60S ribosomal protein L18

Overview
Name60S ribosomal protein L18
Smed IDSMED30009052
Length (bp)664
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of 60S ribosomal protein L18 (SMED30009052) t-SNE clustered cells

Violin plots show distribution of expression levels for 60S ribosomal protein L18 (SMED30009052) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of 60S ribosomal protein L18 (SMED30009052) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for 60S ribosomal protein L18 (SMED30009052) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30009052

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 20

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30009052SMESG000017166.1 SmedASXL_018666SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30009052SMESG000017166.1 SmedASXL_018666SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
pharynxSMED30009052SMESG000017166.1 dd_Smed_v4_128_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30009052SMESG000017166.1 dd_Smed_v4_128_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30009052SMESG000017166.1 dd_Smed_v4_128_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30009052SMESG000017166.1 dd_Smed_v4_128_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30009052SMESG000017166.1 dd_Smed_v4_128_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30009052SMESG000017166.1 dd_Smed_v4_128_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30009052SMESG000017166.1 dd_Smed_v4_128_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30009052SMESG000017166.1 dd_Smed_v4_128_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30009052SMESG000017166.1 dd_Smed_v4_128_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30009052SMESG000017166.1 dd_Smed_v4_128_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30009052SMESG000017166.1 dd_Smed_v4_128_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30009052SMESG000017166.1 Contig45631uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30009052SMESG000017166.1 Contig45631newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
neoblastSMED30009052SMESG000017166.1 dd_Smed_v6_128_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gamma neoblastSMED30009052SMESG000017166.1 dd_Smed_v6_128_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pharynx progenitor cellSMED30009052SMESG000017166.1 dd_Smed_v6_128_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Category 4 cellSMED30009052SMESG000017166.1 NB.38.10esmed_ncbi_20200123PMID:18786419
Eisenhoffer et al., 2008
whole organism asexual adult colorimetric in situ hybridization evidence
Category 4 cellSMED30009052SMESG000017166.1 NB.38.10esmed_ncbi_20200123PMID:18786419
Eisenhoffer et al., 2008
whole organism asexual adult cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of 60S ribosomal protein L18 vs. Ensembl Human
Match: RPL18 (ribosomal protein L18 [Source:HGNC Symbol;Acc:HGNC:10310])

HSP 1 Score: 195.282 bits (495), Expect = 7.166e-63
Identity = 95/169 (56.21%), Postives = 127/169 (75.15%), Query Frame = 3
Query:   63 MGIDISH-KTRIVKRTTPVSNDTYTRINFKLFSFLHRRTEKKFHGIIAKRLAMARRLRQPLSIARLMKQMKKPGREEKIAVVVGTVTDDLRIREVPKMTLCAQRVTAGARARILKAGGEIITLDELAVRAPLGKGTVLLQGPRSQTTSQKYFGPAPGVPHSHTRPHVRS 566
            MG+DI H K R V+R  P S D Y R+  KL+ FL RRT   F+ ++ KRL M+R  R PLS++R++++MK PGRE K AVVVGT+TDD+R++EVPK+ +CA RVT+ AR+RIL+AGG+I+T D+LA+ +P G GTVLL GPR      ++FG APG PHSHT+P+VRS
Sbjct:    1 MGVDIRHNKDRKVRRKEPKSQDIYLRLLVKLYRFLARRTNSTFNQVVLKRLFMSRTNRPPLSLSRMIRKMKLPGRENKTAVVVGTITDDVRVQEVPKLKVCALRVTSRARSRILRAGGKILTFDQLALDSPKGCGTVLLSGPRKGREVYRHFGKAPGTPHSHTKPYVRS 169          
BLAST of 60S ribosomal protein L18 vs. Ensembl Human
Match: RPL18 (ribosomal protein L18 [Source:HGNC Symbol;Acc:HGNC:10310])

HSP 1 Score: 192.586 bits (488), Expect = 9.582e-62
Identity = 94/168 (55.95%), Postives = 126/168 (75.00%), Query Frame = 3
Query:   66 GIDISH-KTRIVKRTTPVSNDTYTRINFKLFSFLHRRTEKKFHGIIAKRLAMARRLRQPLSIARLMKQMKKPGREEKIAVVVGTVTDDLRIREVPKMTLCAQRVTAGARARILKAGGEIITLDELAVRAPLGKGTVLLQGPRSQTTSQKYFGPAPGVPHSHTRPHVRS 566
            G+DI H K R V+R  P S D Y R+  KL+ FL RRT   F+ ++ KRL M+R  R PLS++R++++MK PGRE K AVVVGT+TDD+R++EVPK+ +CA RVT+ AR+RIL+AGG+I+T D+LA+ +P G GTVLL GPR      ++FG APG PHSHT+P+VRS
Sbjct:    4 GVDIRHNKDRKVRRKEPKSQDIYLRLLVKLYRFLARRTNSTFNQVVLKRLFMSRTNRPPLSLSRMIRKMKLPGRENKTAVVVGTITDDVRVQEVPKLKVCALRVTSRARSRILRAGGKILTFDQLALDSPKGCGTVLLSGPRKGREVYRHFGKAPGTPHSHTKPYVRS 171          
BLAST of 60S ribosomal protein L18 vs. Ensembl Human
Match: RPL18 (ribosomal protein L18 [Source:HGNC Symbol;Acc:HGNC:10310])

HSP 1 Score: 186.422 bits (472), Expect = 1.211e-59
Identity = 91/164 (55.49%), Postives = 122/164 (74.39%), Query Frame = 3
Query:   63 MGIDISH-KTRIVKRTTPVSNDTYTRINFKLFSFLHRRTEKKFHGIIAKRLAMARRLRQPLSIARLMKQMKKPGREEKIAVVVGTVTDDLRIREVPKMTLCAQRVTAGARARILKAGGEIITLDELAVRAPLGKGTVLLQGPRSQTTSQKYFGPAPGVPHSHTR 551
            MG+DI H K R V+R  P S D Y R+  KL+ FL RRT   F+ ++ KRL M+R  R PLS++R++++MK PGRE K AVVVGT+TDD+R++EVPK+ +CA RVT+ AR+RIL+AGG+I+T D+LA+ +P G GTVLL GPR      ++FG APG PHSHT+
Sbjct:    1 MGVDIRHNKDRKVRRKEPKSQDIYLRLLVKLYRFLARRTNSTFNQVVLKRLFMSRTNRPPLSLSRMIRKMKLPGRENKTAVVVGTITDDVRVQEVPKLKVCALRVTSRARSRILRAGGKILTFDQLALDSPKGCGTVLLSGPRKGREVYRHFGKAPGTPHSHTK 164          
BLAST of 60S ribosomal protein L18 vs. Ensembl Human
Match: RPL18 (ribosomal protein L18 [Source:HGNC Symbol;Acc:HGNC:10310])

HSP 1 Score: 171.014 bits (432), Expect = 1.109e-53
Identity = 80/139 (57.55%), Postives = 109/139 (78.42%), Query Frame = 3
Query:  150 LFSFLHRRTEKKFHGIIAKRLAMARRLRQPLSIARLMKQMKKPGREEKIAVVVGTVTDDLRIREVPKMTLCAQRVTAGARARILKAGGEIITLDELAVRAPLGKGTVLLQGPRSQTTSQKYFGPAPGVPHSHTRPHVRS 566
            L+ FL RRT   F+ ++ KRL M+R  R PLS++R++++MK PGRE K AVVVGT+TDD+R++EVPK+ +CA RVT+ AR+RIL+AGG+I+T D+LA+ +P G GTVLL GPR      ++FG APG PHSHT+P+VRS
Sbjct:    2 LYRFLARRTNSTFNQVVLKRLFMSRTNRPPLSLSRMIRKMKLPGRENKTAVVVGTITDDVRVQEVPKLKVCALRVTSRARSRILRAGGKILTFDQLALDSPKGCGTVLLSGPRKGREVYRHFGKAPGTPHSHTKPYVRS 140          
BLAST of 60S ribosomal protein L18 vs. Ensembl Human
Match: RPL18 (ribosomal protein L18 [Source:HGNC Symbol;Acc:HGNC:10310])

