (118), Expect = 8.364e-7
Identity = 38/122 (31.15%), Postives = 59/122 (48.36%), Query Frame = 1
Query: 1177 DFLLNRDQIVTASWDRLGRIYDIATGSEVASLTGHDLPLTDVRTNPVADHALAVTASRDCTFRLWDFRCS------TTEVHVQQGHNGIVSSVSFVGNSPEKLVSAGADRACKVWDLRNSRN 1524
            D+  + D++V+ S DR  RI+D+ TG    +L+  D  +T V  +P  D       S D   R+WD           +E     GH   V SV F  +  + +VS   DR+ K+W+L+N+ N
Sbjct:  492 DYFPSGDKLVSGSGDRTVRIWDLRTGQCSLTLSIED-GVTTVAVSP-GDGKYIAAGSLDRAVRVWDSETGFLVERLDSENESGTGHKDSVYSVVFTRDG-QSVVSGSLDRSVKLWNLQNANN 610          

HSP 3 Score: 49.6766 bits (117), Expect = 1.318e-6
Identity = 39/108 (36.11%), Postives = 55/108 (50.93%), Query Frame = 1
Query: 1201 IVTASWDRLGRIYDIATGSEVASLTGHDLPLTDVRTNPVADHALAVTASRDCTFRLWDFR---CSTTEVHVQQGHNGIVSSVSFVGNSP--EKLVSAGA-DRACKVWD 1506
            + T + DRL RI+DI     V  L GH+  +  +   P  D    V+ S D T R+WD R   CS T + ++ G       V+ V  SP   K ++AG+ DRA +VWD
Sbjct:  458 LATGAEDRLIRIWDIENRKIVMILQGHEQDIYSLDYFPSGDK--LVSGSGDRTVRIWDLRTGQCSLT-LSIEDG-------VTTVAVSPGDGKYIAAGSLDRAVRVWD 555          
BLAST of WD repeat-containing protein 37 vs. Ensembl Nematostella
Match: EDO48910 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RHT4])

HSP 1 Score: 268.47 bits (685), Expect = 1.133e-82
Identity = 186/489 (38.04%), Postives = 259/489 (52.97%), Query Frame = 1
Query:  361 LSQEFKQRLWALFRQIESEFEKECKKIYSENYAIHDRNEKIESSDHEESNFAKK--ISGSHLXXXXXXXXXXXXXXXXRLVSTFRDRGSTMPNISNQSHQGSNRHACILCWRVSDHRDGIWEVNCI--GRGLVGTACADGVVRLWNSDNGHCSLVYLGHSGSVNSVRF--KNGIMLTASGDGTAHL--VNLP-PEKISEALSSNEPGKSSVTDSIGHXXXXXXXXXTKRNINSPTEDGAESNPVENTTLILRNPNSMYQTASLYSSFGSYTYKDSAPLSAADFLLNRDQIVTASWDRLGRIYDIATGSEVASLTGHDLPLTDVRTNPVADHALAVTASRDCTFRLWDFRC-STTEVHVQQGHNGIVSSVSFVGNSPEKLVSAGADRACKVWDLRNSRNPLHVIRTDSPINRLAVHPNGKIVALPMDNRIVKIFDLNLGTRIARLPRNSNQSHNRIVTSIAWNVDGGGKP-NFFTTGFDQQLIAWHLQLP 1794
            L  E + RLW LF QIE EFE     +++EN A+ +R EK+E     E        + G  +     ++   S+  + +L +T++   S + +     +Q +    C        HRDG+WEV+    G+ ++ TA AD   RLW+ D+G C L YLGH GSVNS+RF     ++ TASG+GT H+   N+  PE +S A                            R  +    +GA+ NP   T  ILR+      T  L    GS        LSAAD+  +  QIVTASWDR  +++D+ TG +V SLTGHD  LT   T+P     L VT+S D TFRLWDFR  S   V+V QGH+  V S +F   + + +VS   DR  KVWDL+N R+PL  I TDS +NRL+V     I+A+P DNR +++FDLN G R+ARLPR + Q H R+V   AW  +   K  N F+ GFD++++ W + LP
Sbjct:   32 LPPEARTRLWNLFAQIEREFEG----VHAENCALRERVEKLEIILSGEKGVEGDMVVDGMPVKPGYGKKPSASQLMSQKLKTTYKASTSKIVSSFKIPNQAAGSVECHRLRGYLGHRDGVWEVSYARHGQAIIATASADRSARLWDVDSGLCLLKYLGHIGSVNSIRFHPTEPLVCTASGEGTCHVWRANVSIPEPVSNA--------------------------DIRECSLFMAEGAD-NPDAPTPAILRS-----ATLELKGHEGS--------LSAADWFTSGKQIVTASWDRTAKLWDVETGEQVHSLTGHDQELTHTCTHP--SQQLIVTSSTDTTFRLWDFRTPSIHSVNVLQGHSDTVRSTAF-STTKDIVVSGSDDRTVKVWDLKNMRSPLTTINTDSAVNRLSVSSLSNIIAIPHDNRHIRLFDLN-GVRLARLPRRNGQGHQRMVCCTAWGDENSTKSCNLFSCGFDRRVLGWQVILP 472          
BLAST of WD repeat-containing protein 37 vs. Ensembl Nematostella
Match: EDO34865 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SN68])

HSP 1 Score: 67.781 bits (164), Expect = 5.188e-12
Identity = 72/275 (26.18%), Postives = 110/275 (40.00%), Query Frame = 1
Query:  745 VGTACADGVVRLWNSDNGHCSLVYLGHSGSVNSVRF--KNGIMLTASGDGTAHLVNLP------------PEKISEALSSNEPGKSSVTDSIGHXXXXXXXXXTKRNINSPTEDGAESNPVENTTLILRNPNSMYQTASLYSS-----FGSYTYKDSAPLSAADFLLNRDQIVTASWDRLGRIYDIATGSEVASLTGHDLPLTDVRTNPVADHALAVTASRDCTFRLWD---FRCSTTEVHVQQGHNGIVSSVSFVGNSPEKLVSAGADRACKVW 1503
            + T   D   +LWN++ G C   Y GHS  +  + F  ++ ++ T S D TA L ++              E IS A   N  G   +T S  H          +R        G  SN   N         SM +T  ++ +      G+    D   L  A F      I TAS D  GR+Y+  T   ++ L GH+  ++ +  N      L  TAS D T RLWD    +C    + V +GH   + S +F     + +++   D  C++W
Sbjct:  150 IATGSFDKTCKLWNAETGKCYHTYRGHSAEIVCLAFNPQSTVIATGSMDTTAKLWDVQTGAEISTLSGHSAEIISCAF--NSTGTQLLTGSFDHTVSVWDTRSGRRVHTLIGHRGEISNAQFNFDCSFIVTGSMDKTCKIWDAGTGKCIGTLRGHDDEVLDVA-FDYTGQLIATASADGTGRVYNALTHHCLSKLEGHEGEISKITFNAQGTRLL--TASSDKTARLWDPNTGKC----LQVLEGHTDEIFSCAF-NYDGDIIITGSKDNTCRLW 414          

