SMED30009048

Overview
NameSMED30009048
Smed IDSMED30009048
Length (bp)594
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30009048 (SMED30009048) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30009048 (SMED30009048) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30009048 (SMED30009048) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30009048 (SMED30009048) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30009048

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 20

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
neuronSMED30009048SMESG000043809.1 SMESG000043799.1 dd_Smed_v4_655_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30009048SMESG000043809.1 SMESG000043799.1 dd_Smed_v4_655_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
anterior region of the whole animalSMED30009048SMESG000043809.1 SMESG000043799.1 dd_Smed_v4_655_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30009048SMESG000043809.1 SMESG000043799.1 dd_Smed_v4_655_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30009048SMESG000043809.1 SMESG000043799.1 dd_Smed_v4_655_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30009048SMESG000043809.1 SMESG000043799.1 dd_Smed_v6_655_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30009048SMESG000043809.1 SMESG000043799.1 dd_Smed_v6_655_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
intestinal phagocyteSMED30009048SMESG000043809.1 SMESG000043799.1 dd_Smed_v6_655_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30009048SMESG000043809.1 SMESG000043799.1 dd_Smed_v6_655_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
musculature systemSMED30009048SMESG000043809.1 SMESG000043799.1 dd_Smed_v6_655_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cholinergic neuronSMED30009048SMESG000043809.1 SMESG000043799.1 dd_Smed_v6_655_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
GABAergic neuronSMED30009048SMESG000043809.1 SMESG000043799.1 dd_Smed_v6_655_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pigment cellSMED30009048SMESG000043809.1 SMESG000043799.1 dd_Smed_v6_655_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30009048SMESG000043809.1 SMESG000043799.1 dd_Smed_v6_655_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pharynx musculatureSMED30009048SMESG000043809.1 SMESG000043799.1 dd_Smed_v6_655_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
goblet cellSMED30009048SMESG000043809.1 SMESG000043799.1 dd_Smed_v6_655_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
oocyteSMED30009048SMESG000043809.1 SMESG000043799.1 Contig20965uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
vitelline glandSMED30009048SMESG000043809.1 SMESG000043799.1 Contig20965uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
oocyteSMED30009048SMESG000043809.1 SMESG000043799.1 Contig20965newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
vitelline glandSMED30009048SMESG000043809.1 SMESG000043799.1 Contig20965newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of SMED30009048 vs. Ensembl Celegans
Match: vab-10 (VAB-10B protein [Source:UniProtKB/TrEMBL;Acc:G5EFM4])

HSP 1 Score: 78.5666 bits (192), Expect = 6.662e-17
Identity = 62/175 (35.43%), Postives = 86/175 (49.14%), Query Frame = 3
Query:   36 HLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEM----LKSGKNISALLTSE--KERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISA 542
             LTL EA+ KGL D    TI D  +GKEISL EAI   I+D     + D + G+  +  E     L  GKN    L S     R+D      L   S    +    + + EA+ +  VD    ++RDP SG++ S QEA+ R I+DA+   I+    G S S S+ L SG  +S+
Sbjct: 2366 QLTLKEAIMKGLFDPYDTTIVDKKAGKEISLLEAIREEIVDDNAGTVKDTQTGRVHNFLEAGNLGLVKGKNFGDTLDSSLFSGRLD------LGSGSYTRPSGGSSMPIHEAINRNYVDRSSVSVRDPSSGQQYSYQEAVDRRIVDADRGLIHGG--GDSTSFSQGLTSGHLVSS 2532          

HSP 2 Score: 61.2326 bits (147), Expect = 5.921e-11
Identity = 48/171 (28.07%), Postives = 91/171 (53.22%), Query Frame = 3
Query:   39 LTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSE------MLKSG---KNIS-ALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLK 521
            L+L+ A+  G V     ++RD ++G+E+ L+EA   GIID++N   +D  + + +S +E      M  +G   +N S A+ T+ K    + +    +K ++         +L +A+  G  D   GT   P + K+++L+EAI +G+ D  ++ I D + G+ +SL E ++
Sbjct: 2234 LSLERALATGKVAPEDISVRDGLTGREMPLEEAEKWGIIDSKNRYYFDKSQNKRMSYTEAAQQHLMYLTGGVPENASDAVHTTVKV---QTRTAVAKKEALSSGLPLSDYSLGKALSLGWYDQSAGTFTHPETQKQLTLKEAIMKGLFDPYDTTIVDKKAGKEISLLEAIR 2401          

HSP 3 Score: 60.077 bits (144), Expect = 1.387e-10
Identity = 42/158 (26.58%), Postives = 75/158 (47.47%), Query Frame = 3
Query:   21 STDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAEN------SAIYDAEKGQSVSLSEMLK----SGKNISALLTSEKERMDKEKQTELEKISMEYS---TDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIID 455
             T  HH+ +  A+  GL++   G  R+ I+G+++ L + + RG+ID             D    + ++L E ++      KN +  L S +  +   K  +  +I ME          L   EA+ KGL+D+ +    DP +G+++S+ +AI  G ID
Sbjct: 2807 PTKGHHVPVTTALNDGLINASTGNYRNSITGEDVPLSDTVDRGLIDRSTYETITKPFFTDYRSNRKLNLVEAVRERLIDPKNRTIQL-SRQSIVPIAKAVQDGRIPMEIGEKLRKVDKLNFAEALGKGLIDSKQNVFTDPDTGRQMSIAQAIQEGFID 2963          

HSP 4 Score: 55.0694 bits (131), Expect = 7.861e-9
Identity = 56/215 (26.05%), Postives = 95/215 (44.19%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLK----------SGKNISALLTSEKERMDKEKQTELEKISMEY------------STDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSG----KNISALLTSEKERM 569
            K ++E  +  +H+   EA  KGL+D   G I  P   + +S  E I  GIIDA  + I  +  G+SVS+ E L+          +G+NI   + ++   +D E        S                       ++E+ +    DT +G   D ++G+++SL+ A+A G +  E+ ++ D   G+ + L E  K G    KN      S+ +RM
Sbjct: 2078 KGALEVPSRGYHIY--EAERKGLIDLTNGKISAPNVDRVLSFAEGIELGIIDA--TTIQVSTGGRSVSVKEALEKKIMESDGSVNGRNIEQAVEAKTIVIDAEPLVPYNNQSKNIIQIPSGNGPIISFRQVGQPVVEESTQSWEFDTQQGVFVDNLTGEKLSLERALATGKVAPEDISVRDGLTGREMPLEEAEKWGIIDSKNRYYFDKSQNKRM 2288          

HSP 5 Score: 50.447 bits (119), Expect = 2.777e-7
Identity = 46/166 (27.71%), Postives = 78/166 (46.99%), Query Frame = 3
Query:   39 LTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGL--------VDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSE 512
            LTL+EA +  LVD+    +   I G+  +L EAI  G+IDAE   I D  +   +S+SE ++ G     LL + K  ++K               D    T+ EA+ +GL        +  +RG IR+  + + +S  EA+  G+I      + D +  +S  +++
Sbjct: 1706 LTLEEAAQNKLVDSSGYFVDRGILGQRYTLLEAIVAGLIDAEVRHIVDPNENDVISISEAMERG----LLLPNGKIVLEK---------------DEKEFTIPEAVHEGLLTKRVRHSIFNIRG-IRNTETSQNLSFNEAVEAGVIIPNAERVVDLQTQESFLITD 1851          
BLAST of SMED30009048 vs. Ensembl Celegans
Match: vab-10 (VAB-10B protein [Source:UniProtKB/TrEMBL;Acc:G5EFM4])

HSP 1 Score: 78.1814 bits (191), Expect = 7.771e-17
Identity = 62/174 (35.63%), Postives = 86/174 (49.43%), Query Frame = 3
Query:   39 LTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEM----LKSGKNISALLTSE--KERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISA 542
            LTL EA+ KGL D    TI D  +GKEISL EAI   I+D     + D + G+  +  E     L  GKN    L S     R+D      L   S    +    + + EA+ +  VD    ++RDP SG++ S QEA+ R I+DA+   I+    G S S S+ L SG  +S+
Sbjct: 2449 LTLKEAIMKGLFDPYDTTIVDKKAGKEISLLEAIREEIVDDNAGTVKDTQTGRVHNFLEAGNLGLVKGKNFGDTLDSSLFSGRLD------LGSGSYTRPSGGSSMPIHEAINRNYVDRSSVSVRDPSSGQQYSYQEAVDRRIVDADRGLIHGG--GDSTSFSQGLTSGHLVSS 2614          

HSP 2 Score: 61.2326 bits (147), Expect = 6.703e-11
Identity = 48/171 (28.07%), Postives = 91/171 (53.22%), Query Frame = 3
Query:   39 LTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSE------MLKSG---KNIS-ALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLK 521
            L+L+ A+  G V     ++RD ++G+E+ L+EA   GIID++N   +D  + + +S +E      M  +G   +N S A+ T+ K    + +    +K ++         +L +A+  G  D   GT   P + K+++L+EAI +G+ D  ++ I D + G+ +SL E ++
Sbjct: 2316 LSLERALATGKVAPEDISVRDGLTGREMPLEEAEKWGIIDSKNRYYFDKSQNKRMSYTEAAQQHLMYLTGGVPENASDAVHTTVKV---QTRTAVAKKEALSSGLPLSDYSLGKALSLGWYDQSAGTFTHPETQKQLTLKEAIMKGLFDPYDTTIVDKKAGKEISLLEAIR 2483          

HSP 3 Score: 60.077 bits (144), Expect = 1.694e-10
Identity = 42/158 (26.58%), Postives = 75/158 (47.47%), Query Frame = 3
Query:   21 STDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAEN------SAIYDAEKGQSVSLSEMLK----SGKNISALLTSEKERMDKEKQTELEKISMEYS---TDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIID 455
             T  HH+ +  A+  GL++   G  R+ I+G+++ L + + RG+ID             D    + ++L E ++      KN +  L S +  +   K  +  +I ME          L   EA+ KGL+D+ +    DP +G+++S+ +AI  G ID
Sbjct: 2889 PTKGHHVPVTTALNDGLINASTGNYRNSITGEDVPLSDTVDRGLIDRSTYETITKPFFTDYRSNRKLNLVEAVRERLIDPKNRTIQL-SRQSIVPIAKAVQDGRIPMEIGEKLRKVDKLNFAEALGKGLIDSKQNVFTDPDTGRQMSIAQAIQEGFID 3045          

HSP 4 Score: 54.6842 bits (130), Expect = 9.677e-9
Identity = 56/215 (26.05%), Postives = 95/215 (44.19%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLK----------SGKNISALLTSEKERMDKEKQTELEKISMEY------------STDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSG----KNISALLTSEKERM 569
            K ++E  +  +H+   EA  KGL+D   G I  P   + +S  E I  GIIDA  + I  +  G+SVS+ E L+          +G+NI   + ++   +D E        S                       ++E+ +    DT +G   D ++G+++SL+ A+A G +  E+ ++ D   G+ + L E  K G    KN      S+ +RM
Sbjct: 2160 KGALEVPSRGYHIY--EAERKGLIDLTNGKISAPNVDRVLSFAEGIELGIIDA--TTIQVSTGGRSVSVKEALEKKIMESDGSVNGRNIEQAVEAKTIVIDAEPLVPYNNQSKNIIQIPSGNGPIISFRQVGQPVVEESTQSWEFDTQQGVFVDNLTGEKLSLERALATGKVAPEDISVRDGLTGREMPLEEAEKWGIIDSKNRYYFDKSQNKRM 2370          

HSP 5 Score: 50.0618 bits (118), Expect = 3.198e-7
Identity = 46/166 (27.71%), Postives = 78/166 (46.99%), Query Frame = 3
Query:   39 LTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGL--------VDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSE 512
            LTL+EA +  LVD+    +   I G+  +L EAI  G+IDAE   I D  +   +S+SE ++ G     LL + K  ++K               D    T+ EA+ +GL        +  +RG IR+  + + +S  EA+  G+I      + D +  +S  +++
Sbjct: 1788 LTLEEAAQNKLVDSSGYFVDRGILGQRYTLLEAIVAGLIDAEVRHIVDPNENDVISISEAMERG----LLLPNGKIVLEK---------------DEKEFTIPEAVHEGLLTKRVRHSIFNIRG-IRNTETSQNLSFNEAVEAGVIIPNAERVVDLQTQESFLITD 1933          
BLAST of SMED30009048 vs. Ensembl Celegans
Match: vab-10 (VAB-10B protein [Source:UniProtKB/TrEMBL;Acc:G5EFM4])

HSP 1 Score: 78.1814 bits (191), Expect = 8.391e-17
Identity = 62/174 (35.63%), Postives = 86/174 (49.43%), Query Frame = 3
Query:   39 LTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEM----LKSGKNISALLTSE--KERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISA 542
            LTL EA+ KGL D    TI D  +GKEISL EAI   I+D     + D + G+  +  E     L  GKN    L S     R+D      L   S    +    + + EA+ +  VD    ++RDP SG++ S QEA+ R I+DA+   I+    G S S S+ L SG  +S+
Sbjct: 2480 LTLKEAIMKGLFDPYDTTIVDKKAGKEISLLEAIREEIVDDNAGTVKDTQTGRVHNFLEAGNLGLVKGKNFGDTLDSSLFSGRLD------LGSGSYTRPSGGSSMPIHEAINRNYVDRSSVSVRDPSSGQQYSYQEAVDRRIVDADRGLIHGG--GDSTSFSQGLTSGHLVSS 2645          

HSP 2 Score: 60.8474 bits (146), Expect = 7.370e-11
Identity = 48/171 (28.07%), Postives = 91/171 (53.22%), Query Frame = 3
Query:   39 LTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSE------MLKSG---KNIS-ALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLK 521
            L+L+ A+  G V     ++RD ++G+E+ L+EA   GIID++N   +D  + + +S +E      M  +G   +N S A+ T+ K    + +    +K ++         +L +A+  G  D   GT   P + K+++L+EAI +G+ D  ++ I D + G+ +SL E ++
Sbjct: 2347 LSLERALATGKVAPEDISVRDGLTGREMPLEEAEKWGIIDSKNRYYFDKSQNKRMSYTEAAQQHLMYLTGGVPENASDAVHTTVKV---QTRTAVAKKEALSSGLPLSDYSLGKALSLGWYDQSAGTFTHPETQKQLTLKEAIMKGLFDPYDTTIVDKKAGKEISLLEAIR 2514          

HSP 3 Score: 60.077 bits (144), Expect = 1.710e-10
Identity = 42/158 (26.58%), Postives = 75/158 (47.47%), Query Frame = 3
Query:   21 STDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAEN------SAIYDAEKGQSVSLSEMLK----SGKNISALLTSEKERMDKEKQTELEKISMEYS---TDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIID 455
             T  HH+ +  A+  GL++   G  R+ I+G+++ L + + RG+ID             D    + ++L E ++      KN +  L S +  +   K  +  +I ME          L   EA+ KGL+D+ +    DP +G+++S+ +AI  G ID
Sbjct: 2920 PTKGHHVPVTTALNDGLINASTGNYRNSITGEDVPLSDTVDRGLIDRSTYETITKPFFTDYRSNRKLNLVEAVRERLIDPKNRTIQL-SRQSIVPIAKAVQDGRIPMEIGEKLRKVDKLNFAEALGKGLIDSKQNVFTDPDTGRQMSIAQAIQEGFID 3076          

HSP 4 Score: 54.6842 bits (130), Expect = 9.323e-9
Identity = 56/215 (26.05%), Postives = 95/215 (44.19%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLK----------SGKNISALLTSEKERMDKEKQTELEKISMEY------------STDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSG----KNISALLTSEKERM 569
            K ++E  +  +H+   EA  KGL+D   G I  P   + +S  E I  GIIDA  + I  +  G+SVS+ E L+          +G+NI   + ++   +D E        S                       ++E+ +    DT +G   D ++G+++SL+ A+A G +  E+ ++ D   G+ + L E  K G    KN      S+ +RM
Sbjct: 2191 KGALEVPSRGYHIY--EAERKGLIDLTNGKISAPNVDRVLSFAEGIELGIIDA--TTIQVSTGGRSVSVKEALEKKIMESDGSVNGRNIEQAVEAKTIVIDAEPLVPYNNQSKNIIQIPSGNGPIISFRQVGQPVVEESTQSWEFDTQQGVFVDNLTGEKLSLERALATGKVAPEDISVRDGLTGREMPLEEAEKWGIIDSKNRYYFDKSQNKRM 2401          

HSP 5 Score: 50.447 bits (119), Expect = 3.170e-7
Identity = 46/166 (27.71%), Postives = 78/166 (46.99%), Query Frame = 3
Query:   39 LTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGL--------VDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSE 512
            LTL+EA +  LVD+    +   I G+  +L EAI  G+IDAE   I D  +   +S+SE ++ G     LL + K  ++K               D    T+ EA+ +GL        +  +RG IR+  + + +S  EA+  G+I      + D +  +S  +++
Sbjct: 1819 LTLEEAAQNKLVDSSGYFVDRGILGQRYTLLEAIVAGLIDAEVRHIVDPNENDVISISEAMERG----LLLPNGKIVLEK---------------DEKEFTIPEAVHEGLLTKRVRHSIFNIRG-IRNTETSQNLSFNEAVEAGVIIPNAERVVDLQTQESFLITD 1964          
BLAST of SMED30009048 vs. Ensembl Celegans
Match: vab-10 (VAB-10B protein [Source:UniProtKB/TrEMBL;Acc:G5EFM4])

HSP 1 Score: 78.1814 bits (191), Expect = 8.552e-17
Identity = 62/175 (35.43%), Postives = 86/175 (49.14%), Query Frame = 3
Query:   36 HLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEM----LKSGKNISALLTSE--KERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISA 542
             LTL EA+ KGL D    TI D  +GKEISL EAI   I+D     + D + G+  +  E     L  GKN    L S     R+D      L   S    +    + + EA+ +  VD    ++RDP SG++ S QEA+ R I+DA+   I+    G S S S+ L SG  +S+
Sbjct: 2467 QLTLKEAIMKGLFDPYDTTIVDKKAGKEISLLEAIREEIVDDNAGTVKDTQTGRVHNFLEAGNLGLVKGKNFGDTLDSSLFSGRLD------LGSGSYTRPSGGSSMPIHEAINRNYVDRSSVSVRDPSSGQQYSYQEAVDRRIVDADRGLIHGG--GDSTSFSQGLTSGHLVSS 2633          

HSP 2 Score: 60.8474 bits (146), Expect = 7.369e-11
Identity = 48/171 (28.07%), Postives = 91/171 (53.22%), Query Frame = 3
Query:   39 LTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSE------MLKSG---KNIS-ALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLK 521
            L+L+ A+  G V     ++RD ++G+E+ L+EA   GIID++N   +D  + + +S +E      M  +G   +N S A+ T+ K    + +    +K ++         +L +A+  G  D   GT   P + K+++L+EAI +G+ D  ++ I D + G+ +SL E ++
Sbjct: 2335 LSLERALATGKVAPEDISVRDGLTGREMPLEEAEKWGIIDSKNRYYFDKSQNKRMSYTEAAQQHLMYLTGGVPENASDAVHTTVKV---QTRTAVAKKEALSSGLPLSDYSLGKALSLGWYDQSAGTFTHPETQKQLTLKEAIMKGLFDPYDTTIVDKKAGKEISLLEAIR 2502          

HSP 3 Score: 59.6918 bits (143), Expect = 1.743e-10
Identity = 42/158 (26.58%), Postives = 75/158 (47.47%), Query Frame = 3
Query:   21 STDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAEN------SAIYDAEKGQSVSLSEMLK----SGKNISALLTSEKERMDKEKQTELEKISMEYS---TDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIID 455
             T  HH+ +  A+  GL++   G  R+ I+G+++ L + + RG+ID             D    + ++L E ++      KN +  L S +  +   K  +  +I ME          L   EA+ KGL+D+ +    DP +G+++S+ +AI  G ID
Sbjct: 2908 PTKGHHVPVTTALNDGLINASTGNYRNSITGEDVPLSDTVDRGLIDRSTYETITKPFFTDYRSNRKLNLVEAVRERLIDPKNRTIQL-SRQSIVPIAKAVQDGRIPMEIGEKLRKVDKLNFAEALGKGLIDSKQNVFTDPDTGRQMSIAQAIQEGFID 3064          

