Fork-head domain-containing protein

Overview
NameFork-head domain-containing protein
Smed IDSMED30009043
Length (bp)2273
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Fork-head domain-containing protein (SMED30009043) t-SNE clustered cells

Violin plots show distribution of expression levels for Fork-head domain-containing protein (SMED30009043) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Fork-head domain-containing protein (SMED30009043) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Fork-head domain-containing protein (SMED30009043) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30009043

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
neuronSMED30009043h1SMcG0006941 BK013015smed_ncbi_20240424PMID:33536473
Pascual-Carreras et al., 2021
whole organism asexual adult single-cell RNA-sequencing evidence
central nervous systemSMED30009043h1SMcG0006941 BK013015smed_ncbi_20240424PMID:33536473
Pascual-Carreras et al., 2021
whole organism asexual adult colorimetric in situ hybridization evidence
secretory cellSMED30009043h1SMcG0006941 BK013015smed_ncbi_20240424PMID:33536473
Pascual-Carreras et al., 2021
whole organism asexual adult single-cell RNA-sequencing evidence
head regionSMED30009043h1SMcG0006941 SmedASXL_017198SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30009043h1SMcG0006941 dd_Smed_v4_12170_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30009043h1SMcG0006941 dd_Smed_v4_12170_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30009043h1SMcG0006941 dd_Smed_v6_12170_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Fork-head domain-containing protein vs. Ensembl Human
Match: FOXJ3 (forkhead box J3 [Source:HGNC Symbol;Acc:HGNC:29178])

HSP 1 Score: 114.39 bits (285), Expect = 1.058e-26
Identity = 72/186 (38.71%), Postives = 101/186 (54.30%), Query Frame = 3
Query:   51 IRMCA-FDDSLTEIDWLNSLCIQ---KKSEIKEGNVISTTISPYSLITTHHNSPNDNCNTSRI--HGYDKPSYSYAYLIKLAIESSNSKKMKLNEIYSWISETFPYYKYMQKDNNKGWKNAIRHNLSLNKIFKRCAKDSSQLGKGSFWTIDSSLDDDVQYPPVKKMKLMLNSTETVRSSSIEKLDL 590
            +RM +  + SLT +DWL  L ++   +KS+  + N   T IS  + +      PN   +   +  H   KP YSYA LI  AI SS  KKM L+EIY WI + FPYY    ++   GWKN+IRHNLSLNK F +  +     GKGS+W ID++  +DV   P +  K         R+ S+E++ L
Sbjct:   14 LRMTSELESSLTSMDWLPQLTMRAAIQKSDATQ-NAHGTGISKKNALL----DPNTTLDQEEVQQHKDGKPPYSYASLITFAINSSPKKKMTLSEIYQWICDNFPYY----REAGSGWKNSIRHNLSLNKCFLKVPRSKDDPGKGSYWAIDTNPKEDVL--PTRPKK---------RARSVERVTL 179          
BLAST of Fork-head domain-containing protein vs. Ensembl Human
Match: FOXJ2 (forkhead box J2 [Source:HGNC Symbol;Acc:HGNC:24818])

HSP 1 Score: 115.546 bits (288), Expect = 3.204e-26
Identity = 66/149 (44.30%), Postives = 84/149 (56.38%), Query Frame = 3
Query:   66 FDDSLTEIDWLNSLCIQKKSEIKEGNVISTTISPYSLITTHHNSPNDNCNT-----SRIHGYDKPSYSYAYLIKLAIESSNSKKMKLNEIYSWISETFPYYKYMQKDNNKGWKNAIRHNLSLNKIFKRCAKDSSQLGKGSFWTIDSSLD 497
             + SLT IDWL  L +  ++ I++    S    P S       SP D   T     + +H   KP YSYA LI  AI SS +KKM L+EIY WI + FPYY    K+   GWKN+IRHNLSLNK F++  +     GKGS+WTID+  D
Sbjct:    5 LESSLTSIDWLPQLTL--RATIEKLGSASQAGPPGSSRKCSPGSPTDPNATLSKDEAAVHQDGKPRYSYATLITYAINSSPAKKMTLSEIYRWICDNFPYY----KNAGIGWKNSIRHNLSLNKCFRKVPRPRDDPGKGSYWTIDTCPD 147          
BLAST of Fork-head domain-containing protein vs. Ensembl Human
Match: FOXJ2 (forkhead box J2 [Source:HGNC Symbol;Acc:HGNC:24818])

HSP 1 Score: 115.161 bits (287), Expect = 3.393e-26
Identity = 66/149 (44.30%), Postives = 84/149 (56.38%), Query Frame = 3
Query:   66 FDDSLTEIDWLNSLCIQKKSEIKEGNVISTTISPYSLITTHHNSPNDNCNT-----SRIHGYDKPSYSYAYLIKLAIESSNSKKMKLNEIYSWISETFPYYKYMQKDNNKGWKNAIRHNLSLNKIFKRCAKDSSQLGKGSFWTIDSSLD 497
             + SLT IDWL  L +  ++ I++    S    P S       SP D   T     + +H   KP YSYA LI  AI SS +KKM L+EIY WI + FPYY    K+   GWKN+IRHNLSLNK F++  +     GKGS+WTID+  D
Sbjct:    5 LESSLTSIDWLPQLTL--RATIEKLGSASQAGPPGSSRKCSPGSPTDPNATLSKDEAAVHQDGKPRYSYATLITYAINSSPAKKMTLSEIYRWICDNFPYY----KNAGIGWKNSIRHNLSLNKCFRKVPRPRDDPGKGSYWTIDTCPD 147          
BLAST of Fork-head domain-containing protein vs. Ensembl Human
Match: FOXJ3 (forkhead box J3 [Source:HGNC Symbol;Acc:HGNC:29178])

HSP 1 Score: 114.775 bits (286), Expect = 6.268e-26
Identity = 71/186 (38.17%), Postives = 100/186 (53.76%), Query Frame = 3
Query:   51 IRMCA-FDDSLTEIDWLNSLCIQ---KKSEIKEGNVISTTISPYSLITTHHNSPNDNCNTSRI--HGYDKPSYSYAYLIKLAIESSNSKKMKLNEIYSWISETFPYYKYMQKDNNKGWKNAIRHNLSLNKIFKRCAKDSSQLGKGSFWTIDSSLDDDVQYPPVKKMKLMLNSTETVRSSSIEKLDL 590
            +RM +  + SLT +DWL  L ++   +KS+  + N   T IS  + +      PN   +   +  H   KP YSYA LI  AI SS  KKM L+EIY WI + FPYY    ++   GWKN+IRHNLSLNK F +  +     GKGS+W ID++  +DV           L +    R+ S+E++ L
Sbjct:   14 LRMTSELESSLTSMDWLPQLTMRAAIQKSDATQ-NAHGTGISKKNALL----DPNTTLDQEEVQQHKDGKPPYSYASLITFAINSSPKKKMTLSEIYQWICDNFPYY----REAGSGWKNSIRHNLSLNKCFLKVPRSKDDPGKGSYWAIDTNPKEDV-----------LPTRPKKRARSVERVTL 179          
BLAST of Fork-head domain-containing protein vs. Ensembl Human
Match: FOXJ3 (forkhead box J3 [Source:HGNC Symbol;Acc:HGNC:29178])