HSP 2 Score: 49.2914 bits (116), Expect = 3.507e-6
Identity = 41/169 (24.26%), Postives = 74/169 (43.79%), Query Frame = 1
Query: 1162 PLSAADFLLNRDQIVTASWDRLGRIYDIATGSEVASLTGH-DLPLTDVRTNPVADHALAVTASRDCTFRLWDFRCSTTEVHVQQGHNGIVSSVSFVGNSPEKLVSAGA-DRACKVWDLRNSRNPLHVIRTDSPINRLAVHPNGKIVALPMDNRIVKIFDLNLGTRIARL 1662
            PL+   F  +    +T S+DR  +++D A+G E  +L GH ++       NP  D     T S D T +LW+        H  +GH+  +  ++F  N    +++ G+ D   K+WD++       +    + I   A +  G  +     +  V ++D   G R+  L
Sbjct:   94 PLTNVAFNKSGTSFITGSYDRTCKVWDTASGEETLTLEGHKNVVYAIAFNNPYGDK--IATGSFDKTCKLWNAETGKC-YHTYRGHSAEIVCLAF--NPQSTVIATGSMDTTAKLWDVQTGAEISTLSGHSAEIISCAFNSTGTQLLTGSFDHTVSVWDTRSGRRVHTL 257          
BLAST of WD repeat-containing protein 37 vs. Ensembl Nematostella
Match: EDO49767 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RFR6])

HSP 1 Score: 65.4698 bits (158), Expect = 1.161e-11
Identity = 52/170 (30.59%), Postives = 88/170 (51.76%), Query Frame = 1
Query: 1198 QIVTASWDRLGRIYDIATGSEVASLTGHDLPLTDVRTNPVADHALAVTASRDCTFRLWDFRCSTTEVHVQQGHNGIVSSVSFVGNSPEK--LVSAGADRACKVWDLRNSRNPLHVIRTDSPINRLAVHPNGKIVALPMDNRIVKIFDLNLGTRIARLPRNSNQSHNRIVT 1701
            +I+++S+D+  +I+D+ T + V SL GHD  +  +     +D    V+AS+D T R+W+   +   V   +GH+    +V  V  SP+    +S   D   K+WDL +++    ++   S I  +AV P+G  V    D+  VK++ L  G  +A L  +S     RIVT
Sbjct:  111 RIISSSYDKTVKIWDVETCAFVNSLDGHDGHVRGIAIT--SDGRRLVSASQDRTLRIWNLE-TFAHVSTLRGHS---ETVYCVCCSPDDKFAISGSEDTMVKIWDLESAKEVRSLVGHTSDIFAVAVTPDGSKVISSGDDTQVKVWSLESGEELASLHGHSESV--RIVT 272          

HSP 2 Score: 59.3066 bits (142), Expect = 1.313e-9
Identity = 49/198 (24.75%), Postives = 91/198 (45.96%), Query Frame = 1
Query: 1195 DQIVTASWDRLGRIYDIATGSEVASLTGHDLPLTDVRTNPVADHALAVTASRDCTFRLWDFRCSTTEVHVQQGHNGIVSSVSFVGNSPEKLVSAGADRACKVWDLRNSRNPLHVIRTDSPINRLAVHPNGKIVALPMDNRIVKIFDLNLGTRIARLPRNSNQSHNRIVTSIAWNVDGGGKPNFFTTGFDQQLIAWHLQ 1788
            D +V+ ++D   +I+D+ T S V +L GH   ++ V   P  D    +++S D T ++WD   +   V+   GH+G V  ++   +   +LVSA  DR  ++W+L    +   +      +  +   P+ K      ++ +VKI+DL     +  L       H   + ++A   DG       ++G D Q+  W L+
Sbjct:   68 DFLVSGAFDHTVKIWDMDTLSLVHTLKGHKNWVSGVLVTP--DSKRIISSSYDKTVKIWDVE-TCAFVNSLDGHDGHVRGIAITSDG-RRLVSASQDRTLRIWNLETFAHVSTLRGHSETVYCVCCSPDDKFAISGSEDTMVKIWDLESAKEVRSL-----VGHTSDIFAVAVTPDG---SKVISSGDDTQVKVWSLE 253          

HSP 3 Score: 55.8398 bits (133), Expect = 1.787e-8
Identity = 39/144 (27.08%), Postives = 70/144 (48.61%), Query Frame = 1
Query: 1198 QIVTASWDRLGRIYDIATGSEVASLTGHDLPLTDVRTNPVADHALAVTASRDCTFRLWDFRCSTTEVHVQQGHNGIVSSVSFVGNSPEKLVSAGADRACKVWDLRNSRNPLHVIRTDSPINRLAVHPNGKIVALPMDNRIVKIF 1629
            ++V+AS DR  RI+++ T + V++L GH   +  V  +P  D   A++ S D   ++WD   S  EV    GH   + +V+   +   K++S+G D   KVW L +      +      +  + V P+G  +    ++   KI+
Sbjct:  153 RLVSASQDRTLRIWNLETFAHVSTLRGHSETVYCVCCSP--DDKFAISGSEDTMVKIWDLE-SAKEVRSLVGHTSDIFAVAVTPDG-SKVISSGDDTQVKVWSLESGEELASLHGHSESVRIVTVSPDGLTIVSGSEDATFKIW 292          
BLAST of WD repeat-containing protein 37 vs. Ensembl Nematostella
Match: EDO47404 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RLW2])

HSP 1 Score: 65.4698 bits (158), Expect = 3.486e-11
Identity = 47/168 (27.98%), Postives = 83/168 (49.40%), Query Frame = 1
Query: 1183 LLNRDQIVTASWDRLGRIYDIATGSEVASLTGHDLPLTDVRTNPVADHALAVTASRDCTFRLWDFRCSTTEVHVQQGHNGIVSSVSFVGNSPEKLVSAGADRACKVWDLRNSRNPLHVIRTDSPINR----LAVHPNGKIVALPMDNRIVKIFDLNLGTRIARLPRNS 1674
            L +  +++T   D+   +++  T   +A+L GH   +T+V  +P  +  L +TAS D T R+W     + E H+ + H+  V+ +S      + L+S  AD+     D+R  R     I +D  +N+       HP+G I      + I+KI+DL   T +A+ P +S
Sbjct:  234 LADTSKVLTGGLDKNAIVFNKDTEQVIATLKGHTKKITNVIYHPTEE--LGITASADSTIRVWSITKGSCE-HILKAHDQAVTGLSLHATG-DYLLSCSADQHWAFSDIRTGRVLTKCI-SDPAVNQGLTCAQFHPDGLIFGTGTSDSIIKIWDLKERTNVAKFPGHS 396          
BLAST of WD repeat-containing protein 37 vs. Ensembl Nematostella
Match: EDO45346 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RTA6])

HSP 1 Score: 65.0846 bits (157), Expect = 3.791e-11
Identity = 57/209 (27.27%), Postives = 96/209 (45.93%), Query Frame = 1
Query: 1156 SAPLSAADFLLNRDQIVTASWDRLGRIYDIATGSEVASLTGHDLPLTDVRTNPVADHALAVTASRDCTFRLWDFRCSTTEVHVQQGHNGIVSSVSFVGNSPEKLVSAGADRACKVWDLRNSRNPLHVIRTDSPINRLAVHPNGKIVALPMDNRIVKIFDLNLGTRIARLPRNSNQSHNRIVTSIAWNVDGGGKPNFFTTG-FDQQLIAW 1779
            +A + + DF  +   ++TAS D+  +++ +     + SL  H   +   + +P  D  L V+ S D T +LWD R S   VH      G V+SV F   S   + + G D   KVWD+R ++   H       +N ++ HP+G  +     +  +KI DL  G     L       H    TS+ ++ +G     +F +G  D+Q++ W
Sbjct:  102 TATVRSVDFSGDGQSLLTASDDKSLKVWTVHRQKFLYSLNAHMNWVRCAKFSP--DGRLIVSGSDDKTIKLWD-RTSKDCVHTFYDPGGFVNSVEF-HPSGTCIAAGGTDSTVKVWDIRMNKLLQHYQAHTGAVNSVSFHPSGNYLVSASSDTTLKILDLMEGRLFYTL-----HGHQGPATSVVFSRNG----EYFASGSSDEQVMVW 297          