HSP 1 Score: 165.622 bits (418), Expect = 2.018e-51
Identity = 81/146 (55.48%), Postives = 110/146 (75.34%), Query Frame = 3
Query:  147 KLFSFLHRRTEKKFHGIIAKRLAMARRLRQPLSIARLMKQMKKPGREEKIAVVVGTVTDDLRIREVPKM------TLCAQRVTAGARARILKAGGEIITLDELAVRAPLGKGTVLLQGPRSQTTSQKYFGPAPGVPHSHTRPHVRS 566
            KL+ FL RRT   F+ ++ KRL M+R  R PLS++R++++MK PGRE K AVVVGT+TDD+R++EVPK+       +CA RVT+ AR+RIL+AGG+I+T D+LA+ +P G GTVLL GPR      ++FG APG PHSHT+P+VRS
Sbjct:    3 KLYRFLARRTNSTFNQVVLKRLFMSRTNRPPLSLSRMIRKMKLPGRENKTAVVVGTITDDVRVQEVPKLKPCPLHQVCALRVTSRARSRILRAGGKILTFDQLALDSPKGCGTVLLSGPRKGREVYRHFGKAPGTPHSHTKPYVRS 148          
BLAST of 60S ribosomal protein L18 vs. Ensembl Celegans
Match: rpl-18 (60S ribosomal protein L18 [Source:UniProtKB/Swiss-Prot;Acc:O45946])

HSP 1 Score: 203.371 bits (516), Expect = 1.813e-66
Identity = 99/169 (58.58%), Postives = 130/169 (76.92%), Query Frame = 3
Query:   63 MGIDISHK-TRIVKRTTPVSNDTYTRINFKLFSFLHRRTEKKFHGIIAKRLAMARRLRQPLSIARLMKQMKKPGREEKIAVVVGTVTDDLRIREVPKMTLCAQRVTAGARARILKAGGEIITLDELAVRAPLGKGTVLLQGPRSQTTSQKYFGPAPGVPHSHTRPHVRS 566
            MGIDI+HK  R+ +RT P S + Y R+  KL++FL RRT +KF+ I+ KRL M+RR RQPLS+A+L + ++K G E K  V + TVTDD R+  VPK+++ A  VT GARARIL AGGEIITLD+LA+++P G+ TV LQGPRS   ++K+FGPAPGVPHSHT+P+VRS
Sbjct:    1 MGIDINHKHDRVARRTAPKSENPYLRLLSKLYAFLARRTGEKFNAIVLKRLRMSRRNRQPLSLAKLARAVQKAGNENKTVVTLSTVTDDARLYTVPKISVAALHVTEGARARILAAGGEIITLDQLALKSPKGENTVFLQGPRSAREAEKHFGPAPGVPHSHTKPYVRS 169          
BLAST of 60S ribosomal protein L18 vs. Ensembl Celegans
Match: rpl-18 (60S ribosomal protein L18 [Source:UniProtKB/Swiss-Prot;Acc:O45946])

HSP 1 Score: 203.371 bits (516), Expect = 1.813e-66
Identity = 99/169 (58.58%), Postives = 130/169 (76.92%), Query Frame = 3
Query:   63 MGIDISHK-TRIVKRTTPVSNDTYTRINFKLFSFLHRRTEKKFHGIIAKRLAMARRLRQPLSIARLMKQMKKPGREEKIAVVVGTVTDDLRIREVPKMTLCAQRVTAGARARILKAGGEIITLDELAVRAPLGKGTVLLQGPRSQTTSQKYFGPAPGVPHSHTRPHVRS 566
            MGIDI+HK  R+ +RT P S + Y R+  KL++FL RRT +KF+ I+ KRL M+RR RQPLS+A+L + ++K G E K  V + TVTDD R+  VPK+++ A  VT GARARIL AGGEIITLD+LA+++P G+ TV LQGPRS   ++K+FGPAPGVPHSHT+P+VRS
Sbjct:    1 MGIDINHKHDRVARRTAPKSENPYLRLLSKLYAFLARRTGEKFNAIVLKRLRMSRRNRQPLSLAKLARAVQKAGNENKTVVTLSTVTDDARLYTVPKISVAALHVTEGARARILAAGGEIITLDQLALKSPKGENTVFLQGPRSAREAEKHFGPAPGVPHSHTKPYVRS 169          
BLAST of 60S ribosomal protein L18 vs. Ensembl Fly
Match: RpL18 (gene:FBgn0035753 transcript:FBtr0333370)

HSP 1 Score: 190.66 bits (483), Expect = 2.186e-61
Identity = 99/169 (58.58%), Postives = 123/169 (72.78%), Query Frame = 3
Query:   63 MGIDISHK-TRIVKRTTPVSNDTYTRINFKLFSFLHRRTEKKFHGIIAKRLAMARRLRQPLSIARLMKQMKKPGREEKIAVVVGTVTDDLRIREVPKMTLCAQRVTAGARARILKAGGEIITLDELAVRAPLGKGTVLLQGPRSQTTSQKYFGPAPGVPHSHTRPHVRS 566
            MGIDI+HK  R V+RT P S D Y R+  KL+ FL RRT KKF+ II KRL M++  R PLS+ R+ +  K   + E   VVVGTVTDD R+  VPK+T+CA  VT  AR RILKAGGE++T D+LA+R+P GK T+LLQG R+  T+ K+FG APGVPHSHTRP+VRS
Sbjct:    1 MGIDINHKYDRKVRRTEPKSQDVYLRLLVKLYRFLQRRTNKKFNRIILKRLFMSKINRPPLSLQRIARFFKAANQPESTIVVVGTVTDDARLLVVPKLTVCALHVTQTARERILKAGGEVLTFDQLALRSPTGKNTLLLQGRRTARTACKHFGKAPGVPHSHTRPYVRS 169          
BLAST of 60S ribosomal protein L18 vs. Ensembl Fly
Match: RpL18 (gene:FBgn0035753 transcript:FBtr0076892)

HSP 1 Score: 190.66 bits (483), Expect = 2.186e-61
Identity = 99/169 (58.58%), Postives = 123/169 (72.78%), Query Frame = 3
Query:   63 MGIDISHK-TRIVKRTTPVSNDTYTRINFKLFSFLHRRTEKKFHGIIAKRLAMARRLRQPLSIARLMKQMKKPGREEKIAVVVGTVTDDLRIREVPKMTLCAQRVTAGARARILKAGGEIITLDELAVRAPLGKGTVLLQGPRSQTTSQKYFGPAPGVPHSHTRPHVRS 566
            MGIDI+HK  R V+RT P S D Y R+  KL+ FL RRT KKF+ II KRL M++  R PLS+ R+ +  K   + E   VVVGTVTDD R+  VPK+T+CA  VT  AR RILKAGGE++T D+LA+R+P GK T+LLQG R+  T+ K+FG APGVPHSHTRP+VRS
Sbjct:    1 MGIDINHKYDRKVRRTEPKSQDVYLRLLVKLYRFLQRRTNKKFNRIILKRLFMSKINRPPLSLQRIARFFKAANQPESTIVVVGTVTDDARLLVVPKLTVCALHVTQTARERILKAGGEVLTFDQLALRSPTGKNTLLLQGRRTARTACKHFGKAPGVPHSHTRPYVRS 169          
BLAST of 60S ribosomal protein L18 vs. Ensembl Fly
Match: RpL18 (gene:FBgn0035753 transcript:FBtr0345036)

HSP 1 Score: 190.66 bits (483), Expect = 2.186e-61
Identity = 99/169 (58.58%), Postives = 123/169 (72.78%), Query Frame = 3
Query:   63 MGIDISHK-TRIVKRTTPVSNDTYTRINFKLFSFLHRRTEKKFHGIIAKRLAMARRLRQPLSIARLMKQMKKPGREEKIAVVVGTVTDDLRIREVPKMTLCAQRVTAGARARILKAGGEIITLDELAVRAPLGKGTVLLQGPRSQTTSQKYFGPAPGVPHSHTRPHVRS 566
            MGIDI+HK  R V+RT P S D Y R+  KL+ FL RRT KKF+ II KRL M++  R PLS+ R+ +  K   + E   VVVGTVTDD R+  VPK+T+CA  VT  AR RILKAGGE++T D+LA+R+P GK T+LLQG R+  T+ K+FG APGVPHSHTRP+VRS
Sbjct:    1 MGIDINHKYDRKVRRTEPKSQDVYLRLLVKLYRFLQRRTNKKFNRIILKRLFMSKINRPPLSLQRIARFFKAANQPESTIVVVGTVTDDARLLVVPKLTVCALHVTQTARERILKAGGEVLTFDQLALRSPTGKNTLLLQGRRTARTACKHFGKAPGVPHSHTRPYVRS 169          
BLAST of 60S ribosomal protein L18 vs. Ensembl Zebrafish
Match: rpl18 (ribosomal protein L18 [Source:ZFIN;Acc:ZDB-GENE-040801-165])