HSP 1 Score: 114.005 bits (284), Expect = 1.433e-25
Identity = 66/158 (41.77%), Postives = 90/158 (56.96%), Query Frame = 3
Query:   51 IRMCA-FDDSLTEIDWLNSLCIQ---KKSEIKEGNVISTTISPYSLITTHHNSPNDNCNTSRI--HGYDKPSYSYAYLIKLAIESSNSKKMKLNEIYSWISETFPYYKYMQKDNNKGWKNAIRHNLSLNKIFKRCAKDSSQLGKGSFWTIDSSLDDDV 506
            +RM +  + SLT +DWL  L ++   +KS+  + N   T IS  + +      PN   +   +  H   KP YSYA LI  AI SS  KKM L+EIY WI + FPYY+    +   GWKN+IRHNLSLNK F +  +     GKGS+W ID++  +DV
Sbjct:   14 LRMTSELESSLTSMDWLPQLTMRAAIQKSDATQ-NAHGTGISKKNALL----DPNTTLDQEEVQQHKDGKPPYSYASLITFAINSSPKKKMTLSEIYQWICDNFPYYR----EAGSGWKNSIRHNLSLNKCFLKVPRSKDDPGKGSYWAIDTNPKEDV 162          
BLAST of Fork-head domain-containing protein vs. Ensembl Celegans
Match: fkh-2 (ForKHead transcription factor family [Source:UniProtKB/TrEMBL;Acc:Q95QA9])

HSP 1 Score: 90.5077 bits (223), Expect = 7.861e-20
Identity = 39/90 (43.33%), Postives = 61/90 (67.78%), Query Frame = 3
Query:  237 DKPSYSYAYLIKLAIESSNSKKMKLNEIYSWISETFPYYKYMQKDNNKGWKNAIRHNLSLNKIFKRCAKDSSQLGKGSFWTIDSSLDDDV 506
            DKP +SY  LI +AI+ S  K++ L  IY +I   +P+Y+    DN +GW+N+IRHNLSLNK F +  ++    GKG++W +D++ +D+V
Sbjct:   92 DKPPFSYNALIMMAIKDSPEKRLTLAGIYEYIVTNYPFYR----DNKQGWQNSIRHNLSLNKCFVKVPRNFDDPGKGNYWMLDATAEDEV 177          
BLAST of Fork-head domain-containing protein vs. Ensembl Celegans
Match: pha-4 (Defective pharyngeal development protein 4 [Source:UniProtKB/Swiss-Prot;Acc:Q17381])

HSP 1 Score: 93.2041 bits (230), Expect = 9.500e-20
Identity = 41/85 (48.24%), Postives = 60/85 (70.59%), Query Frame = 3
Query:  228 HGYDKPSYSYAYLIKLAIESSNSKKMKLNEIYSWISETFPYYKYMQKDNNKGWKNAIRHNLSLNKIFKRCAKDSSQLGKGSFWTI 482
            +G  KP YSY  LI +AI+ SNS+++ L+EIY+WI + FPYY    ++N + W+N+IRH+LS N  F + A+   + GKGSFWT+
Sbjct:  168 YGQSKPPYSYISLITMAIQKSNSRQLTLSEIYNWIMDLFPYY----QNNQQRWQNSIRHSLSFNDCFVKVARSPDKPGKGSFWTL 248          
BLAST of Fork-head domain-containing protein vs. Ensembl Celegans
Match: pha-4 (Defective pharyngeal development protein 4 [Source:UniProtKB/Swiss-Prot;Acc:Q17381])

HSP 1 Score: 92.4337 bits (228), Expect = 1.072e-19
Identity = 41/85 (48.24%), Postives = 60/85 (70.59%), Query Frame = 3
Query:  228 HGYDKPSYSYAYLIKLAIESSNSKKMKLNEIYSWISETFPYYKYMQKDNNKGWKNAIRHNLSLNKIFKRCAKDSSQLGKGSFWTI 482
            +G  KP YSY  LI +AI+ SNS+++ L+EIY+WI + FPYY    ++N + W+N+IRH+LS N  F + A+   + GKGSFWT+
Sbjct:  137 YGQSKPPYSYISLITMAIQKSNSRQLTLSEIYNWIMDLFPYY----QNNQQRWQNSIRHSLSFNDCFVKVARSPDKPGKGSFWTL 217          
BLAST of Fork-head domain-containing protein vs. Ensembl Celegans
Match: pha-4 (Defective pharyngeal development protein 4 [Source:UniProtKB/Swiss-Prot;Acc:Q17381])

HSP 1 Score: 93.2041 bits (230), Expect = 1.197e-19
Identity = 41/85 (48.24%), Postives = 60/85 (70.59%), Query Frame = 3
Query:  228 HGYDKPSYSYAYLIKLAIESSNSKKMKLNEIYSWISETFPYYKYMQKDNNKGWKNAIRHNLSLNKIFKRCAKDSSQLGKGSFWTI 482
            +G  KP YSY  LI +AI+ SNS+++ L+EIY+WI + FPYY    ++N + W+N+IRH+LS N  F + A+   + GKGSFWT+
Sbjct:  232 YGQSKPPYSYISLITMAIQKSNSRQLTLSEIYNWIMDLFPYY----QNNQQRWQNSIRHSLSFNDCFVKVARSPDKPGKGSFWTL 312          
BLAST of Fork-head domain-containing protein vs. Ensembl Celegans
Match: fkh-6 (ForKHead transcription factor family [Source:UniProtKB/TrEMBL;Acc:Q10924])

HSP 1 Score: 87.4261 bits (215), Expect = 2.205e-18
Identity = 39/85 (45.88%), Postives = 54/85 (63.53%), Query Frame = 3
Query:  237 DKPSYSYAYLIKLAIESSNSKKMKLNEIYSWISETFPYYKYMQKDNNKGWKNAIRHNLSLNKIFKRCAKDSSQLG---KGSFWTI 482
            DKP YSY  LI +AI++S  K+M LN+IY +I   FPYY+       +GW+N+IRHNLSLN  F + A+D        KG++W +
Sbjct:   20 DKPPYSYVALIAMAIDASPDKRMTLNQIYKFIEAKFPYYRDADAKRKQGWQNSIRHNLSLNDCFVKKARDGQSCANDRKGNYWQM 104          
BLAST of Fork-head domain-containing protein vs. Ensembl Fly
Match: croc (gene:FBgn0014143 transcript:FBtr0078395)

HSP 1 Score: 99.7525 bits (247), Expect = 1.471e-21
Identity = 44/82 (53.66%), Postives = 60/82 (73.17%), Query Frame = 3
Query:  240 KPSYSYAYLIKLAIESSNSKKMKLNEIYSWISETFPYYKYMQKDNNKGWKNAIRHNLSLNKIFKRCAKDSSQLGKGSFWTID 485
            KP YSY  LI +AI+++  KK+ LN IY +I E FPYY+    DN +GW+N+IRHNLSLN+ F + A+D  + GKGS+WT+D
Sbjct:   70 KPPYSYIALIAMAIQNAADKKVTLNGIYQYIMERFPYYR----DNKQGWQNSIRHNLSLNECFVKVARDDKKPGKGSYWTLD 147          
BLAST of Fork-head domain-containing protein vs. Ensembl Fly
Match: FoxK (gene:FBgn0036134 transcript:FBtr0332653)