HSP 4 Score: 54.6842 bits (130), Expect = 9.410e-9
Identity = 56/215 (26.05%), Postives = 95/215 (44.19%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLK----------SGKNISALLTSEKERMDKEKQTELEKISMEY------------STDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSG----KNISALLTSEKERM 569
            K ++E  +  +H+   EA  KGL+D   G I  P   + +S  E I  GIIDA  + I  +  G+SVS+ E L+          +G+NI   + ++   +D E        S                       ++E+ +    DT +G   D ++G+++SL+ A+A G +  E+ ++ D   G+ + L E  K G    KN      S+ +RM
Sbjct: 2179 KGALEVPSRGYHIY--EAERKGLIDLTNGKISAPNVDRVLSFAEGIELGIIDA--TTIQVSTGGRSVSVKEALEKKIMESDGSVNGRNIEQAVEAKTIVIDAEPLVPYNNQSKNIIQIPSGNGPIISFRQVGQPVVEESTQSWEFDTQQGVFVDNLTGEKLSLERALATGKVAPEDISVRDGLTGREMPLEEAEKWGIIDSKNRYYFDKSQNKRM 2389          

HSP 5 Score: 50.0618 bits (118), Expect = 3.259e-7
Identity = 46/166 (27.71%), Postives = 78/166 (46.99%), Query Frame = 3
Query:   39 LTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGL--------VDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSE 512
            LTL+EA +  LVD+    +   I G+  +L EAI  G+IDAE   I D  +   +S+SE ++ G     LL + K  ++K               D    T+ EA+ +GL        +  +RG IR+  + + +S  EA+  G+I      + D +  +S  +++
Sbjct: 1807 LTLEEAAQNKLVDSSGYFVDRGILGQRYTLLEAIVAGLIDAEVRHIVDPNENDVISISEAMERG----LLLPNGKIVLEK---------------DEKEFTIPEAVHEGLLTKRVRHSIFNIRG-IRNTETSQNLSFNEAVEAGVIIPNAERVVDLQTQESFLITD 1952          
BLAST of SMED30009048 vs. Ensembl Celegans
Match: vab-10 (VAB-10B protein [Source:UniProtKB/TrEMBL;Acc:G5EFM4])

HSP 1 Score: 78.1814 bits (191), Expect = 9.221e-17
Identity = 62/174 (35.63%), Postives = 86/174 (49.43%), Query Frame = 3
Query:   39 LTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEM----LKSGKNISALLTSE--KERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISA 542
            LTL EA+ KGL D    TI D  +GKEISL EAI   I+D     + D + G+  +  E     L  GKN    L S     R+D      L   S    +    + + EA+ +  VD    ++RDP SG++ S QEA+ R I+DA+   I+    G S S S+ L SG  +S+
Sbjct: 2366 LTLKEAIMKGLFDPYDTTIVDKKAGKEISLLEAIREEIVDDNAGTVKDTQTGRVHNFLEAGNLGLVKGKNFGDTLDSSLFSGRLD------LGSGSYTRPSGGSSMPIHEAINRNYVDRSSVSVRDPSSGQQYSYQEAVDRRIVDADRGLIHGG--GDSTSFSQGLTSGHLVSS 2531          

HSP 2 Score: 60.8474 bits (146), Expect = 7.502e-11
Identity = 48/171 (28.07%), Postives = 91/171 (53.22%), Query Frame = 3
Query:   39 LTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSE------MLKSG---KNIS-ALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLK 521
            L+L+ A+  G V     ++RD ++G+E+ L+EA   GIID++N   +D  + + +S +E      M  +G   +N S A+ T+ K    + +    +K ++         +L +A+  G  D   GT   P + K+++L+EAI +G+ D  ++ I D + G+ +SL E ++
Sbjct: 2233 LSLERALATGKVAPEDISVRDGLTGREMPLEEAEKWGIIDSKNRYYFDKSQNKRMSYTEAAQQHLMYLTGGVPENASDAVHTTVKV---QTRTAVAKKEALSSGLPLSDYSLGKALSLGWYDQSAGTFTHPETQKQLTLKEAIMKGLFDPYDTTIVDKKAGKEISLLEAIR 2400          

HSP 3 Score: 59.6918 bits (143), Expect = 1.741e-10
Identity = 42/158 (26.58%), Postives = 75/158 (47.47%), Query Frame = 3
Query:   21 STDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAEN------SAIYDAEKGQSVSLSEMLK----SGKNISALLTSEKERMDKEKQTELEKISMEYS---TDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIID 455
             T  HH+ +  A+  GL++   G  R+ I+G+++ L + + RG+ID             D    + ++L E ++      KN +  L S +  +   K  +  +I ME          L   EA+ KGL+D+ +    DP +G+++S+ +AI  G ID
Sbjct: 2806 PTKGHHVPVTTALNDGLINASTGNYRNSITGEDVPLSDTVDRGLIDRSTYETITKPFFTDYRSNRKLNLVEAVRERLIDPKNRTIQL-SRQSIVPIAKAVQDGRIPMEIGEKLRKVDKLNFAEALGKGLIDSKQNVFTDPDTGRQMSIAQAIQEGFID 2962          

HSP 4 Score: 54.6842 bits (130), Expect = 9.488e-9
Identity = 56/215 (26.05%), Postives = 95/215 (44.19%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLK----------SGKNISALLTSEKERMDKEKQTELEKISMEY------------STDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSG----KNISALLTSEKERM 569
            K ++E  +  +H+   EA  KGL+D   G I  P   + +S  E I  GIIDA  + I  +  G+SVS+ E L+          +G+NI   + ++   +D E        S                       ++E+ +    DT +G   D ++G+++SL+ A+A G +  E+ ++ D   G+ + L E  K G    KN      S+ +RM
Sbjct: 2077 KGALEVPSRGYHIY--EAERKGLIDLTNGKISAPNVDRVLSFAEGIELGIIDA--TTIQVSTGGRSVSVKEALEKKIMESDGSVNGRNIEQAVEAKTIVIDAEPLVPYNNQSKNIIQIPSGNGPIISFRQVGQPVVEESTQSWEFDTQQGVFVDNLTGEKLSLERALATGKVAPEDISVRDGLTGREMPLEEAEKWGIIDSKNRYYFDKSQNKRM 2287          

HSP 5 Score: 50.447 bits (119), Expect = 2.965e-7
Identity = 46/166 (27.71%), Postives = 78/166 (46.99%), Query Frame = 3
Query:   39 LTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGL--------VDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSE 512
            LTL+EA +  LVD+    +   I G+  +L EAI  G+IDAE   I D  +   +S+SE ++ G     LL + K  ++K               D    T+ EA+ +GL        +  +RG IR+  + + +S  EA+  G+I      + D +  +S  +++
Sbjct: 1705 LTLEEAAQNKLVDSSGYFVDRGILGQRYTLLEAIVAGLIDAEVRHIVDPNENDVISISEAMERG----LLLPNGKIVLEK---------------DEKEFTIPEAVHEGLLTKRVRHSIFNIRG-IRNTETSQNLSFNEAVEAGVIIPNAERVVDLQTQESFLITD 1850          
BLAST of SMED30009048 vs. Ensembl Fly
Match: shot (gene:FBgn0013733 transcript:FBtr0087621)

HSP 1 Score: 55.8398 bits (133), Expect = 5.914e-9
Identity = 40/170 (23.53%), Postives = 87/170 (51.18%), Query Frame = 3
Query:   39 LTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTD-------AHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSG 527
            L L EA+ K + D + G   DP SG++++  EA+   ++D  +  I D + G    L+  L   K+ + ++ ++  ++    QT    ++++++ D          +++  A+ +GL D   G + DP +G++I+L E++   +++      +D +  Q  +LSE  ++G
Sbjct: 4215 LRLIEAVVKNVYDEVDGHFVDPKSGEKLNFAEALNTNLLDEHSVQIRDFKTGLYKQLN--LTHAKD-TGIIDAQNSKLLYNNQT----MTLKHAFDIGILMDVNAPISIQRAIHQGLFDDKTGKLSDPRTGRQITLLESMRSFVVNPHLPCYFDEQTEQMYTLSETCRNG 4377          

HSP 2 Score: 55.8398 bits (133), Expect = 5.970e-9
Identity = 40/160 (25.00%), Postives = 73/160 (45.62%), Query Frame = 3
Query:   21 STDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSG--KNISALLTSEKERMDKEKQTEL---EKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAE 485
             T   +L L EA+  G +D      ++ ++GKE+ L EAI  G ID     ++D +   + +    L  G    I+  LT   + + ++   EL     +S+  S     ++L+EA+   ++D     +RD  S K +    A+ RG++D     + D +
Sbjct: 4532 PTTGEYLDLIEAIHSGFIDPATTVFKNQLTGKELPLTEAIENGDIDVSKGRVFDPKSKSAYNYDVALSRGILVTITRPLTDRNDVVRRQDSVELLNQTPVSVVISK-PREMSLEEAIRYNIIDPKTALVRDFDSFKFLPYSVAVERGLVDTTKRTLVDPK 4690          

HSP 3 Score: 53.9138 bits (128), Expect = 2.206e-8
Identity = 50/168 (29.76%), Postives = 82/168 (48.81%), Query Frame = 3
Query:   39 LTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISA 542
            L L +A+  GLVD   G I D  SG +  L  AIA  +IDA    + DA++   ++L E L+SG  ++A        + KEK T  E  + +     +  TL +  +  L+D  +  I  P+  +++S+ +AI  G++D          KG+ V+L E +  G  + A
Sbjct: 1664 LCLSDAIAHGLVDGA-GWIADRNSGDKFRLDSAIANQLIDASVREVVDAKRDTKITLQEALQSGV-LNAKTGRYVNEVTKEKLTFAEARNRQLIVKPY--TLKDICDLNLLDK-QAQITSPMRREKLSIMQAIEAGVLDGNLLKCITKRKGELVTLQEAIADGIVLPA 1826          

HSP 4 Score: 51.6026 bits (122), Expect = 1.400e-7
Identity = 54/200 (27.00%), Postives = 87/200 (43.50%), Query Frame = 3
Query:   18 YSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIAR-GIIDA----------ENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRD-------------------PISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSG 527
            +ST  +  TL  A+E+ L+D   G + DP +GK+I   E + R  II A          EN  I D + GQ V     L  G+  S +      ++D      ++ IS+        + L  A+E G+VD   GT+ D                   P + K ISL+ A+ +G+ D E   ++D+E    V + + ++ G
Sbjct: 3677 FSTGKYE-TLTAALERPLLDRHTGHMVDPKTGKKIPFFECVDRQWIIRANPEEQKPSGIENVTI-DTQTGQVV-----LDDGRVCSIVEAINSGKLD------IQSISVRDPVSGEVIPLRMAIELGVVDMQAGTVIDIQTLKEIPMELAFQLGFLVPGARKPISLEAAVRKGLYDPETGKLFDSESQNQVDVQKSIEIG 3863          

HSP 5 Score: 50.0618 bits (118), Expect = 4.814e-7
Identity = 35/168 (20.83%), Postives = 81/168 (48.21%), Query Frame = 3
Query:   39 LTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL-----EKISMEYSTDAHH--LTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLK 521
            +++  A+ +GL D   G + DP +G++I+L E++   +++      +D +  Q  +LSE  ++G      + + +E + +E  +       E +S+    D  +    L E +  G  +T    +  P++ ++++L EA    ++   +S +   E G+ + L+  +K
Sbjct: 4314 ISIQRAIHQGLFDDKTGKLSDPRTGRQITLLESMRSFVVNPHLPCYFDEQTEQMYTLSETCRNG------IINRREGVFREPGSNSFVPLGEALSLGLIVDIENAGFGLYELLSMGFYETSTRKVLHPVTNRKLNLNEACVEDVVSLSSSLVKHHETGKYLRLANAIK 4475          

HSP 6 Score: 49.6766 bits (117), Expect = 6.313e-7
Identity = 56/187 (29.95%), Postives = 89/187 (47.59%), Query Frame = 3
Query:   51 EAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSG--KNISALLTSEKERMDKEKQTELEKISMEYSTDAH---HLTLDEAMEKGLV--DTL-RGTIRD--P--ISGKEISLQ----------EAIARGIID------AENSAIYDAEKGQSVSLSEMLKSG 527
            +A  +GLVD     I DP + + IS+ EAIAR I D + + I D+E GQ V L    K G    + A L + +  +           ++ + TD      + ++ A E+G+V  D L RG   D  P  +  K + LQ          +A+ +GIID       EN++ +   KG+ V+++E L +G
Sbjct: 2323 DAARQGLVDEQLIKIVDPTTKQPISVTEAIARSIYDPKTATILDSE-GQPVDLITATKLGLLSVVGAPLVAAEGALR----------TVRFVTDPRTGEQIPVEVAYERGIVSRDQLHRGRSFDSEPATVEDKVVVLQRMRKVILKPKDALRKGIIDEETCEILENTSNFTNPKGEVVNITEALNTG 2498          

HSP 7 Score: 48.1358 bits (113), Expect = 2.266e-6
Identity = 43/168 (25.60%), Postives = 74/168 (44.05%), Query Frame = 3
Query:   51 EAMEKGLVDTLRGTIRDPISGKEISLQEAIARG----------IIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAI----------ARGIIDAENSAIYDAEKGQ 494
            EA + GL+DT+RGT+  P     ISL EA  +G          ++D     +YD    +     + L     I+  L + +E +  + +TE              +++ EA+ KG +D + G + +P +  ++SL EA+           R + DA    +YD + GQ
Sbjct: 3984 EAAKVGLLDTVRGTLSSP----NISLDEAFVKGYLISTKKPLSLVDCLLRGLYDPSTAKFTIDDKQLDLKAAIAQKLINPEELVLLDPKTE------------SIISITEAIAKGYLDPIEGYVINPYASTKLSLHEALENRILIPPKRKRSLPDAVYRGLYDPKTGQ 4135          

HSP 8 Score: 46.595 bits (109), Expect = 7.184e-6
Identity = 37/160 (23.12%), Postives = 72/160 (45.00%), Query Frame = 3
Query:   27 DAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSL 506
            D    ++ EA+  G +D    ++RDP+SG+ I L+ AI  G++D +   + D +  + + +    + G     L+   ++                       ++L+ A+ KGL D   G + D  S  ++ +Q++I  G++D + S I D    + V L
Sbjct: 3750 DGRVCSIVEAINSGKLDIQSISVRDPVSGEVIPLRMAIELGVVDMQAGTVIDIQTLKEIPMELAFQLG----FLVPGARK----------------------PISLEAAVRKGLYDPETGKLFDSESQNQVDVQKSIEIGLVDPKISLIVDTVTKKEVKL 3883          
BLAST of SMED30009048 vs. TrEMBL
Match: X2AMI3 (Uncharacterized protein OS=Capitella teleta OX=283909 PE=4 SV=1)

HSP 1 Score: 100.138 bits (248), Expect = 8.134e-21
Identity = 61/174 (35.06%), Postives = 104/174 (59.77%), Query Frame = 3
Query:   27 DAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEML-------KSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSG 527
            D   L+L+EA+++GLVD   G++ DP +G ++SL EA+  G+ID E S+++D E  + ++L E L       K+GK    ++ S  + M   + +E  K  +  S +   LTL EA+E+G+++   G + DP++GK IS+++AI +G++D  +  I D E G  + L E L+ G
Sbjct: 8701 DEPSLSLEEAIKQGLVDRTSGSVTDPSNGHKMSLGEAVKTGLIDGEESSVFDPESRRPLTLLEALDRKLINPKTGK----MVDSVGQEMGVVEASE--KGVIRSSDEELDLTLAEAIERGVLNPANGLVTDPVTGKTISMEDAIKQGLLDGSSPQIPDPETGSLIGLDEALRRG 8868          

HSP 2 Score: 85.5001 bits (210), Expect = 1.170e-15
Identity = 47/167 (28.14%), Postives = 96/167 (57.49%), Query Frame = 3
Query:   39 LTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEK----QTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSG 527
             +LD A++ G+ D   G  RDP++G+ +SLQ+AI RG++D    AI D + G+++SL E LK       ++ S   ++++ K    +  L+ +     T    + +++A+  GL+++  G  R P +G+ ++L+EA++  ++  +++ + D   G+ +SL+E +  G
Sbjct: 2759 FSLDSAVKLGIYDVRTGQFRDPLNGESMSLQQAIERGLVDVNAPAIVDIKSGRTLSLEEALKEN-----IINSNTGKVNEGKARTLKIALDPLFTSKETKLSPINVEDAILAGLLNSKTGVFRHPKTGETMTLEEALSLNLLAGDSTLVTDPANGERISLTEAIHKG 2920          

HSP 3 Score: 84.3445 bits (207), Expect = 2.244e-15
Identity = 54/163 (33.13%), Postives = 86/163 (52.76%), Query Frame = 3
Query:   39 LTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSG 527
            +T+DEA+EKG++D     IRDP +G++++LQ+AI  GI+D     + D   G+++ LSE    G  +++  T E                         L++ +AMEKG+ +   GTI D  SG+++SL +AI  G++  ++  I D   G  VSL E  K G
Sbjct: 6894 VTVDEALEKGILDPT-SKIRDPHTGRDLTLQDAIESGIVDTNLGILIDTSTGKAIPLSEAYNKGLVVTSPKTDEA------------------------LSIKQAMEKGIFNEESGTILDEESGQDLSLGDAIKSGLLSGDDVKIVDPSSGNLVSLPEASKKG 7031          

HSP 4 Score: 83.9593 bits (206), Expect = 3.693e-15
Identity = 59/202 (29.21%), Postives = 103/202 (50.99%), Query Frame = 3
Query:   39 LTLDEAMEKGLVDTLRGTIRDPISGKE--------------------------ISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEML-------KSGKNISAL 545
            L+LDEA+++GLVD   G I DP + K+                          + L+EA+A G++ AE+ ++ +   G+ VSL + +  G  +      +K  +  +K  E          D   L+L+EA+++GLVD   G++ DP +G ++SL EA+  G+ID E S+++D E  + ++L E L       K+GK + ++
Sbjct: 8591 LSLDEAVQQGLVDPKTGMITDPSTKKQMPFKQGLESIIDRDQSQVIDPATREAVGLKEALASGLLSAEDGSVLNRATGERVSLEQAMALGY-LMGWAAHQKATLSADKADE----------DEPSLSLEEAIKQGLVDRTSGSVTDPSNGHKMSLGEAVKTGLIDGEESSVFDPESRRPLTLLEALDRKLINPKTGKMVDSV 8781          

HSP 5 Score: 83.1889 bits (204), Expect = 6.882e-15
Identity = 52/164 (31.71%), Postives = 92/164 (56.10%), Query Frame = 3
Query:   39 LTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISM-EYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSG 527
            L+L EA  KG V+   G I+DP SG+E+++ EA+  G++D E++ +   +  + ++LSE +  G  +  + +S  +    ++    + IS  ++      LT  +A++KG      G + DP S  E SL+EAI +G+ID  +S I + + G+ +SL E + SG
Sbjct: 7371 LSLTEAASKGFVNPDTGLIKDPQSGQELTIGEALTTGLLDGESTLLTSPQTNELITLSEAIDQGV-VDPVSSSVLDDTTNDQVKLADAISTGQFKERIEGLTFQDALDKGFFSPETGKVTDPNSKSECSLKEAIKQGLIDPTSSIIKEPDSGKILSLQEAISSG 7533          

HSP 6 Score: 81.2629 bits (199), Expect = 2.921e-14
Identity = 48/166 (28.92%), Postives = 94/166 (56.63%), Query Frame = 3
Query:   39 LTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSG---KNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSG 527
            L++ +AMEKG+ +   GTI D  SG+++SL +AI  G++  ++  I D   G  VSL E  K G    +   + + E + M    +   + I++E+S     ++  +A+++G+++   G +RDP +G ++++ EA+ +G+ID  +  + D   G  +S+ + +K G
Sbjct: 6968 LSIKQAMEKGIFNEESGTILDEESGQDLSLGDAIKSGLLSGDDVKIVDPSSGNLVSLPEASKKGLADLDKGTVFSPEAKSMVPISEALHKGIALEFSKPP--MSPKDALQQGVMEPRTGQVRDPKTGDDVTITEAVVKGVIDPSSFKVIDPVSGDLLSMEKAIKKG 7131          

HSP 7 Score: 81.2629 bits (199), Expect = 3.437e-14
Identity = 54/164 (32.93%), Postives = 93/164 (56.71%), Query Frame = 3
Query:   39 LTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELE-KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSG 527
            L+L +A+EKGL +   G   DP+S +E++LQEAI RG+ID+++  I     G+ +S+S+ +  G     L  S  + +D   Q  +    +M        ++L +A+ +G +D   G + DP SG++++L EAI RG++D +   I D    + +SLSE ++ G
Sbjct: 1572 LSLTDALEKGLYNPQTGKFLDPVSREEMTLQEAIDRGLIDSDSREIQHPVTGEQMSVSQAIAQG----ILNASNGKLIDPRSQKGMGLDEAMHRQLLHRRMSLHDALLEGHLDA-EGCLIDPKSGRKLNLLEAIERGVLDTDFKCIVDPRTNELLSLSEAIQRG 1730          