HSP 1 Score: 186.422 bits (472), Expect = 1.324e-59
Identity = 91/169 (53.85%), Postives = 125/169 (73.96%), Query Frame = 3
Query:   63 MGIDISH-KTRIVKRTTPVSNDTYTRINFKLFSFLHRRTEKKFHGIIAKRLAMARRLRQPLSIARLMKQMKKPGREEKIAVVVGTVTDDLRIREVPKMTLCAQRVTAGARARILKAGGEIITLDELAVRAPLGKGTVLLQGPRSQTTSQKYFGPAPGVPHSHTRPHVRS 566
            MG+DI H K R V R  P S D Y R+  KL+ FL RR++  F+ +I +RL M++  R PL+++RL+++MK PGRE   AVVVGT+TDD+RI+ +PK+ +CA +VT  AR+RILKAGG+I+T D+LA+ +P G+GTVLL GPR      ++FG APG PHSHT+P+VRS
Sbjct:    1 MGVDIRHNKDRKVHRKEPKSQDIYLRLLVKLYRFLSRRSDAPFNKVILRRLFMSKTNRPPLALSRLIRKMKLPGRENLTAVVVGTITDDVRIQNIPKLKVCALKVTDRARSRILKAGGQIMTFDQLALTSPRGRGTVLLSGPRKGRQVYRHFGKAPGTPHSHTKPYVRS 169          
BLAST of 60S ribosomal protein L18 vs. Ensembl Zebrafish
Match: rpl18 (ribosomal protein L18 [Source:ZFIN;Acc:ZDB-GENE-040801-165])

HSP 1 Score: 186.422 bits (472), Expect = 1.324e-59
Identity = 91/169 (53.85%), Postives = 125/169 (73.96%), Query Frame = 3
Query:   63 MGIDISH-KTRIVKRTTPVSNDTYTRINFKLFSFLHRRTEKKFHGIIAKRLAMARRLRQPLSIARLMKQMKKPGREEKIAVVVGTVTDDLRIREVPKMTLCAQRVTAGARARILKAGGEIITLDELAVRAPLGKGTVLLQGPRSQTTSQKYFGPAPGVPHSHTRPHVRS 566
            MG+DI H K R V R  P S D Y R+  KL+ FL RR++  F+ +I +RL M++  R PL+++RL+++MK PGRE   AVVVGT+TDD+RI+ +PK+ +CA +VT  AR+RILKAGG+I+T D+LA+ +P G+GTVLL GPR      ++FG APG PHSHT+P+VRS
Sbjct:    1 MGVDIRHNKDRKVHRKEPKSQDIYLRLLVKLYRFLSRRSDAPFNKVILRRLFMSKTNRPPLALSRLIRKMKLPGRENLTAVVVGTITDDVRIQNIPKLKVCALKVTDRARSRILKAGGQIMTFDQLALTSPRGRGTVLLSGPRKGRQVYRHFGKAPGTPHSHTKPYVRS 169          
BLAST of 60S ribosomal protein L18 vs. Ensembl Zebrafish
Match: rpl18 (ribosomal protein L18 [Source:ZFIN;Acc:ZDB-GENE-040801-165])

HSP 1 Score: 177.948 bits (450), Expect = 1.306e-56
Identity = 87/164 (53.05%), Postives = 120/164 (73.17%), Query Frame = 3
Query:   63 MGIDISH-KTRIVKRTTPVSNDTYTRINFKLFSFLHRRTEKKFHGIIAKRLAMARRLRQPLSIARLMKQMKKPGREEKIAVVVGTVTDDLRIREVPKMTLCAQRVTAGARARILKAGGEIITLDELAVRAPLGKGTVLLQGPRSQTTSQKYFGPAPGVPHSHTR 551
            MG+DI H K R V R  P S D Y R+  KL+ FL RR++  F+ +I +RL M++  R PL+++RL+++MK PGRE   AVVVGT+TDD+RI+ +PK+ +CA +VT  AR+RILKAGG+I+T D+LA+ +P G+GTVLL GPR      ++FG APG PHSHT+
Sbjct:    1 MGVDIRHNKDRKVHRKEPKSQDIYLRLLVKLYRFLSRRSDAPFNKVILRRLFMSKTNRPPLALSRLIRKMKLPGRENLTAVVVGTITDDVRIQNIPKLKVCALKVTDRARSRILKAGGQIMTFDQLALTSPRGRGTVLLSGPRKGRQVYRHFGKAPGTPHSHTK 164          
BLAST of 60S ribosomal protein L18 vs. Ensembl Zebrafish
Match: rpl18 (ribosomal protein L18 [Source:ZFIN;Acc:ZDB-GENE-040801-165])

HSP 1 Score: 157.532 bits (397), Expect = 1.561e-48
Identity = 82/168 (48.81%), Postives = 112/168 (66.67%), Query Frame = 3
Query:   66 GIDISH-KTRIVKRTTPVSNDTYTRINFKLFSFLHRRTEKKFHGIIAKRLAMARRLRQPLSIARLMKQMKKPGREEKIAVVVGTVTDDLRIREVPKMTLCAQRVTAGARARILKAGGEIITLDELAVRAPLGKGTVLLQGPRSQTTSQKYFGPAPGVPHSHTRPHVRS 566
            G+DI H K R V R  P S D Y R+  KL+ FL RR++  F+ +I +RL M++  R PL+++RL+++MK PGRE   AVVVGT+TDD+RI+ +PK                LKAGG+I+T D+LA+ +P G+GTVLL GPR      ++FG APG PHSHT+P+VRS
Sbjct:    2 GVDIRHNKDRKVHRKEPKSQDIYLRLLVKLYRFLSRRSDAPFNKVILRRLFMSKTNRPPLALSRLIRKMKLPGRENLTAVVVGTITDDVRIQNIPK----------------LKAGGQIMTFDQLALTSPRGRGTVLLSGPRKGRQVYRHFGKAPGTPHSHTKPYVRS 153          
BLAST of 60S ribosomal protein L18 vs. Ensembl Xenopus
Match: rpl18 (ribosomal protein L18 [Source:NCBI gene;Acc:496439])

HSP 1 Score: 188.734 bits (478), Expect = 2.638e-60
Identity = 92/169 (54.44%), Postives = 123/169 (72.78%), Query Frame = 3
Query:   63 MGIDISH-KTRIVKRTTPVSNDTYTRINFKLFSFLHRRTEKKFHGIIAKRLAMARRLRQPLSIARLMKQMKKPGREEKIAVVVGTVTDDLRIREVPKMTLCAQRVTAGARARILKAGGEIITLDELAVRAPLGKGTVLLQGPRSQTTSQKYFGPAPGVPHSHTRPHVRS 566
            MG+DI H K R V+R  P S D Y R+  KL+ FL RRT   F+ ++ KRL M+R  R PLS++RL+++MK  GRE K AVVVG +TDD+RI ++PK+ +CA ++T GAR+RILKAGG+I+T D+LA+ AP G+ TVLL GPR      ++FG APG PHSHT+P+V S
Sbjct:    1 MGVDIRHNKDRKVRRKEPKSQDIYLRLLVKLYRFLARRTNSSFNRVVLKRLFMSRTNRPPLSLSRLIRKMKLTGRENKTAVVVGCITDDVRIHDIPKLKVCALKMTGGARSRILKAGGQIMTFDQLALAAPKGQNTVLLSGPRKAREVYRHFGKAPGTPHSHTKPYVLS 169          
BLAST of 60S ribosomal protein L18 vs. Ensembl Mouse
Match: Rpl18 (ribosomal protein L18 [Source:MGI Symbol;Acc:MGI:98003])

HSP 1 Score: 175.252 bits (443), Expect = 4.090e-55
Identity = 97/169 (57.40%), Postives = 127/169 (75.15%), Query Frame = 3
Query:   63 MGIDISH-KTRIVKRTTPVSNDTYTRINFKLFSFLHRRTEKKFHGIIAKRLAMARRLRQPLSIARLMKQMKKPGREEKIAVVVGTVTDDLRIREVPKMTLCAQRVTAGARARILKAGGEIITLDELAVRAPLGKGTVLLQGPRSQTTSQKYFGPAPGVPHSHTRPHVRS 566
            MG+DI H K R V+R  P S D Y R+  KL+ FL RRT   F+ ++ KRL M+R  R PLS++R++++MK PGRE K AVVVGTVTDD+RI EVPK+ +CA RV++ AR+RILKAGG+I+T D+LA+ +P G+GTVLL GPR      ++FG APG PHSHT+P+VRS
Sbjct:    1 MGVDIRHNKDRKVRRKEPKSQDIYLRLLVKLYRFLARRTNSTFNQVVLKRLFMSRTNRPPLSLSRMIRKMKLPGRENKTAVVVGTVTDDVRILEVPKLKVCALRVSSRARSRILKAGGKILTFDQLALESPKGRGTVLLSGPRKGREVYRHFGKAPGTPHSHTKPYVRS 169          
BLAST of 60S ribosomal protein L18 vs. Ensembl Mouse
Match: Rpl18 (ribosomal protein L18 [Source:MGI Symbol;Acc:MGI:98003])