HSP 1 Score: 96.6709 bits (239), Expect = 2.970e-20
Identity = 43/83 (51.81%), Postives = 60/83 (72.29%), Query Frame = 3
Query:  237 DKPSYSYAYLIKLAIESSNSKKMKLNEIYSWISETFPYYKYMQKDNNKGWKNAIRHNLSLNKIFKRCAKDSSQLGKGSFWTID 485
            +KP YSYA LI  AI ++  K++ L+ IYS+I + +PYY+   K+ NKGW+N+IRHNLSLN+ F + A+   + GKGSFW ID
Sbjct:  451 EKPPYSYAQLIVQAISAAPDKQLTLSGIYSFIVKHYPYYR---KETNKGWQNSIRHNLSLNRYFIKVARSQDEPGKGSFWRID 530          
BLAST of Fork-head domain-containing protein vs. Ensembl Fly
Match: FoxK (gene:FBgn0036134 transcript:FBtr0300783)

HSP 1 Score: 96.6709 bits (239), Expect = 2.975e-20
Identity = 43/83 (51.81%), Postives = 60/83 (72.29%), Query Frame = 3
Query:  237 DKPSYSYAYLIKLAIESSNSKKMKLNEIYSWISETFPYYKYMQKDNNKGWKNAIRHNLSLNKIFKRCAKDSSQLGKGSFWTID 485
            +KP YSYA LI  AI ++  K++ L+ IYS+I + +PYY+   K+ NKGW+N+IRHNLSLN+ F + A+   + GKGSFW ID
Sbjct:  452 EKPPYSYAQLIVQAISAAPDKQLTLSGIYSFIVKHYPYYR---KETNKGWQNSIRHNLSLNRYFIKVARSQDEPGKGSFWRID 531          
BLAST of Fork-head domain-containing protein vs. Ensembl Fly
Match: FoxK (gene:FBgn0036134 transcript:FBtr0300784)

HSP 1 Score: 96.6709 bits (239), Expect = 2.975e-20
Identity = 43/83 (51.81%), Postives = 60/83 (72.29%), Query Frame = 3
Query:  237 DKPSYSYAYLIKLAIESSNSKKMKLNEIYSWISETFPYYKYMQKDNNKGWKNAIRHNLSLNKIFKRCAKDSSQLGKGSFWTID 485
            +KP YSYA LI  AI ++  K++ L+ IYS+I + +PYY+   K+ NKGW+N+IRHNLSLN+ F + A+   + GKGSFW ID
Sbjct:  452 EKPPYSYAQLIVQAISAAPDKQLTLSGIYSFIVKHYPYYR---KETNKGWQNSIRHNLSLNRYFIKVARSQDEPGKGSFWRID 531          
BLAST of Fork-head domain-containing protein vs. Ensembl Fly
Match: FoxK (gene:FBgn0036134 transcript:FBtr0300786)

HSP 1 Score: 96.6709 bits (239), Expect = 2.975e-20
Identity = 43/83 (51.81%), Postives = 60/83 (72.29%), Query Frame = 3
Query:  237 DKPSYSYAYLIKLAIESSNSKKMKLNEIYSWISETFPYYKYMQKDNNKGWKNAIRHNLSLNKIFKRCAKDSSQLGKGSFWTID 485
            +KP YSYA LI  AI ++  K++ L+ IYS+I + +PYY+   K+ NKGW+N+IRHNLSLN+ F + A+   + GKGSFW ID
Sbjct:  452 EKPPYSYAQLIVQAISAAPDKQLTLSGIYSFIVKHYPYYR---KETNKGWQNSIRHNLSLNRYFIKVARSQDEPGKGSFWRID 531          
BLAST of Fork-head domain-containing protein vs. Ensembl Zebrafish
Match: foxj2 (forkhead box J2 [Source:ZFIN;Acc:ZDB-GENE-100922-240])

HSP 1 Score: 110.538 bits (275), Expect = 3.207e-25
Identity = 62/152 (40.79%), Postives = 84/152 (55.26%), Query Frame = 3
Query:   66 FDDSLTEIDWLNSLCI-----------QKKSEIKEGNV-ISTTISPYSLITTHHNSPNDNCNTSRIHGYDKPSYSYAYLIKLAIESSNSKKMKLNEIYSWISETFPYYKYMQKDNNKGWKNAIRHNLSLNKIFKRCAKDSSQLGKGSFWTID 485
             D SLT IDWL  L I           +KK   +E ++ +   +SP S               S++    KP +SYA LI +AI S+   K+ LN+IY+WIS+TFPYY        +GWKN+IRHNLSLNK F++  +  S  GKGS+WT+D
Sbjct:    5 LDSSLTSIDWLPQLGISTLRSGKERVERKKERGREKDIPLIPALSPGS--------------NSKV----KPPHSYATLIAMAISSAPEMKLSLNDIYTWISDTFPYYCRA----GRGWKNSIRHNLSLNKCFRKVPRPQSDPGKGSYWTMD 134          
BLAST of Fork-head domain-containing protein vs. Ensembl Zebrafish
Match: foxj2 (forkhead box J2 [Source:ZFIN;Acc:ZDB-GENE-100922-240])

HSP 1 Score: 109.768 bits (273), Expect = 1.071e-24
Identity = 62/152 (40.79%), Postives = 84/152 (55.26%), Query Frame = 3
Query:   66 FDDSLTEIDWLNSLCI-----------QKKSEIKEGNV-ISTTISPYSLITTHHNSPNDNCNTSRIHGYDKPSYSYAYLIKLAIESSNSKKMKLNEIYSWISETFPYYKYMQKDNNKGWKNAIRHNLSLNKIFKRCAKDSSQLGKGSFWTID 485
             D SLT IDWL  L I           +KK   +E ++ +   +SP S               S++    KP +SYA LI +AI S+   K+ LN+IY+WIS+TFPYY        +GWKN+IRHNLSLNK F++  +  S  GKGS+WT+D
Sbjct:    5 LDSSLTSIDWLPQLGISTLRSGKERVERKKERGREKDIPLIPALSPGS--------------NSKV----KPPHSYATLIAMAISSAPEMKLSLNDIYTWISDTFPYYCRA----GRGWKNSIRHNLSLNKCFRKVPRPQSDPGKGSYWTMD 134          
BLAST of Fork-head domain-containing protein vs. Ensembl Zebrafish
Match: foxj3 (forkhead box J3 [Source:ZFIN;Acc:ZDB-GENE-101005-1])

HSP 1 Score: 106.301 bits (264), Expect = 1.993e-23
Identity = 59/150 (39.33%), Postives = 80/150 (53.33%), Query Frame = 3
Query:   66 FDDSLTEIDWLNSLCIQKKSEIKEG-NVISTTISPYSLITTHHNSPNDNCNTSRI--HGYDKPSYSYAYLIKLAIESSNSKKMKLNEIYSWISETFPYYKYMQKDNNKGWKNAIRHNLSLNKIFKRCAKDSSQLGKGSFWTIDSSLDDDV 506
             + SLT +DWL  L ++   +  +  N     +   S +      PN   +   +  H   KP YSYA LI  AI SS  KKM L+EIY WI + FPYY    ++   GWKN+IRHNLSLNK F +  +     GKGS+W ID++  +D 
Sbjct:    5 LESSLTSMDWLPQLTMRAAIQKADAQNAHGPGMPKKSALL----DPNTTLDQEEVQQHKDGKPPYSYASLITFAINSSPKKKMTLSEIYQWICDNFPYY----REAGSGWKNSIRHNLSLNKCFLKVPRSKDDPGKGSYWAIDTNPKEDT 146          
BLAST of Fork-head domain-containing protein vs. Ensembl Zebrafish
Match: foxj3 (forkhead box J3 [Source:ZFIN;Acc:ZDB-GENE-101005-1])