HSP 8 Score: 79.7221 bits (195), Expect = 9.207e-14
Identity = 49/162 (30.25%), Postives = 85/162 (52.47%), Query Frame = 3
Query:   39 LTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKS 524
            +T+ EA+ KG++D     + DP+SG  +S+++AI +GI+D E   +Y+   GQS+S+ E +  G                        + +E  T    L+L EA+++GL D   GTIRD    ++++L EA+  GI+D   S +       +V+L+E +K+
Sbjct: 7095 VTITEAVVKGVIDPSSFKVIDPVSGDLLSMEKAIKKGIMDNETGEVYNPHTGQSISMQEAIHKG------------------------LVVEVKT-PRRLSLTEAVQQGLYDPENGTIRDSDRKRDLTLIEAVESGIVDPSKSDVRVPGTDDTVTLAEAMKT 7231          

HSP 9 Score: 78.9518 bits (193), Expect = 1.833e-13
Identity = 52/158 (32.91%), Postives = 90/158 (56.96%), Query Frame = 3
Query:   39 LTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSG--KNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSL 506
            L+L +A+++GL +   G + +P SG++ +L+ A+A G+IDA+ S I D E G+S+ + + LKSG     S  +   K R        + K ++  + D   L+L EA++KGL D+    + DP SGK+++++E I  GI+    + I D+  G  + L
Sbjct: 7771 LSLTDAVKQGLYNPDTGMLTNPTSGEQTTLEGAVACGLIDADKSRIKDPESGKSLKIDDALKSGLIDMNSGTIEDPKTRAPINLGEAMMK-NLLVTDDKPELSLAEAVDKGLYDSDSRKVTDPESGKQLTIEEGIKSGILSPTKTKILDSSTGDMLPL 7927          

HSP 10 Score: 78.5666 bits (192), Expect = 2.537e-13
Identity = 62/213 (29.11%), Postives = 109/213 (51.17%), Query Frame = 3
Query:    6 ISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAE-------NSAIYDAEKGQSVSLSEMLKSG-----KN------------ISALLTSEKERMDKEKQTELEKISMEYS----TDAHH-----------LTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSG 527
            +S+ +    + L+L +A+  GL D   GT +DP SG+++S+ EA + G +D E          I D   G+ ++L E ++ G     +N            IS  L+S    + +   ++L+ +SM+ S    T+A +           L+L +A+EKGL +   G   DP+S +E++LQEAI RG+ID+++  I     G+ +S+S+ +  G
Sbjct: 1425 LSVTHPESGNRLSLLDAILCGLFDPKTGTFKDPESGRQLSISEAASSGFLDPEMVKELQQKCGIRDPRTGRELTLLEAMQKGFYDPLRNEVKDPKTGRSMPISQALSSGI--ISQTMASKLQFVSMKASQSMQTEAFYSIASSDGVNLKLSLTDALEKGLYNPQTGKFLDPVSREEMTLQEAIDRGLIDSDSREIQHPVTGEQMSVSQAIAQG 1635          

HSP 11 Score: 76.6406 bits (187), Expect = 1.264e-12
Identity = 49/169 (28.99%), Postives = 88/169 (52.07%), Query Frame = 3
Query:   12 MEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEML 518
            +++      L+++EA+E G++D  + T     S   ISL EA+ +GI+D ++  + +   G S+SL+E +      S L+  + +R                      LTLDEA++KGL D +  T+ DP + + +  Q+AI RGIIDA+ + I     G++++L + +
Sbjct: 7988 IKHPVTMQQLSVEEAVESGVIDPEKTTFTFQDSADAISLTEALDQGIVDPDSGLVRNPTSGDSISLTEAID-----SELVFDQPQR--------------------QALTLDEAIQKGLYDEISRTVLDPDTKEPMKFQDAIERGIIDADRTLINIPSTGETMTLGDAI 8131          

HSP 12 Score: 76.2554 bits (186), Expect = 1.732e-12
Identity = 56/174 (32.18%), Postives = 93/174 (53.45%), Query Frame = 3
Query:   39 LTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSL-------SEMLKS-----GKNISALLTSEKERMDKEKQT--ELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEML 518
            LTL EAM+KG  D LR  ++DP +G+ + + +A++ GII         A K Q VS+       +E   S     G N+   LT   E+     QT   L+ +S E       +TL EA+++GL+D+    I+ P++G+++S+ +AIA+GI++A N  + D    + + L E +
Sbjct: 1497 LTLLEAMQKGFYDPLRNEVKDPKTGRSMPISQALSSGIISQTM-----ASKLQFVSMKASQSMQTEAFYSIASSDGVNLKLSLTDALEKGLYNPQTGKFLDPVSRE------EMTLQEAIDRGLIDSDSREIQHPVTGEQMSVSQAIAQGILNASNGKLIDPRSQKGMGLDEAM 1659          

HSP 13 Score: 76.2554 bits (186), Expect = 1.816e-12
Identity = 51/179 (28.49%), Postives = 101/179 (56.42%), Query Frame = 3
Query:   39 LTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEM-LKSGK-----NISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSE 557
            LT  +A+++ L+D  + TI +P +G +++++EA+ +G +D  +  + +A  G+ VS+ ++ +  GK     +    LT E    +    +E   ++  ++     +T+DEA+EKG++D     IRDP +G++++LQ+AI  GI+D     + D   G+++ LSE    G  +++  T E
Sbjct: 6792 LTFQDALQRRLLDP-KSTITNPSTGLKMTVEEAVDQGTLDISSGLVMNARTGKPVSVHDVAMNPGKIQDTVSPPTYLTLESAFEEGLYNSEDNTLTDPWT--GVGVTVDEALEKGILDPT-SKIRDPHTGRDLTLQDAIESGIVDTNLGILIDTSTGKAIPLSEAYNKGLVVTSPKTDE 6966          

HSP 14 Score: 75.485 bits (184), Expect = 2.818e-12
Identity = 54/180 (30.00%), Postives = 100/180 (55.56%), Query Frame = 3
Query:   39 LTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSE-----MLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSG----KNISALLT 551
             +L EA+++GL+D     I++P SGK +SLQEAI+ G++D E   + D++  + VS+ E     +L S K  +  L   KE M+  K        ++ ST    LTL++A+ KG+++  +  + DP + ++ +L++AI R ++D +   +   +K Q VS+    + G    ++I  L++
Sbjct: 7497 CSLKEAIKQGLIDPTSSIIKEPDSGKILSLQEAISSGVLDPEKGVLKDSDTSKVVSIQEAIDEDLLMSSKEPNLSL---KELMEAGKFNPSTGKVIDPST-GKKLTLEDALVKGVLNPSKTIVEDPATEEKYTLEDAIKRKLVDPKKGKMLVGKKAQPVSMDVAFEKGLLTERDIKPLMS 7672          

HSP 15 Score: 74.7146 bits (182), Expect = 5.551e-12
Identity = 54/174 (31.03%), Postives = 94/174 (54.02%), Query Frame = 3
Query:   39 LTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEML-------KSGK---NISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDA-EKGQSVSLSEMLKSG 527
            LTL EA E+GL+D   G + DP+S ++++  +A+A G++DA  + + D    + + LSE +       KSGK    +S  L     +         E IS+ Y      +++++A++ GL+D   G ++DP++GK  S  +A  RG++D   + I D  +K   +SL+E +K G
Sbjct: 8903 LTLKEAFEEGLLDDKSGKVMDPLSKQKLTAVQALANGVLDARQTVV-DPASQKEMPLSEAVEKGIINGKSGKVRDPVSGKLVGVGSK---------EGISLLYPL---KMSVEDALDSGLLDVRSGQMKDPLTGKMHSFGDATKRGLLDGSTAQIADPNDKDHLLSLNEAMKRG 9063          

HSP 16 Score: 74.3294 bits (181), Expect = 7.462e-12
Identity = 48/167 (28.74%), Postives = 89/167 (53.29%), Query Frame = 3
Query:   39 LTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKIS------MEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLK 521
            LT  +A++KG      G + DP S  E SL+EAI +G+ID  +S I + + G+ +SL E + SG     +L  EK  +     +++  I       +  S+   +L+L E ME G  +   G + DP +GK+++L++A+ +G+++   + + D    +  +L + +K
Sbjct: 7470 LTFQDALDKGFFSPETGKVTDPNSKSECSLKEAIKQGLIDPTSSIIKEPDSGKILSLQEAISSG-----VLDPEKGVLKDSDTSKVVSIQEAIDEDLLMSSKEPNLSLKELMEAGKFNPSTGKVIDPSTGKKLTLEDALVKGVLNPSKTIVEDPATEEKYTLEDAIK 7631          

HSP 17 Score: 73.559 bits (179), Expect = 1.428e-11
Identity = 51/169 (30.18%), Postives = 83/169 (49.11%), Query Frame = 3
Query:   21 STDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSG 527
             T      L+EA+E GL+D  + TI DP +GK+++L  A A G+ID+++  + +   G+++ L E + +G   + +                         D   LTL EA+  G+VDT   T  +P++ + +SL+ AI   +ID  +S I D   G  VSL E +  G
Sbjct: 6593 PTCGRFFALEEAIEFGLIDD-QSTILDPATGKQMALARATACGVIDSKHGNVINVHTGETIPLKEHI-TGSKFACV------------------------GDRTGLTLQEAISSGIVDTTNNTYVNPMTNEAVSLEHAIKTELIDP-HSLIQDPTTGDVVSLKEAVHEG 6734          

HSP 18 Score: 73.1738 bits (178), Expect = 1.695e-11
Identity = 51/174 (29.31%), Postives = 86/174 (49.43%), Query Frame = 3
Query:   54 AMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSG---------KNISALLTSEKERMDKEKQTELE-------KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSG 527
            A++ GL +       +P +GKE++LQEAI RG+ID + SA+ D   G S++L E +K G         K     + S  +  D +  T          K S E   D +  T  EA+ +GL D+   T   P SG++++++EA+  G I+ E++ + D   G+ ++   +   G
Sbjct: 6265 ALDSGLYNPDTNRFVEPGTGKELTLQEAIDRGVIDPKGSAMLDPNTGGSLTLEEAVKKGLINPKEGHIKTPEGDMVSLGQAADIDILTNCHIPADPKLKYSSEVPVDGYTFT--EAINEGLFDSETCTFSHPGSGQQMTIEEALDIGFINPESAIVRDPNSGRQMTFEALRDMG 6436          

HSP 19 Score: 71.2478 bits (173), Expect = 8.736e-11
Identity = 52/166 (31.33%), Postives = 90/166 (54.22%), Query Frame = 3
Query:   39 LTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHH---LTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSG 527
            +++ EA+E  L D   G I DP +G +++LQ A+  G+ID  +  +   E  + +  +  ++ G   S   T +    D E  T  E I    +  A     L+L +A+++GL +   G + +P SG++ +L+ A+A G+IDA+ S I D E G+S+ + + LKSG
Sbjct: 7671 MSIHEALETQLFDEDTGRIVDPQTGAKMTLQGAVDSGVIDKNSIKVRHPETSELLDFNRAVEEGVLDSQ--TGDVISPDLETLTLKEAIDSGLAVTATQDKGLSLTDAVKQGLYNPDTGMLTNPTSGEQTTLEGAVACGLIDADKSRIKDPESGKSLKIDDALKSG 7834          

HSP 20 Score: 70.4774 bits (171), Expect = 1.734e-10
Identity = 44/146 (30.14%), Postives = 83/146 (56.85%), Query Frame = 3
Query:   39 LTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLT------LDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDA 458
            +TL+EA  +GL+    G I+ P++G+ ++++EAI  G +D+E+S I D   G+++++SE ++ G  I    T +       K   L ++++E     H LT      L EA+++GL++   G   DP +G+ + ++ A+  G I+A
Sbjct: 3424 MTLNEAATRGLLIVPLGKIKHPVTGQRMTIEEAINCGFLDSEHSIIIDPSTGRTLTISEAIRRG--ILDPRTGDVMNTADGKVMSLTEVTLEGLLPEHGLTSSDAIPLSEAIDRGLLNVKSGQYTDPNTGQVMDIERAMRLGFIEA 3567          

HSP 21 Score: 68.5514 bits (166), Expect = 7.231e-10
Identity = 60/196 (30.61%), Postives = 92/196 (46.94%), Query Frame = 3
Query:   39 LTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAI---------------------------ARGIIDAENSAIYDAEKGQSVSLSEMLKSG------KNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSG 527
            + LD+A+EKGLVD   GT  DP +G+ +SL  AI                           ++G+ID + +   +   G  + L   ++ G        +   +T EKE     KQTE    S+  ST    LT  +A ++G +D   G  RDP +GK++ + EAI +G+ID    A   AE+G  +SL+E +  G
Sbjct: 3604 VPLDQAVEKGLVDQQSGTYTDPRTGEIMSLASAITYGLVCAPMSDADELNDVDGIDFETAMSQGLIDIQGNTFTEPVTGSLMPLDTAIRKGFVILPEGGVKVKITEEKEET-LSKQTEAVH-SLGGSTQG-TLTFVDAYDQGYIDLDTGVYRDPSTGKQMPIAEAIEKGLIDPTKEAA--AEEGAPLSLTEAINRG 3794          

HSP 22 Score: 67.781 bits (164), Expect = 1.142e-9
Identity = 50/163 (30.67%), Postives = 85/163 (52.15%), Query Frame = 3
Query:   39 LTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSG 527
            LT  +A ++G +D   G  RDP +GK++ + EAI +G+ID    A   AE+G  +SL+E +  G      L  EK    ++ +T               ++L EA+ +GL+D     + D  S K ++L++A+ +G+ID+ +    D+  GQ +SL +  K G
Sbjct: 3733 LTFVDAYDQGYIDLDTGVYRDPSTGKQMPIAEAIEKGLIDPTKEAA--AEEGAPLSLTEAINRG------LFDEKTGKFRDLRT------------GRTMSLTEAISQGLIDR-DSMVYDTTSAKTLTLEDALHQGVIDSRSGKFIDS-SGQKISLKDAAKFG 3873          

HSP 23 Score: 67.781 bits (164), Expect = 1.280e-9
Identity = 49/163 (30.06%), Postives = 84/163 (51.53%), Query Frame = 3
Query:   39 LTLDEAMEKGLVDTLR-------------GTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYS----TDAH---HLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENS 467
            + LDEA+ +GLV T +             G++++P++G+ IS  EA+ +GI+D  NS   D    ++ +L+E    G  I A +    + +   +Q ++++ +  YS     D H    +   EA+EKG++D   G   DP +GK + + EA  +G I AE S
Sbjct: 4231 IPLDEAVRQGLVITQKPSDAPKPGQTYSIGSVKNPLTGQFISPAEAVEQGILDMNNSLYVDPITSKTYALAEAFHMG-FIRAQVAESSDSVTVTQQ-QIKQDNQAYSIKSVIDPHTGQKIHPSEAVEKGILDLTNGVYIDPTTGKTMPIHEAFEKGFITAEKS 4391          

HSP 24 Score: 67.3958 bits (163), Expect = 1.981e-9
Identity = 47/176 (26.70%), Postives = 87/176 (49.43%), Query Frame = 3
Query:   39 LTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEML-------KSGK--------NISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLK 521
            LTLDEA++KGL D +  T+ DP + + +  Q+AI RGIIDA+ + I     G++++L + +       +SG         ++  +   E +       +E+    +E  T  H  +L +A++ G++D     + DP SG ++    A+  G++D     I+     + V + E +K
Sbjct: 8071 LTLDEAIQKGLYDEISRTVLDPDTKEPMKFQDAIERGIIDADRTLINIPSTGETMTLGDAIDQDIVDVESGTVKDMEYPVSVGQICVHEAQVDSVATSSEM---FIESPTQMHGFSLIKALKVGVIDRESNVVTDPNSGLDVQFHLALISGLLDFSTLRIWHESSNEFVDIDEAIK 8243          

HSP 25 Score: 67.0106 bits (162), Expect = 2.179e-9
Identity = 56/196 (28.57%), Postives = 94/196 (47.96%), Query Frame = 3
Query:   39 LTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSV------SLSEMLKSG--------------------KNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDE-------AMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSG 527
            +TL EA++ G+VD+  G + DP + +     EA+++GI+     ++  AE+ + V       L E +KSG                    + I   L   KE +  + +T L  +S+  ++    L   E       A++ GL +       +P +GKE++LQEAI RG+ID + SA+ D   G S++L E +K G
Sbjct: 6129 MTLSEAIDDGIVDSCSGDLIDPNTNERTKFSEAVSKGIVSPTKPSVSFAEEPEVVKKNPREGLDEAIKSGLMNAATTIMDPSTGDMISIEEAIHEGLLDPKEGVLLDTRTGL-PMSLYQASKKGILVQQELPVPLLTALDSGLYNPDTNRFVEPGTGKELTLQEAIDRGVIDPKGSAMLDPNTGGSLTLEEAVKKG 6323          

HSP 26 Score: 66.6254 bits (161), Expect = 3.817e-9
Identity = 48/169 (28.40%), Postives = 86/169 (50.89%), Query Frame = 3
Query:   27 DAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTE--LEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSG 527
            D   L+L EA++KGL D+    + DP SGK+++++E I  GI+    + I D+  G  + L + +       +        + K    E  LEK  +  S     ++L +A E+GL     G I+ P++ +++S++EA+  G+ID E +     +   ++SL+E L  G
Sbjct: 7867 DKPELSLAEAVDKGLYDSDSRKVTDPESGKQLTIEEGIKSGILSPTKTKILDSSTGDMLPLEDAVSKKLFDPSTGAVSPSPLGKPIGFEQALEKGLVADSFIPPMMSLQQANEQGLFS--EGKIKHPVTMQQLSVEEAVESGVIDPEKTTFTFQDSADAISLTEALDQG 8033          

HSP 27 Score: 65.4698 bits (158), Expect = 7.564e-9
Identity = 46/177 (25.99%), Postives = 88/177 (49.72%), Query Frame = 3
Query:   45 LDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKI----------SMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSV------SLSEMLKSG 527
              EA+EK ++D     ++ P +G+ ++L EA+  G++D E  ++ D E  Q V L   +  G  + A   +E++    +KQ   E +           +++ +    +TL EA++ G+VD+  G + DP + +     EA+++GI+     ++  AE+ + V       L E +KSG
Sbjct: 6023 FKEAVEKKVIDGDGMLVKHPQTGRPVTLTEALEEGVVD-EKGSVIDPETRQPVDLQGAIAKGLVVPASEEAEEDDAIPQKQPFKEAVEKNIIDGSSMQVKHPSTGVSMTLSEAIDDGIVDSCSGDLIDPNTNERTKFSEAVSKGIVSPTKPSVSFAEEPEVVKKNPREGLDEAIKSG 6198          

HSP 28 Score: 65.4698 bits (158), Expect = 7.709e-9
Identity = 48/164 (29.27%), Postives = 86/164 (52.44%), Query Frame = 3
Query:   39 LTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGK 530
            +TL EA+++GL+D     + DP S   +SL+E+I   + D +   I D    + V L+  ++ G  I+  + S    +D     E     ++  T      L+EA+E GL+D  + TI DP +GK+++L  A A G+ID+++  + +   G+++ L E +   K
Sbjct: 6502 VTLGEAIDRGLLDPNSVVVNDPRSCAVLSLEESIKANLTDHKKGFIKDTSCREKVPLTVAMERGILIARPM-SVATAVDIGLYNETTYKFLD-PTCGRFFALEEAIEFGLIDD-QSTILDPATGKQMALARATACGVIDSKHGNVINVHTGETIPLKEHITGSK 6662          

HSP 29 Score: 63.5438 bits (153), Expect = 3.387e-8
Identity = 46/142 (32.39%), Postives = 74/142 (52.11%), Query Frame = 3
Query:   39 LTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHH----LTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGII 452
            +T+ EA+E+G+VD L GT  D  +GK+I L EA A+G++      I D  K Q       +   + +   + +E       K TE   I+ +Y T   +    ++  EA+ +GL++  RG  RDP +G  +SL EAI R ++
Sbjct: 4728 MTVSEAVERGIVDVLNGTYLDTTTGKKIPLHEAAAKGLV------ITDDPKFQF-----NMNDPQGLKFKVDTETSLATSYKATE---ITSDYDTVDQYSRKAMSYSEAISQGLLNKARGEFRDPSTGDIMSLDEAIKRNLL 4855          

HSP 30 Score: 62.7734 bits (151), Expect = 7.299e-8
Identity = 52/184 (28.26%), Postives = 93/184 (50.54%), Query Frame = 3
Query:   39 LTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSG-----KNISALLTSEKERMDKEKQTELEKISMEYSTDAHH----------LTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEK------GQSVSLSEMLKSG 527
            ++L +A+ +G +D   G + DP SG++++L EAI RG++D +   I D    + +SLSE ++ G           LT  +  +         K+  +  T A            LTL EA+++G++D       D  + KE+S+++A+ RG+ID E +   +++       G S+S+ E+LK G
Sbjct: 1668 MSLHDALLEGHLDA-EGCLIDPKSGRKLNLLEAIERGVLDTDFKCIVDPRTNELLSLSEAIQRGLINSRGQFVNPLTGHQMSIQNAMNDGCTKVLNQDVTFAQRGIKDTASDDWLTLAEAIQQGIIDVNSSRYIDRRNRKEMSIEDAVRRGLIDLELAQTLNSDSGLKDIMGSSLSVLEVLKRG 1850          