HSP 1 Score: 175.252 bits (443), Expect = 4.090e-55
Identity = 97/169 (57.40%), Postives = 127/169 (75.15%), Query Frame = 3
Query:   63 MGIDISH-KTRIVKRTTPVSNDTYTRINFKLFSFLHRRTEKKFHGIIAKRLAMARRLRQPLSIARLMKQMKKPGREEKIAVVVGTVTDDLRIREVPKMTLCAQRVTAGARARILKAGGEIITLDELAVRAPLGKGTVLLQGPRSQTTSQKYFGPAPGVPHSHTRPHVRS 566
            MG+DI H K R V+R  P S D Y R+  KL+ FL RRT   F+ ++ KRL M+R  R PLS++R++++MK PGRE K AVVVGTVTDD+RI EVPK+ +CA RV++ AR+RILKAGG+I+T D+LA+ +P G+GTVLL GPR      ++FG APG PHSHT+P+VRS
Sbjct:    1 MGVDIRHNKDRKVRRKEPKSQDIYLRLLVKLYRFLARRTNSTFNQVVLKRLFMSRTNRPPLSLSRMIRKMKLPGRENKTAVVVGTVTDDVRILEVPKLKVCALRVSSRARSRILKAGGKILTFDQLALESPKGRGTVLLSGPRKGREVYRHFGKAPGTPHSHTKPYVRS 169          
BLAST of 60S ribosomal protein L18 vs. Ensembl Mouse
Match: Rpl18 (ribosomal protein L18 [Source:MGI Symbol;Acc:MGI:98003])

HSP 1 Score: 150.214 bits (378), Expect = 9.024e-46
Identity = 82/139 (58.99%), Postives = 109/139 (78.42%), Query Frame = 3
Query:  150 LFSFLHRRTEKKFHGIIAKRLAMARRLRQPLSIARLMKQMKKPGREEKIAVVVGTVTDDLRIREVPKMTLCAQRVTAGARARILKAGGEIITLDELAVRAPLGKGTVLLQGPRSQTTSQKYFGPAPGVPHSHTRPHVRS 566
            L+ FL RRT   F+ ++ KRL M+R  R PLS++R++++MK PGRE K AVVVGTVTDD+RI EVPK+ +CA RV++ AR+RILKAGG+I+T D+LA+ +P G+GTVLL GPR      ++FG APG PHSHT+P+VRS
Sbjct:    2 LYRFLARRTNSTFNQVVLKRLFMSRTNRPPLSLSRMIRKMKLPGRENKTAVVVGTVTDDVRILEVPKLKVCALRVSSRARSRILKAGGKILTFDQLALESPKGRGTVLLSGPRKGREVYRHFGKAPGTPHSHTKPYVRS 140          
BLAST of 60S ribosomal protein L18 vs. Ensembl Mouse
Match: Rpl18 (ribosomal protein L18 [Source:MGI Symbol;Acc:MGI:98003])

HSP 1 Score: 134.42 bits (337), Expect = 1.267e-39
Identity = 74/169 (43.79%), Postives = 99/169 (58.58%), Query Frame = 3
Query:   63 MGIDISH-KTRIVKRTTPVSNDTYTRINFKLFSFLHRRTEKKFHGIIAKRLAMARRLRQPLSIARLMKQMKKPGREEKIAVVVGTVTDDLRIREVPKMTLCAQRVTAGARARILKAGGEIITLDELAVRAPLGKGTVLLQGPRSQTTSQKYFGPAPGVPHSHTRPHVRS 566
            MG+DI H K R V+R  P S D Y R+  KL+ FL RRT   F+ ++ KRL M+R  R PLS++R+                                 +CA RV++ AR+RILKAGG+I+T D+LA+ +P G+GTVLL GPR      ++FG APG PHSHT+P+VRS
Sbjct:    1 MGVDIRHNKDRKVRRKEPKSQDIYLRLLVKLYRFLARRTNSTFNQVVLKRLFMSRTNRPPLSLSRM---------------------------------VCALRVSSRARSRILKAGGKILTFDQLALESPKGRGTVLLSGPRKGREVYRHFGKAPGTPHSHTKPYVRS 136          
BLAST of 60S ribosomal protein L18 vs. Ensembl Mouse
Match: Rpl18 (ribosomal protein L18 [Source:MGI Symbol;Acc:MGI:98003])

HSP 1 Score: 129.798 bits (325), Expect = 4.271e-38
Identity = 72/117 (61.54%), Postives = 95/117 (81.20%), Query Frame = 3
Query:  216 MARRLRQPLSIARLMKQMKKPGREEKIAVVVGTVTDDLRIREVPKMTLCAQRVTAGARARILKAGGEIITLDELAVRAPLGKGTVLLQGPRSQTTSQKYFGPAPGVPHSHTRPHVRS 566
            M+R  R PLS++R++++MK PGRE K AVVVGTVTDD+RI EVPK+ +CA RV++ AR+RILKAGG+I+T D+LA+ +P G+GTVLL GPR      ++FG APG PHSHT+P+VRS
Sbjct:    1 MSRTNRPPLSLSRMIRKMKLPGRENKTAVVVGTVTDDVRILEVPKLKVCALRVSSRARSRILKAGGKILTFDQLALESPKGRGTVLLSGPRKGREVYRHFGKAPGTPHSHTKPYVRS 117          
BLAST of 60S ribosomal protein L18 vs. UniProt/SwissProt
Match: sp|A3F4S0|RL18_TAEAS (60S ribosomal protein L18 OS=Taenia asiatica OX=60517 GN=RPL18 PE=2 SV=1)

HSP 1 Score: 219.55 bits (558), Expect = 8.301e-72
Identity = 108/169 (63.91%), Postives = 136/169 (80.47%), Query Frame = 3
Query:   63 MGIDISHKT-RIVKRTTPVSNDTYTRINFKLFSFLHRRTEKKFHGIIAKRLAMARRLRQPLSIARLMKQMKKPGREEKIAVVVGTVTDDLRIREVPKMTLCAQRVTAGARARILKAGGEIITLDELAVRAPLGKGTVLLQGPRSQTTSQKYFGPAPGVPHSHTRPHVRS 566
            MGIDISH+  R V R  P S D Y R+  KL+ FL RRT  KF+ I+ +RL M+R  R PLS++RL +QMKKPGRE KIAVV+GTVT+D+R+REVPK+T+CA RVTAGAR RILKAGG+++T+D+LA++APLGKGTVLLQGPR    + ++FGPAPGVP SHT+P+V S
Sbjct:    1 MGIDISHRNKRKVVRRNPKSGDVYLRLMVKLYKFLARRTHSKFNNIVKRRLFMSRINRAPLSLSRLTRQMKKPGREGKIAVVIGTVTNDIRMREVPKLTVCALRVTAGARTRILKAGGKVMTVDQLALKAPLGKGTVLLQGPRKAREACRHFGPAPGVPGSHTKPYVIS 169          
BLAST of 60S ribosomal protein L18 vs. UniProt/SwissProt
Match: sp|Q60P81|RL18_CAEBR (60S ribosomal protein L18 OS=Caenorhabditis briggsae OX=6238 GN=rpl-18 PE=3 SV=1)

HSP 1 Score: 209.92 bits (533), Expect = 7.249e-68
Identity = 103/169 (60.95%), Postives = 132/169 (78.11%), Query Frame = 3
Query:   63 MGIDISHK-TRIVKRTTPVSNDTYTRINFKLFSFLHRRTEKKFHGIIAKRLAMARRLRQPLSIARLMKQMKKPGREEKIAVVVGTVTDDLRIREVPKMTLCAQRVTAGARARILKAGGEIITLDELAVRAPLGKGTVLLQGPRSQTTSQKYFGPAPGVPHSHTRPHVRS 566
            MGIDISHK  R+ +RT P S + Y R+  KL++FL RRT +KF+ I+ KRL M+RR RQPLS+A++ + +K+ G E+K  V + TVTDD R+ EVPK++L A  VT GARARIL AGGEIITLD+LA+R+P G+ TV LQGPRS   ++K+FGPAPGVPHSHT+PHVRS
Sbjct:    1 MGIDISHKHDRVARRTAPKSENPYLRLLSKLYAFLARRTGEKFNAIVLKRLRMSRRNRQPLSLAKVARVVKQAGNEKKTVVTLSTVTDDARLYEVPKISLAALHVTEGARARILAAGGEIITLDQLALRSPKGENTVFLQGPRSAREAEKHFGPAPGVPHSHTKPHVRS 169          
BLAST of 60S ribosomal protein L18 vs. UniProt/SwissProt
Match: sp|O45946|RL18_CAEEL (60S ribosomal protein L18 OS=Caenorhabditis elegans OX=6239 GN=rpl-18 PE=3 SV=1)