HSP 1 Score: 106.301 bits (264), Expect = 2.235e-23
Identity = 59/150 (39.33%), Postives = 80/150 (53.33%), Query Frame = 3
Query:   66 FDDSLTEIDWLNSLCIQKKSEIKEG-NVISTTISPYSLITTHHNSPNDNCNTSRI--HGYDKPSYSYAYLIKLAIESSNSKKMKLNEIYSWISETFPYYKYMQKDNNKGWKNAIRHNLSLNKIFKRCAKDSSQLGKGSFWTIDSSLDDDV 506
             + SLT +DWL  L ++   +  +  N     +   S +      PN   +   +  H   KP YSYA LI  AI SS  KKM L+EIY WI + FPYY    ++   GWKN+IRHNLSLNK F +  +     GKGS+W ID++  +D 
Sbjct:    5 LESSLTSMDWLPQLTMRAAIQKADAQNAHGPGMPKKSALL----DPNTTLDQEEVQQHKDGKPPYSYASLITFAINSSPKKKMTLSEIYQWICDNFPYY----REAGSGWKNSIRHNLSLNKCFLKVPRSKDDPGKGSYWAIDTNPKEDT 146          
BLAST of Fork-head domain-containing protein vs. Ensembl Zebrafish
Match: foxc1b (forkhead box C1b [Source:NCBI gene;Acc:79375])

HSP 1 Score: 97.8265 bits (242), Expect = 4.638e-21
Identity = 43/82 (52.44%), Postives = 60/82 (73.17%), Query Frame = 3
Query:  240 KPSYSYAYLIKLAIESSNSKKMKLNEIYSWISETFPYYKYMQKDNNKGWKNAIRHNLSLNKIFKRCAKDSSQLGKGSFWTID 485
            KP YSY  LI +AI++S+ KK+ LN IY +I E FP+Y+    DN +GW+N+IRHNLSLN+ F +  +D  + GKGS+WT+D
Sbjct:   74 KPPYSYIALITMAIQNSSDKKITLNGIYQFIMERFPFYR----DNKQGWQNSIRHNLSLNECFVKVPRDDKKPGKGSYWTLD 151          
BLAST of Fork-head domain-containing protein vs. Ensembl Xenopus
Match: ndel1 (nudE neurodevelopment protein 1 like 1 [Source:Xenbase;Acc:XB-GENE-989304])

HSP 1 Score: 107.842 bits (268), Expect = 1.186e-23
Identity = 67/181 (37.02%), Postives = 92/181 (50.83%), Query Frame = 3
Query:   27 KFKLYEYDIRMCA-------FDDSLTEIDWLNSLCIQK--KSEIKEGNVISTTISPYSLITTHHNSPNDNCNTSRI--HGYDKPSYSYAYLIKLAIESSNSKKMKLNEIYSWISETFPYYKYMQKDNNKGWKNAIRHNLSLNKIFKRCAKDSSQLGKGSFWTIDSSLDDD-VQYPPVKKMK 533
            +F  Y+   R  A        + SLT +DWL  + ++   +S     +   T I   + +      PN   +   +  H   KP YSYA LI  AI SS  KKM L+EIY WI + FPYY    K+   GWKN+IRHNLSLNK F +  +     GKGS+W ID++  +D  Q  P K+ +
Sbjct:    2 RFHPYQRACRYLATFKMTSELESSLTSMDWLPKITVRAAIQSSDCSQHAHGTGIPKKNSVL----DPNTTLDQEEVQQHKDGKPPYSYASLITFAINSSPKKKMTLSEIYQWICDNFPYY----KEAGSGWKNSIRHNLSLNKCFLKVPRSKDDPGKGSYWAIDTNPKEDAAQARPRKRPR 174          
BLAST of Fork-head domain-containing protein vs. Ensembl Xenopus
Match: ndel1 (nudE neurodevelopment protein 1 like 1 [Source:Xenbase;Acc:XB-GENE-989304])

HSP 1 Score: 107.842 bits (268), Expect = 1.196e-23
Identity = 67/181 (37.02%), Postives = 92/181 (50.83%), Query Frame = 3
Query:   27 KFKLYEYDIRMCA-------FDDSLTEIDWLNSLCIQK--KSEIKEGNVISTTISPYSLITTHHNSPNDNCNTSRI--HGYDKPSYSYAYLIKLAIESSNSKKMKLNEIYSWISETFPYYKYMQKDNNKGWKNAIRHNLSLNKIFKRCAKDSSQLGKGSFWTIDSSLDDD-VQYPPVKKMK 533
            +F  Y+   R  A        + SLT +DWL  + ++   +S     +   T I   + +      PN   +   +  H   KP YSYA LI  AI SS  KKM L+EIY WI + FPYY    K+   GWKN+IRHNLSLNK F +  +     GKGS+W ID++  +D  Q  P K+ +
Sbjct:    2 RFHPYQRACRYLATFKMTSELESSLTSMDWLPKITVRAAIQSSDCSQHAHGTGIPKKNSVL----DPNTTLDQEEVQQHKDGKPPYSYASLITFAINSSPKKKMTLSEIYQWICDNFPYY----KEAGSGWKNSIRHNLSLNKCFLKVPRSKDDPGKGSYWAIDTNPKEDAAQARPRKRPR 174          
BLAST of Fork-head domain-containing protein vs. Ensembl Xenopus
Match: ndel1 (nudE neurodevelopment protein 1 like 1 [Source:Xenbase;Acc:XB-GENE-989304])

HSP 1 Score: 105.916 bits (263), Expect = 3.983e-23
Identity = 63/161 (39.13%), Postives = 86/161 (53.42%), Query Frame = 3
Query:   66 FDDSLTEIDWLNSLCIQK--KSEIKEGNVISTTISPYSLITTHHNSPNDNCNTSRI--HGYDKPSYSYAYLIKLAIESSNSKKMKLNEIYSWISETFPYYKYMQKDNNKGWKNAIRHNLSLNKIFKRCAKDSSQLGKGSFWTIDSSLDDD-VQYPPVKKMK 533
             + SLT +DWL  + ++   +S     +   T I   + +      PN   +   +  H   KP YSYA LI  AI SS  KKM L+EIY WI + FPYY    K+   GWKN+IRHNLSLNK F +  +     GKGS+W ID++  +D  Q  P K+ +
Sbjct:    5 LESSLTSMDWLPKITVRAAIQSSDCSQHAHGTGIPKKNSVL----DPNTTLDQEEVQQHKDGKPPYSYASLITFAINSSPKKKMTLSEIYQWICDNFPYY----KEAGSGWKNSIRHNLSLNKCFLKVPRSKDDPGKGSYWAIDTNPKEDAAQARPRKRPR 157          
BLAST of Fork-head domain-containing protein vs. Ensembl Xenopus
Match: ndel1 (nudE neurodevelopment protein 1 like 1 [Source:Xenbase;Acc:XB-GENE-989304])