HSP 2 Score: 55.4546 bits (132), Expect = 3.988e-8
Identity = 45/157 (28.66%), Postives = 76/157 (48.41%), Query Frame = 1
Query: 1165 LSAADFLLNRDQIVTASWDRLGRIYDIATGSEVASLTGHDLPLTDVRTNPVADHALAVTASRDCTFRLWDFRCSTTEVHVQQGHNGIVSSVSFVGNSPEKLVSAGADRACKVWDLRNSRNPLHVIRTDSPINRLA-VHPNGKIVALPMDNRIVKIFD 1632
            +++ DF  N  Q+VT S D    I+            GH   +  V+ +P + H +A +ASRD T RLW       E  V + H   V SV F G+  + L++A  D++ KVW +   +  L+ +       R A   P+G+++    D++ +K++D
Sbjct:   21 VTSVDFNPNMKQLVTGSMDSSLMIWHFKPHMRAYRFVGHKDAILSVKFSP-SGHLIA-SASRDKTVRLW-VPSVKGESTVFKAHTATVRSVDFSGDG-QSLLTASDDKSLKVWTVHRQKF-LYSLNAHMNWVRCAKFSPDGRLIVSGSDDKTIKLWD 172          
BLAST of WD repeat-containing protein 37 vs. Ensembl Medaka
Match: WDR37 (WD repeat domain 37 [Source:NCBI gene;Acc:101165588])

HSP 1 Score: 253.447 bits (646), Expect = 3.206e-76
Identity = 181/505 (35.84%), Postives = 256/505 (50.69%), Query Frame = 1
Query:  346 GDDGILSQEFKQRLWALFRQIESEFEKECKKIYSENYA----IHDRNEKIESSDH--EESNFAK---KISGSHLXXXXXXXXXXXXXXXXRLVSTFRDRGSTMPNISNQSHQGSNRHACILCWRVSDHRDGIWEVNCIGRG--LVGTACADGVVRLWNSDNGHCSLVYLGHSGSVNSVRF--KNGIMLTASGDGTAH----LVNLP-PEKISEALSSNEPGKSSVTDSIGHXXXXXXXXXTKRNINSPTEDGAESNPVENTTLILRNPNSMYQTASLYSSFGSYTYKDSAPLSAADFLLNRDQIVTASWDRLGRIYDIATGSEVASLTGHDLPLTDVRTNPVADHALAVTASRDCTFRLWDFR-CSTTEVHVQQGHNGIVSSVSF-VGNSPEKLVSAGADRACKVWDLRNSRNPLHVIRTDSPINRLAVHPNGKIVALPMDNRIVKIFDLNLGTRIARLPRNSNQSHNRIVTSIAWNVDGGGKPNFFTTGFDQQLIAWHLQLPLL 1800
            G D  L    +  L  LF QIE EFE     +Y EN      I   NE++ +  H  + ++ AK   K   SH           + Q + +L +T++   ++   I +     + R  C L      HRDGIW+++       ++GTA AD    LW+ + G C L Y GH GSVNS++F     + LTASGD TAH    +V LP P+ +++                               +++P ED  + +  +     +  P          ++  S+       + AAD+L+   Q+VTASWDR   +YD+ T   V SLTGHD  LT   T+P     L VT+SRD TFRLWDFR  S   V+V QGH   V+S  F VG++   +VS   DR  KVWDL+N R+P+  IRTDS +NR++V  N KI+ALP DNR V++FD++ G R+ARLPR++ Q H R+V    W  D     N FT GFD+Q I W++ +P L
Sbjct:   45 GQDSKLPPSLRSNLLDLFSQIEREFEN----LYLENIELRRDIETLNERLAAEGHTFDGADLAKGALKTKASH----------STSQLSQKLKTTYK---ASTSKIVSSFKATAARAVCQLVKEYVGHRDGIWDLSVTRNQPVVLGTASADHTAMLWSIETGKCLLRYTGHQGSVNSIKFHPTEQMALTASGDQTAHIWRYMVQLPTPQPVAD-------------------------------VSTPCEDDVDFSDKDEPDCEVEGPIDCPSIRVAATTLRSH----QGVVIAADWLVGGRQVVTASWDRSANLYDVETSELVHSLTGHDQELTHCCTHPT--QRLVVTSSRDTTFRLWDFRDPSIHSVNVFQGHTDTVTSAVFTVGDN---VVSGSDDRTVKVWDLKNMRSPIATIRTDSAVNRISVSVNQKIIALPHDNRQVRLFDMS-GVRLARLPRSNRQGHRRMVCCSIWCED-NTTCNLFTCGFDRQAIGWNINIPAL 490          
BLAST of WD repeat-containing protein 37 vs. Ensembl Medaka
Match: wdr37 (WD repeat-containing protein 37 [Source:NCBI gene;Acc:101164263])

HSP 1 Score: 245.743 bits (626), Expect = 2.712e-73
Identity = 179/497 (36.02%), Postives = 254/497 (51.11%), Query Frame = 1
Query:  346 GDDGILSQEFKQRLWALFRQIESEFEKECKKIYSENYAIHDRNEKIESSDHEESNFAKKISGSHLXX--XXXXXXXXXXXXXXRLVSTFRDRGSTMPNISNQSHQGSNRHACILCWRVSDHRDGIWEVNCIGRG--LVGTACADGVVRLWNSDNGHCSLVYLGHSGSVNSVRF--KNGIMLTASGDGTAH----LVNLP-PEKISEALSSNEPGKSSVTDSIGHXXXXXXXXXTKRNINSPTEDGAESNPVENTTLILRNPNSMYQTASLYSSFGSYTYKDSAPLSAADFLLNRDQIVTASWDRLGRIYDIATGSEVASLTGHDLPLTDVRTNPVADHALAVTASRDCTFRLWDFR-CSTTEVHVQQGHNGIVSSVSFVGNSPEKLVSAGADRACKVWDLRNSRNPLHVIRTDSPINRLAVHPNGKIVALPMDNRIVKIFDLNLGTRIARLPRNSNQSHNRIVTSIAWNVDGGGKPNFFTTGFDQQLIAWHLQLPLL 1800
            G D  L    +  L  LF QIE EFE     +Y EN    D   +I+S +   +   + + G   ++     +    + Q + +L +T++   ST   +S+      +R  C L      HRDGIW+++       ++GTA AD    LW+ + G C L Y GH+GSVNS++F     + LTASGD TAH    +V LP P+   +  +  +  + S     G V                  DG    P E        P     TA+L S          + +  AD+L+   Q+VTASWDR   +Y++ T   V +LTGHD  LT   T+P     L VT+SRD TFRLWDFR  S   V+V QGH   V+S  F   + + +VS   DR  KVWDL+N R+P+  IRTDS +NR++V  N +I+ALP DNR V++FD++ G R+ARLPR++   H R+V   AWN +     N FT GFD+Q I W++ +P L
Sbjct:   50 GQDSKLPHHVRNNLLDLFGQIEREFEN----LYIENL---DLRREIDSLNERLTGDGQTVDGGDPTKGALKAKASHSTSQLSQKLKTTYK--ASTSKIVSSFKATTGSRALCQLLKEYVGHRDGIWDLSVTRTQPVVLGTASADHSALLWSIETGKCLLKYCGHAGSVNSIKFHPTEQMALTASGDQTAHIWRYMVQLPAPQPPPDVTALCDDDQDSSDREEGEV------------------DG--EGPCEV-------PTVRVATATLKSH--------QSVVITADWLVGGRQVVTASWDRAANLYEVETSELVHTLTGHDQELTHCCTHPT--QRLVVTSSRDTTFRLWDFRDPSIHSVNVFQGHTDTVTSAVFT--TGDNVVSGSDDRTVKVWDLKNMRSPITTIRTDSAVNRISVSANQRIIALPHDNRQVRLFDMS-GVRLARLPRSNRMGHRRMVCCTAWN-EENQTCNLFTCGFDRQAIGWNINIPAL 496          
BLAST of WD repeat-containing protein 37 vs. Ensembl Medaka
Match: wdr37 (WD repeat-containing protein 37 [Source:NCBI gene;Acc:101164263])