HSP 1 Score: 203.371 bits (516), Expect = 2.306e-65
Identity = 99/169 (58.58%), Postives = 130/169 (76.92%), Query Frame = 3
Query:   63 MGIDISHK-TRIVKRTTPVSNDTYTRINFKLFSFLHRRTEKKFHGIIAKRLAMARRLRQPLSIARLMKQMKKPGREEKIAVVVGTVTDDLRIREVPKMTLCAQRVTAGARARILKAGGEIITLDELAVRAPLGKGTVLLQGPRSQTTSQKYFGPAPGVPHSHTRPHVRS 566
            MGIDI+HK  R+ +RT P S + Y R+  KL++FL RRT +KF+ I+ KRL M+RR RQPLS+A+L + ++K G E K  V + TVTDD R+  VPK+++ A  VT GARARIL AGGEIITLD+LA+++P G+ TV LQGPRS   ++K+FGPAPGVPHSHT+P+VRS
Sbjct:    1 MGIDINHKHDRVARRTAPKSENPYLRLLSKLYAFLARRTGEKFNAIVLKRLRMSRRNRQPLSLAKLARAVQKAGNENKTVVTLSTVTDDARLYTVPKISVAALHVTEGARARILAAGGEIITLDQLALKSPKGENTVFLQGPRSAREAEKHFGPAPGVPHSHTKPYVRS 169          
BLAST of 60S ribosomal protein L18 vs. UniProt/SwissProt
Match: sp|Q4PM04|RL18_IXOSC (60S ribosomal protein L18 OS=Ixodes scapularis OX=6945 GN=RpL18 PE=2 SV=1)

HSP 1 Score: 200.29 bits (508), Expect = 4.064e-64
Identity = 103/169 (60.95%), Postives = 130/169 (76.92%), Query Frame = 3
Query:   63 MGIDISHK-TRIVKRTTPVSNDTYTRINFKLFSFLHRRTEKKFHGIIAKRLAMARRLRQPLSIARLMKQMKKPGREEKIAVVVGTVTDDLRIREVPKMTLCAQRVTAGARARILKAGGEIITLDELAVRAPLGKGTVLLQGPRSQTTSQKYFGPAPGVPHSHTRPHVRS 566
            MGIDI+HK  R V R  P S + Y  +  K++ FL RR+  KF+ I+ KRL M+R  +  +S+AR+ + MKKPGRE  IAVVVGTVTDDLR+ +VPK+ LCA RVT  ARARILKAGGEI+T D+LAV+AP GKGTVL+QGPR+   + ++FGPAPGVPHSHT+P+VRS
Sbjct:    1 MGIDINHKYDRKVVRRRPKSENVYLGLLVKVYRFLARRSGAKFNRIVLKRLFMSRINKPVISLARVTRFMKKPGRENLIAVVVGTVTDDLRLYDVPKLRLCALRVTERARARILKAGGEILTFDQLAVQAPKGKGTVLMQGPRNSREACRHFGPAPGVPHSHTKPYVRS 169          
BLAST of 60S ribosomal protein L18 vs. UniProt/SwissProt
Match: sp|Q0PXY6|RL18_DIACI (60S ribosomal protein L18 OS=Diaphorina citri OX=121845 GN=RpL18 PE=2 SV=1)

HSP 1 Score: 198.364 bits (503), Expect = 2.110e-63
Identity = 98/169 (57.99%), Postives = 128/169 (75.74%), Query Frame = 3
Query:   63 MGIDISHK-TRIVKRTTPVSNDTYTRINFKLFSFLHRRTEKKFHGIIAKRLAMARRLRQPLSIARLMKQMKKPGREEKIAVVVGTVTDDLRIREVPKMTLCAQRVTAGARARILKAGGEIITLDELAVRAPLGKGTVLLQGPRSQTTSQKYFGPAPGVPHSHTRPHVRS 566
            MG+DI HK  R V+RT P S D Y  +  KL+ FL RRT  KF+ II KRL M++  R P++I+++++ MKKP RE ++AV+VGT+ DD R+  +PK+T+CA RVT  AR+RILKAGGEIIT D+LA+RAP GK TVL+QG R+   + K+FGPAPGVPHSHT+ HVRS
Sbjct:    1 MGVDICHKYDRRVRRTKPKSKDVYLELLVKLYRFLTRRTNSKFNKIILKRLFMSKINRPPMAISKIVRFMKKPTREGRVAVIVGTIVDDPRMWTIPKLTVCALRVTDKARSRILKAGGEIITFDQLALRAPTGKNTVLMQGKRTGREANKHFGPAPGVPHSHTKAHVRS 169          
BLAST of 60S ribosomal protein L18 vs. TrEMBL
Match: A0A0R3WC18 (Ribosomal_L18e/L15P domain-containing protein OS=Taenia asiatica OX=60517 GN=TASK_LOCUS8222 PE=4 SV=1)

HSP 1 Score: 219.55 bits (558), Expect = 2.487e-69
Identity = 107/167 (64.07%), Postives = 135/167 (80.84%), Query Frame = 3
Query:   63 MGIDISHKT-RIVKRTTPVSNDTYTRINFKLFSFLHRRTEKKFHGIIAKRLAMARRLRQPLSIARLMKQMKKPGREEKIAVVVGTVTDDLRIREVPKMTLCAQRVTAGARARILKAGGEIITLDELAVRAPLGKGTVLLQGPRSQTTSQKYFGPAPGVPHSHTRPHV 560
            MGIDISH+  R V R  P S D Y R+  KL+ FL RRT  KF+ I+ +RL M+R  R PLS++RL +QMKKPGRE KIAVV+GTVT+D+R+REVPK+T+CA RVTAGAR RILKAGG+++T+D+LA++APLGKGTVLLQGPR    + ++FGPAPGVP SHT+P+V
Sbjct:    1 MGIDISHRNKRKVVRRNPKSGDVYLRLMVKLYKFLARRTHSKFNNIVKRRLFMSRINRAPLSLSRLARQMKKPGREGKIAVVIGTVTNDIRMREVPKLTVCALRVTAGARNRILKAGGKVMTVDQLALKAPLGKGTVLLQGPRKAREACRHFGPAPGVPGSHTKPYV 167          
BLAST of 60S ribosomal protein L18 vs. TrEMBL
Match: A0A0R3TE83 (Ribosomal_L18e/L15P domain-containing protein OS=Rodentolepis nana OX=102285 GN=HNAJ_LOCUS5370 PE=4 SV=1)

HSP 1 Score: 218.009 bits (554), Expect = 8.364e-69
Identity = 108/169 (63.91%), Postives = 135/169 (79.88%), Query Frame = 3
Query:   63 MGIDISHK-TRIVKRTTPVSNDTYTRINFKLFSFLHRRTEKKFHGIIAKRLAMARRLRQPLSIARLMKQMKKPGREEKIAVVVGTVTDDLRIREVPKMTLCAQRVTAGARARILKAGGEIITLDELAVRAPLGKGTVLLQGPRSQTTSQKYFGPAPGVPHSHTRPHVRS 566
            MGIDISH+  R V R  P S D Y R+  KL+ FL RRT  KF+ II +RL M+R  R PLS++RL +QMKKPGRE KIAVVVGTVTDD+R+REVPK+ +CA R+TAGAR+RILKAGG+++T+D+LA +APLGKGTVLLQGPR    + ++FG APGVP+SHT+P+V S
Sbjct:    1 MGIDISHRFKRKVVRRDPKSEDVYLRLMVKLYKFLARRTHSKFNNIIKRRLCMSRTNRAPLSLSRLARQMKKPGREGKIAVVVGTVTDDIRMREVPKLMVCALRITAGARSRILKAGGKVMTIDQLAQKAPLGKGTVLLQGPRKAREACRHFGLAPGVPNSHTKPYVVS 169          
BLAST of 60S ribosomal protein L18 vs. TrEMBL
Match: A0A0R3SAM6 (Ribosomal_L18e/L15P domain-containing protein OS=Hymenolepis diminuta OX=6216 GN=HDID_LOCUS1421 PE=4 SV=1)