HSP 1 Score: 105.916 bits (263), Expect = 4.512e-23
Identity = 63/161 (39.13%), Postives = 86/161 (53.42%), Query Frame = 3
Query:   66 FDDSLTEIDWLNSLCIQK--KSEIKEGNVISTTISPYSLITTHHNSPNDNCNTSRI--HGYDKPSYSYAYLIKLAIESSNSKKMKLNEIYSWISETFPYYKYMQKDNNKGWKNAIRHNLSLNKIFKRCAKDSSQLGKGSFWTIDSSLDDD-VQYPPVKKMK 533
             + SLT +DWL  + ++   +S     +   T I   + +      PN   +   +  H   KP YSYA LI  AI SS  KKM L+EIY WI + FPYY    K+   GWKN+IRHNLSLNK F +  +     GKGS+W ID++  +D  Q  P K+ +
Sbjct:    5 LESSLTSMDWLPKITVRAAIQSSDCSQHAHGTGIPKKNSVL----DPNTTLDQEEVQQHKDGKPPYSYASLITFAINSSPKKKMTLSEIYQWICDNFPYY----KEAGSGWKNSIRHNLSLNKCFLKVPRSKDDPGKGSYWAIDTNPKEDAAQARPRKRPR 157          
BLAST of Fork-head domain-containing protein vs. Ensembl Xenopus
Match: ndel1 (nudE neurodevelopment protein 1 like 1 [Source:Xenbase;Acc:XB-GENE-989304])

HSP 1 Score: 105.531 bits (262), Expect = 5.296e-23
Identity = 63/161 (39.13%), Postives = 86/161 (53.42%), Query Frame = 3
Query:   66 FDDSLTEIDWLNSLCIQK--KSEIKEGNVISTTISPYSLITTHHNSPNDNCNTSRI--HGYDKPSYSYAYLIKLAIESSNSKKMKLNEIYSWISETFPYYKYMQKDNNKGWKNAIRHNLSLNKIFKRCAKDSSQLGKGSFWTIDSSLDDD-VQYPPVKKMK 533
             + SLT +DWL  + ++   +S     +   T I   + +      PN   +   +  H   KP YSYA LI  AI SS  KKM L+EIY WI + FPYY    K+   GWKN+IRHNLSLNK F +  +     GKGS+W ID++  +D  Q  P K+ +
Sbjct:   22 LESSLTSMDWLPKITVRAAIQSSDCSQHAHGTGIPKKNSVL----DPNTTLDQEEVQQHKDGKPPYSYASLITFAINSSPKKKMTLSEIYQWICDNFPYY----KEAGSGWKNSIRHNLSLNKCFLKVPRSKDDPGKGSYWAIDTNPKEDAAQARPRKRPR 174          
BLAST of Fork-head domain-containing protein vs. Ensembl Mouse
Match: Foxj2 (forkhead box J2 [Source:MGI Symbol;Acc:MGI:1926805])

HSP 1 Score: 115.161 bits (287), Expect = 9.928e-29
Identity = 65/149 (43.62%), Postives = 83/149 (55.70%), Query Frame = 3
Query:   66 FDDSLTEIDWLNSLCIQKKSEIKEGNVISTTISPYSLITTHHNSPNDNCNT-----SRIHGYDKPSYSYAYLIKLAIESSNSKKMKLNEIYSWISETFPYYKYMQKDNNKGWKNAIRHNLSLNKIFKRCAKDSSQLGKGSFWTIDSSLD 497
             + SLT IDWL  L +  ++ I++    S    P         SP D   T     + +H   KP YSYA LI  AI SS +KKM L+EIY WI + FPYY    K+   GWKN+IRHNLSLNK F++  +     GKGS+WTID+  D
Sbjct:    5 LESSLTSIDWLPQLTL--RATIEKLGSASQAGPPGGARKCSPGSPTDPNATLSKDEAAVHQDGKPRYSYATLITYAINSSPAKKMTLSEIYRWICDNFPYY----KNAGIGWKNSIRHNLSLNKCFRKVPRPRDDPGKGSYWTIDTCPD 147          
BLAST of Fork-head domain-containing protein vs. Ensembl Mouse
Match: Foxj2 (forkhead box J2 [Source:MGI Symbol;Acc:MGI:1926805])

HSP 1 Score: 114.775 bits (286), Expect = 3.587e-26
Identity = 65/149 (43.62%), Postives = 83/149 (55.70%), Query Frame = 3
Query:   66 FDDSLTEIDWLNSLCIQKKSEIKEGNVISTTISPYSLITTHHNSPNDNCNT-----SRIHGYDKPSYSYAYLIKLAIESSNSKKMKLNEIYSWISETFPYYKYMQKDNNKGWKNAIRHNLSLNKIFKRCAKDSSQLGKGSFWTIDSSLD 497
             + SLT IDWL  L +  ++ I++    S    P         SP D   T     + +H   KP YSYA LI  AI SS +KKM L+EIY WI + FPYY    K+   GWKN+IRHNLSLNK F++  +     GKGS+WTID+  D
Sbjct:    5 LESSLTSIDWLPQLTL--RATIEKLGSASQAGPPGGARKCSPGSPTDPNATLSKDEAAVHQDGKPRYSYATLITYAINSSPAKKMTLSEIYRWICDNFPYY----KNAGIGWKNSIRHNLSLNKCFRKVPRPRDDPGKGSYWTIDTCPD 147          
BLAST of Fork-head domain-containing protein vs. Ensembl Mouse
Match: Foxj2 (forkhead box J2 [Source:MGI Symbol;Acc:MGI:1926805])

HSP 1 Score: 114.775 bits (286), Expect = 3.587e-26
Identity = 65/149 (43.62%), Postives = 83/149 (55.70%), Query Frame = 3
Query:   66 FDDSLTEIDWLNSLCIQKKSEIKEGNVISTTISPYSLITTHHNSPNDNCNT-----SRIHGYDKPSYSYAYLIKLAIESSNSKKMKLNEIYSWISETFPYYKYMQKDNNKGWKNAIRHNLSLNKIFKRCAKDSSQLGKGSFWTIDSSLD 497
             + SLT IDWL  L +  ++ I++    S    P         SP D   T     + +H   KP YSYA LI  AI SS +KKM L+EIY WI + FPYY    K+   GWKN+IRHNLSLNK F++  +     GKGS+WTID+  D
Sbjct:    5 LESSLTSIDWLPQLTL--RATIEKLGSASQAGPPGGARKCSPGSPTDPNATLSKDEAAVHQDGKPRYSYATLITYAINSSPAKKMTLSEIYRWICDNFPYY----KNAGIGWKNSIRHNLSLNKCFRKVPRPRDDPGKGSYWTIDTCPD 147          
BLAST of Fork-head domain-containing protein vs. Ensembl Mouse
Match: Foxj3 (forkhead box J3 [Source:MGI Symbol;Acc:MGI:2443432])