HSP 31 Score: 62.3882 bits (150), Expect = 9.163e-8
Identity = 49/165 (29.70%), Postives = 83/165 (50.30%), Query Frame = 3
Query:   33 HHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSG 527
            H L+L+EAM++GL+D   G +  P     + L EA A GI+      +  +E  +     +   + K+ +  + + KE + +   T+  K S         L+LDEA+++GLVD   G I DP + K++  ++ +   IID + S + D    ++V L E L SG
Sbjct: 8505 HLLSLNEAMKRGLIDPRSGRVLVPGKVGGLPLDEAQAAGIV------VSSSEDQEDQEARDFAATAKSAAPEIGAVKEPLAEAAATKKLKPS---------LSLDEAVQQGLVDPKTGMITDPSTKKQMPFKQGL-ESIIDRDQSQVIDPATREAVGLKEALASG 8653          

HSP 32 Score: 61.2326 bits (147), Expect = 2.547e-7
Identity = 45/161 (27.95%), Postives = 80/161 (49.69%), Query Frame = 3
Query:   45 LDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSG 527
              EA+EK ++D     ++ P +G  ++L EAI  GI+D+ +  + D    +    SE +  G     +++  K  +   ++ E+ K +           LDEA++ GL++    TI DP +G  IS++EAI  G++D +   + D   G  +SL +  K G
Sbjct: 6104 FKEAVEKNIIDGSSMQVKHPSTGVSMTLSEAIDDGIVDSCSGDLIDPNTNERTKFSEAVSKG-----IVSPTKPSVSFAEEPEVVKKNPREG-------LDEAIKSGLMNAAT-TIMDPSTGDMISIEEAIHEGLLDPKEGVLLDTRTGLPMSLYQASKKG 6251          

HSP 33 Score: 60.4622 bits (145), Expect = 4.579e-7
Identity = 50/180 (27.78%), Postives = 91/180 (50.56%), Query Frame = 3
Query:   39 LTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISME----------------YSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVS-LSEMLKSG 527
            ++L +A+E+GLVD     I D  SG+ +SL+EA+   II++ N+   +  K +++ ++        +  L TS        K+T+L  I++E                +      +TL+EA+   L+      + DP +G+ ISL EAI +GIID +  +  D + G+ ++ L + +K+G
Sbjct: 2786 MSLQQAIERGLVDVNAPAIVDIKSGRTLSLEEALKENIINS-NTGKVNEGKARTLKIA--------LDPLFTS--------KETKLSPINVEDAILAGLLNSKTGVFRHPKTGETMTLEEALSLNLLAGDSTLVTDPANGERISLTEAIHKGIIDGKTGSFLDTKTGEKLAPLGDAIKAG 2948          

HSP 34 Score: 59.6918 bits (143), Expect = 6.747e-7
Identity = 58/203 (28.57%), Postives = 94/203 (46.31%), Query Frame = 3
Query:   24 TDAH--HLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSG--KNISA--LLTSEKERMDKEKQTELEKISMEYSTDAHH-LTLDEAMEKGLVDTLRGTIRDPISGKE---------------------------ISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGK 530
            TDA    +TL +A + G  +  RG   DP SG+ +++ EA+  GI+D  N  I   + GQ +SL E +  G  + +S   L    K     +  T  E +++  +  A   L+L EA  KG V+   G I+DP SG+E                           I+L EAI +G++D  +S++ D      V L++ + +G+
Sbjct: 7262 TDAQIDPITLADAYKSGNFNPERGVFNDPNSGRPMAVVEAMHAGILDP-NQIIMVVD-GQDISLEEAIDEGFLEPLSGRVLHPDTKATHLTDSLTAEEPLTITPTKKAPQKLSLTEAASKGFVNPDTGLIKDPQSGQELTIGEALTTGLLDGESTLLTSPQTNELITLSEAIDQGVVDPVSSSVLDDTTNDQVKLADAISTGQ 7462          

HSP 35 Score: 59.6918 bits (143), Expect = 8.151e-7
Identity = 48/211 (22.75%), Postives = 94/211 (44.55%), Query Frame = 3
Query:   24 TDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAI-----------------------ARGIIDAENSAIYDAEKGQSVSLSEMLKSG---KNISALLTSEK------ERMDKEKQTELEKISMEYSTDAH-----------HLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSG 527
            T +  L+  +A+ KGL+D  RG  RDP + K +S+ +AI                       A G++D +    +D +  + + + E ++ G    + +A L  E       +R  +E   ++  +S E S+ +             +T D+A++KG +D       +P +G+ +S+ +A+A G+       +  A+ G  +SL+E +  G
Sbjct: 4860 TSSKPLSFKDALAKGLIDVKRGEFRDPTTNKVMSIHDAINQGLIQGVDPKTLQKPVKFADALAAGLLDPQTGNFFDPKTRKPMPIQEAIQKGLLNPDGAAFLERESKTEMVTKRTKEETTIDITDMSRERSSKSPIVERKPMLLPSGMTFDQALDKGYIDPTTKEYLNPATGQRMSIPDAVAAGL-------LLPADVGPGMSLNEAVLHG 5063          

HSP 36 Score: 59.3066 bits (142), Expect = 1.178e-6
Identity = 41/147 (27.89%), Postives = 78/147 (53.06%), Query Frame = 3
Query:   93 IRDPISGKEISLQEAIARGII--DAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSG 527
            + D  +G+++   EA+ RG+I  D +   I D    + ++  E  +      AL+ S        KQ  LE++          +TL+EA  +GL+    G I+ P++G+ ++++EAI  G +D+E+S I D   G+++++SE ++ G
Sbjct: 3352 VVDSSTGRQVPASEALERGLIHIDWDTGIITDTNTKEKMTPDEAEQK-----ALIDSHI------KQLILERVREMAEDIPDRMTLNEAATRGLLIVPLGKIKHPVTGQRMTIEEAINCGFLDSEHSIIIDPSTGRTLTISEAIRRG 3487          

HSP 37 Score: 57.7658 bits (138), Expect = 3.692e-6
Identity = 43/143 (30.07%), Postives = 79/143 (55.24%), Query Frame = 3
Query:   90 TIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISA--LLTSEKERMD-KEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEK-GQSVSL 506
            ++ DPI+ + IS +EA  +G +D       D E  QS++  E L+SG  ++   + +S   ++D K + T L+ + +   T    LT ++A+E+GL+    G    P++G+ I L EA+ +G++  +  +  DA K GQ+ S+
Sbjct: 4119 SVVDPITKQLISPEEAKRKGYLDPATGLYIDPETRQSMTFDEALESGLILTTETVKSSRTTKLDVKTEMTTLDIVGVIDPTTGRQLTANQAVEEGLLWKSTGQYVHPVTGEVIPLDEAVRQGLVITQKPS--DAPKPGQTYSI 4259          

HSP 38 Score: 56.9954 bits (136), Expect = 6.320e-6
Identity = 40/171 (23.39%), Postives = 91/171 (53.22%), Query Frame = 3
Query:   39 LTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKG-------QSVSLSEMLKSGKNISALLTSEKERMDKEKQTELE------------KISMEYSTDA-------HHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAI 473
            L+L EA+++GL+++ RG   +P++G ++S+Q A+  G     N  +  A++G         ++L+E ++ G     +  +    +D+  + E+             +++   ++D+         L++ E +++GL+D   G I DP+SG+++S+QEA A  ++D++ + +
Sbjct: 1721 LSLSEAIQRGLINS-RGQFVNPLTGHQMSIQNAMNDGCTKVLNQDVTFAQRGIKDTASDDWLTLAEAIQQG----IIDVNSSRYIDRRNRKEMSIEDAVRRGLIDLELAQTLNSDSGLKDIMGSSLSVLEVLKRGLLDPTTGQITDPVSGRKMSIQEAAACRLLDSKKAQM 1886          

HSP 39 Score: 56.9954 bits (136), Expect = 6.944e-6
Identity = 46/167 (27.54%), Postives = 88/167 (52.69%), Query Frame = 3
Query:   72 VDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDA-HHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALL--TSEKE 563
            V TL+  I  P++ KEIS++EA+A G+ID       +   G+ +SL++ +  G  I  L   E   + ++++  +  + ++   DA   + ++E  E+     + G + DP +G+ I L EAI +G+ID +     +   G+ + ++E L  G  +  L+  T+E+E
Sbjct: 2411 VYTLKSIIH-PVTRKEISIEEAVAAGLIDQTKGIFRNPRTGEVMSLNDAIDKGFIIVELGKPEPAELSRDEK--VSSLHIDDQMDALEDIGMEEVSEETKTFQITG-VNDPRTGEIIPLNEAIEQGLIDEDAGYYINISTGERIPITEALNQGLIVGQLISKTAEQE 2573          
BLAST of SMED30009048 vs. TrEMBL
Match: E2AVR2 (Bullous pemphigoid antigen 1, isoforms 6/9/10 OS=Camponotus floridanus OX=104421 GN=EAG_03706 PE=4 SV=1)

HSP 1 Score: 85.1149 bits (209), Expect = 1.331e-15
Identity = 54/171 (31.58%), Postives = 97/171 (56.73%), Query Frame = 3
Query:   24 TDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEY------STDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEML 518
            T+A  L+L EA++ G+ + + GTI++P SG+ +S+ EAI  G+ID E  ++ +    + + LSE L+     +  L   K+ ++ E  TE++ ++  +       T    ++L+  + K L DT  G I+DP + + I ++E + RGI+DA  + + D + G SVSL + L
Sbjct: 3402 TEAQPLSLQEAIDIGICNPITGTIQNPESGQALSMSEAIDMGLIDPELLSVRNPITEELMPLSEALE-----TEALNLRKDIINMETNTEVDVVTSAFLQGLIVPTSRKPISLEAVIRKDLYDTETGKIQDPFTKQPIDIEEGVRRGIVDAFITEVEDTKAGSSVSLDDAL 3567          

HSP 2 Score: 72.7886 bits (177), Expect = 2.744e-11
Identity = 53/176 (30.11%), Postives = 90/176 (51.14%), Query Frame = 3
Query:   39 LTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGK------NISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDP------ISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGK 530
            L  +EA+EK  +    G + DPIS ++++L+EA+  GI+D++++ I D++K + V L E  + G       N+    TS+   + K  +T L        T  + ++  EA++ GL +   G   DP      +  K ++L +AI  G+ID   + I D   G   SL E++ SGK
Sbjct: 4392 LAFEEAIEKEYLSLESGKLTDPISNEQLTLKEAVGLGIVDSDSALIKDSQKKKLVKLPEAFRKGMMDAEKGNVLDTATSKLYSLSKALETGL------LITPRNGVSFIEALQFGLYNPTTGGFHDPFVVTSVLDRKRLTLADAIESGLIDPSTTVIKDPLTGNIESLLEVINSGK 4561          

HSP 3 Score: 61.6178 bits (148), Expect = 1.855e-7
Identity = 48/180 (26.67%), Postives = 92/180 (51.11%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTD----AHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAE-NSAIYDAEKGQSVSLSEMLKSG 527
            K+ +      + + L +A+ +GLVD   G + D I+G+   L EAI +G+ID++   I D      V++++ LK G     +L ++  R        +EK+  + +         +TL +  +  ++D  RG I  P    ++ + EAI+RG++D+E   +I D   G+ ++L++ L +G
Sbjct: 1660 KVDVTVRVSRNAVALSDAISQGLVDDRSGRVVDRITGESYPLDEAIDKGVIDSKIREIVDTRNDTKVTVADALKRG-----ILNAKSGRY--MHGLSMEKLPFKEARRRQLIVKPMTLKDCCDLEIIDD-RGRIVSPAHRSKLMILEAISRGVLDSEIVKSIVDTRTGEMITLADALATG 1831          

HSP 4 Score: 61.2326 bits (147), Expect = 2.020e-7
Identity = 45/179 (25.14%), Postives = 89/179 (49.72%), Query Frame = 3
Query:   39 LTLDEAMEKGLVDTLRGTI------RDPI----------SGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSG 527
              +D A+E+GL+ T+  ++      R P+          S KE +L+EAI   +ID   S + D   G+ ++ +  +  G   S++  + +     +++    +           L  +EA+EK  +    G + DPIS ++++L+EA+  GI+D++++ I D++K + V L E  + G
Sbjct: 4277 FNIDVALERGLLVTIDKSLAQQMAHRSPLEVSKVGPGDRSVKECTLEEAINFELIDPNTSVVKDPRTGRFITTTRAIADGIVDSSVKGTIELNGGGKREPRFVRFGDVTIFVREPLAFEEAIEKEYLSLESGKLTDPISNEQLTLKEAVGLGIVDSDSALIKDSQKKKLVKLPEAFRKG 4455          

HSP 5 Score: 60.4622 bits (145), Expect = 4.734e-7
Identity = 50/168 (29.76%), Postives = 85/168 (50.60%), Query Frame = 3
Query:   39 LTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYS--TDA---HHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSG 527
             TL+EA+   L+D     ++DP +G+ I+   AIA GI+D+      +   G        ++ G +++  +   +E +  E+  E E +S+E    TD      LTL EA+  G+VD+    I+D    K + L EA  +G++DAE   + D    +  SLS+ L++G
Sbjct: 4320 CTLEEAINFELIDPNTSVVKDPRTGRFITTTRAIADGIVDSSVKGTIELNGGGKRE-PRFVRFG-DVTIFV---REPLAFEEAIEKEYLSLESGKLTDPISNEQLTLKEAVGLGIVDSDSALIKDSQKKKLVKLPEAFRKGMMDAEKGNVLDTATSKLYSLSKALETG 4482          

HSP 6 Score: 59.3066 bits (142), Expect = 9.350e-7
Identity = 50/186 (26.88%), Postives = 100/186 (53.76%), Query Frame = 3
Query:   30 AHHLTLDEAMEKGLVDTL-RGTI------RDPISGKEISLQEAIARGIIDAENSAIY--DAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKS-GKNISALLTSE 557
            A  +++ +A+EKGL+ ++ + TI      +DP+SG+ ISL  A+ +G+I +++   +  D + G++VSLSE             +E++   + +  E+    +    +   +++ EA+  GL+D   G + DP S + + L+EAI RG+I  + +A+  +    +V+   + K+  K ++ L T E
Sbjct: 1845 AEEMSIPQAVEKGLITSVTQKTIFDIDGFKDPVSGEYISLNAALLKGLISSKSGGTFTIDLKTGKTVSLSE-------------AEEQEYIRPEVIEMLNRGIGIIENGREVSVLEAVLLGLLDPKSGQLLDPRSKRIVPLEEAIKRGLITPDGAALLTSMLNIAVTTQTVTKTIRKYVTTLQTGE 2017          

HSP 7 Score: 58.9214 bits (141), Expect = 1.430e-6
Identity = 44/175 (25.14%), Postives = 85/175 (48.57%), Query Frame = 3
Query:   18 YSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERM---DKEKQTELEKISMEYSTD--AHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSG 527
            ++ D ++ TL+E +E+  +     +I+DP +   ISL +AI  G ++A+     D      +SL++ L  G  + A     K ++   D   +   +  + +++       L  D A++ G++DT    +RDP +G  I+  +AI   I+D ++  +  A +G  V   E L+ G
Sbjct: 3719 FNIDGNNYTLEEMIERNFISKDGPSIKDPRNNDIISLGDAIKHGFVNAKTGTAIDPCTSVPLSLTDALDRGFVVPA-----KRKISLPDAVFKGLYDPKTGQFTVPDTQEKLPTDRAIKMGVIDTTTAIVRDP-NGDVITFNKAIKTSIVDPKSGTVSHA-RGPPVDFQEALERG 3886          

HSP 8 Score: 56.6102 bits (135), Expect = 9.889e-6
Identity = 51/188 (27.13%), Postives = 90/188 (47.87%), Query Frame = 3
Query:   39 LTLDEAMEKGLVD-TLRGTIRDPIS-----GKEISLQEAIARGIIDAENSAIYD-------AEKGQS------VSLSEMLKSG---KNISALLTSEKERMDKEK---QTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSG 527
            ++++EA   G++D  L   +  P       G+ +SL EAI R + DAE + I D        +KG        VS+ + ++ G        ++    ER+  E+   +  L K+ +      + + L +A+ +GLVD   G + D I+G+   L EAI +G+ID++   I D      V++++ LK G
Sbjct: 1548 VSIEEAARDGIIDIALANRLLGPCGVKSEEGRRVSLLEAIQRELCDAERADIADRVKVTTAQDKGAGSGAIAGVSVVDAMRQGLLDPATGEVVAENGERISIEEAYSRGYLTKVDVTVRVSRNAVALSDAISQGLVDDRSGRVVDRITGESYPLDEAIDKGVIDSKIREIVDTRNDTKVTVADALKRG 1735          
BLAST of SMED30009048 vs. TrEMBL
Match: A0A2C9K847 (Uncharacterized protein OS=Biomphalaria glabrata OX=6526 GN=106064970 PE=4 SV=1)

HSP 1 Score: 84.3445 bits (207), Expect = 2.553e-15
Identity = 56/159 (35.22%), Postives = 92/159 (57.86%), Query Frame = 3
Query:   54 AMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAH-HLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSG 527
            A + GLV+   G IRDP +G+ ++LQE+I R +IDA+   + D+E G S+SL E +K  KNI ++ T  K   +  KQ   ++  +  S  A     L +++  GL + + G I +P+SG+  +LQEA+ +G+I+ E   + D   G+ + LS  +K G
Sbjct: 2698 AAKLGLVNHETGRIRDPRTGEWLTLQESIDRKVIDAKMPCLVDSEAGNSLSLEECIK--KNIISIQTG-KINTNLAKQLGFKEDVLPISESAKDSRNLIDSVSAGLFNVITGKILEPVSGQRNTLQEALDKGVIEGELVTVKDTLTGERIPLSLAVKKG 2853          

HSP 2 Score: 67.0106 bits (162), Expect = 2.724e-9
Identity = 49/174 (28.16%), Postives = 88/174 (50.57%), Query Frame = 3
Query:   39 LTLDEAMEKGLVD-------TLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSG---KNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPIS-GKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSG 527
            ++L +A +KG +D       T    + DP SGKE+SL E I + + D  N++  D+  G+ VS++E +  G   ++ S LL  E   +     T+    S         L+L + +EKGL   + G + DP+S   ++++ EA+ +G I+ +   I D   G  ++L++ +  G
Sbjct: 1559 MSLADATKKGYIDEVLLKQLTSPCGLTDPQSGKEMSLLEGIQKKLFDPSNNSFVDSTNGEQVSVTEAVSRGLISESCSRLLAGETLDLSAVTHTQAVFASTVPVKLQSGLSLGKLIEKGLYSEITGKVTDPLSKTTDLTVLEAVEKGYINPDYQEIEDPSSGNYITLTDAVTDG 1732          

HSP 3 Score: 64.3142 bits (155), Expect = 2.098e-8
Identity = 43/174 (24.71%), Postives = 92/174 (52.87%), Query Frame = 3
Query:   45 LDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLK----SGKNISALLTSEKERMD---------KEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSG 527
            L +++  GL + + G I +P+SG+  +LQEA+ +G+I+ E   + D   G+ + LS  +K    +G       T+++  M           E +  ++ +S+  +    H+ L +A+ +G +      I+D ++G+++++  AI+RG++D   + + D + G+ +S  + LK G
Sbjct: 2792 LIDSVSAGLFNVITGKILEPVSGQRNTLQEALDKGVIEGELVTVKDTLTGERIPLSLAVKKGLVNGNRAEVYDTAQRTTMPLPIAIENKLVENKFNIQDLSVTDNRTGEHIPLRKAIAEGDLKADSVVIKDTLTGQQVTMDVAISRGLVDRAGNVV-DKQTGKKMSPQDALKLG 2964          

HSP 4 Score: 58.5362 bits (140), Expect = 1.934e-6
Identity = 51/172 (29.65%), Postives = 81/172 (47.09%), Query Frame = 3
Query:  108 SGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRD------------------------PISGKEI--------SLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSG 527
            SG+E+S+++A+ +G++D  +    D   G  +SL+E LK G     L+ SEK  +DK +++    I  +   D   +   +AM+KGL+D   GT  D                        P S K +        S + A+  GIIDAE    YD+  G+++SL E L+ G
Sbjct: 4422 SGQELSVEDAMLKGVLDP-SGKFTDTLTGDVISLAEALKLG-----LVLSEK--LDKSQRS---IILADELVDNERIPFFDAMQKGLIDPNAGTFLDEASQKVYSIDEAVRTGMVLASDGRPFSYKGVSDSAGLTYSFKTALQTGIIDAETCLFYDSISGENISLEEALELG 4582          
BLAST of SMED30009048 vs. TrEMBL
Match: A0A2C9K8A3 (Uncharacterized protein OS=Biomphalaria glabrata OX=6526 GN=106064970 PE=4 SV=1)