HSP 1 Score: 216.853 bits (551), Expect = 2.187e-68
Identity = 104/167 (62.28%), Postives = 135/167 (80.84%), Query Frame = 3
Query:   63 MGIDISHK-TRIVKRTTPVSNDTYTRINFKLFSFLHRRTEKKFHGIIAKRLAMARRLRQPLSIARLMKQMKKPGREEKIAVVVGTVTDDLRIREVPKMTLCAQRVTAGARARILKAGGEIITLDELAVRAPLGKGTVLLQGPRSQTTSQKYFGPAPGVPHSHTRPHV 560
            MGIDISH+  R V R  P S+D Y R+  KL+ FL RRT  KF+ II +RL M+R  R PLS++RL +QMKKPGRE KIAVVVGTVTDD+R+REVP + +CA R+TAGA++RIL+AGG+++T+D+LA +APLGKGTVLLQGPR    + ++FGPAPGVP+SH++P+V
Sbjct:    1 MGIDISHRFKRKVVRRNPKSDDVYLRLMVKLYKFLARRTHSKFNNIIKRRLCMSRTNRAPLSLSRLARQMKKPGREGKIAVVVGTVTDDIRMREVPTLMVCALRITAGAKSRILRAGGKVMTIDQLAQKAPLGKGTVLLQGPRKAREACRHFGPAPGVPNSHSKPYV 167          
BLAST of 60S ribosomal protein L18 vs. TrEMBL
Match: A0A026WZE1 (60S ribosomal protein L18 OS=Ooceraea biroi OX=2015173 GN=X777_08395 PE=4 SV=1)

HSP 1 Score: 217.238 bits (552), Expect = 2.440e-68
Identity = 111/169 (65.68%), Postives = 134/169 (79.29%), Query Frame = 3
Query:   63 MGIDISHK-TRIVKRTTPVSNDTYTRINFKLFSFLHRRTEKKFHGIIAKRLAMARRLRQPLSIARLMKQMKKPGREEKIAVVVGTVTDDLRIREVPKMTLCAQRVTAGARARILKAGGEIITLDELAVRAPLGKGTVLLQGPRSQTTSQKYFGPAPGVPHSHTRPHVRS 566
            MGIDI+HK  R V+RT P S D Y R+  KL+ FL RRT  KF+ II KRL M++  R P+S+AR+++ MKKPGRE  IAV+VGTVTDD RI E+PK+T+CA RVT  ARARILKAGGEIITLD+LA+RAP GK TVL+QGPR    S K+FGPAPGVPHSH++P+VRS
Sbjct:    1 MGIDINHKHDRKVRRTEPKSEDVYLRLLVKLYRFLARRTNSKFNRIILKRLFMSKIHRPPISLARIVRFMKKPGRENCIAVIVGTVTDDARIFEIPKLTVCALRVTTRARARILKAGGEIITLDQLALRAPTGKHTVLMQGPRKARESVKHFGPAPGVPHSHSKPYVRS 169          
BLAST of 60S ribosomal protein L18 vs. TrEMBL
Match: A0A3S8V3G7 (60S ribosomal protein L18 OS=Polyrhachis vicina OX=455035 PE=2 SV=1)

HSP 1 Score: 216.853 bits (551), Expect = 3.171e-68
Identity = 108/169 (63.91%), Postives = 134/169 (79.29%), Query Frame = 3
Query:   63 MGIDISHK-TRIVKRTTPVSNDTYTRINFKLFSFLHRRTEKKFHGIIAKRLAMARRLRQPLSIARLMKQMKKPGREEKIAVVVGTVTDDLRIREVPKMTLCAQRVTAGARARILKAGGEIITLDELAVRAPLGKGTVLLQGPRSQTTSQKYFGPAPGVPHSHTRPHVRS 566
            MGIDI+HK  R V+RT P S D Y R+  KL+ FL RRT  KF+ II +RL M++  R P+S+AR+++ MKKPGRE  +AV+VG+VTDD RI E+PK+T+CA RVT GARARILKAGGEIIT D+LA+RAP GK TVL+QGPR    S K+FGPAPGVPHSH++P+VRS
Sbjct:    1 MGIDINHKHDRKVRRTEPKSQDVYLRLLVKLYRFLARRTNSKFNQIILRRLFMSKINRPPISLARIVRFMKKPGRENCVAVIVGSVTDDARIFEIPKLTVCALRVTEGARARILKAGGEIITFDQLALRAPTGKRTVLMQGPRKARESVKHFGPAPGVPHSHSKPYVRS 169          
BLAST of 60S ribosomal protein L18 vs. Ensembl Cavefish
Match: rpl18 (ribosomal protein L18 [Source:NCBI gene;Acc:103023695])

HSP 1 Score: 172.94 bits (437), Expect = 2.020e-54
Identity = 97/169 (57.40%), Postives = 127/169 (75.15%), Query Frame = 3
Query:   63 MGIDISH-KTRIVKRTTPVSNDTYTRINFKLFSFLHRRTEKKFHGIIAKRLAMARRLRQPLSIARLMKQMKKPGREEKIAVVVGTVTDDLRIREVPKMTLCAQRVTAGARARILKAGGEIITLDELAVRAPLGKGTVLLQGPRSQTTSQKYFGPAPGVPHSHTRPHVRS 566
            MGIDI H K R V R  P S D Y R+  KL+ FL RR+   F+ +I +RL M++  R PL+++RL+++MK PGRE + AVVVGTVTDD+RI++VPK+ LCA +VT+GAR RILKAGG+I+T D+LA+ AP G+GTVLL GPR      ++FG APG PHSHT+P+VRS
Sbjct:    1 MGIDIRHNKDRKVHRKEPKSQDIYLRLLVKLYRFLARRSNAPFNKVILRRLFMSKTNRPPLALSRLIRKMKLPGRENQTAVVVGTVTDDVRIQDVPKLKLCALKVTSGARRRILKAGGQIMTFDQLALAAPKGQGTVLLSGPRKGREVYRHFGKAPGTPHSHTKPYVRS 169          
BLAST of 60S ribosomal protein L18 vs. Ensembl Cavefish
Match: rpl18 (ribosomal protein L18 [Source:NCBI gene;Acc:103023695])

HSP 1 Score: 171.785 bits (434), Expect = 7.549e-54
Identity = 96/171 (56.14%), Postives = 127/171 (74.27%), Query Frame = 3
Query:   57 EIMGIDISH-KTRIVKRTTPVSNDTYTRINFKLFSFLHRRTEKKFHGIIAKRLAMARRLRQPLSIARLMKQMKKPGREEKIAVVVGTVTDDLRIREVPKMTLCAQRVTAGARARILKAGGEIITLDELAVRAPLGKGTVLLQGPRSQTTSQKYFGPAPGVPHSHTRPHVRS 566
             + GIDI H K R V R  P S D Y R+  KL+ FL RR+   F+ +I +RL M++  R PL+++RL+++MK PGRE + AVVVGTVTDD+RI++VPK+ LCA +VT+GAR RILKAGG+I+T D+LA+ AP G+GTVLL GPR      ++FG APG PHSHT+P+VRS
Sbjct:    4 SLQGIDIRHNKDRKVHRKEPKSQDIYLRLLVKLYRFLARRSNAPFNKVILRRLFMSKTNRPPLALSRLIRKMKLPGRENQTAVVVGTVTDDVRIQDVPKLKLCALKVTSGARRRILKAGGQIMTFDQLALAAPKGQGTVLLSGPRKGREVYRHFGKAPGTPHSHTKPYVRS 174          
BLAST of 60S ribosomal protein L18 vs. Ensembl Cavefish
Match: rpl18 (ribosomal protein L18 [Source:NCBI gene;Acc:103023695])

HSP 1 Score: 88.1965 bits (217), Expect = 7.773e-22
Identity = 57/121 (47.11%), Postives = 82/121 (67.77%), Query Frame = 3
Query:   63 MGIDISH-KTRIVKRTTPVSNDTYTRINFKLFSFLHRRTEKKFHGIIAKRLAMARRLRQPLSIARLMKQMKKPGREEKIAVVVGTVTDDLRIREVPKMTLCAQRVTAGARARILKAGGEII 422
            MGIDI H K R V R  P S D Y R+  KL+ FL RR+   F+ +I +RL M++  R PL+++RL+++MK PGRE + AVVVGTVTDD+RI++VPK+ LCA   T  + + + K   +++
Sbjct:    1 MGIDIRHNKDRKVHRKEPKSQDIYLRLLVKLYRFLARRSNAPFNKVILRRLFMSKTNRPPLALSRLIRKMKLPGRENQTAVVVGTVTDDVRIQDVPKLKLCAFIATVTSVSEVEKISFDLV 121          
BLAST of 60S ribosomal protein L18 vs. Ensembl Yeast
Match: RPL18A (Ribosomal 60S subunit protein L18A; intron of RPL18A pre-mRNA forms stem-loop structures that are a target for Rnt1p cleavage leading to degradation; homologous to mammalian ribosomal protein L18, no bacterial homolog; RPL18A has a paralog, RPL18B, that arose from the whole genome duplication [Source:SGD;Acc:S000005480])