HSP 1 Score: 237.654 bits (605), Expect = 4.767e-70
Identity = 182/518 (35.14%), Postives = 254/518 (49.03%), Query Frame = 1
Query:  346 GDDGILSQEFKQRLWALFRQIESEFEKECKKIYSENY----AIHDRNEKI------------------ESSDHEESNFAKKISGSHLXXXXXXX-XXXXXXXXXRLVSTFRDRGSTMPNISNQSHQGSNRHACILCWRVSDHRDGIWEVNCIGRG--LVGTACADGVVRLWNSDNGHCSLVYLGHSGSVNSVRF--KNGIMLTASGDGTAH----LVNLP-PEKISEALSSNEPGKSSVTDSIGHXXXXXXXXXTKRNINSPTEDGAESNPVENTTLILRNPNSMYQTASLYSSFGSYTYKDSAPLSAADFLLNRDQIVTASWDRLGRIYDIATGSEVASLTGHDLPLTDVRTNPVADHALAVTASRDCTFRLWDFR-CSTTEVHVQQGHNGIVSSVSFVGNSPEKLVSAGADRACKVWDLRNSRNPLHVIRTDSPINRLAVHPNGKIVALPMDNRIVKIFDLNLGTRIARLPRNSNQSHNRIVTSIAWNVDGGGKPNFFTTGFDQQLIAWHLQLPLL 1800
            G D  L    +  L  LF QIE EFE     +Y EN      I   NE++                    + H  S  ++K+  ++ +   K     Q K   +R  +T+   G     +S+      +R  C L      HRDGIW+++       ++GTA AD    LW+ + G C L Y GH+GSVNS++F     + LTASGD TAH    +V LP P+   +  +  +  + S     G V                  DG    P E        P     TA+L S          + +  AD+L+   Q+VTASWDR   +Y++ T   V +LTGHD  LT   T+P     L VT+SRD TFRLWDFR  S   V+V QGH   V+S  F   + + +VS   DR  KVWDL+N R+P+  IRTDS +NR++V  N +I+ALP DNR V++FD++ G R+ARLPR++   H R+V   AWN +     N FT GFD+Q I W++ +P L
Sbjct:   50 GQDSKLPHHVRNNLLDLFGQIEREFEN----LYIENLDLRREIDSLNERLTGDGQTVDGGDPTKGALKAKASHSTSQLSQKLKTTYKASTSKCLCTFQHKLGGARSFTTWELWGGDSWIVSSFKATTGSRALCQLLKEYVGHRDGIWDLSVTRTQPVVLGTASADHSALLWSIETGKCLLKYCGHAGSVNSIKFHPTEQMALTASGDQTAHIWRYMVQLPAPQPPPDVTALCDDDQDSSDREEGEV------------------DG--EGPCEV-------PTVRVATATLKSH--------QSVVITADWLVGGRQVVTASWDRAANLYEVETSELVHTLTGHDQELTHCCTHPT--QRLVVTSSRDTTFRLWDFRDPSIHSVNVFQGHTDTVTSAVFT--TGDNVVSGSDDRTVKVWDLKNMRSPITTIRTDSAVNRISVSANQRIIALPHDNRQVRLFDMS-GVRLARLPRSNRMGHRRMVCCTAWN-EENQTCNLFTCGFDRQAIGWNINIPAL 522          
BLAST of WD repeat-containing protein 37 vs. Ensembl Medaka
Match: rack1 (receptor for activated C kinase 1 [Source:NCBI gene;Acc:101162055])

HSP 1 Score: 65.4698 bits (158), Expect = 3.738e-11
Identity = 46/154 (29.87%), Postives = 72/154 (46.75%), Query Frame = 1
Query: 1204 VTASWDRLGRIYDIATGSEVASLTGHDLPLTDVRTNPVADHALAVTASRDCTFRLWDFRCSTTEVHVQQGHNGIVSSVSFVGNSPEKL-VSAGADRACKVWDLRNSRNPLHVIRTDSPINRLAVHPNGKIVALPMDNRIVKIFDLNLGTRIARL 1662
            ++ +WD   R++D+ TG       GH   +  V  +  AD+   V+ SRD T +LW+           +GH   VS V F  NS   + VS G D+  KVW+L N +   + I     +N + V P+G + A    +    ++DLN G  +  L
Sbjct:   79 LSGAWDGTLRLWDLTTGLTTRQFVGHTKDVLSVAFS--ADNRQIVSGSRDKTIKLWNTLGVCKYTIQDEGHTEWVSCVRFSPNSSNPIIVSCGWDKMVKVWNLANCKLKTNHIGHTGYLNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTL 230          
BLAST of WD repeat-containing protein 37 vs. Ensembl Medaka
Match: rack1 (receptor for activated C kinase 1 [Source:NCBI gene;Acc:101162055])

HSP 1 Score: 63.5438 bits (153), Expect = 8.139e-11
Identity = 44/157 (28.03%), Postives = 74/157 (47.13%), Query Frame = 1
Query: 1204 VTASWDRLGRIYDIATGSEVASLTGHDLPLTDVRTNPVADHALAVTASRDCTFRLWDFRCSTTEVHVQQGHNGIVSSVSFVGNSPEKL-VSAGADRACKVWDLRNSRNPLHVIRTDSPINRLAVHPNGKIVA-------LPMDNRIVKIFDLNLGTR 1650
            ++ +WD   R++D+ TG       GH   +  V  +  AD+   V+ SRD T +LW+           +GH   VS V F  NS   + VS G D+  KVW+L N +   + I     +N + V P+G + A           + +++++ + +GTR
Sbjct:   79 LSGAWDGTLRLWDLTTGLTTRQFVGHTKDVLSVAFS--ADNRQIVSGSRDKTIKLWNTLGVCKYTIQDEGHTEWVSCVRFSPNSSNPIIVSCGWDKMVKVWNLANCKLKTNHIGHTGYLNTVTVSPDGSLCASGGKTLFAGYTDNLIRVWQVTIGTR 233          
BLAST of WD repeat-containing protein 37 vs. Planmine SMEST
Match: SMESG000023812.1 (SMESG000023812.1)