HSP 1 Score: 112.849 bits (281), Expect = 1.896e-25
Identity = 70/186 (37.63%), Postives = 99/186 (53.23%), Query Frame = 3
Query:   51 IRMCA-FDDSLTEIDWLNSLCIQ---KKSEIKEGNVISTTISPYSLITTHHNSPNDNCNTSRI--HGYDKPSYSYAYLIKLAIESSNSKKMKLNEIYSWISETFPYYKYMQKDNNKGWKNAIRHNLSLNKIFKRCAKDSSQLGKGSFWTIDSSLDDDVQYPPVKKMKLMLNSTETVRSSSIEKLDL 590
            +RM +  + SLT +DWL  L ++   +KS+  + N   T IS  + +      PN   +   +  H   KP YSYA LI  AI SS  KKM L+EIY WI + FPYY    ++   GWKN+IRHNLSLNK F +  +     GKGS+W ID++  +D            L +    R+ S+E++ L
Sbjct:   14 LRMTSELESSLTSMDWLPQLTMRAAIQKSDATQ-NAHGTGISKKNALL----DPNTTLDQEEVQQHKDGKPPYSYASLITFAINSSPKKKMTLSEIYQWICDNFPYY----REAGSGWKNSIRHNLSLNKCFLKVPRSKDDPGKGSYWAIDTNPKEDT-----------LPTRPKKRARSVERVTL 179          
BLAST of Fork-head domain-containing protein vs. Ensembl Mouse
Match: Foxj3 (forkhead box J3 [Source:MGI Symbol;Acc:MGI:2443432])

HSP 1 Score: 111.694 bits (278), Expect = 4.564e-25
Identity = 65/158 (41.14%), Postives = 89/158 (56.33%), Query Frame = 3
Query:   51 IRMCA-FDDSLTEIDWLNSLCIQ---KKSEIKEGNVISTTISPYSLITTHHNSPNDNCNTSRI--HGYDKPSYSYAYLIKLAIESSNSKKMKLNEIYSWISETFPYYKYMQKDNNKGWKNAIRHNLSLNKIFKRCAKDSSQLGKGSFWTIDSSLDDDV 506
            +RM +  + SLT +DWL  L ++   +KS+  + N   T IS  + +      PN   +   +  H   KP YSYA LI  AI SS  KKM L+EIY WI + FPYY    ++   GWKN+IRHNLSLNK F +  +     GKGS+W ID++  +D 
Sbjct:   14 LRMTSELESSLTSMDWLPQLTMRAAIQKSDATQ-NAHGTGISKKNALL----DPNTTLDQEEVQQHKDGKPPYSYASLITFAINSSPKKKMTLSEIYQWICDNFPYY----REAGSGWKNSIRHNLSLNKCFLKVPRSKDDPGKGSYWAIDTNPKEDT 162          
BLAST of Fork-head domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9P0K8|FOXJ2_HUMAN (Forkhead box protein J2 OS=Homo sapiens OX=9606 GN=FOXJ2 PE=1 SV=1)

HSP 1 Score: 115.546 bits (288), Expect = 1.539e-25
Identity = 66/149 (44.30%), Postives = 84/149 (56.38%), Query Frame = 3
Query:   66 FDDSLTEIDWLNSLCIQKKSEIKEGNVISTTISPYSLITTHHNSPNDNCNT-----SRIHGYDKPSYSYAYLIKLAIESSNSKKMKLNEIYSWISETFPYYKYMQKDNNKGWKNAIRHNLSLNKIFKRCAKDSSQLGKGSFWTIDSSLD 497
             + SLT IDWL  L +  ++ I++    S    P S       SP D   T     + +H   KP YSYA LI  AI SS +KKM L+EIY WI + FPYY    K+   GWKN+IRHNLSLNK F++  +     GKGS+WTID+  D
Sbjct:    5 LESSLTSIDWLPQLTL--RATIEKLGSASQAGPPGSSRKCSPGSPTDPNATLSKDEAAVHQDGKPRYSYATLITYAINSSPAKKMTLSEIYRWICDNFPYY----KNAGIGWKNSIRHNLSLNKCFRKVPRPRDDPGKGSYWTIDTCPD 147          
BLAST of Fork-head domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9ES18|FOXJ2_MOUSE (Forkhead box protein J2 OS=Mus musculus OX=10090 GN=Foxj2 PE=2 SV=1)

HSP 1 Score: 114.775 bits (286), Expect = 2.509e-25
Identity = 65/149 (43.62%), Postives = 83/149 (55.70%), Query Frame = 3
Query:   66 FDDSLTEIDWLNSLCIQKKSEIKEGNVISTTISPYSLITTHHNSPNDNCNT-----SRIHGYDKPSYSYAYLIKLAIESSNSKKMKLNEIYSWISETFPYYKYMQKDNNKGWKNAIRHNLSLNKIFKRCAKDSSQLGKGSFWTIDSSLD 497
             + SLT IDWL  L +  ++ I++    S    P         SP D   T     + +H   KP YSYA LI  AI SS +KKM L+EIY WI + FPYY    K+   GWKN+IRHNLSLNK F++  +     GKGS+WTID+  D
Sbjct:    5 LESSLTSIDWLPQLTL--RATIEKLGSASQAGPPGGARKCSPGSPTDPNATLSKDEAAVHQDGKPRYSYATLITYAINSSPAKKMTLSEIYRWICDNFPYY----KNAGIGWKNSIRHNLSLNKCFRKVPRPRDDPGKGSYWTIDTCPD 147          
BLAST of Fork-head domain-containing protein vs. UniProt/SwissProt
Match: sp|Q28EM1|FOXJ2_XENTR (Forkhead box protein J2 OS=Xenopus tropicalis OX=8364 GN=foxj2 PE=2 SV=1)

HSP 1 Score: 114.005 bits (284), Expect = 3.046e-25
Identity = 62/159 (38.99%), Postives = 85/159 (53.46%), Query Frame = 3
Query:   66 FDDSLTEIDWLNSLCIQKKSEIKEGN-----VISTTISPYSLITTHHNSPNDNCNTSRIHGYDKPSYSYAYLIKLAIESSNSKKMKLNEIYSWISETFPYYKYMQKDNNKGWKNAIRHNLSLNKIFKRCAKDSSQLGKGSFWTIDSSLDDDVQYPPVKK 527
               SLT IDWL  L IQ   +  + N        +   P ++++            +  H   KP YSYA LI+ AI S+ +K+M L+EIY WI + FPYY+    +   GWKN+IRHNLSLNK F++  +     GKGS+W IDS   +DV  P  K+
Sbjct:    5 LGSSLTSIDWLPQLTIQAAMKGSQQNNAGRKGPGSPTDPSAMLSKEE---------AAAHRDGKPPYSYANLIQYAINSAPAKRMTLSEIYRWICDNFPYYR----NAGVGWKNSIRHNLSLNKCFRKVPRPRDDPGKGSYWMIDSCPKEDVALPRRKR 150          
BLAST of Fork-head domain-containing protein vs. UniProt/SwissProt
Match: sp|Q68EZ2|FOXJ2_XENLA (Forkhead box protein J2 OS=Xenopus laevis OX=8355 GN=foxj2 PE=2 SV=1)