HSP 1 Score: 84.3445 bits (207), Expect = 2.602e-15
Identity = 56/159 (35.22%), Postives = 92/159 (57.86%), Query Frame = 3
Query:   54 AMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAH-HLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSG 527
            A + GLV+   G IRDP +G+ ++LQE+I R +IDA+   + D+E G S+SL E +K  KNI ++ T  K   +  KQ   ++  +  S  A     L +++  GL + + G I +P+SG+  +LQEA+ +G+I+ E   + D   G+ + LS  +K G
Sbjct: 2729 AAKLGLVNHETGRIRDPRTGEWLTLQESIDRKVIDAKMPCLVDSEAGNSLSLEECIK--KNIISIQTG-KINTNLAKQLGFKEDVLPISESAKDSRNLIDSVSAGLFNVITGKILEPVSGQRNTLQEALDKGVIEGELVTVKDTLTGERIPLSLAVKKG 2884          

HSP 2 Score: 67.0106 bits (162), Expect = 2.776e-9
Identity = 49/174 (28.16%), Postives = 88/174 (50.57%), Query Frame = 3
Query:   39 LTLDEAMEKGLVD-------TLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSG---KNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPIS-GKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSG 527
            ++L +A +KG +D       T    + DP SGKE+SL E I + + D  N++  D+  G+ VS++E +  G   ++ S LL  E   +     T+    S         L+L + +EKGL   + G + DP+S   ++++ EA+ +G I+ +   I D   G  ++L++ +  G
Sbjct: 1590 MSLADATKKGYIDEVLLKQLTSPCGLTDPQSGKEMSLLEGIQKKLFDPSNNSFVDSTNGEQVSVTEAVSRGLISESCSRLLAGETLDLSAVTHTQAVFASTVPVKLQSGLSLGKLIEKGLYSEITGKVTDPLSKTTDLTVLEAVEKGYINPDYQEIEDPSSGNYITLTDAVTDG 1763          

HSP 3 Score: 64.3142 bits (155), Expect = 2.118e-8
Identity = 43/174 (24.71%), Postives = 92/174 (52.87%), Query Frame = 3
Query:   45 LDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLK----SGKNISALLTSEKERMD---------KEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSG 527
            L +++  GL + + G I +P+SG+  +LQEA+ +G+I+ E   + D   G+ + LS  +K    +G       T+++  M           E +  ++ +S+  +    H+ L +A+ +G +      I+D ++G+++++  AI+RG++D   + + D + G+ +S  + LK G
Sbjct: 2823 LIDSVSAGLFNVITGKILEPVSGQRNTLQEALDKGVIEGELVTVKDTLTGERIPLSLAVKKGLVNGNRAEVYDTAQRTTMPLPIAIENKLVENKFNIQDLSVTDNRTGEHIPLRKAIAEGDLKADSVVIKDTLTGQQVTMDVAISRGLVDRAGNVV-DKQTGKKMSPQDALKLG 2995          

HSP 4 Score: 58.5362 bits (140), Expect = 2.009e-6
Identity = 51/172 (29.65%), Postives = 81/172 (47.09%), Query Frame = 3
Query:  108 SGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRD------------------------PISGKEI--------SLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSG 527
            SG+E+S+++A+ +G++D  +    D   G  +SL+E LK G     L+ SEK  +DK +++    I  +   D   +   +AM+KGL+D   GT  D                        P S K +        S + A+  GIIDAE    YD+  G+++SL E L+ G
Sbjct: 4453 SGQELSVEDAMLKGVLDP-SGKFTDTLTGDVISLAEALKLG-----LVLSEK--LDKSQRS---IILADELVDNERIPFFDAMQKGLIDPNAGTFLDEASQKVYSIDEAVRTGMVLASDGRPFSYKGVSDSAGLTYSFKTALQTGIIDAETCLFYDSISGENISLEEALELG 4613          
BLAST of SMED30009048 vs. TrEMBL
Match: A0A2C9K844 (Uncharacterized protein OS=Biomphalaria glabrata OX=6526 GN=106064970 PE=4 SV=1)

HSP 1 Score: 84.3445 bits (207), Expect = 2.603e-15
Identity = 56/159 (35.22%), Postives = 92/159 (57.86%), Query Frame = 3
Query:   54 AMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAH-HLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSG 527
            A + GLV+   G IRDP +G+ ++LQE+I R +IDA+   + D+E G S+SL E +K  KNI ++ T  K   +  KQ   ++  +  S  A     L +++  GL + + G I +P+SG+  +LQEA+ +G+I+ E   + D   G+ + LS  +K G
Sbjct: 2851 AAKLGLVNHETGRIRDPRTGEWLTLQESIDRKVIDAKMPCLVDSEAGNSLSLEECIK--KNIISIQTG-KINTNLAKQLGFKEDVLPISESAKDSRNLIDSVSAGLFNVITGKILEPVSGQRNTLQEALDKGVIEGELVTVKDTLTGERIPLSLAVKKG 3006          

HSP 2 Score: 67.0106 bits (162), Expect = 2.724e-9
Identity = 49/174 (28.16%), Postives = 88/174 (50.57%), Query Frame = 3
Query:   39 LTLDEAMEKGLVD-------TLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSG---KNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPIS-GKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSG 527
            ++L +A +KG +D       T    + DP SGKE+SL E I + + D  N++  D+  G+ VS++E +  G   ++ S LL  E   +     T+    S         L+L + +EKGL   + G + DP+S   ++++ EA+ +G I+ +   I D   G  ++L++ +  G
Sbjct: 1712 MSLADATKKGYIDEVLLKQLTSPCGLTDPQSGKEMSLLEGIQKKLFDPSNNSFVDSTNGEQVSVTEAVSRGLISESCSRLLAGETLDLSAVTHTQAVFASTVPVKLQSGLSLGKLIEKGLYSEITGKVTDPLSKTTDLTVLEAVEKGYINPDYQEIEDPSSGNYITLTDAVTDG 1885          

HSP 3 Score: 64.3142 bits (155), Expect = 2.200e-8
Identity = 43/174 (24.71%), Postives = 92/174 (52.87%), Query Frame = 3
Query:   45 LDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLK----SGKNISALLTSEKERMD---------KEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSG 527
            L +++  GL + + G I +P+SG+  +LQEA+ +G+I+ E   + D   G+ + LS  +K    +G       T+++  M           E +  ++ +S+  +    H+ L +A+ +G +      I+D ++G+++++  AI+RG++D   + + D + G+ +S  + LK G
Sbjct: 2945 LIDSVSAGLFNVITGKILEPVSGQRNTLQEALDKGVIEGELVTVKDTLTGERIPLSLAVKKGLVNGNRAEVYDTAQRTTMPLPIAIENKLVENKFNIQDLSVTDNRTGEHIPLRKAIAEGDLKADSVVIKDTLTGQQVTMDVAISRGLVDRAGNVV-DKQTGKKMSPQDALKLG 3117          

HSP 4 Score: 58.5362 bits (140), Expect = 1.990e-6
Identity = 51/172 (29.65%), Postives = 81/172 (47.09%), Query Frame = 3
Query:  108 SGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRD------------------------PISGKEI--------SLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSG 527
            SG+E+S+++A+ +G++D  +    D   G  +SL+E LK G     L+ SEK  +DK +++    I  +   D   +   +AM+KGL+D   GT  D                        P S K +        S + A+  GIIDAE    YD+  G+++SL E L+ G
Sbjct: 4575 SGQELSVEDAMLKGVLDP-SGKFTDTLTGDVISLAEALKLG-----LVLSEK--LDKSQRS---IILADELVDNERIPFFDAMQKGLIDPNAGTFLDEASQKVYSIDEAVRTGMVLASDGRPFSYKGVSDSAGLTYSFKTALQTGIIDAETCLFYDSISGENISLEEALELG 4735          
BLAST of SMED30009048 vs. Planmine SMEST
Match: SMESG000043809.1 (SMESG000043809.1)

HSP 1 Score: 387.497 bits (994), Expect = 1.235e-124
Identity = 196/197 (99.49%), Postives = 197/197 (100.00%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 593
            KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQ+EL
Sbjct: 4007 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQSEL 4203          

HSP 2 Score: 387.497 bits (994), Expect = 1.573e-124
Identity = 196/197 (99.49%), Postives = 196/197 (99.49%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 593
            KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEML SGKNISALLTSEKERMDKEKQTEL
Sbjct:  690 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLNSGKNISALLTSEKERMDKEKQTEL 886          

HSP 3 Score: 387.497 bits (994), Expect = 1.573e-124
Identity = 196/197 (99.49%), Postives = 196/197 (99.49%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 593
            KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEML SGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL
Sbjct:  789 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLNSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 985          

HSP 4 Score: 386.341 bits (991), Expect = 3.906e-124
Identity = 195/197 (98.98%), Postives = 197/197 (100.00%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 593
            KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLT+EKER+DKEKQTEL
Sbjct:  308 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTNEKERIDKEKQTEL 504          

HSP 5 Score: 386.341 bits (991), Expect = 3.906e-124
Identity = 195/197 (98.98%), Postives = 197/197 (100.00%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 593
            KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLT+EKER+DKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL
Sbjct:  591 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTNEKERIDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 787          

HSP 6 Score: 386.341 bits (991), Expect = 3.906e-124
Identity = 195/197 (98.98%), Postives = 197/197 (100.00%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 593
            KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLT+EKER+DKEKQTEL
Sbjct:  888 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTNEKERIDKEKQTEL 1084          

HSP 7 Score: 386.341 bits (991), Expect = 3.906e-124
Identity = 195/197 (98.98%), Postives = 197/197 (100.00%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 593
            KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLT+EKER+DKEKQTEL
Sbjct: 2436 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTNEKERIDKEKQTEL 2632          

HSP 8 Score: 385.956 bits (990), Expect = 4.786e-124
Identity = 196/197 (99.49%), Postives = 196/197 (99.49%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 593
            KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEK TEL
Sbjct: 2733 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKLTEL 2929          

HSP 9 Score: 385.956 bits (990), Expect = 4.786e-124
Identity = 196/197 (99.49%), Postives = 196/197 (99.49%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 593
            KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEK TELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL
Sbjct: 3426 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKLTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 3622          

HSP 10 Score: 385.571 bits (989), Expect = 6.586e-124
Identity = 195/197 (98.98%), Postives = 196/197 (99.49%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 593
            KISMEYSTDAHHLTLD+AMEKGLVDTLRGTIRDPISG EISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL
Sbjct: 2634 KISMEYSTDAHHLTLDDAMEKGLVDTLRGTIRDPISGTEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 2830          

HSP 11 Score: 384.03 bits (985), Expect = 2.528e-123
Identity = 194/197 (98.48%), Postives = 196/197 (99.49%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 593
            KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQE IARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLT+EKER+DKEKQTEL
Sbjct:  110 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEEIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTNEKERIDKEKQTEL 306          

HSP 12 Score: 384.03 bits (985), Expect = 2.528e-123
Identity = 194/197 (98.48%), Postives = 196/197 (99.49%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 593
            KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQE IARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLT+EKER+DKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL
Sbjct:  209 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEEIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTNEKERIDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 405          

HSP 13 Score: 383.259 bits (983), Expect = 4.474e-123
Identity = 193/197 (97.97%), Postives = 197/197 (100.00%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 593
            KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNIS+LLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLT+EKER+DKEKQT+L
Sbjct: 1284 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISSLLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTNEKERIDKEKQTKL 1480          

HSP 14 Score: 382.874 bits (982), Expect = 5.074e-123
Identity = 194/197 (98.48%), Postives = 196/197 (99.49%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 593
            KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLT+EKER+DKEK TEL
Sbjct: 3525 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTNEKERIDKEKLTEL 3721          

HSP 15 Score: 382.874 bits (982), Expect = 5.074e-123
Identity = 194/197 (98.48%), Postives = 196/197 (99.49%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 593
            KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLT+EKER+DKEK TELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL
Sbjct: 3908 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTNEKERIDKEKLTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 4104          

HSP 16 Score: 382.874 bits (982), Expect = 5.754e-123
Identity = 195/197 (98.98%), Postives = 195/197 (98.98%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 593
            KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEK TELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKS KNISALLTSEKERMDKEKQTEL
Sbjct: 3228 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKLTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSDKNISALLTSEKERMDKEKQTEL 3424          

HSP 17 Score: 382.874 bits (982), Expect = 5.754e-123
Identity = 195/197 (98.98%), Postives = 195/197 (98.98%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 593
            KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKS KNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEK TEL
Sbjct: 3327 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSDKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKLTEL 3523          

HSP 18 Score: 382.874 bits (982), Expect = 6.217e-123
Identity = 195/197 (98.98%), Postives = 195/197 (98.98%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 593
            KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEK TELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEK TEL
Sbjct: 3129 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKLTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKLTEL 3325          

HSP 19 Score: 382.489 bits (981), Expect = 6.982e-123
Identity = 193/197 (97.97%), Postives = 196/197 (99.49%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 593
            KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLT+EKER+DKEKQTELEKISMEYSTDAHHLTLD+AMEKGLVDTLRGTIRDPISG EISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL
Sbjct:  987 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTNEKERIDKEKQTELEKISMEYSTDAHHLTLDDAMEKGLVDTLRGTIRDPISGTEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 1183          

HSP 20 Score: 382.489 bits (981), Expect = 6.982e-123
Identity = 193/197 (97.97%), Postives = 196/197 (99.49%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 593
            KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLT+EKER+DKEKQTELEKISMEYSTDAHHLTLD+AMEKGLVDTLRGTIRDPISG EISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL
Sbjct: 2535 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTNEKERIDKEKQTELEKISMEYSTDAHHLTLDDAMEKGLVDTLRGTIRDPISGTEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 2731          

HSP 21 Score: 382.489 bits (981), Expect = 8.807e-123
Identity = 195/197 (98.98%), Postives = 195/197 (98.98%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 593
            KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEK TELEKISMEYSTDAHHLTLDEAMEKGLVDTLR TIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL
Sbjct: 2832 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKLTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRVTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 3028          

HSP 22 Score: 382.489 bits (981), Expect = 9.067e-123
Identity = 193/197 (97.97%), Postives = 196/197 (99.49%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 593
            KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLT+EKER+DKEKQT+LEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISG EISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL
Sbjct: 1383 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTNEKERIDKEKQTKLEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGTEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 1579          

HSP 23 Score: 381.719 bits (979), Expect = 1.375e-122
Identity = 195/197 (98.98%), Postives = 195/197 (98.98%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 593
            KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRD ISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEK TELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL
Sbjct:   11 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDTISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKLTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 207          

HSP 24 Score: 380.563 bits (976), Expect = 3.797e-122
Identity = 192/197 (97.46%), Postives = 195/197 (98.98%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 593
            KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNIS L T+EKER+DKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNIS+LLTSEKERMDKEKQTEL
Sbjct: 1185 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISVLQTNEKERIDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISSLLTSEKERMDKEKQTEL 1381          

HSP 25 Score: 379.793 bits (974), Expect = 6.591e-122
Identity = 193/197 (97.97%), Postives = 195/197 (98.98%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 593
            KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEK TELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLT+EKER+DKEK TEL
Sbjct: 3809 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKLTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTNEKERIDKEKLTEL 4005          

HSP 26 Score: 379.407 bits (973), Expect = 8.233e-122
Identity = 194/197 (98.48%), Postives = 194/197 (98.48%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 593
            KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISG EISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRD ISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEK TEL
Sbjct: 1482 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGTEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDTISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKLTEL 1678          

HSP 27 Score: 379.407 bits (973), Expect = 8.233e-122
Identity = 194/197 (98.48%), Postives = 194/197 (98.48%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 593
            KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISG EISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRD ISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEK TEL
Sbjct: 2139 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGTEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDTISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKLTEL 2335          

HSP 28 Score: 378.637 bits (971), Expect = 1.786e-121
Identity = 194/197 (98.48%), Postives = 194/197 (98.48%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 593
            KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRD ISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEK TELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEK TEL
Sbjct: 3030 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDTISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKLTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKLTEL 3226          

HSP 29 Score: 378.252 bits (970), Expect = 2.296e-121
Identity = 191/197 (96.95%), Postives = 194/197 (98.48%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 593
            KISMEYSTDAHHLTLD+AMEKGLVDTLRGTIRDPISG EISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNIS L T+EKER+DKEKQTEL
Sbjct: 1086 KISMEYSTDAHHLTLDDAMEKGLVDTLRGTIRDPISGTEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISVLQTNEKERIDKEKQTEL 1282          

HSP 30 Score: 378.252 bits (970), Expect = 2.530e-121
Identity = 194/197 (98.48%), Postives = 194/197 (98.48%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 593
            KISMEYSTDAHHLTLDEAMEKGLVDTLR TIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRD ISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEK TEL
Sbjct: 2931 KISMEYSTDAHHLTLDEAMEKGLVDTLRVTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDTISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKLTEL 3127          

HSP 31 Score: 377.867 bits (969), Expect = 3.689e-121
Identity = 192/197 (97.46%), Postives = 194/197 (98.48%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 593
            KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRD ISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNIS L T+EKER+DKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL
Sbjct: 2337 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDTISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISVLQTNEKERIDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 2533          

HSP 32 Score: 375.555 bits (963), Expect = 2.210e-120
Identity = 191/197 (96.95%), Postives = 193/197 (97.97%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 593
            KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRD ISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNIS L T+EKER+DKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISG EISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL
Sbjct: 2040 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDTISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISVLQTNEKERIDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGTEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 2236          

HSP 33 Score: 374.015 bits (959), Expect = 6.595e-120
Identity = 190/197 (96.45%), Postives = 193/197 (97.97%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 593
            KISMEYSTDAHHLTLD+AMEKGLVDTLRGTIRDPISG EISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRD ISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNIS L T+EKER+DKEKQTEL
Sbjct: 1941 KISMEYSTDAHHLTLDDAMEKGLVDTLRGTIRDPISGTEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDTISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISVLQTNEKERIDKEKQTEL 2137          

HSP 34 Score: 370.548 bits (950), Expect = 1.376e-118
Identity = 190/197 (96.45%), Postives = 192/197 (97.46%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 593
            KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRD ISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEK TELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRD ISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNIS L T+EKER+DKEKQTEL
Sbjct: 2238 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDTISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKLTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDTISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISVLQTNEKERIDKEKQTEL 2434          

HSP 35 Score: 360.533 bits (924), Expect = 3.488e-115
Identity = 181/183 (98.91%), Postives = 183/183 (100.00%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLT 551
            KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLT+EKER+DKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLT
Sbjct:  407 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTNEKERIDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLT 589          

HSP 36 Score: 351.673 bits (901), Expect = 4.805e-112
Identity = 182/197 (92.39%), Postives = 183/197 (92.89%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 593
            KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNI             +KQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEK TEL
Sbjct: 3723 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNI-------------KKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKLTEL 3906          

HSP 37 Score: 349.362 bits (895), Expect = 3.110e-111
Identity = 180/197 (91.37%), Postives = 183/197 (92.89%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 593
            KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLT              +KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLT+EKER+DKEKQTEL
Sbjct:  506 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLT--------------KKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTNEKERIDKEKQTEL 688          

HSP 38 Score: 348.977 bits (894), Expect = 4.158e-111
Identity = 175/178 (98.31%), Postives = 177/178 (99.44%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNI 536
            KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLT+EKER+DKEK TELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNI
Sbjct: 3624 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTNEKERIDKEKLTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNI 3801          

HSP 39 Score: 347.821 bits (891), Expect = 1.073e-110
Identity = 174/190 (91.58%), Postives = 182/190 (95.79%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMD 572
            KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQ+ELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLK+  ++ +L  +   ++D
Sbjct: 4106 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQSELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKNFSDVPSLFKAYDFKID 4295          

HSP 40 Score: 343.199 bits (879), Expect = 3.926e-109
Identity = 178/197 (90.36%), Postives = 180/197 (91.37%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 593
            KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRD ISGKEISLQEAIARGIIDAENSAIYDAEKGQS               L T+EKER+DKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL
Sbjct: 1680 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDTISGKEISLQEAIARGIIDAENSAIYDAEKGQS--------------CLQTNEKERIDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 1862          