HSP 1 Score: 1097.03 bits (2836), Expect = 0.000e+0
Identity = 560/560 (100.00%), Postives = 560/560 (100.00%), Query Frame = 1
Query:  121 MLNSQFSLSNANSNGHDVQSANLGLNLINNSSASVSLDSPSNSFNVSHGNINNANSELIAGITSFCAPQSCTNPLGDDGILSQEFKQRLWALFRQIESEFEKECKKIYSENYAIHDRNEKIESSDHEESNFAKKISGSHLXXXXXXXXXXXXXXXXRLVSTFRDRGSTMPNISNQSHQGSNRHACILCWRVSDHRDGIWEVNCIGRGLVGTACADGVVRLWNSDNGHCSLVYLGHSGSVNSVRFKNGIMLTASGDGTAHLVNLPPEKISEALSSNEPGKSSVTDSIGHXXXXXXXXXTKRNINSPTEDGAESNPVENTTLILRNPNSMYQTASLYSSFGSYTYKDSAPLSAADFLLNRDQIVTASWDRLGRIYDIATGSEVASLTGHDLPLTDVRTNPVADHALAVTASRDCTFRLWDFRCSTTEVHVQQGHNGIVSSVSFVGNSPEKLVSAGADRACKVWDLRNSRNPLHVIRTDSPINRLAVHPNGKIVALPMDNRIVKIFDLNLGTRIARLPRNSNQSHNRIVTSIAWNVDGGGKPNFFTTGFDQQLIAWHLQLPLL 1800
            MLNSQFSLSNANSNGHDVQSANLGLNLINNSSASVSLDSPSNSFNVSHGNINNANSELIAGITSFCAPQSCTNPLGDDGILSQEFKQRLWALFRQIESEFEKECKKIYSENYAIHDRNEKIESSDHEESNFAKKISGSHLSQKIKQQYKQSKQSTSRLVSTFRDRGSTMPNISNQSHQGSNRHACILCWRVSDHRDGIWEVNCIGRGLVGTACADGVVRLWNSDNGHCSLVYLGHSGSVNSVRFKNGIMLTASGDGTAHLVNLPPEKISEALSSNEPGKSSVTDSIGHVDDDVIVDDTKRNINSPTEDGAESNPVENTTLILRNPNSMYQTASLYSSFGSYTYKDSAPLSAADFLLNRDQIVTASWDRLGRIYDIATGSEVASLTGHDLPLTDVRTNPVADHALAVTASRDCTFRLWDFRCSTTEVHVQQGHNGIVSSVSFVGNSPEKLVSAGADRACKVWDLRNSRNPLHVIRTDSPINRLAVHPNGKIVALPMDNRIVKIFDLNLGTRIARLPRNSNQSHNRIVTSIAWNVDGGGKPNFFTTGFDQQLIAWHLQLPLL
Sbjct:    1 MLNSQFSLSNANSNGHDVQSANLGLNLINNSSASVSLDSPSNSFNVSHGNINNANSELIAGITSFCAPQSCTNPLGDDGILSQEFKQRLWALFRQIESEFEKECKKIYSENYAIHDRNEKIESSDHEESNFAKKISGSHLSQKIKQQYKQSKQSTSRLVSTFRDRGSTMPNISNQSHQGSNRHACILCWRVSDHRDGIWEVNCIGRGLVGTACADGVVRLWNSDNGHCSLVYLGHSGSVNSVRFKNGIMLTASGDGTAHLVNLPPEKISEALSSNEPGKSSVTDSIGHVDDDVIVDDTKRNINSPTEDGAESNPVENTTLILRNPNSMYQTASLYSSFGSYTYKDSAPLSAADFLLNRDQIVTASWDRLGRIYDIATGSEVASLTGHDLPLTDVRTNPVADHALAVTASRDCTFRLWDFRCSTTEVHVQQGHNGIVSSVSFVGNSPEKLVSAGADRACKVWDLRNSRNPLHVIRTDSPINRLAVHPNGKIVALPMDNRIVKIFDLNLGTRIARLPRNSNQSHNRIVTSIAWNVDGGGKPNFFTTGFDQQLIAWHLQLPLL 560          
BLAST of WD repeat-containing protein 37 vs. Planmine SMEST
Match: SMESG000061733.1 (SMESG000061733.1)

HSP 1 Score: 77.411 bits (189), Expect = 5.705e-15
Identity = 53/164 (32.32%), Postives = 83/164 (50.61%), Query Frame = 1
Query: 1189 NRDQIVTASWDRLGRIYDIATGSEVASLTGH--DLPLTDVRTNPVADHALAVTASRDCTFRLWDFRCSTTEVHVQQGHNGIVSSVSFVGNSPEKLVSAGADRACKVWDLRNSRNPLHVIRTDSPIN----RLAVHPNGKIVALPMDNRIVKIFDLNLGTRIARL 1662
            N D I++AS D+   +++I T   ++S  GH  D+   D+    V    + VTAS D T RLWD R     V V +GH   V+ +SF   S    VSA  D+AC++WD+R+  +    I TD  I      + +  +G+++    D+ I  ++DL    R+  L
Sbjct:  154 NDDTIISASGDKSCGLWNIETNKMLSSYYGHENDVTCLDISRKDVN---IFVTASADKTCRLWDVRIPNRYVQVFEGHEQDVNGISFFPESSYGFVSASDDKACRLWDIRS--DQCIAIYTDDYIKSGSTSVTISKSGRVLIAGYDDFICHVWDLLREERVGLL 312          
BLAST of WD repeat-containing protein 37 vs. Planmine SMEST
Match: SMESG000061733.1 (SMESG000061733.1)

HSP 1 Score: 77.411 bits (189), Expect = 5.941e-15
Identity = 53/164 (32.32%), Postives = 83/164 (50.61%), Query Frame = 1
Query: 1189 NRDQIVTASWDRLGRIYDIATGSEVASLTGH--DLPLTDVRTNPVADHALAVTASRDCTFRLWDFRCSTTEVHVQQGHNGIVSSVSFVGNSPEKLVSAGADRACKVWDLRNSRNPLHVIRTDSPIN----RLAVHPNGKIVALPMDNRIVKIFDLNLGTRIARL 1662
            N D I++AS D+   +++I T   ++S  GH  D+   D+    V    + VTAS D T RLWD R     V V +GH   V+ +SF   S    VSA  D+AC++WD+R+  +    I TD  I      + +  +G+++    D+ I  ++DL    R+  L
Sbjct:  171 NDDTIISASGDKSCGLWNIETNKMLSSYYGHENDVTCLDISRKDVN---IFVTASADKTCRLWDVRIPNRYVQVFEGHEQDVNGISFFPESSYGFVSASDDKACRLWDIRS--DQCIAIYTDDYIKSGSTSVTISKSGRVLIAGYDDFICHVWDLLREERVGLL 329          
BLAST of WD repeat-containing protein 37 vs. Planmine SMEST
Match: SMESG000024482.1 (SMESG000024482.1)

HSP 1 Score: 70.4774 bits (171), Expect = 1.954e-12
Identity = 56/208 (26.92%), Postives = 97/208 (46.63%), Query Frame = 1
Query: 1156 SAPLSAADFLLNRDQIVTASWDRLGRIYDIATGSEVASLTGHDLPLTDVRTNPVADHALAVTASRDCTFRLWDFRCSTTEVHVQQGHNGIVSSVSFVGNSPEKLVSAGADRACKVWDLRNSRNPLHVIRTDSPINRLAVHPNGKIVALPMDNRIVKIFDLNLGTRIARLPRNSNQSHNRIVTSIAWNVDGGGKPNFFTTGFDQQLIAW 1779
            +A + + D   +  ++VT S D+  +++ +       SL  H   +  VR +  +D  L  ++S D T +LWD R +   +H  Q H G V S++F  N    + S G D    +WD+R ++   H     SP+N ++ HP+G  +    D+  +KI+DL  G  +  +     Q H   +   A++  G     F + G D Q+  W
Sbjct:   98 TATVRSVDISCDNLEMVTGSDDKTIKVWKMHRQKFSYSLNEHKNWVRCVRFS--SDGQLIASSSDDKTIKLWD-RHNQECIHTFQEHGGFVPSLAFHPNG-SYIASGGTDSHVNIWDIRMNKLLQHYTSHTSPVNAVSFHPSGNFLISSSDDSSMKIYDLLEGRLLYTV-----QGHEGPILGTAFSHCG---EMFASGGADHQVFLW 293          