HSP 1 Score: 130.954 bits (328), Expect = 8.228e-39
Identity = 76/157 (48.41%), Postives = 109/157 (69.43%), Query Frame = 3
Query:   63 MGIDISHKT--RIVKRTTPVSNDTYTRINFKLFSFLHRRTEKKFHGIIAKRLAMARRLRQPLSIARLMKQMKKPGREEKIAVVVGTVTDDLRIREVPKMTLCAQRVTAGARARILKAGGEIITLDELAVRAPLGKGTVLLQGPRSQTTSQKYFGPAP 527
            MGID + K   R   RT P S++ Y ++  KL++FL RRT+  F+ ++ K L +++  R P+S++R+ + +K+ G   K  VVVGTVTDD RI E PK T+ A R TAGARA+I+KAGGE ITLD+LAVRAP G+ T++L+GPR+   + ++FG  P
Sbjct:    1 MGIDHTSKQHKRSGHRTAPKSDNVYLKLLVKLYTFLARRTDAPFNKVVLKALFLSKINRPPVSVSRIARALKQEGAANKTVVVVGTVTDDARIFEFPKTTVAALRFTAGARAKIVKAGGECITLDQLAVRAPKGQNTLILRGPRNSREAVRHFGMGP 157          
BLAST of 60S ribosomal protein L18 vs. Ensembl Yeast
Match: RPL18B (Ribosomal 60S subunit protein L18B; homologous to mammalian ribosomal protein L18, no bacterial homolog; RPL18B has a paralog, RPL18A, that arose from the whole genome duplication [Source:SGD;Acc:S000005245])

HSP 1 Score: 130.954 bits (328), Expect = 8.228e-39
Identity = 76/157 (48.41%), Postives = 109/157 (69.43%), Query Frame = 3
Query:   63 MGIDISHKT--RIVKRTTPVSNDTYTRINFKLFSFLHRRTEKKFHGIIAKRLAMARRLRQPLSIARLMKQMKKPGREEKIAVVVGTVTDDLRIREVPKMTLCAQRVTAGARARILKAGGEIITLDELAVRAPLGKGTVLLQGPRSQTTSQKYFGPAP 527
            MGID + K   R   RT P S++ Y ++  KL++FL RRT+  F+ ++ K L +++  R P+S++R+ + +K+ G   K  VVVGTVTDD RI E PK T+ A R TAGARA+I+KAGGE ITLD+LAVRAP G+ T++L+GPR+   + ++FG  P
Sbjct:    1 MGIDHTSKQHKRSGHRTAPKSDNVYLKLLVKLYTFLARRTDAPFNKVVLKALFLSKINRPPVSVSRIARALKQEGAANKTVVVVGTVTDDARIFEFPKTTVAALRFTAGARAKIVKAGGECITLDQLAVRAPKGQNTLILRGPRNSREAVRHFGMGP 157          
BLAST of 60S ribosomal protein L18 vs. Ensembl Nematostella
Match: EDO48382 (60S ribosomal protein L18 [Source:UniProtKB/TrEMBL;Acc:A7RJH9])

HSP 1 Score: 189.119 bits (479), Expect = 3.954e-61
Identity = 96/169 (56.80%), Postives = 123/169 (72.78%), Query Frame = 3
Query:   63 MGIDISHK-TRIVKRTTPVSNDTYTRINFKLFSFLHRRTEKKFHGIIAKRLAMARRLRQPLSIARLMKQMKKPGREEKIAVVVGTVTDDLRIREVPKMTLCAQRVTAGARARILKAGGEIITLDELAVRAPLGKGTVLLQGPRSQTTSQKYFGPAPGVPHSHTRPHVRS 566
            MGIDI  K  +   R  PVS + Y R+  KL+ FL RRT  KF+ I+ KRL M+R  R PLS+ARL+++MK  G ++KI VVVG++TDD RI EVP + +CA R +  ARARILKAGGEI+T D+LA+RAPLG+ TVLLQGPR    ++++ G APGVPHS T+P VRS
Sbjct:    1 MGIDIEKKHPKKNYRREPVSQNVYIRLLVKLYRFLSRRTNAKFNQIVMKRLCMSRTKRPPLSLARLVRKMKASGHKDKICVVVGSITDDKRIFEVPALKICALRFSETARARILKAGGEILTFDQLALRAPLGQNTVLLQGPRKAREAERHMGLAPGVPHSDTKPFVRS 169          
BLAST of 60S ribosomal protein L18 vs. Ensembl Medaka
Match: rpl18 (ribosomal protein L18 [Source:NCBI gene;Acc:100049515])

HSP 1 Score: 169.088 bits (427), Expect = 1.791e-52
Identity = 94/169 (55.62%), Postives = 124/169 (73.37%), Query Frame = 3
Query:   63 MGIDISH-KTRIVKRTTPVSNDTYTRINFKLFSFLHRRTEKKFHGIIAKRLAMARRLRQPLSIARLMKQMKKPGREEKIAVVVGTVTDDLRIREVPKMTLCAQRVTAGARARILKAGGEIITLDELAVRAPLGKGTVLLQGPRSQTTSQKYFGPAPGVPHSHTRPHVRS 566
            MG+DI H K R V R  P S D Y R+  KL+ FL RRT   F+ ++ KRL M+R  R P++I+RL+++MK PGR+ KIAVVVGTVTDD+RI+E+PK+ +CA +VT GAR RILK+GG+++T D+LA+  P G GTVLL GPR      ++FG A G PHSHT+P+VRS
Sbjct:   26 MGVDIRHNKDRKVHRKEPKSQDIYLRLLVKLYRFLSRRTNAPFNKVVLKRLFMSRTNRPPIAISRLIRKMKLPGRDNKIAVVVGTVTDDVRIQEIPKLKICALKVTDGARRRILKSGGQVMTFDQLALATPKGHGTVLLSGPRKAREVYRHFGKATGTPHSHTKPYVRS 194          
BLAST of 60S ribosomal protein L18 vs. Planmine SMEST
Match: SMESG000017166.1 (SMESG000017166.1)

HSP 1 Score: 340.117 bits (871), Expect = 1.631e-120
Identity = 168/168 (100.00%), Postives = 168/168 (100.00%), Query Frame = 3
Query:   63 MGIDISHKTRIVKRTTPVSNDTYTRINFKLFSFLHRRTEKKFHGIIAKRLAMARRLRQPLSIARLMKQMKKPGREEKIAVVVGTVTDDLRIREVPKMTLCAQRVTAGARARILKAGGEIITLDELAVRAPLGKGTVLLQGPRSQTTSQKYFGPAPGVPHSHTRPHVRS 566
            MGIDISHKTRIVKRTTPVSNDTYTRINFKLFSFLHRRTEKKFHGIIAKRLAMARRLRQPLSIARLMKQMKKPGREEKIAVVVGTVTDDLRIREVPKMTLCAQRVTAGARARILKAGGEIITLDELAVRAPLGKGTVLLQGPRSQTTSQKYFGPAPGVPHSHTRPHVRS
Sbjct:    1 MGIDISHKTRIVKRTTPVSNDTYTRINFKLFSFLHRRTEKKFHGIIAKRLAMARRLRQPLSIARLMKQMKKPGREEKIAVVVGTVTDDLRIREVPKMTLCAQRVTAGARARILKAGGEIITLDELAVRAPLGKGTVLLQGPRSQTTSQKYFGPAPGVPHSHTRPHVRS 168          
BLAST of 60S ribosomal protein L18 vs. Planmine SMEST
Match: SMESG000017166.1 (SMESG000017166.1)