HSP 41 Score: 335.88 bits (860), Expect = 1.465e-106
Identity = 176/197 (89.34%), Postives = 178/197 (90.36%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 593
            KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRD ISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEK TELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRD ISGKEISLQEAIARGIIDAENSAIYDAEKGQ              S L T+EKER+DKEKQTEL
Sbjct: 1581 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDTISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKLTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDTISGKEISLQEAIARGIIDAENSAIYDAEKGQ--------------SCLQTNEKERIDKEKQTEL 1763          

HSP 42 Score: 334.724 bits (857), Expect = 4.371e-106
Identity = 173/197 (87.82%), Postives = 175/197 (88.83%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 593
            KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQ                      +R+DKEKQTEL
Sbjct: 1765 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQ----------------------KRIDKEKQTEL 1939          

HSP 43 Score: 330.872 bits (847), Expect = 7.890e-105
Identity = 171/197 (86.80%), Postives = 174/197 (88.32%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 593
            KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQ                      +R+DKEKQTELEKISMEYSTDAHHLTLD+AMEKGLVDTLRGTIRDPISG EISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL
Sbjct: 1864 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQ----------------------KRIDKEKQTELEKISMEYSTDAHHLTLDDAMEKGLVDTLRGTIRDPISGTEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 2038          

HSP 44 Score: 207.223 bits (526), Expect = 1.208e-61
Identity = 106/108 (98.15%), Postives = 106/108 (98.15%), Query Frame = 3
Query:  270 MDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 593
            MDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRD ISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEK TEL
Sbjct:    1 MDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDTISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKLTEL 108          
BLAST of SMED30009048 vs. Planmine SMEST
Match: SMESG000043809.1 (SMESG000043809.1)

HSP 1 Score: 387.497 bits (994), Expect = 1.259e-124
Identity = 196/197 (99.49%), Postives = 197/197 (100.00%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 593
            KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQ+EL
Sbjct: 3995 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQSEL 4191          

HSP 2 Score: 387.497 bits (994), Expect = 1.634e-124
Identity = 196/197 (99.49%), Postives = 196/197 (99.49%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 593
            KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEML SGKNISALLTSEKERMDKEKQTEL
Sbjct:  690 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLNSGKNISALLTSEKERMDKEKQTEL 886          

HSP 3 Score: 387.497 bits (994), Expect = 1.634e-124
Identity = 196/197 (99.49%), Postives = 196/197 (99.49%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 593
            KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEML SGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL
Sbjct:  789 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLNSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 985          

HSP 4 Score: 386.341 bits (991), Expect = 4.058e-124
Identity = 195/197 (98.98%), Postives = 197/197 (100.00%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 593
            KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLT+EKER+DKEKQTEL
Sbjct:  308 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTNEKERIDKEKQTEL 504          

HSP 5 Score: 386.341 bits (991), Expect = 4.058e-124
Identity = 195/197 (98.98%), Postives = 197/197 (100.00%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 593
            KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLT+EKER+DKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL
Sbjct:  591 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTNEKERIDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 787          

HSP 6 Score: 386.341 bits (991), Expect = 4.058e-124
Identity = 195/197 (98.98%), Postives = 197/197 (100.00%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 593
            KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLT+EKER+DKEKQTEL
Sbjct:  888 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTNEKERIDKEKQTEL 1084          

HSP 7 Score: 386.341 bits (991), Expect = 4.058e-124
Identity = 195/197 (98.98%), Postives = 197/197 (100.00%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 593
            KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLT+EKER+DKEKQTEL
Sbjct: 2425 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTNEKERIDKEKQTEL 2621          

HSP 8 Score: 385.956 bits (990), Expect = 5.021e-124
Identity = 196/197 (99.49%), Postives = 196/197 (99.49%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 593
            KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEK TEL
Sbjct: 2722 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKLTEL 2918          

HSP 9 Score: 385.956 bits (990), Expect = 5.021e-124
Identity = 196/197 (99.49%), Postives = 196/197 (99.49%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 593
            KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEK TELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL
Sbjct: 3415 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKLTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 3611          

HSP 10 Score: 385.571 bits (989), Expect = 6.843e-124
Identity = 195/197 (98.98%), Postives = 196/197 (99.49%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 593
            KISMEYSTDAHHLTLD+AMEKGLVDTLRGTIRDPISG EISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL
Sbjct: 2623 KISMEYSTDAHHLTLDDAMEKGLVDTLRGTIRDPISGTEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 2819          

HSP 11 Score: 384.03 bits (985), Expect = 2.601e-123
Identity = 194/197 (98.48%), Postives = 196/197 (99.49%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 593
            KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQE IARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLT+EKER+DKEKQTEL
Sbjct:  110 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEEIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTNEKERIDKEKQTEL 306          

HSP 12 Score: 384.03 bits (985), Expect = 2.601e-123
Identity = 194/197 (98.48%), Postives = 196/197 (99.49%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 593
            KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQE IARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLT+EKER+DKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL
Sbjct:  209 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEEIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTNEKERIDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 405          

HSP 13 Score: 383.259 bits (983), Expect = 4.604e-123
Identity = 193/197 (97.97%), Postives = 197/197 (100.00%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 593
            KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNIS+LLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLT+EKER+DKEKQT+L
Sbjct: 1284 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISSLLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTNEKERIDKEKQTKL 1480          

HSP 14 Score: 382.874 bits (982), Expect = 5.375e-123
Identity = 194/197 (98.48%), Postives = 196/197 (99.49%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 593
            KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLT+EKER+DKEK TEL
Sbjct: 3514 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTNEKERIDKEKLTEL 3710          

HSP 15 Score: 382.874 bits (982), Expect = 5.375e-123
Identity = 194/197 (98.48%), Postives = 196/197 (99.49%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 593
            KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLT+EKER+DKEK TELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL
Sbjct: 3896 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTNEKERIDKEKLTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 4092          

HSP 16 Score: 382.874 bits (982), Expect = 6.036e-123
Identity = 195/197 (98.98%), Postives = 195/197 (98.98%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 593
            KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEK TELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKS KNISALLTSEKERMDKEKQTEL
Sbjct: 3217 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKLTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSDKNISALLTSEKERMDKEKQTEL 3413          

HSP 17 Score: 382.874 bits (982), Expect = 6.036e-123
Identity = 195/197 (98.98%), Postives = 195/197 (98.98%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 593
            KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKS KNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEK TEL
Sbjct: 3316 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSDKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKLTEL 3512          

HSP 18 Score: 382.874 bits (982), Expect = 6.650e-123
Identity = 195/197 (98.98%), Postives = 195/197 (98.98%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 593
            KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEK TELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEK TEL
Sbjct: 3118 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKLTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKLTEL 3314          

HSP 19 Score: 382.489 bits (981), Expect = 7.325e-123
Identity = 193/197 (97.97%), Postives = 196/197 (99.49%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 593
            KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLT+EKER+DKEKQTELEKISMEYSTDAHHLTLD+AMEKGLVDTLRGTIRDPISG EISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL
Sbjct:  987 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTNEKERIDKEKQTELEKISMEYSTDAHHLTLDDAMEKGLVDTLRGTIRDPISGTEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 1183          

HSP 20 Score: 382.489 bits (981), Expect = 7.325e-123
Identity = 193/197 (97.97%), Postives = 196/197 (99.49%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 593
            KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLT+EKER+DKEKQTELEKISMEYSTDAHHLTLD+AMEKGLVDTLRGTIRDPISG EISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL
Sbjct: 2524 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTNEKERIDKEKQTELEKISMEYSTDAHHLTLDDAMEKGLVDTLRGTIRDPISGTEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 2720          

HSP 21 Score: 382.489 bits (981), Expect = 9.330e-123
Identity = 195/197 (98.98%), Postives = 195/197 (98.98%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 593
            KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEK TELEKISMEYSTDAHHLTLDEAMEKGLVDTLR TIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL
Sbjct: 2821 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKLTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRVTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 3017          

HSP 22 Score: 382.104 bits (980), Expect = 9.512e-123
Identity = 193/197 (97.97%), Postives = 196/197 (99.49%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 593
            KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLT+EKER+DKEKQT+LEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISG EISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL
Sbjct: 1383 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTNEKERIDKEKQTKLEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGTEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 1579          

HSP 23 Score: 381.719 bits (979), Expect = 1.428e-122
Identity = 195/197 (98.98%), Postives = 195/197 (98.98%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 593
            KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRD ISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEK TELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL
Sbjct:   11 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDTISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKLTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 207          

HSP 24 Score: 380.563 bits (976), Expect = 3.869e-122
Identity = 192/197 (97.46%), Postives = 195/197 (98.98%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 593
            KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNIS L T+EKER+DKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNIS+LLTSEKERMDKEKQTEL
Sbjct: 1185 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISVLQTNEKERIDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISSLLTSEKERMDKEKQTEL 1381          

HSP 25 Score: 379.793 bits (974), Expect = 7.118e-122
Identity = 193/197 (97.97%), Postives = 195/197 (98.98%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 593
            KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEK TELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLT+EKER+DKEK TEL
Sbjct: 3797 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKLTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTNEKERIDKEKLTEL 3993          

HSP 26 Score: 379.407 bits (973), Expect = 8.638e-122
Identity = 194/197 (98.48%), Postives = 194/197 (98.48%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 593
            KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISG EISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRD ISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEK TEL
Sbjct: 1482 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGTEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDTISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKLTEL 1678          

HSP 27 Score: 379.407 bits (973), Expect = 8.638e-122
Identity = 194/197 (98.48%), Postives = 194/197 (98.48%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 593
            KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISG EISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRD ISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEK TEL
Sbjct: 2128 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGTEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDTISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKLTEL 2324          

HSP 28 Score: 378.637 bits (971), Expect = 1.891e-121
Identity = 194/197 (98.48%), Postives = 194/197 (98.48%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 593
            KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRD ISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEK TELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEK TEL
Sbjct: 3019 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDTISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKLTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKLTEL 3215          

HSP 29 Score: 378.252 bits (970), Expect = 2.386e-121
Identity = 191/197 (96.95%), Postives = 194/197 (98.48%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 593
            KISMEYSTDAHHLTLD+AMEKGLVDTLRGTIRDPISG EISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNIS L T+EKER+DKEKQTEL
Sbjct: 1086 KISMEYSTDAHHLTLDDAMEKGLVDTLRGTIRDPISGTEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISVLQTNEKERIDKEKQTEL 1282          

HSP 30 Score: 378.252 bits (970), Expect = 2.654e-121
Identity = 194/197 (98.48%), Postives = 194/197 (98.48%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 593
            KISMEYSTDAHHLTLDEAMEKGLVDTLR TIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRD ISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEK TEL
Sbjct: 2920 KISMEYSTDAHHLTLDEAMEKGLVDTLRVTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDTISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKLTEL 3116          

HSP 31 Score: 377.867 bits (969), Expect = 3.760e-121
Identity = 192/197 (97.46%), Postives = 194/197 (98.48%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 593
            KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRD ISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNIS L T+EKER+DKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL
Sbjct: 2326 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDTISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISVLQTNEKERIDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 2522          

HSP 32 Score: 375.555 bits (963), Expect = 2.274e-120
Identity = 191/197 (96.95%), Postives = 193/197 (97.97%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 593
            KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRD ISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNIS L T+EKER+DKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISG EISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL
Sbjct: 2029 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDTISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISVLQTNEKERIDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGTEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 2225          

HSP 33 Score: 374.015 bits (959), Expect = 6.786e-120
Identity = 190/197 (96.45%), Postives = 193/197 (97.97%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 593
            KISMEYSTDAHHLTLD+AMEKGLVDTLRGTIRDPISG EISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRD ISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNIS L T+EKER+DKEKQTEL
Sbjct: 1930 KISMEYSTDAHHLTLDDAMEKGLVDTLRGTIRDPISGTEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDTISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISVLQTNEKERIDKEKQTEL 2126          

HSP 34 Score: 370.163 bits (949), Expect = 1.416e-118
Identity = 190/197 (96.45%), Postives = 192/197 (97.46%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 593
            KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRD ISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEK TELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRD ISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNIS L T+EKER+DKEKQTEL
Sbjct: 2227 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDTISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKLTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDTISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISVLQTNEKERIDKEKQTEL 2423          

HSP 35 Score: 360.533 bits (924), Expect = 3.487e-115
Identity = 181/183 (98.91%), Postives = 183/183 (100.00%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLT 551
            KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLT+EKER+DKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLT
Sbjct:  407 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTNEKERIDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLT 589          

HSP 36 Score: 349.747 bits (896), Expect = 2.051e-111
Identity = 181/197 (91.88%), Postives = 181/197 (91.88%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 593
            KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQS               LLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEK TEL
Sbjct: 3712 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQS--------------CLLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKLTEL 3894          

HSP 37 Score: 349.362 bits (895), Expect = 3.109e-111
Identity = 180/197 (91.37%), Postives = 183/197 (92.89%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 593
            KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLT              +KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLT+EKER+DKEKQTEL
Sbjct:  506 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLT--------------KKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTNEKERIDKEKQTEL 688          

HSP 38 Score: 347.821 bits (891), Expect = 1.159e-110
Identity = 174/190 (91.58%), Postives = 182/190 (95.79%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMD 572
            KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQ+ELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLK+  ++ +L  +   ++D
Sbjct: 4094 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQSELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKNFSDVPSLFKAYDFKID 4283          

HSP 39 Score: 347.051 bits (889), Expect = 2.195e-110
Identity = 179/197 (90.86%), Postives = 181/197 (91.88%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 593
            KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLT+EKER+DKEK TELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQ              S LLTSEKERMDKEKQTEL
Sbjct: 3613 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTNEKERIDKEKLTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQ--------------SCLLTSEKERMDKEKQTEL 3795          

HSP 40 Score: 334.339 bits (856), Expect = 4.813e-106
Identity = 173/197 (87.82%), Postives = 175/197 (88.83%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 593
            KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQ                      +R+DKEKQTEL
Sbjct: 1754 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQ----------------------KRIDKEKQTEL 1928          

HSP 41 Score: 330.872 bits (847), Expect = 8.772e-105
Identity = 171/197 (86.80%), Postives = 174/197 (88.32%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 593
            KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQ                      +R+DKEKQTELEKISMEYSTDAHHLTLD+AMEKGLVDTLRGTIRDPISG EISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL
Sbjct: 1853 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQ----------------------KRIDKEKQTELEKISMEYSTDAHHLTLDDAMEKGLVDTLRGTIRDPISGTEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 2027          

HSP 42 Score: 324.709 bits (831), Expect = 1.331e-102
Identity = 170/197 (86.29%), Postives = 171/197 (86.80%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 593
            KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRD ISGKEISLQEAIARGIIDAENSAIYDAEKGQ                         +KEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL
Sbjct: 1680 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDTISGKEISLQEAIARGIIDAENSAIYDAEKGQ-------------------------NKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 1851          

HSP 43 Score: 318.546 bits (815), Expect = 1.746e-100
Identity = 161/165 (97.58%), Postives = 162/165 (98.18%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQS 497
            KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRD ISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEK TELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRD ISGKEISLQEAIARGIIDAENSAIYDAEKGQ+
Sbjct: 1581 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDTISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKLTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDTISGKEISLQEAIARGIIDAENSAIYDAEKGQN 1745          

HSP 44 Score: 207.223 bits (526), Expect = 1.268e-61
Identity = 106/108 (98.15%), Postives = 106/108 (98.15%), Query Frame = 3
Query:  270 MDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 593
            MDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRD ISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEK TEL
Sbjct:    1 MDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDTISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKLTEL 108          
BLAST of SMED30009048 vs. Planmine SMEST
Match: SMESG000043809.1 (SMESG000043809.1)

HSP 1 Score: 387.497 bits (994), Expect = 1.259e-124
Identity = 196/197 (99.49%), Postives = 197/197 (100.00%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 593
            KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQ+EL
Sbjct: 3998 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQSEL 4194          

HSP 2 Score: 387.497 bits (994), Expect = 1.634e-124
Identity = 196/197 (99.49%), Postives = 196/197 (99.49%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 593
            KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEML SGKNISALLTSEKERMDKEKQTEL
Sbjct:  690 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLNSGKNISALLTSEKERMDKEKQTEL 886          

HSP 3 Score: 387.497 bits (994), Expect = 1.634e-124
Identity = 196/197 (99.49%), Postives = 196/197 (99.49%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 593
            KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEML SGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL
Sbjct:  789 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLNSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 985          

HSP 4 Score: 386.341 bits (991), Expect = 4.058e-124
Identity = 195/197 (98.98%), Postives = 197/197 (100.00%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 593
            KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLT+EKER+DKEKQTEL
Sbjct:  308 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTNEKERIDKEKQTEL 504          

HSP 5 Score: 386.341 bits (991), Expect = 4.058e-124
Identity = 195/197 (98.98%), Postives = 197/197 (100.00%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 593
            KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLT+EKER+DKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL
Sbjct:  591 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTNEKERIDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 787          

HSP 6 Score: 386.341 bits (991), Expect = 4.058e-124
Identity = 195/197 (98.98%), Postives = 197/197 (100.00%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 593
            KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLT+EKER+DKEKQTEL
Sbjct:  888 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTNEKERIDKEKQTEL 1084          

HSP 7 Score: 386.341 bits (991), Expect = 4.058e-124
Identity = 195/197 (98.98%), Postives = 197/197 (100.00%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 593
            KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLT+EKER+DKEKQTEL
Sbjct: 2428 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTNEKERIDKEKQTEL 2624          

HSP 8 Score: 385.956 bits (990), Expect = 5.021e-124
Identity = 196/197 (99.49%), Postives = 196/197 (99.49%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 593
            KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEK TEL
Sbjct: 2725 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKLTEL 2921          

HSP 9 Score: 385.956 bits (990), Expect = 5.021e-124
Identity = 196/197 (99.49%), Postives = 196/197 (99.49%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 593
            KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEK TELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL
Sbjct: 3418 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKLTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 3614          

HSP 10 Score: 385.571 bits (989), Expect = 6.843e-124
Identity = 195/197 (98.98%), Postives = 196/197 (99.49%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 593
            KISMEYSTDAHHLTLD+AMEKGLVDTLRGTIRDPISG EISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL
Sbjct: 2626 KISMEYSTDAHHLTLDDAMEKGLVDTLRGTIRDPISGTEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 2822          

HSP 11 Score: 384.03 bits (985), Expect = 2.601e-123
Identity = 194/197 (98.48%), Postives = 196/197 (99.49%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 593
            KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQE IARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLT+EKER+DKEKQTEL
Sbjct:  110 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEEIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTNEKERIDKEKQTEL 306          

HSP 12 Score: 384.03 bits (985), Expect = 2.601e-123
Identity = 194/197 (98.48%), Postives = 196/197 (99.49%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 593
            KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQE IARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLT+EKER+DKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL
Sbjct:  209 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEEIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTNEKERIDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 405          

HSP 13 Score: 383.259 bits (983), Expect = 4.604e-123
Identity = 193/197 (97.97%), Postives = 197/197 (100.00%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 593
            KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNIS+LLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLT+EKER+DKEKQT+L
Sbjct: 1284 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISSLLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTNEKERIDKEKQTKL 1480          

HSP 14 Score: 382.874 bits (982), Expect = 5.375e-123
Identity = 194/197 (98.48%), Postives = 196/197 (99.49%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 593
            KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLT+EKER+DKEK TEL
Sbjct: 3517 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTNEKERIDKEKLTEL 3713          

HSP 15 Score: 382.874 bits (982), Expect = 5.375e-123
Identity = 194/197 (98.48%), Postives = 196/197 (99.49%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 593
            KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLT+EKER+DKEK TELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL
Sbjct: 3899 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTNEKERIDKEKLTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 4095          

HSP 16 Score: 382.874 bits (982), Expect = 6.036e-123
Identity = 195/197 (98.98%), Postives = 195/197 (98.98%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 593
            KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEK TELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKS KNISALLTSEKERMDKEKQTEL
Sbjct: 3220 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKLTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSDKNISALLTSEKERMDKEKQTEL 3416          

HSP 17 Score: 382.874 bits (982), Expect = 6.036e-123
Identity = 195/197 (98.98%), Postives = 195/197 (98.98%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 593
            KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKS KNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEK TEL
Sbjct: 3319 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSDKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKLTEL 3515          

HSP 18 Score: 382.874 bits (982), Expect = 6.650e-123
Identity = 195/197 (98.98%), Postives = 195/197 (98.98%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 593
            KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEK TELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEK TEL
Sbjct: 3121 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKLTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKLTEL 3317          

HSP 19 Score: 382.489 bits (981), Expect = 7.325e-123
Identity = 193/197 (97.97%), Postives = 196/197 (99.49%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 593
            KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLT+EKER+DKEKQTELEKISMEYSTDAHHLTLD+AMEKGLVDTLRGTIRDPISG EISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL
Sbjct:  987 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTNEKERIDKEKQTELEKISMEYSTDAHHLTLDDAMEKGLVDTLRGTIRDPISGTEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 1183          