HSP 2 Score: 51.6026 bits (122), Expect = 1.432e-6
Identity = 47/212 (22.17%), Postives = 92/212 (43.40%), Query Frame = 1
Query: 1165 LSAADFLLNRDQIVTASWDRLGRIYDIATGSEVASLTGHDLPLTDVRTNPVADHALAVTASRDCTFRLWDFRCSTTEVHVQQGHNGIVSSVSFVGNSPEKLVSAGADRACKVWDLRNSRNPLHVIRTDSPINRLAVHPNGKIVALPMDNRIVKIFDLNLGTRIARLPRNSNQSHNRIVTSIAWNVDGGGKPNFFTTGFDQQLIAWHLQLPLL 1800
            ++  DF  N  Q+ +   D    I++    +      GH+  +  V+ +P     L  +ASRD T RLW       E  V + H   V SV    ++ E +V+   D+  KVW +   +    +    + +  +    +G+++A   D++ +K++D +    I     ++ Q H   V S+A++ +G       + G D  +  W +++  L
Sbjct:   17 VTCVDFNPNSSQLASGGIDSCLMIWNFKPQTRAYRFVGHEDAILSVKFSPTGQ--LVASASRDKTVRLW-VPSIKGESLVFRAHTATVRSVDISCDNLE-MVTGSDDKTIKVWKMHRQKFSYSLNEHKNWVRCVRFSSDGQLIASSSDDKTIKLWDRHNQECI-----HTFQEHGGFVPSLAFHPNGS---YIASGGTDSHVNIWDIRMNKL 216          
BLAST of WD repeat-containing protein 37 vs. Planmine SMEST
Match: SMESG000008519.1 (SMESG000008519.1)

HSP 1 Score: 65.0846 bits (157), Expect = 3.772e-11
Identity = 45/153 (29.41%), Postives = 73/153 (47.71%), Query Frame = 1
Query: 1195 DQIVTASWDRLGRIYDIATGSEVASLTGHDLPLTDVRTNPVADHALAVTASRDCTFRLWDFRCSTTEVHVQQGHNGIVSSVSF-VGNSPEKLVSAGADRACKVWDLRNSRNPLHVIRTDSPINRLAVHPNGKIVALPMDNRIVKIFDLNLGTR 1650
            D+IVT S+D+  +++    GS   +  GH   +  V+ NP +   L  T   D    LWD   S   V   QGH   V S+ F   ++ + L++   D    +WD+ N R    +I  D+ I+    + +G  VA    ++ +KI+DL +G R
Sbjct:   26 DKIVTGSFDKTAKMWSANDGSLYHTFKGHTAEVVCVQFNPSS--TLVGTGGMDTLAMLWDVE-SGKCVSNLQGHTAEVISLQFGQAHNGKHLITGSFDHTVILWDVHNGRRVSQLIGHDAEISAAVFNFDGTYVATASMDKSIKIWDLRMGAR 175          

HSP 2 Score: 57.3806 bits (137), Expect = 1.271e-8
Identity = 71/306 (23.20%), Postives = 122/306 (39.87%), Query Frame = 1
Query:  751 TACADGVVRLWNSDNGHCSLVYLGHSGSVNSVRFKNGIMLTASG--DGTAHLVNLP------------PEKISEALSSNEPGKSSVTDSIGHXXXXXXXXXTKRNINSPTEDGAESNPVENTTLILRNPNSMYQTASLYSSFGSYTYKDSAPLSAADFLLNRDQIVTASWDRLGRIYDIATGS-EVASLTGHDLPLTDVRTNPVADHALAVTASRDCTFRLWDFRCSTTEVHVQQGHNGIVSSVSFVGNSPEK--LVSAGADRACKVWDLRNSRNPLHVIR--TDSPINRLAVHPNGKIVALPMDN 1611
            T   D   ++W++++G     + GH+  V  V+F     L  +G  D  A L ++              E IS        GK  +T S  H                              T+IL + ++  + + L            A +SAA F  +   + TAS D+  +I+D+  G+ ++ +L GH   + DV  + V       +A  D T RLWD +  +    + +GH   VS V+F   +P+   L+SA AD++ + W+    +  + V+   TD   +    +   KI+    DN
Sbjct:   30 TGSFDKTAKMWSANDGSLYHTFKGHTAEVVCVQFNPSSTLVGTGGMDTLAMLWDVESGKCVSNLQGHTAEVISLQFGQAHNGKHLITGSFDH------------------------------TVILWDVHNGRRVSQLIGH--------DAEISAAVFNFDGTYVATASMDKSIKIWDLRMGARDLFTLAGHTDEVLDVTFDNVGKQ--VASAGADNTVRLWDVKDFSKPSFIFKGHEAEVSKVTF---NPQGTVLLSASADKSARTWNTTTGK-VIQVLEGHTDEIFSCAFNYDGSKIITGSKDN 291          