HSP 1 Score: 114.005 bits (284), Expect = 3.716e-25
Identity = 61/159 (38.36%), Postives = 85/159 (53.46%), Query Frame = 3
Query:   66 FDDSLTEIDWLNSLCIQKKSEIKEGNVIS-----TTISPYSLITTHHNSPNDNCNTSRIHGYDKPSYSYAYLIKLAIESSNSKKMKLNEIYSWISETFPYYKYMQKDNNKGWKNAIRHNLSLNKIFKRCAKDSSQLGKGSFWTIDSSLDDDVQYPPVKK 527
               SLT IDWL  L IQ   +  + N +      +   P ++++            +  H   KP YSYA LI+ AI S+ +K+M L+EIY WI + FPYY+        GWKN+IRHNLSLNK F++  +     GKGS+W IDS   +D+  P  K+
Sbjct:    5 LGSSLTSIDWLPQLTIQASIKGSQQNSVGRKGPGSPADPSAMLSKEE---------AAAHRDGKPPYSYANLIQYAINSAPAKRMTLSEIYRWICDNFPYYR----SAGVGWKNSIRHNLSLNKCFRKVPRPRDDPGKGSYWMIDSCPKEDITLPRRKR 150          
BLAST of Fork-head domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9UPW0|FOXJ3_HUMAN (Forkhead box protein J3 OS=Homo sapiens OX=9606 GN=FOXJ3 PE=1 SV=2)

HSP 1 Score: 114.005 bits (284), Expect = 6.882e-25
Identity = 66/158 (41.77%), Postives = 90/158 (56.96%), Query Frame = 3
Query:   51 IRMCA-FDDSLTEIDWLNSLCIQ---KKSEIKEGNVISTTISPYSLITTHHNSPNDNCNTSRI--HGYDKPSYSYAYLIKLAIESSNSKKMKLNEIYSWISETFPYYKYMQKDNNKGWKNAIRHNLSLNKIFKRCAKDSSQLGKGSFWTIDSSLDDDV 506
            +RM +  + SLT +DWL  L ++   +KS+  + N   T IS  + +      PN   +   +  H   KP YSYA LI  AI SS  KKM L+EIY WI + FPYY+    +   GWKN+IRHNLSLNK F +  +     GKGS+W ID++  +DV
Sbjct:   14 LRMTSELESSLTSMDWLPQLTMRAAIQKSDATQ-NAHGTGISKKNALL----DPNTTLDQEEVQQHKDGKPPYSYASLITFAINSSPKKKMTLSEIYQWICDNFPYYR----EAGSGWKNSIRHNLSLNKCFLKVPRSKDDPGKGSYWAIDTNPKEDV 162          
BLAST of Fork-head domain-containing protein vs. TrEMBL
Match: A0A0R3U8K1 (Fork-head domain-containing protein OS=Mesocestoides corti OX=53468 GN=MCOS_LOCUS3210 PE=4 SV=1)

HSP 1 Score: 123.25 bits (308), Expect = 2.112e-28
Identity = 69/145 (47.59%), Postives = 87/145 (60.00%), Query Frame = 3
Query:   57 MCAFDDSLTEIDWLNSLCIQKKSEIKEGNVISTTISP---YSLITTHHNSPNDNCNTSRIHGYDKPSYSYAYLIKLAIESSNSKKMKLNEIYSWISETFPYYKYMQKDNNKGWKNAIRHNLSLNKIFKRCAKDSSQLGKGSFWTI 482
            M   DDSLT +DWL +  I   S +K  NV    +S       ++ + NS  DN +       DKP YSYA LIK AIESS   KM LNEIY WI + FPYY+  Q     GWKN+IRHNLSLN++F++ A+ S + G+GSFW I
Sbjct:    1 MTEIDDSLTAMDWLVNPSIDIFSGLKLSNVFFDQVSQADSVDFVSGNRNSKPDNAHP------DKPPYSYAELIKKAIESSPQNKMTLNEIYEWICKNFPYYREGQ----NGWKNSIRHNLSLNRLFRKVARRSDEPGRGSFWRI 135          
BLAST of Fork-head domain-containing protein vs. TrEMBL
Match: Q3U3U9 (Fork-head domain-containing protein (Fragment) OS=Mus musculus OX=10090 GN=Foxj2 PE=2 SV=1)

HSP 1 Score: 113.62 bits (283), Expect = 1.799e-25
Identity = 65/149 (43.62%), Postives = 83/149 (55.70%), Query Frame = 3
Query:   66 FDDSLTEIDWLNSLCIQKKSEIKEGNVISTTISPYSLITTHHNSPNDNCNT-----SRIHGYDKPSYSYAYLIKLAIESSNSKKMKLNEIYSWISETFPYYKYMQKDNNKGWKNAIRHNLSLNKIFKRCAKDSSQLGKGSFWTIDSSLD 497
             + SLT IDWL  L +  ++ I++    S    P         SP D   T     + +H   KP YSYA LI  AI SS +KKM L+EIY WI + FPYY    K+   GWKN+IRHNLSLNK F++  +     GKGS+WTID+  D
Sbjct:    5 LESSLTSIDWLPQLTL--RATIEKLGSASQAGPPGGARKCSPGSPTDPNATLSKDEAAVHQDGKPRYSYATLITYAINSSPAKKMTLSEIYRWICDNFPYY----KNAGIGWKNSIRHNLSLNKCFRKVPRPRDDPGKGSYWTIDTCPD 147          
BLAST of Fork-head domain-containing protein vs. TrEMBL
Match: A0A0N4SWA4 (Forkhead box protein J2 (Fragment) OS=Mus musculus OX=10090 GN=Foxj2 PE=1 SV=1)

HSP 1 Score: 115.161 bits (287), Expect = 2.058e-25
Identity = 65/149 (43.62%), Postives = 83/149 (55.70%), Query Frame = 3
Query:   66 FDDSLTEIDWLNSLCIQKKSEIKEGNVISTTISPYSLITTHHNSPNDNCNT-----SRIHGYDKPSYSYAYLIKLAIESSNSKKMKLNEIYSWISETFPYYKYMQKDNNKGWKNAIRHNLSLNKIFKRCAKDSSQLGKGSFWTIDSSLD 497
             + SLT IDWL  L +  ++ I++    S    P         SP D   T     + +H   KP YSYA LI  AI SS +KKM L+EIY WI + FPYY    K+   GWKN+IRHNLSLNK F++  +     GKGS+WTID+  D
Sbjct:    5 LESSLTSIDWLPQLTL--RATIEKLGSASQAGPPGGARKCSPGSPTDPNATLSKDEAAVHQDGKPRYSYATLITYAINSSPAKKMTLSEIYRWICDNFPYY----KNAGIGWKNSIRHNLSLNKCFRKVPRPRDDPGKGSYWTIDTCPD 147          
BLAST of Fork-head domain-containing protein vs. TrEMBL
Match: A0A452Q7R9 (Fork-head domain-containing protein OS=Ursus americanus OX=9643 PE=4 SV=1)

HSP 1 Score: 113.62 bits (283), Expect = 6.283e-25
Identity = 65/149 (43.62%), Postives = 83/149 (55.70%), Query Frame = 3
Query:   66 FDDSLTEIDWLNSLCIQKKSEIKEGNVISTTISPYSLITTHHNSPNDNCNT-----SRIHGYDKPSYSYAYLIKLAIESSNSKKMKLNEIYSWISETFPYYKYMQKDNNKGWKNAIRHNLSLNKIFKRCAKDSSQLGKGSFWTIDSSLD 497
             + SLT IDWL  L +  ++ I++    S    P         SP D   T     + +H   KP YSYA LI  AI SS +KKM L+EIY WI + FPYY    K+   GWKN+IRHNLSLNK F++  +     GKGS+WTID+  D
Sbjct:   15 LESSLTSIDWLPQLTL--RATIEKLGSASQAGPPGGSRKCPPGSPTDPNATLSKDEAAVHQDGKPRYSYATLITYAINSSPAKKMTLSEIYRWICDNFPYY----KNAGIGWKNSIRHNLSLNKCFRKVPRPRDDPGKGSYWTIDTCPD 157          
BLAST of Fork-head domain-containing protein vs. TrEMBL
Match: A0A2I7MLF0 (Foxj2 OS=Andrias davidianus OX=141262 PE=2 SV=1)