HSP 20 Score: 382.489 bits (981), Expect = 7.325e-123
Identity = 193/197 (97.97%), Postives = 196/197 (99.49%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 593
            KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLT+EKER+DKEKQTELEKISMEYSTDAHHLTLD+AMEKGLVDTLRGTIRDPISG EISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL
Sbjct: 2527 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTNEKERIDKEKQTELEKISMEYSTDAHHLTLDDAMEKGLVDTLRGTIRDPISGTEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 2723          

HSP 21 Score: 382.489 bits (981), Expect = 9.240e-123
Identity = 195/197 (98.98%), Postives = 195/197 (98.98%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 593
            KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEK TELEKISMEYSTDAHHLTLDEAMEKGLVDTLR TIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL
Sbjct: 2824 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKLTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRVTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 3020          

HSP 22 Score: 382.104 bits (980), Expect = 9.512e-123
Identity = 193/197 (97.97%), Postives = 196/197 (99.49%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 593
            KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLT+EKER+DKEKQT+LEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISG EISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL
Sbjct: 1383 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTNEKERIDKEKQTKLEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGTEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 1579          

HSP 23 Score: 381.719 bits (979), Expect = 1.428e-122
Identity = 195/197 (98.98%), Postives = 195/197 (98.98%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 593
            KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRD ISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEK TELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL
Sbjct:   11 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDTISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKLTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 207          

HSP 24 Score: 380.563 bits (976), Expect = 3.869e-122
Identity = 192/197 (97.46%), Postives = 195/197 (98.98%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 593
            KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNIS L T+EKER+DKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNIS+LLTSEKERMDKEKQTEL
Sbjct: 1185 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISVLQTNEKERIDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISSLLTSEKERMDKEKQTEL 1381          

HSP 25 Score: 379.793 bits (974), Expect = 7.118e-122
Identity = 193/197 (97.97%), Postives = 195/197 (98.98%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 593
            KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEK TELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLT+EKER+DKEK TEL
Sbjct: 3800 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKLTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTNEKERIDKEKLTEL 3996          

HSP 26 Score: 379.407 bits (973), Expect = 8.638e-122
Identity = 194/197 (98.48%), Postives = 194/197 (98.48%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 593
            KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISG EISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRD ISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEK TEL
Sbjct: 1482 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGTEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDTISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKLTEL 1678          

HSP 27 Score: 379.407 bits (973), Expect = 8.638e-122
Identity = 194/197 (98.48%), Postives = 194/197 (98.48%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 593
            KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISG EISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRD ISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEK TEL
Sbjct: 2131 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGTEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDTISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKLTEL 2327          

HSP 28 Score: 378.637 bits (971), Expect = 1.891e-121
Identity = 194/197 (98.48%), Postives = 194/197 (98.48%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 593
            KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRD ISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEK TELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEK TEL
Sbjct: 3022 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDTISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKLTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKLTEL 3218          

HSP 29 Score: 378.252 bits (970), Expect = 2.386e-121
Identity = 191/197 (96.95%), Postives = 194/197 (98.48%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 593
            KISMEYSTDAHHLTLD+AMEKGLVDTLRGTIRDPISG EISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNIS L T+EKER+DKEKQTEL
Sbjct: 1086 KISMEYSTDAHHLTLDDAMEKGLVDTLRGTIRDPISGTEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISVLQTNEKERIDKEKQTEL 1282          

HSP 30 Score: 378.252 bits (970), Expect = 2.628e-121
Identity = 194/197 (98.48%), Postives = 194/197 (98.48%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 593
            KISMEYSTDAHHLTLDEAMEKGLVDTLR TIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRD ISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEK TEL
Sbjct: 2923 KISMEYSTDAHHLTLDEAMEKGLVDTLRVTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDTISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKLTEL 3119          

HSP 31 Score: 377.867 bits (969), Expect = 3.760e-121
Identity = 192/197 (97.46%), Postives = 194/197 (98.48%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 593
            KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRD ISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNIS L T+EKER+DKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL
Sbjct: 2329 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDTISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISVLQTNEKERIDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 2525          

HSP 32 Score: 375.555 bits (963), Expect = 2.274e-120
Identity = 191/197 (96.95%), Postives = 193/197 (97.97%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 593
            KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRD ISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNIS L T+EKER+DKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISG EISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL
Sbjct: 2032 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDTISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISVLQTNEKERIDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGTEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 2228          

HSP 33 Score: 374.015 bits (959), Expect = 6.786e-120
Identity = 190/197 (96.45%), Postives = 193/197 (97.97%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 593
            KISMEYSTDAHHLTLD+AMEKGLVDTLRGTIRDPISG EISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRD ISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNIS L T+EKER+DKEKQTEL
Sbjct: 1933 KISMEYSTDAHHLTLDDAMEKGLVDTLRGTIRDPISGTEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDTISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISVLQTNEKERIDKEKQTEL 2129          

HSP 34 Score: 370.163 bits (949), Expect = 1.416e-118
Identity = 190/197 (96.45%), Postives = 192/197 (97.46%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 593
            KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRD ISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEK TELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRD ISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNIS L T+EKER+DKEKQTEL
Sbjct: 2230 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDTISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKLTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDTISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISVLQTNEKERIDKEKQTEL 2426          

HSP 35 Score: 360.533 bits (924), Expect = 3.487e-115
Identity = 181/183 (98.91%), Postives = 183/183 (100.00%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLT 551
            KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLT+EKER+DKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLT
Sbjct:  407 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTNEKERIDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLT 589          

HSP 36 Score: 349.747 bits (896), Expect = 2.051e-111
Identity = 181/197 (91.88%), Postives = 181/197 (91.88%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 593
            KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQS               LLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEK TEL
Sbjct: 3715 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQS--------------CLLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKLTEL 3897          

HSP 37 Score: 349.362 bits (895), Expect = 3.109e-111
Identity = 180/197 (91.37%), Postives = 183/197 (92.89%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 593
            KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLT              +KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLT+EKER+DKEKQTEL
Sbjct:  506 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLT--------------KKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTNEKERIDKEKQTEL 688          

HSP 38 Score: 347.821 bits (891), Expect = 1.170e-110
Identity = 174/190 (91.58%), Postives = 182/190 (95.79%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMD 572
            KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQ+ELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLK+  ++ +L  +   ++D
Sbjct: 4097 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQSELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKNFSDVPSLFKAYDFKID 4286          

HSP 39 Score: 347.051 bits (889), Expect = 2.195e-110
Identity = 179/197 (90.86%), Postives = 181/197 (91.88%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 593
            KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLT+EKER+DKEK TELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQ              S LLTSEKERMDKEKQTEL
Sbjct: 3616 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTNEKERIDKEKLTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQ--------------SCLLTSEKERMDKEKQTEL 3798          

HSP 40 Score: 334.339 bits (856), Expect = 4.813e-106
Identity = 173/197 (87.82%), Postives = 175/197 (88.83%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 593
            KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQ                      +R+DKEKQTEL
Sbjct: 1757 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQ----------------------KRIDKEKQTEL 1931          

HSP 41 Score: 330.872 bits (847), Expect = 8.772e-105
Identity = 171/197 (86.80%), Postives = 174/197 (88.32%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 593
            KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQ                      +R+DKEKQTELEKISMEYSTDAHHLTLD+AMEKGLVDTLRGTIRDPISG EISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL
Sbjct: 1856 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQ----------------------KRIDKEKQTELEKISMEYSTDAHHLTLDDAMEKGLVDTLRGTIRDPISGTEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 2030          

HSP 42 Score: 330.102 bits (845), Expect = 1.382e-104
Identity = 172/197 (87.31%), Postives = 174/197 (88.32%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 593
            KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRD ISGKEISLQEAIARGIIDAENSAIYDAEKGQ                      +R+DKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL
Sbjct: 1680 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDTISGKEISLQEAIARGIIDAENSAIYDAEKGQ----------------------KRIDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 1854          

HSP 43 Score: 322.783 bits (826), Expect = 5.157e-102
Identity = 170/197 (86.29%), Postives = 172/197 (87.31%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 593
            KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRD ISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEK TELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRD ISGKEISLQEAIARGIIDAENSAIYDAEKGQ                      +R+DKEKQTEL
Sbjct: 1581 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDTISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKLTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDTISGKEISLQEAIARGIIDAENSAIYDAEKGQ----------------------KRIDKEKQTEL 1755          

HSP 44 Score: 207.223 bits (526), Expect = 1.268e-61
Identity = 106/108 (98.15%), Postives = 106/108 (98.15%), Query Frame = 3
Query:  270 MDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 593
            MDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRD ISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEK TEL
Sbjct:    1 MDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDTISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKLTEL 108          
BLAST of SMED30009048 vs. Planmine SMEST
Match: SMESG000043809.1 (SMESG000043809.1)

HSP 1 Score: 387.497 bits (994), Expect = 1.259e-124
Identity = 196/197 (99.49%), Postives = 197/197 (100.00%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 593
            KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQ+EL
Sbjct: 3998 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQSEL 4194          

HSP 2 Score: 387.497 bits (994), Expect = 1.634e-124
Identity = 196/197 (99.49%), Postives = 196/197 (99.49%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 593
            KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEML SGKNISALLTSEKERMDKEKQTEL
Sbjct:  690 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLNSGKNISALLTSEKERMDKEKQTEL 886          

HSP 3 Score: 387.497 bits (994), Expect = 1.634e-124
Identity = 196/197 (99.49%), Postives = 196/197 (99.49%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 593
            KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEML SGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL
Sbjct:  789 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLNSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 985          

HSP 4 Score: 386.341 bits (991), Expect = 4.058e-124
Identity = 195/197 (98.98%), Postives = 197/197 (100.00%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 593
            KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLT+EKER+DKEKQTEL
Sbjct:  308 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTNEKERIDKEKQTEL 504          

HSP 5 Score: 386.341 bits (991), Expect = 4.058e-124
Identity = 195/197 (98.98%), Postives = 197/197 (100.00%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 593
            KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLT+EKER+DKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL
Sbjct:  591 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTNEKERIDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 787          

HSP 6 Score: 386.341 bits (991), Expect = 4.058e-124
Identity = 195/197 (98.98%), Postives = 197/197 (100.00%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 593
            KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLT+EKER+DKEKQTEL
Sbjct:  888 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTNEKERIDKEKQTEL 1084          

HSP 7 Score: 386.341 bits (991), Expect = 4.058e-124
Identity = 195/197 (98.98%), Postives = 197/197 (100.00%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 593
            KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLT+EKER+DKEKQTEL
Sbjct: 2433 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTNEKERIDKEKQTEL 2629          

HSP 8 Score: 385.956 bits (990), Expect = 5.021e-124
Identity = 196/197 (99.49%), Postives = 196/197 (99.49%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 593
            KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEK TEL
Sbjct: 2730 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKLTEL 2926          

HSP 9 Score: 385.956 bits (990), Expect = 5.021e-124
Identity = 196/197 (99.49%), Postives = 196/197 (99.49%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 593
            KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEK TELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL
Sbjct: 3423 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKLTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 3619          

HSP 10 Score: 385.571 bits (989), Expect = 6.843e-124
Identity = 195/197 (98.98%), Postives = 196/197 (99.49%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 593
            KISMEYSTDAHHLTLD+AMEKGLVDTLRGTIRDPISG EISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL
Sbjct: 2631 KISMEYSTDAHHLTLDDAMEKGLVDTLRGTIRDPISGTEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 2827          

HSP 11 Score: 384.03 bits (985), Expect = 2.601e-123
Identity = 194/197 (98.48%), Postives = 196/197 (99.49%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 593
            KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQE IARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLT+EKER+DKEKQTEL
Sbjct:  110 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEEIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTNEKERIDKEKQTEL 306          

HSP 12 Score: 384.03 bits (985), Expect = 2.601e-123
Identity = 194/197 (98.48%), Postives = 196/197 (99.49%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 593
            KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQE IARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLT+EKER+DKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL
Sbjct:  209 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEEIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTNEKERIDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 405          

HSP 13 Score: 383.259 bits (983), Expect = 4.559e-123
Identity = 193/197 (97.97%), Postives = 197/197 (100.00%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 593
            KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNIS+LLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLT+EKER+DKEKQT+L
Sbjct: 1284 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISSLLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTNEKERIDKEKQTKL 1480          

HSP 14 Score: 382.874 bits (982), Expect = 5.375e-123
Identity = 194/197 (98.48%), Postives = 196/197 (99.49%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 593
            KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLT+EKER+DKEK TEL
Sbjct: 3522 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTNEKERIDKEKLTEL 3718          

HSP 15 Score: 382.874 bits (982), Expect = 5.375e-123
Identity = 194/197 (98.48%), Postives = 196/197 (99.49%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 593
            KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLT+EKER+DKEK TELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL
Sbjct: 3899 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTNEKERIDKEKLTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 4095          

HSP 16 Score: 382.874 bits (982), Expect = 6.036e-123
Identity = 195/197 (98.98%), Postives = 195/197 (98.98%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 593
            KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEK TELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKS KNISALLTSEKERMDKEKQTEL
Sbjct: 3225 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKLTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSDKNISALLTSEKERMDKEKQTEL 3421          

HSP 17 Score: 382.874 bits (982), Expect = 6.036e-123
Identity = 195/197 (98.98%), Postives = 195/197 (98.98%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 593
            KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKS KNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEK TEL
Sbjct: 3324 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSDKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKLTEL 3520          

HSP 18 Score: 382.874 bits (982), Expect = 6.650e-123
Identity = 195/197 (98.98%), Postives = 195/197 (98.98%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 593
            KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEK TELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEK TEL
Sbjct: 3126 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKLTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKLTEL 3322          

HSP 19 Score: 382.489 bits (981), Expect = 7.325e-123
Identity = 193/197 (97.97%), Postives = 196/197 (99.49%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 593
            KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLT+EKER+DKEKQTELEKISMEYSTDAHHLTLD+AMEKGLVDTLRGTIRDPISG EISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL
Sbjct:  987 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTNEKERIDKEKQTELEKISMEYSTDAHHLTLDDAMEKGLVDTLRGTIRDPISGTEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 1183          

HSP 20 Score: 382.489 bits (981), Expect = 7.325e-123
Identity = 193/197 (97.97%), Postives = 196/197 (99.49%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 593
            KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLT+EKER+DKEKQTELEKISMEYSTDAHHLTLD+AMEKGLVDTLRGTIRDPISG EISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL
Sbjct: 2532 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTNEKERIDKEKQTELEKISMEYSTDAHHLTLDDAMEKGLVDTLRGTIRDPISGTEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 2728          

HSP 21 Score: 382.489 bits (981), Expect = 9.330e-123
Identity = 195/197 (98.98%), Postives = 195/197 (98.98%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 593
            KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEK TELEKISMEYSTDAHHLTLDEAMEKGLVDTLR TIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL
Sbjct: 2829 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKLTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRVTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 3025          

HSP 22 Score: 382.104 bits (980), Expect = 9.421e-123
Identity = 193/197 (97.97%), Postives = 196/197 (99.49%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 593
            KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLT+EKER+DKEKQT+LEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISG EISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL
Sbjct: 1383 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTNEKERIDKEKQTKLEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGTEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 1579          

HSP 23 Score: 381.719 bits (979), Expect = 1.428e-122
Identity = 195/197 (98.98%), Postives = 195/197 (98.98%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 593
            KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRD ISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEK TELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL
Sbjct:   11 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDTISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKLTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 207          

HSP 24 Score: 380.563 bits (976), Expect = 3.869e-122
Identity = 192/197 (97.46%), Postives = 195/197 (98.98%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 593
            KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNIS L T+EKER+DKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNIS+LLTSEKERMDKEKQTEL
Sbjct: 1185 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISVLQTNEKERIDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISSLLTSEKERMDKEKQTEL 1381          

HSP 25 Score: 379.793 bits (974), Expect = 7.118e-122
Identity = 193/197 (97.97%), Postives = 195/197 (98.98%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 593
            KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEK TELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLT+EKER+DKEK TEL
Sbjct: 3800 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKLTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTNEKERIDKEKLTEL 3996          

HSP 26 Score: 379.407 bits (973), Expect = 8.638e-122
Identity = 194/197 (98.48%), Postives = 194/197 (98.48%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 593
            KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISG EISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRD ISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEK TEL
Sbjct: 1482 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGTEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDTISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKLTEL 1678          

HSP 27 Score: 379.407 bits (973), Expect = 8.638e-122
Identity = 194/197 (98.48%), Postives = 194/197 (98.48%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 593
            KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISG EISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRD ISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEK TEL
Sbjct: 2136 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGTEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDTISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKLTEL 2332          

HSP 28 Score: 378.637 bits (971), Expect = 1.891e-121
Identity = 194/197 (98.48%), Postives = 194/197 (98.48%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 593
            KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRD ISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEK TELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEK TEL
Sbjct: 3027 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDTISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKLTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKLTEL 3223          

HSP 29 Score: 378.252 bits (970), Expect = 2.386e-121
Identity = 191/197 (96.95%), Postives = 194/197 (98.48%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 593
            KISMEYSTDAHHLTLD+AMEKGLVDTLRGTIRDPISG EISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNIS L T+EKER+DKEKQTEL
Sbjct: 1086 KISMEYSTDAHHLTLDDAMEKGLVDTLRGTIRDPISGTEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISVLQTNEKERIDKEKQTEL 1282          

HSP 30 Score: 378.252 bits (970), Expect = 2.654e-121
Identity = 194/197 (98.48%), Postives = 194/197 (98.48%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 593
            KISMEYSTDAHHLTLDEAMEKGLVDTLR TIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRD ISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEK TEL
Sbjct: 2928 KISMEYSTDAHHLTLDEAMEKGLVDTLRVTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDTISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKLTEL 3124          

HSP 31 Score: 377.867 bits (969), Expect = 3.760e-121
Identity = 192/197 (97.46%), Postives = 194/197 (98.48%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 593
            KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRD ISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNIS L T+EKER+DKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL
Sbjct: 2334 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDTISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISVLQTNEKERIDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 2530          

HSP 32 Score: 375.555 bits (963), Expect = 2.274e-120
Identity = 191/197 (96.95%), Postives = 193/197 (97.97%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 593
            KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRD ISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNIS L T+EKER+DKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISG EISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL
Sbjct: 2037 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDTISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISVLQTNEKERIDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGTEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 2233          

HSP 33 Score: 374.015 bits (959), Expect = 6.786e-120
Identity = 190/197 (96.45%), Postives = 193/197 (97.97%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 593
            KISMEYSTDAHHLTLD+AMEKGLVDTLRGTIRDPISG EISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRD ISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNIS L T+EKER+DKEKQTEL
Sbjct: 1938 KISMEYSTDAHHLTLDDAMEKGLVDTLRGTIRDPISGTEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDTISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISVLQTNEKERIDKEKQTEL 2134          

HSP 34 Score: 370.163 bits (949), Expect = 1.416e-118
Identity = 190/197 (96.45%), Postives = 192/197 (97.46%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 593
            KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRD ISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEK TELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRD ISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNIS L T+EKER+DKEKQTEL
Sbjct: 2235 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDTISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKLTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDTISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISVLQTNEKERIDKEKQTEL 2431          

HSP 35 Score: 360.533 bits (924), Expect = 3.487e-115
Identity = 181/183 (98.91%), Postives = 183/183 (100.00%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLT 551
            KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLT+EKER+DKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLT
Sbjct:  407 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTNEKERIDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLT 589          

HSP 36 Score: 349.362 bits (895), Expect = 3.079e-111
Identity = 180/197 (91.37%), Postives = 183/197 (92.89%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 593
            KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLT              +KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLT+EKER+DKEKQTEL
Sbjct:  506 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLT--------------KKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTNEKERIDKEKQTEL 688          

HSP 37 Score: 348.977 bits (894), Expect = 4.278e-111
Identity = 175/178 (98.31%), Postives = 177/178 (99.44%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNI 536
            KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLT+EKER+DKEK TELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNI
Sbjct: 3621 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTNEKERIDKEKLTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNI 3798          

HSP 38 Score: 347.821 bits (891), Expect = 1.170e-110
Identity = 174/190 (91.58%), Postives = 182/190 (95.79%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMD 572
            KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQ+ELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLK+  ++ +L  +   ++D
Sbjct: 4097 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQSELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKNFSDVPSLFKAYDFKID 4286          

HSP 39 Score: 343.199 bits (879), Expect = 4.240e-109
Identity = 178/197 (90.36%), Postives = 180/197 (91.37%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 593
            KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRD ISGKEISLQEAIARGIIDAENSAIYDAEKGQS               L T+EKER+DKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL
Sbjct: 1680 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDTISGKEISLQEAIARGIIDAENSAIYDAEKGQS--------------CLQTNEKERIDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 1862          