HSP 3 Score: 56.9954 bits (136), Expect = 1.682e-8
Identity = 53/247 (21.46%), Postives = 100/247 (40.49%), Query Frame = 1
Query: 1114 ASLYSSFGSYTYKDSAPLSAADFLLNRDQIVTASWDRLGRIYDIATGSEVASLTG-------------------------HDLPLTDV----RTNPVADH-------------ALAVTASRDCTFRLWDFRCSTTEVHVQQGHNGIVSSVSFVGNSPEKLVSAGADRACKVWDLRNSRNPLHVIRT-DSPINRLAVHPNGKIVALPMDNRIVKIFDLNLGTRIARLPRNSNQSHNRIVTSIAWNVDG 1725
             SLY +F  +T    A +    F  +   + T   D L  ++D+ +G  V++L G                         H + L DV    R + +  H                 TAS D + ++WD R    ++    GH   V  V+F  N  +++ SAGAD   ++WD+++   P  + +  ++ ++++  +P G ++     ++  + ++   G  I  L     + H   + S A+N DG
Sbjct:   45 GSLYHTFKGHT----AEVVCVQFNPSSTLVGTGGMDTLAMLWDVESGKCVSNLQGHTAEVISLQFGQAHNGKHLITGSFDHTVILWDVHNGRRVSQLIGHDAEISAAVFNFDGTYVATASMDKSIKIWDLRMGARDLFTLAGHTDEVLDVTF-DNVGKQVASAGADNTVRLWDVKDFSKPSFIFKGHEAEVSKVTFNPQGTVLLSASADKSARTWNTTTGKVIQVL-----EGHTDEIFSCAFNYDG 281          
The following BLAST results are available for this feature:
BLAST of WD repeat-containing protein 37 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
WDR371.121e-7537.40WD repeat domain 37 [Source:HGNC Symbol;Acc:HGNC:3... [more]
WDR371.121e-7537.40WD repeat domain 37 [Source:HGNC Symbol;Acc:HGNC:3... [more]
WDR374.248e-5250.93WD repeat domain 37 [Source:HGNC Symbol;Acc:HGNC:3... [more]
WDR375.264e-1931.92WD repeat domain 37 [Source:HGNC Symbol;Acc:HGNC:3... [more]
WDR379.630e-1931.92WD repeat domain 37 [Source:HGNC Symbol;Acc:HGNC:3... [more]
back to top
BLAST of WD repeat-containing protein 37 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
C05D2.101.585e-5731.71pep chromosome:WBcel235:III:5597947:5600058:-1 gen... [more]
C05D2.107.110e-5631.58pep chromosome:WBcel235:III:5597947:5600058:-1 gen... [more]
prp-44.962e-1226.09Yeast PRP (Splicing factor) related [Source:UniPr... [more]
rack-12.242e-1129.30Guanine nucleotide-binding protein subunit beta-2-... [more]
rack-12.242e-1129.30Guanine nucleotide-binding protein subunit beta-2-... [more]
back to top
BLAST of WD repeat-containing protein 37 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG123332.790e-7239.95gene:FBgn0038617 transcript:FBtr0083655[more]
Rack11.851e-1129.59gene:FBgn0020618 transcript:FBtr0079565[more]
Rack11.851e-1129.59gene:FBgn0020618 transcript:FBtr0331238[more]
Rack11.851e-1129.59gene:FBgn0020618 transcript:FBtr0345448[more]
Lis-16.490e-1030.14gene:FBgn0015754 transcript:FBtr0087241[more]
back to top
BLAST of WD repeat-containing protein 37 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
wdr373.990e-7937.33WD repeat domain 37 [Source:ZFIN;Acc:ZDB-GENE-0301... [more]
wdr373.990e-7937.33WD repeat domain 37 [Source:ZFIN;Acc:ZDB-GENE-0301... [more]
daw14.527e-1124.49dynein assembly factor with WDR repeat domains 1 [... [more]
daw16.204e-1124.49dynein assembly factor with WDR repeat domains 1 [... [more]
pafah1b1a1.433e-1024.55platelet-activating factor acetylhydrolase 1b, reg... [more]
back to top
BLAST of WD repeat-containing protein 37 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
wdr371.732e-7436.82WD repeat domain 37 [Source:NCBI gene;Acc:10012508... [more]
wdr372.073e-7436.82WD repeat domain 37 [Source:NCBI gene;Acc:10012508... [more]
wdr377.590e-7035.23WD repeat domain 37 [Source:NCBI gene;Acc:10012508... [more]
wdr376.736e-6835.48WD repeat domain 37 [Source:NCBI gene;Acc:10012508... [more]
wdr378.153e-6836.71WD repeat domain 37 [Source:NCBI gene;Acc:10012508... [more]
back to top
BLAST of WD repeat-containing protein 37 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Wdr371.974e-7637.27WD repeat domain 37 [Source:MGI Symbol;Acc:MGI:192... [more]
Wdr371.974e-7637.27WD repeat domain 37 [Source:MGI Symbol;Acc:MGI:192... [more]
Wdr371.431e-2540.96WD repeat domain 37 [Source:MGI Symbol;Acc:MGI:192... [more]
Wdr371.964e-1631.75WD repeat domain 37 [Source:MGI Symbol;Acc:MGI:192... [more]
Poc1a2.889e-1328.85POC1 centriolar protein A [Source:MGI Symbol;Acc:M... [more]
back to top
BLAST of WD repeat-containing protein 37 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5R650|WDR37_PONAB3.600e-7637.80WD repeat-containing protein 37 OS=Pongo abelii OX... [more]
sp|Q8CBE3|WDR37_MOUSE1.381e-7537.27WD repeat-containing protein 37 OS=Mus musculus OX... [more]
sp|Q9Y2I8|WDR37_HUMAN5.381e-7537.40WD repeat-containing protein 37 OS=Homo sapiens OX... [more]
sp|A4IIX9|WDR37_XENTR6.271e-7436.75WD repeat-containing protein 37 OS=Xenopus tropica... [more]
sp|Q6DDF0|WDR37_XENLA3.047e-7336.35WD repeat-containing protein 37 OS=Xenopus laevis ... [more]
back to top
BLAST of WD repeat-containing protein 37 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0X3PLG92.696e-11341.81WD repeat-containing protein 37 (Fragment) OS=Schi... [more]
A0A158QVL17.340e-10742.25Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A5K3F3Q15.303e-10642.25Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A0R3X3222.127e-10239.41Uncharacterized protein OS=Hydatigena taeniaeformi... [more]
A0A0R3W5I01.476e-10038.59Uncharacterized protein OS=Taenia asiatica OX=6051... [more]
back to top
BLAST of WD repeat-containing protein 37 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
wdr374.918e-5332.06WD repeat domain 37 [Source:ZFIN;Acc:ZDB-GENE-0301... [more]
ENSAMXT00000007662.27.775e-1230.52receptor of activated protein C kinase 1 [Source:N... [more]
ENSAMXT00000047239.19.022e-1230.52receptor of activated protein C kinase 1 [Source:N... [more]
ENSAMXT00000032472.12.207e-1128.66receptor of activated protein C kinase 1 [Source:N... [more]
taf5l3.194e-1128.04TATA-box binding protein associated factor 5 like ... [more]
back to top
BLAST of WD repeat-containing protein 37 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
wdr372.161e-7936.40WD repeat domain 37 [Source:ZFIN;Acc:ZDB-GENE-0301... [more]
wdr373.557e-7936.57WD repeat domain 37 [Source:ZFIN;Acc:ZDB-GENE-0301... [more]
POC1A1.712e-1227.75POC1 centriolar protein A [Source:HGNC Symbol;Acc:... [more]
pafah1b1b5.546e-1223.79platelet-activating factor acetylhydrolase 1b, reg... [more]
ENSPMAT00000002506.17.160e-1229.87pep scaffold:Pmarinus_7.0:GL479076:26529:32136:-1 ... [more]
back to top
BLAST of WD repeat-containing protein 37 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
ASC12.483e-1231.16G-protein beta subunit and guanine dissociation in... [more]
PRP44.228e-1229.59Splicing factor; component of the U4/U6-U5 snRNP c... [more]
TAF54.567e-1123.94Subunit (90 kDa) of TFIID and SAGA complexes; invo... [more]
PFS28.800e-1125.36Integral subunit of the pre-mRNA CPF complex; the ... [more]
TUP14.801e-1028.30General repressor of transcription; forms complex ... [more]
back to top
BLAST of WD repeat-containing protein 37 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO489101.133e-8238.04Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO348655.188e-1226.18Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO497671.161e-1130.59Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO474043.486e-1127.98Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO453463.791e-1127.27Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of WD repeat-containing protein 37 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
WDR373.206e-7635.84WD repeat domain 37 [Source:NCBI gene;Acc:10116558... [more]
wdr372.712e-7336.02WD repeat-containing protein 37 [Source:NCBI gene;... [more]
wdr374.767e-7035.14WD repeat-containing protein 37 [Source:NCBI gene;... [more]
rack13.738e-1129.87receptor for activated C kinase 1 [Source:NCBI gen... [more]
rack18.139e-1128.03receptor for activated C kinase 1 [Source:NCBI gen... [more]
back to top
BLAST of WD repeat-containing protein 37 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000023812.10.000e+0100.00SMESG000023812.1[more]
SMESG000061733.15.705e-1532.32SMESG000061733.1[more]
SMESG000061733.15.941e-1532.32SMESG000061733.1[more]
SMESG000024482.11.954e-1226.92SMESG000024482.1[more]
SMESG000008519.13.772e-1129.41SMESG000008519.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30009068 ID=SMED30009068|Name=WD repeat-containing protein 37|organism=Schmidtea mediterranea sexual|type=transcript|length=2002bp
TTTAAATAAATAATAAAACACTGAAATCAAAATTTGTAAATTGATAATTT
TTTTTGAAATATAATTTGAAATATATTATTGTGAAAATTCAACGAAAATA
TTATCAAGACGTAATTTTTAATGTTAAATTCACAATTTTCCTTGTCAAAC
GCGAATTCCAATGGTCATGATGTTCAATCTGCAAATTTAGGATTAAATTT
AATTAATAATTCATCAGCATCAGTTTCCTTAGATTCTCCTAGCAATAGTT
TCAATGTTAGTCATGGCAATATTAATAATGCAAACTCAGAGTTAATCGCT
GGAATTACTAGTTTTTGTGCTCCTCAATCATGCACTAATCCTTTAGGTGA
TGATGGAATTTTGTCTCAGGAATTTAAACAACGTCTTTGGGCATTATTCC
GCCAAATTGAATCTGAATTTGAAAAGGAATGTAAAAAAATCTATTCAGAA
AATTACGCGATTCATGATCGAAATGAAAAAATTGAATCATCTGATCATGA
AGAATCAAATTTTGCTAAGAAAATTTCTGGAAGCCACCTGTCACAGAAAA
TCAAACAGCAATATAAGCAATCTAAACAGTCGACAAGTCGACTTGTATCC
ACATTTCGCGACCGTGGATCTACAATGCCAAATATCAGTAATCAATCGCA
CCAGGGTAGCAATAGACATGCCTGTATTCTCTGCTGGCGAGTTTCTGACC
ACAGAGATGGGATATGGGAAGTAAATTGTATTGGAAGAGGATTAGTGGGA
ACAGCATGTGCTGACGGAGTCGTCCGATTATGGAACTCTGATAATGGACA
TTGCTCGTTGGTTTATTTGGGGCATTCGGGTTCGGTTAATTCTGTTCGAT
TTAAAAATGGAATTATGCTTACTGCTTCTGGCGATGGAACTGCTCATTTA
GTCAATTTGCCTCCAGAAAAAATTTCTGAAGCCCTCAGCTCAAATGAGCC
TGGGAAATCCAGTGTTACCGATAGTATCGGTCATGTTGATGATGATGTGA
TAGTTGATGATACAAAAAGAAATATTAACAGCCCGACAGAAGATGGGGCT
GAATCAAACCCTGTTGAAAATACAACATTGATACTTCGTAATCCGAATTC
TATGTATCAGACTGCTTCTCTTTATTCATCATTTGGTTCATACACATATA
AGGATTCCGCTCCGCTTTCGGCAGCAGACTTTTTGTTAAACCGCGATCAA
ATAGTCACAGCTAGTTGGGATCGGTTAGGTCGAATCTATGACATAGCAAC
AGGCAGTGAAGTAGCTAGTCTAACTGGACATGATCTCCCACTAACTGACG
TTCGAACTAATCCTGTTGCCGATCACGCATTGGCAGTTACAGCATCAAGA
GATTGCACTTTCCGCTTATGGGATTTCAGATGCAGTACTACCGAAGTGCA
TGTTCAACAGGGTCACAATGGAATCGTTTCGTCGGTGAGTTTCGTCGGCA
ATAGTCCAGAGAAATTGGTCAGCGCCGGTGCAGATCGGGCATGCAAAGTC
TGGGATTTACGAAACAGTCGTAACCCATTGCATGTCATCCGAACCGACTC
TCCAATCAATCGGCTCGCTGTCCATCCGAATGGCAAAATTGTGGCGTTAC
CAATGGACAATAGAATTGTGAAAATTTTCGATCTAAATCTTGGCACTCGC
ATCGCTCGATTGCCGCGTAATTCAAACCAAAGTCACAATCGAATAGTTAC
AAGCATTGCTTGGAATGTTGACGGAGGCGGTAAGCCGAATTTCTTCACTA
CGGGTTTCGATCAGCAGTTGATAGCGTGGCATTTACAGTTGCCGTTGCTA
AGCAGTAGCTAAACCGTTAACGTCACCGTCACAAATGAGTCTAGTCCAAT
CGTATTAATAACATCTGCCAGATCCCTATTAATCTTTCTATTTGTGATTA
TATTGATTGGTTACTCAATCAATATTTCACTTCAGATTGACTTCTCATTA
GATATCGTCTCTTGATTTCTTTTTTGTTGGCAATTTAAAATTCTCTTGTT
TC
back to top