HSP 1 Score: 235.728 bits (600), Expect = 5.331e-80
Identity = 117/117 (100.00%), Postives = 117/117 (100.00%), Query Frame = 3
Query:  216 MARRLRQPLSIARLMKQMKKPGREEKIAVVVGTVTDDLRIREVPKMTLCAQRVTAGARARILKAGGEIITLDELAVRAPLGKGTVLLQGPRSQTTSQKYFGPAPGVPHSHTRPHVRS 566
            MARRLRQPLSIARLMKQMKKPGREEKIAVVVGTVTDDLRIREVPKMTLCAQRVTAGARARILKAGGEIITLDELAVRAPLGKGTVLLQGPRSQTTSQKYFGPAPGVPHSHTRPHVRS
Sbjct:    1 MARRLRQPLSIARLMKQMKKPGREEKIAVVVGTVTDDLRIREVPKMTLCAQRVTAGARARILKAGGEIITLDELAVRAPLGKGTVLLQGPRSQTTSQKYFGPAPGVPHSHTRPHVRS 117          
The following BLAST results are available for this feature:
BLAST of 60S ribosomal protein L18 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RPL187.166e-6356.21ribosomal protein L18 [Source:HGNC Symbol;Acc:HGNC... [more]
RPL189.582e-6255.95ribosomal protein L18 [Source:HGNC Symbol;Acc:HGNC... [more]
RPL181.211e-5955.49ribosomal protein L18 [Source:HGNC Symbol;Acc:HGNC... [more]
RPL181.109e-5357.55ribosomal protein L18 [Source:HGNC Symbol;Acc:HGNC... [more]
RPL182.018e-5155.48ribosomal protein L18 [Source:HGNC Symbol;Acc:HGNC... [more]
back to top
BLAST of 60S ribosomal protein L18 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
rpl-181.813e-6658.5860S ribosomal protein L18 [Source:UniProtKB/Swiss... [more]
rpl-181.813e-6658.5860S ribosomal protein L18 [Source:UniProtKB/Swiss... [more]
back to top
BLAST of 60S ribosomal protein L18 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
RpL182.186e-6158.58gene:FBgn0035753 transcript:FBtr0333370[more]
RpL182.186e-6158.58gene:FBgn0035753 transcript:FBtr0076892[more]
RpL182.186e-6158.58gene:FBgn0035753 transcript:FBtr0345036[more]
back to top
BLAST of 60S ribosomal protein L18 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
rpl181.324e-5953.85ribosomal protein L18 [Source:ZFIN;Acc:ZDB-GENE-04... [more]
rpl181.324e-5953.85ribosomal protein L18 [Source:ZFIN;Acc:ZDB-GENE-04... [more]
rpl181.306e-5653.05ribosomal protein L18 [Source:ZFIN;Acc:ZDB-GENE-04... [more]
rpl181.561e-4848.81ribosomal protein L18 [Source:ZFIN;Acc:ZDB-GENE-04... [more]
back to top
BLAST of 60S ribosomal protein L18 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
rpl182.638e-6054.44ribosomal protein L18 [Source:NCBI gene;Acc:496439... [more]
back to top
BLAST of 60S ribosomal protein L18 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Rpl184.090e-5557.40ribosomal protein L18 [Source:MGI Symbol;Acc:MGI:9... [more]
Rpl184.090e-5557.40ribosomal protein L18 [Source:MGI Symbol;Acc:MGI:9... [more]
Rpl189.024e-4658.99ribosomal protein L18 [Source:MGI Symbol;Acc:MGI:9... [more]
Rpl181.267e-3943.79ribosomal protein L18 [Source:MGI Symbol;Acc:MGI:9... [more]
Rpl184.271e-3861.54ribosomal protein L18 [Source:MGI Symbol;Acc:MGI:9... [more]
back to top
BLAST of 60S ribosomal protein L18 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|A3F4S0|RL18_TAEAS8.301e-7263.9160S ribosomal protein L18 OS=Taenia asiatica OX=60... [more]
sp|Q60P81|RL18_CAEBR7.249e-6860.9560S ribosomal protein L18 OS=Caenorhabditis briggs... [more]
sp|O45946|RL18_CAEEL2.306e-6558.5860S ribosomal protein L18 OS=Caenorhabditis elegan... [more]
sp|Q4PM04|RL18_IXOSC4.064e-6460.9560S ribosomal protein L18 OS=Ixodes scapularis OX=... [more]
sp|Q0PXY6|RL18_DIACI2.110e-6357.9960S ribosomal protein L18 OS=Diaphorina citri OX=1... [more]
back to top
BLAST of 60S ribosomal protein L18 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0R3WC182.487e-6964.07Ribosomal_L18e/L15P domain-containing protein OS=T... [more]
A0A0R3TE838.364e-6963.91Ribosomal_L18e/L15P domain-containing protein OS=R... [more]
A0A0R3SAM62.187e-6862.28Ribosomal_L18e/L15P domain-containing protein OS=H... [more]
A0A026WZE12.440e-6865.6860S ribosomal protein L18 OS=Ooceraea biroi OX=201... [more]
A0A3S8V3G73.171e-6863.9160S ribosomal protein L18 OS=Polyrhachis vicina OX... [more]
back to top
BLAST of 60S ribosomal protein L18 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
rpl182.020e-5457.40ribosomal protein L18 [Source:NCBI gene;Acc:103023... [more]
rpl187.549e-5456.14ribosomal protein L18 [Source:NCBI gene;Acc:103023... [more]
rpl187.773e-2247.11ribosomal protein L18 [Source:NCBI gene;Acc:103023... [more]
back to top
BLAST of 60S ribosomal protein L18 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of 60S ribosomal protein L18 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
RPL18A8.228e-3948.41Ribosomal 60S subunit protein L18A; intron of RPL1... [more]
RPL18B8.228e-3948.41Ribosomal 60S subunit protein L18B; homologous to ... [more]
back to top
BLAST of 60S ribosomal protein L18 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO483823.954e-6156.8060S ribosomal protein L18 [Source:UniProtKB/TrEMB... [more]
back to top
BLAST of 60S ribosomal protein L18 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
rpl181.791e-5255.62ribosomal protein L18 [Source:NCBI gene;Acc:100049... [more]
back to top
BLAST of 60S ribosomal protein L18 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000017166.11.631e-120100.00SMESG000017166.1[more]
SMESG000017166.15.331e-80100.00SMESG000017166.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30009052 ID=SMED30009052|Name=60S ribosomal protein L18|organism=Schmidtea mediterranea sexual|type=transcript|length=664bp
CAAATGTTTAAATAAATTTGTTTTAAATAATAATATAATATAATACTAAA
AAGTTTGAAATTATGGGAATCGACATTTCACATAAAACCAGAATTGTCAA
GAGGACTACTCCAGTTTCTAATGACACTTACACCCGTATTAACTTTAAAT
TGTTCTCCTTTTTGCACAGAAGAACTGAAAAGAAGTTCCATGGTATTATT
GCAAAAAGATTGGCTATGGCTAGAAGATTGAGACAACCTCTTTCAATTGC
CCGTCTTATGAAACAAATGAAAAAACCAGGACGTGAAGAAAAGATTGCAG
TCGTTGTCGGAACTGTTACCGATGACCTAAGAATTCGAGAAGTCCCTAAA
ATGACTTTGTGTGCTCAACGAGTCACTGCTGGTGCCAGAGCAAGAATTTT
GAAAGCAGGCGGTGAAATTATCACTCTTGATGAATTAGCCGTCAGAGCTC
CATTGGGAAAAGGAACTGTTTTGTTACAAGGTCCTAGATCTCAAACCACA
TCTCAAAAATACTTTGGCCCAGCTCCTGGTGTTCCACACAGTCACACTAG
ACCCCACGTAAGATCTAAAGGAAGAAAATTTGAACGTGCTCGTGGTAGAA
GAAGCAGCAGAGGTTACAAGAAATAAACTTGAATAAATTTTAATGGATTT
AAAAAAAAAGATCG
back to top

protein sequence of SMED30009052-orf-1

>SMED30009052-orf-1 ID=SMED30009052-orf-1|Name=SMED30009052-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=188bp
MGIDISHKTRIVKRTTPVSNDTYTRINFKLFSFLHRRTEKKFHGIIAKRL
AMARRLRQPLSIARLMKQMKKPGREEKIAVVVGTVTDDLRIREVPKMTLC
AQRVTAGARARILKAGGEIITLDELAVRAPLGKGTVLLQGPRSQTTSQKY
FGPAPGVPHSHTRPHVRSKGRKFERARGRRSSRGYKK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000018Category 4 cell
PLANA:0000026gut
PLANA:0000039gamma neoblast
PLANA:0000101muscle cell
PLANA:0000110pharynx progenitor cell
PLANA:0000429neoblast
PLANA:0002032epidermal cell
PLANA:0002109X1 cell
PLANA:0002111X2 cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR000039Ribosomal_L18e
IPR036227L18e/L15P_sf
IPR021131Ribosomal_L18e/L15P
Vocabulary: molecular function
TermDefinition
GO:0003735structural constituent of ribosome
Vocabulary: cellular component
TermDefinition
GO:0005622intracellular
GO:0005737cytoplasm
GO:0005840ribosome
GO:0030529intracellular ribonucleoprotein complex
Vocabulary: biological process
TermDefinition
GO:0006412translation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR021131Ribosomal protein L18e/L15PPFAMPF17135Ribosomal_L18coord: 2..187
e-value: 7.6E-77
score: 256.9
NoneNo IPR availableGENE3DG3DSA:3.100.10.10coord: 1..187
e-value: 3.5E-77
score: 260.2
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 162..187
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 152..187
NoneNo IPR availablePANTHERPTHR10934:SF260S RIBOSOMAL PROTEIN L18coord: 1..186
IPR000039Ribosomal protein L18ePANTHERPTHR1093460S RIBOSOMAL PROTEIN L18coord: 1..186
IPR036227Ribosomal L18e/L15P superfamilySUPERFAMILYSSF52080Ribosomal proteins L15p and L18ecoord: 21..138