HSP 40 Score: 338.576 bits (867), Expect = 1.660e-107
Identity = 176/197 (89.34%), Postives = 177/197 (89.85%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 593
            KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNI                   +KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEK TEL
Sbjct: 3720 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNI-------------------KKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKLTEL 3897          

HSP 41 Score: 335.88 bits (860), Expect = 1.597e-106
Identity = 176/197 (89.34%), Postives = 178/197 (90.36%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 593
            KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRD ISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEK TELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRD ISGKEISLQEAIARGIIDAENSAIYDAEKGQ              S L T+EKER+DKEKQTEL
Sbjct: 1581 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDTISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKLTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDTISGKEISLQEAIARGIIDAENSAIYDAEKGQ--------------SCLQTNEKERIDKEKQTEL 1763          

HSP 42 Score: 330.102 bits (845), Expect = 1.629e-104
Identity = 164/165 (99.39%), Postives = 165/165 (100.00%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQS 497
            KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQ+
Sbjct: 1765 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQN 1929          

HSP 43 Score: 325.094 bits (832), Expect = 8.444e-103
Identity = 169/197 (85.79%), Postives = 171/197 (86.80%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 593
            KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQ                         +KEKQTELEKISMEYSTDAHHLTLD+AMEKGLVDTLRGTIRDPISG EISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL
Sbjct: 1864 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQ-------------------------NKEKQTELEKISMEYSTDAHHLTLDDAMEKGLVDTLRGTIRDPISGTEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 2035          

HSP 44 Score: 207.223 bits (526), Expect = 1.268e-61
Identity = 106/108 (98.15%), Postives = 106/108 (98.15%), Query Frame = 3
Query:  270 MDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 593
            MDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRD ISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEK TEL
Sbjct:    1 MDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDTISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKLTEL 108          
BLAST of SMED30009048 vs. Planmine SMEST
Match: SMESG000043809.1 (SMESG000043809.1)

HSP 1 Score: 387.497 bits (994), Expect = 1.442e-124
Identity = 196/197 (99.49%), Postives = 197/197 (100.00%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 593
            KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQ+EL
Sbjct: 3999 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQSEL 4195          

HSP 2 Score: 387.111 bits (993), Expect = 1.836e-124
Identity = 196/197 (99.49%), Postives = 196/197 (99.49%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 593
            KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEML SGKNISALLTSEKERMDKEKQTEL
Sbjct:  690 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLNSGKNISALLTSEKERMDKEKQTEL 886          

HSP 3 Score: 387.111 bits (993), Expect = 1.836e-124
Identity = 196/197 (99.49%), Postives = 196/197 (99.49%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 593
            KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEML SGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL
Sbjct:  789 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLNSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 985          

HSP 4 Score: 385.956 bits (990), Expect = 4.560e-124
Identity = 195/197 (98.98%), Postives = 197/197 (100.00%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 593
            KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLT+EKER+DKEKQTEL
Sbjct:  308 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTNEKERIDKEKQTEL 504          

HSP 5 Score: 385.956 bits (990), Expect = 4.560e-124
Identity = 195/197 (98.98%), Postives = 197/197 (100.00%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 593
            KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLT+EKER+DKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL
Sbjct:  591 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTNEKERIDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 787          

HSP 6 Score: 385.956 bits (990), Expect = 4.560e-124
Identity = 195/197 (98.98%), Postives = 197/197 (100.00%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 593
            KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLT+EKER+DKEKQTEL
Sbjct:  888 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTNEKERIDKEKQTEL 1084          

HSP 7 Score: 385.956 bits (990), Expect = 4.560e-124
Identity = 195/197 (98.98%), Postives = 197/197 (100.00%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 593
            KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLT+EKER+DKEKQTEL
Sbjct: 2428 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTNEKERIDKEKQTEL 2624          

HSP 8 Score: 385.956 bits (990), Expect = 5.587e-124
Identity = 196/197 (99.49%), Postives = 196/197 (99.49%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 593
            KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEK TEL
Sbjct: 2725 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKLTEL 2921          

HSP 9 Score: 385.956 bits (990), Expect = 5.587e-124
Identity = 196/197 (99.49%), Postives = 196/197 (99.49%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 593
            KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEK TELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL
Sbjct: 3418 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKLTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 3614          

HSP 10 Score: 385.571 bits (989), Expect = 7.689e-124
Identity = 195/197 (98.98%), Postives = 196/197 (99.49%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 593
            KISMEYSTDAHHLTLD+AMEKGLVDTLRGTIRDPISG EISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL
Sbjct: 2626 KISMEYSTDAHHLTLDDAMEKGLVDTLRGTIRDPISGTEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 2822          

HSP 11 Score: 383.645 bits (984), Expect = 2.923e-123
Identity = 194/197 (98.48%), Postives = 196/197 (99.49%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 593
            KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQE IARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLT+EKER+DKEKQTEL
Sbjct:  110 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEEIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTNEKERIDKEKQTEL 306          

HSP 12 Score: 383.645 bits (984), Expect = 2.923e-123
Identity = 194/197 (98.48%), Postives = 196/197 (99.49%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 593
            KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQE IARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLT+EKER+DKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL
Sbjct:  209 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEEIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTNEKERIDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 405          

HSP 13 Score: 382.874 bits (982), Expect = 5.173e-123
Identity = 193/197 (97.97%), Postives = 197/197 (100.00%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 593
            KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNIS+LLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLT+EKER+DKEKQT+L
Sbjct: 1284 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISSLLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTNEKERIDKEKQTKL 1480          

HSP 14 Score: 382.874 bits (982), Expect = 5.923e-123
Identity = 194/197 (98.48%), Postives = 196/197 (99.49%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 593
            KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLT+EKER+DKEK TEL
Sbjct: 3517 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTNEKERIDKEKLTEL 3713          

HSP 15 Score: 382.874 bits (982), Expect = 5.923e-123
Identity = 194/197 (98.48%), Postives = 196/197 (99.49%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 593
            KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLT+EKER+DKEK TELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL
Sbjct: 3900 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTNEKERIDKEKLTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 4096          

HSP 16 Score: 382.874 bits (982), Expect = 6.717e-123
Identity = 195/197 (98.98%), Postives = 195/197 (98.98%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 593
            KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEK TELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKS KNISALLTSEKERMDKEKQTEL
Sbjct: 3220 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKLTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSDKNISALLTSEKERMDKEKQTEL 3416          

HSP 17 Score: 382.874 bits (982), Expect = 6.717e-123
Identity = 195/197 (98.98%), Postives = 195/197 (98.98%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 593
            KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKS KNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEK TEL
Sbjct: 3319 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSDKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKLTEL 3515          

HSP 18 Score: 382.489 bits (981), Expect = 7.258e-123
Identity = 195/197 (98.98%), Postives = 195/197 (98.98%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 593
            KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEK TELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEK TEL
Sbjct: 3121 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKLTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKLTEL 3317          

HSP 19 Score: 382.489 bits (981), Expect = 8.151e-123
Identity = 193/197 (97.97%), Postives = 196/197 (99.49%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 593
            KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLT+EKER+DKEKQTELEKISMEYSTDAHHLTLD+AMEKGLVDTLRGTIRDPISG EISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL
Sbjct:  987 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTNEKERIDKEKQTELEKISMEYSTDAHHLTLDDAMEKGLVDTLRGTIRDPISGTEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 1183          

HSP 20 Score: 382.489 bits (981), Expect = 8.151e-123
Identity = 193/197 (97.97%), Postives = 196/197 (99.49%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 593
            KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLT+EKER+DKEKQTELEKISMEYSTDAHHLTLD+AMEKGLVDTLRGTIRDPISG EISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL
Sbjct: 2527 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTNEKERIDKEKQTELEKISMEYSTDAHHLTLDDAMEKGLVDTLRGTIRDPISGTEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 2723          

HSP 21 Score: 382.104 bits (980), Expect = 1.028e-122
Identity = 195/197 (98.98%), Postives = 195/197 (98.98%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 593
            KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEK TELEKISMEYSTDAHHLTLDEAMEKGLVDTLR TIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL
Sbjct: 2824 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKLTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRVTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 3020          

HSP 22 Score: 382.104 bits (980), Expect = 1.058e-122
Identity = 193/197 (97.97%), Postives = 196/197 (99.49%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 593
            KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLT+EKER+DKEKQT+LEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISG EISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL
Sbjct: 1383 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTNEKERIDKEKQTKLEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGTEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 1579          

HSP 23 Score: 381.719 bits (979), Expect = 1.605e-122
Identity = 195/197 (98.98%), Postives = 195/197 (98.98%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 593
            KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRD ISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEK TELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL
Sbjct:   11 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDTISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKLTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 207          

HSP 24 Score: 380.563 bits (976), Expect = 4.347e-122
Identity = 192/197 (97.46%), Postives = 195/197 (98.98%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 593
            KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNIS L T+EKER+DKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNIS+LLTSEKERMDKEKQTEL
Sbjct: 1185 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISVLQTNEKERIDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISSLLTSEKERMDKEKQTEL 1381          

HSP 25 Score: 379.793 bits (974), Expect = 7.694e-122
Identity = 193/197 (97.97%), Postives = 195/197 (98.98%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 593
            KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEK TELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLT+EKER+DKEK TEL
Sbjct: 3801 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKLTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTNEKERIDKEKLTEL 3997          

HSP 26 Score: 379.407 bits (973), Expect = 9.612e-122
Identity = 194/197 (98.48%), Postives = 194/197 (98.48%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 593
            KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISG EISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRD ISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEK TEL
Sbjct: 1482 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGTEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDTISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKLTEL 1678          

HSP 27 Score: 379.407 bits (973), Expect = 9.612e-122
Identity = 194/197 (98.48%), Postives = 194/197 (98.48%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 593
            KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISG EISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRD ISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEK TEL
Sbjct: 2131 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGTEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDTISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKLTEL 2327          

HSP 28 Score: 378.252 bits (970), Expect = 2.084e-121
Identity = 194/197 (98.48%), Postives = 194/197 (98.48%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 593
            KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRD ISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEK TELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEK TEL
Sbjct: 3022 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDTISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKLTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKLTEL 3218          

HSP 29 Score: 378.252 bits (970), Expect = 2.655e-121
Identity = 191/197 (96.95%), Postives = 194/197 (98.48%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 593
            KISMEYSTDAHHLTLD+AMEKGLVDTLRGTIRDPISG EISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNIS L T+EKER+DKEKQTEL
Sbjct: 1086 KISMEYSTDAHHLTLDDAMEKGLVDTLRGTIRDPISGTEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISVLQTNEKERIDKEKQTEL 1282          

HSP 30 Score: 377.867 bits (969), Expect = 2.953e-121
Identity = 194/197 (98.48%), Postives = 194/197 (98.48%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 593
            KISMEYSTDAHHLTLDEAMEKGLVDTLR TIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRD ISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEK TEL
Sbjct: 2923 KISMEYSTDAHHLTLDEAMEKGLVDTLRVTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDTISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKLTEL 3119          

HSP 31 Score: 377.481 bits (968), Expect = 4.265e-121
Identity = 192/197 (97.46%), Postives = 194/197 (98.48%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 593
            KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRD ISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNIS L T+EKER+DKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL
Sbjct: 2329 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDTISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISVLQTNEKERIDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 2525          

HSP 32 Score: 375.17 bits (962), Expect = 2.555e-120
Identity = 191/197 (96.95%), Postives = 193/197 (97.97%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 593
            KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRD ISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNIS L T+EKER+DKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISG EISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL
Sbjct: 2032 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDTISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISVLQTNEKERIDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGTEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 2228          

HSP 33 Score: 374.015 bits (959), Expect = 7.625e-120
Identity = 190/197 (96.45%), Postives = 193/197 (97.97%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 593
            KISMEYSTDAHHLTLD+AMEKGLVDTLRGTIRDPISG EISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRD ISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNIS L T+EKER+DKEKQTEL
Sbjct: 1933 KISMEYSTDAHHLTLDDAMEKGLVDTLRGTIRDPISGTEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDTISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISVLQTNEKERIDKEKQTEL 2129          

HSP 34 Score: 370.163 bits (949), Expect = 1.591e-118
Identity = 190/197 (96.45%), Postives = 192/197 (97.46%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 593
            KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRD ISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEK TELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRD ISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNIS L T+EKER+DKEKQTEL
Sbjct: 2230 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDTISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKLTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDTISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISVLQTNEKERIDKEKQTEL 2426          

HSP 35 Score: 360.533 bits (924), Expect = 4.072e-115
Identity = 181/183 (98.91%), Postives = 183/183 (100.00%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLT 551
            KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLT+EKER+DKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLT
Sbjct:  407 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTNEKERIDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLT 589          

HSP 36 Score: 351.288 bits (900), Expect = 5.556e-112
Identity = 182/197 (92.39%), Postives = 183/197 (92.89%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 593
            KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNI             +KQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEK TEL
Sbjct: 3715 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNI-------------KKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKLTEL 3898          

HSP 37 Score: 348.977 bits (894), Expect = 3.631e-111
Identity = 180/197 (91.37%), Postives = 183/197 (92.89%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 593
            KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLT              +KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLT+EKER+DKEKQTEL
Sbjct:  506 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLT--------------KKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTNEKERIDKEKQTEL 688          

HSP 38 Score: 348.591 bits (893), Expect = 4.807e-111
Identity = 175/178 (98.31%), Postives = 177/178 (99.44%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNI 536
            KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLT+EKER+DKEK TELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNI
Sbjct: 3616 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTNEKERIDKEKLTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNI 3793          

HSP 39 Score: 347.821 bits (891), Expect = 1.073e-110
Identity = 174/190 (91.58%), Postives = 182/190 (95.79%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMD 572
            KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQ+ELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLK+  ++ +L  +   ++D
Sbjct: 4098 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQSELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKNFSDVPSLFKAYDFKID 4287          

HSP 40 Score: 334.339 bits (856), Expect = 5.054e-106
Identity = 173/197 (87.82%), Postives = 175/197 (88.83%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 593
            KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQ                      +R+DKEKQTEL
Sbjct: 1757 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQ----------------------KRIDKEKQTEL 1931          

HSP 41 Score: 330.872 bits (847), Expect = 7.890e-105
Identity = 171/197 (86.80%), Postives = 174/197 (88.32%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 593
            KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQ                      +R+DKEKQTELEKISMEYSTDAHHLTLD+AMEKGLVDTLRGTIRDPISG EISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL
Sbjct: 1856 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQ----------------------KRIDKEKQTELEKISMEYSTDAHHLTLDDAMEKGLVDTLRGTIRDPISGTEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 2030          

HSP 42 Score: 330.487 bits (846), Expect = 1.268e-104
Identity = 172/197 (87.31%), Postives = 174/197 (88.32%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 593
            KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRD ISGKEISLQEAIARGIIDAENSAIYDAEKGQ                      +R+DKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL
Sbjct: 1680 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDTISGKEISLQEAIARGIIDAENSAIYDAEKGQ----------------------KRIDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 1854          

HSP 43 Score: 322.783 bits (826), Expect = 5.415e-102
Identity = 170/197 (86.29%), Postives = 172/197 (87.31%), Query Frame = 3
Query:    3 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 593
            KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRD ISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEK TELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRD ISGKEISLQEAIARGIIDAENSAIYDAEKGQ                      +R+DKEKQTEL
Sbjct: 1581 KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDTISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKLTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDTISGKEISLQEAIARGIIDAENSAIYDAEKGQ----------------------KRIDKEKQTEL 1755          

HSP 44 Score: 207.223 bits (526), Expect = 1.306e-61
Identity = 106/108 (98.15%), Postives = 106/108 (98.15%), Query Frame = 3
Query:  270 MDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL 593
            MDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRD ISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEK TEL
Sbjct:    1 MDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDTISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKLTEL 108          
The following BLAST results are available for this feature:
BLAST of SMED30009048 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30009048 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
vab-106.662e-1735.43VAB-10B protein [Source:UniProtKB/TrEMBL;Acc:G5EF... [more]
vab-107.771e-1735.63VAB-10B protein [Source:UniProtKB/TrEMBL;Acc:G5EF... [more]
vab-108.391e-1735.63VAB-10B protein [Source:UniProtKB/TrEMBL;Acc:G5EF... [more]
vab-108.552e-1735.43VAB-10B protein [Source:UniProtKB/TrEMBL;Acc:G5EF... [more]
vab-109.221e-1735.63VAB-10B protein [Source:UniProtKB/TrEMBL;Acc:G5EF... [more]
back to top
BLAST of SMED30009048 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
shot5.914e-923.53gene:FBgn0013733 transcript:FBtr0087621[more]
back to top
BLAST of SMED30009048 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30009048 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30009048 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30009048 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30009048 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
X2AMI38.134e-2135.06Uncharacterized protein OS=Capitella teleta OX=283... [more]
E2AVR21.331e-1531.58Bullous pemphigoid antigen 1, isoforms 6/9/10 OS=C... [more]
A0A2C9K8472.553e-1535.22Uncharacterized protein OS=Biomphalaria glabrata O... [more]
A0A2C9K8A32.602e-1535.22Uncharacterized protein OS=Biomphalaria glabrata O... [more]
A0A2C9K8442.603e-1535.22Uncharacterized protein OS=Biomphalaria glabrata O... [more]
back to top
BLAST of SMED30009048 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30009048 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30009048 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30009048 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30009048 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30009048 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000043809.11.235e-12499.49SMESG000043809.1[more]
SMESG000043809.11.259e-12499.49SMESG000043809.1[more]
SMESG000043809.11.259e-12499.49SMESG000043809.1[more]
SMESG000043809.11.259e-12499.49SMESG000043809.1[more]
SMESG000043809.11.442e-12499.49SMESG000043809.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30009048 ID=SMED30009048|Name=SMED30009048|organism=Schmidtea mediterranea sexual|type=transcript|length=594bp
AAAAGATCAGTATGGAATATTCAACTGACGCACATCATTTGACTTTGGAT
GAAGCAATGGAAAAAGGTCTTGTAGACACTTTGCGAGGAACGATACGAGA
TCCGATTTCTGGAAAAGAAATTTCATTACAAGAAGCAATTGCGAGAGGAA
TTATCGACGCAGAAAATAGCGCAATATATGATGCTGAGAAAGGACAAAGT
GTATCTCTTTCTGAAATGCTAAAGAGCGGCAAAAATATAAGTGCTTTGCT
AACAAGTGAAAAAGAACGTATGGATAAAGAAAAGCAAACGGAATTAGAAA
AGATCAGTATGGAATATTCAACTGACGCACATCATTTGACTTTGGATGAA
GCAATGGAAAAAGGTCTTGTAGACACTTTGCGAGGAACGATACGAGATCC
GATTTCTGGAAAAGAAATTTCATTACAAGAAGCAATTGCGAGAGGAATTA
TCGACGCAGAAAATAGCGCAATATATGATGCTGAGAAAGGACAAAGTGTA
TCTCTTTCTGAAATGCTAAAGAGCGGCAAAAATATAAGTGCTTTGCTAAC
AAGTGAAAAAGAACGTATGGATAAAGAAAAGCAAACGGAATTAG
back to top

protein sequence of SMED30009048-orf-1

>SMED30009048-orf-1 ID=SMED30009048-orf-1|Name=SMED30009048-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=197bp
KISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGI
IDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEK
ISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGII
DAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTEL
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000067goblet cell
PLANA:0000070intestinal phagocyte
PLANA:0000074oocyte
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000140anterior region of the whole animal
PLANA:0000231vitelline gland
PLANA:0000420parapharyngeal region
PLANA:0000428musculature system
PLANA:0000463cholinergic neuron
PLANA:0000464GABAergic neuron
PLANA:0000478pharynx musculature
PLANA:0002032epidermal cell
PLANA:0002075pigment cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR035915Plakin_repeat_sf
IPR001101Plectin_repeat
Vocabulary: cellular component
TermDefinition
GO:0005856cytoskeleton
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: molecular function
TermDefinition
GO:0003779actin binding
GO:0005509calcium ion binding
GO:0008017microtubule binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001101Plectin repeatSMARTSM00250plec_5coord: 19..56
e-value: 5.7E-4
score: 29.2
coord: 118..155
e-value: 5.7E-4
score: 29.2
IPR001101Plectin repeatPFAMPF00681Plectincoord: 29..54
e-value: 1.6E-4
score: 21.5
coord: 128..153
e-value: 1.6E-4
score: 21.5
IPR035915Plakin repeat superfamilyGENE3DG3DSA:3.90.1290.10coord: 7..179
e-value: 2.3E-8
score: 35.6
IPR035915Plakin repeat superfamilySUPERFAMILYSSF75399Plakin repeatcoord: 11..76
IPR035915Plakin repeat superfamilySUPERFAMILYSSF75399Plakin repeatcoord: 110..175