protein sequence of SMED30009068-orf-1

>SMED30009068-orf-1 ID=SMED30009068-orf-1|Name=SMED30009068-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=564bp
MLNSQFSLSNANSNGHDVQSANLGLNLINNSSASVSLDSPSNSFNVSHGN
INNANSELIAGITSFCAPQSCTNPLGDDGILSQEFKQRLWALFRQIESEF
EKECKKIYSENYAIHDRNEKIESSDHEESNFAKKISGSHLSQKIKQQYKQ
SKQSTSRLVSTFRDRGSTMPNISNQSHQGSNRHACILCWRVSDHRDGIWE
VNCIGRGLVGTACADGVVRLWNSDNGHCSLVYLGHSGSVNSVRFKNGIML
TASGDGTAHLVNLPPEKISEALSSNEPGKSSVTDSIGHVDDDVIVDDTKR
NINSPTEDGAESNPVENTTLILRNPNSMYQTASLYSSFGSYTYKDSAPLS
AADFLLNRDQIVTASWDRLGRIYDIATGSEVASLTGHDLPLTDVRTNPVA
DHALAVTASRDCTFRLWDFRCSTTEVHVQQGHNGIVSSVSFVGNSPEKLV
SAGADRACKVWDLRNSRNPLHVIRTDSPINRLAVHPNGKIVALPMDNRIV
KIFDLNLGTRIARLPRNSNQSHNRIVTSIAWNVDGGGKPNFFTTGFDQQL
IAWHLQLPLLSSS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005737cytoplasm
GO:0030687preribosome, large subunit precursor
GO:0070545PeBoW complex
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000074oocyte
PLANA:0000231vitelline gland
Vocabulary: INTERPRO
TermDefinition
IPR036322WD40_repeat_dom_sf
IPR001680WD40_repeat
IPR015943WD40/YVTN_repeat-like_dom_sf
IPR019775WD40_repeat_CS
IPR017986WD40_repeat_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0003674molecular_function
Vocabulary: biological process
TermDefinition
GO:0000460maturation of 5.8S rRNA
GO:0000470maturation of LSU-rRNA
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001680WD40 repeatSMARTSM00320WD40_4coord: 336..374
e-value: 6.8
score: 11.7
coord: 466..504
e-value: 4.5
score: 12.8
coord: 512..554
e-value: 2.7
score: 14.3
coord: 182..222
e-value: 0.76
score: 17.8
coord: 377..418
e-value: 2.5E-4
score: 30.4
coord: 422..462
e-value: 2.2E-7
score: 40.5
coord: 225..262
e-value: 0.034
score: 23.3
IPR001680WD40 repeatPFAMPF00400WD40coord: 379..418
e-value: 0.0031
score: 18.3
coord: 426..462
e-value: 0.0054
score: 17.5
IPR001680WD40 repeatPROSITEPS50082WD_REPEATS_2coord: 429..471
score: 11.778
IPR001680WD40 repeatPROSITEPS50082WD_REPEATS_2coord: 384..420
score: 9.305
IPR015943WD40/YVTN repeat-like-containing domain superfamilyGENE3DG3DSA:2.130.10.10coord: 146..296
e-value: 3.3E-13
score: 51.0
IPR015943WD40/YVTN repeat-like-containing domain superfamilyGENE3DG3DSA:2.130.10.10coord: 315..468
e-value: 3.9E-25
score: 90.9
IPR015943WD40/YVTN repeat-like-containing domain superfamilyGENE3DG3DSA:2.130.10.10coord: 469..557
e-value: 9.6E-10
score: 40.2
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 146..176
NoneNo IPR availablePANTHERPTHR19855WD40 REPEAT PROTEIN 12, 37coord: 79..549
NoneNo IPR availablePANTHERPTHR19855:SF12WD REPEAT-CONTAINING PROTEIN 37coord: 79..549
IPR019775WD40 repeat, conserved sitePROSITEPS00678WD_REPEATS_1coord: 449..463
IPR019775WD40 repeat, conserved sitePROSITEPS00678WD_REPEATS_1coord: 209..223
IPR017986WD40-repeat-containing domainPROSITEPS50294WD_REPEATS_REGIONcoord: 191..271
score: 11.207
IPR017986WD40-repeat-containing domainPROSITEPS50294WD_REPEATS_REGIONcoord: 342..563
score: 25.707
IPR036322WD40-repeat-containing domain superfamilySUPERFAMILYSSF50978WD40 repeat-likecoord: 188..553