HSP 1 Score: 120.939 bits (302), Expect = 6.389e-25
Identity = 67/159 (42.14%), Postives = 89/159 (55.97%), Query Frame = 3
Query:   66 FDDSLTEIDWLNSLCIQKKSEIKEGNVISTTISPYSLITTHHNSPND-----NCNTSRIHGYDKPSYSYAYLIKLAIESSNSKKMKLNEIYSWISETFPYYKYMQKDNNKGWKNAIRHNLSLNKIFKRCAKDSSQLGKGSFWTIDSSLDDDVQYPPVKK 527
             + SLT IDWL  L +  ++ +++G+       P         SP D     N   +  H   KP YSYA LI  AI SS++K+M L+EIY WI E FPYYK    +   GWKN+IRHNLSLNK F++  +     GKGS+WTID+   DD+  P  K+
Sbjct:    5 LESSLTSIDWLPQLTL--RATMEKGHAAQAHAGPRKGP----GSPTDPNAILNKEEAAAHRDGKPPYSYANLITYAINSSSAKRMTLSEIYRWICENFPYYK----NAGVGWKNSIRHNLSLNKCFRKVPRPRDDPGKGSYWTIDTCPKDDLTLPRRKR 153          
BLAST of Fork-head domain-containing protein vs. Ensembl Cavefish
Match: foxj2 (forkhead box protein J2 [Source:NCBI gene;Acc:103026648])

HSP 1 Score: 114.775 bits (286), Expect = 4.993e-26
Identity = 74/199 (37.19%), Postives = 102/199 (51.26%), Query Frame = 3
Query:   66 FDDSLTEIDWLNSLCI------QKKSEIKEGNVISTTISPYSLITTHHNSPNDNCNTSRIHGYDKPSYSYAYLIKLAIESSNSKKMKLNEIYSWISETFPYYKYMQKDNNKGWKNAIRHNLSLNKIFKRCAKDSSQLGKGSFWTIDSSLDDDVQYPPVKKMKLMLNSTETVRSSSIEKLDLIHSTEITQNISKEMPIPV 644
             D SLT IDWL  L I      ++++E K          P    T    SP  N          KP +SYA LI +AI S+  +K+ LN+IY+WIS+ FPYY        +GWKN+IRHNLSLNK F++  +  S  GKGS+WT+D  L     Y P  +      ST+ V   +I   +   ++E   NIS+  P+P+
Sbjct:    5 LDSSLTSIDWLPQLGISSLRSGKERAERKRERGRDPGAPPGVPST----SPPPNAK-------GKPPHSYATLIAMAIGSAPERKLSLNDIYTWISDMFPYYSRA----GRGWKNSIRHNLSLNKCFRKVPRPQSDPGKGSYWTMDGPL-----YQPQPRGVKRPYSTDEVEEETIP--ENTPTSEDKPNISQIEPLPL 181          
BLAST of Fork-head domain-containing protein vs. Ensembl Cavefish
Match: foxj3 (forkhead box J3 [Source:NCBI gene;Acc:103033658])

HSP 1 Score: 106.686 bits (265), Expect = 1.215e-23
Identity = 59/150 (39.33%), Postives = 81/150 (54.00%), Query Frame = 3
Query:   66 FDDSLTEIDWLNSLCIQKKSEIKEG-NVISTTISPYSLITTHHNSPNDNCNTSRI--HGYDKPSYSYAYLIKLAIESSNSKKMKLNEIYSWISETFPYYKYMQKDNNKGWKNAIRHNLSLNKIFKRCAKDSSQLGKGSFWTIDSSLDDDV 506
             + SLT +DWL  L ++   +  +  N     ++  S +      PN   +   +  H   KP YSYA LI  AI SS  KKM L+EIY WI + FPYY    ++   GWKN+IRHNLSLNK F +  +     GKGS+W ID++  +D 
Sbjct:   15 LESSLTSMDWLPQLTMRAAIQKADAQNAHGPGMAKKSALL----DPNTTLDQEEVQQHKDGKPPYSYASLITFAINSSPKKKMTLSEIYQWICDNFPYY----REAGSGWKNSIRHNLSLNKCFLKVPRSKDDPGKGSYWAIDTNPKEDT 156          
BLAST of Fork-head domain-containing protein vs. Ensembl Cavefish
Match: foxj3 (forkhead box J3 [Source:NCBI gene;Acc:103033658])

HSP 1 Score: 107.071 bits (266), Expect = 1.384e-23
Identity = 59/150 (39.33%), Postives = 81/150 (54.00%), Query Frame = 3
Query:   66 FDDSLTEIDWLNSLCIQKKSEIKEG-NVISTTISPYSLITTHHNSPNDNCNTSRI--HGYDKPSYSYAYLIKLAIESSNSKKMKLNEIYSWISETFPYYKYMQKDNNKGWKNAIRHNLSLNKIFKRCAKDSSQLGKGSFWTIDSSLDDDV 506
             + SLT +DWL  L ++   +  +  N     ++  S +      PN   +   +  H   KP YSYA LI  AI SS  KKM L+EIY WI + FPYY    ++   GWKN+IRHNLSLNK F +  +     GKGS+W ID++  +D 
Sbjct:    5 LESSLTSMDWLPQLTMRAAIQKADAQNAHGPGMAKKSALL----DPNTTLDQEEVQQHKDGKPPYSYASLITFAINSSPKKKMTLSEIYQWICDNFPYY----REAGSGWKNSIRHNLSLNKCFLKVPRSKDDPGKGSYWAIDTNPKEDT 146          
BLAST of Fork-head domain-containing protein vs. Ensembl Cavefish
Match: foxc1b (forkhead box C1b [Source:NCBI gene;Acc:79375])

HSP 1 Score: 95.1301 bits (235), Expect = 8.200e-22
Identity = 42/82 (51.22%), Postives = 59/82 (71.95%), Query Frame = 3
Query:  240 KPSYSYAYLIKLAIESSNSKKMKLNEIYSWISETFPYYKYMQKDNNKGWKNAIRHNLSLNKIFKRCAKDSSQLGKGSFWTID 485
            KP YSY  LI +AI+SS  K++ LN IY +I E FP+Y+    +N +GW+N+IRHNLSLN+ F +  +D  + GKGS+WT+D
Sbjct:   72 KPPYSYIALITMAIQSSAEKRVTLNGIYQFIMERFPFYR----ENKQGWQNSIRHNLSLNECFVKVPRDDKKPGKGSYWTLD 149          
BLAST of Fork-head domain-containing protein vs. Ensembl Cavefish
Match: foxn3 (forkhead box N3 [Source:NCBI gene;Acc:103032353])

HSP 1 Score: 97.0561 bits (240), Expect = 7.231e-21
Identity = 56/144 (38.89%), Postives = 88/144 (61.11%), Query Frame = 3
Query:   69 DDSLTEIDWLNSLCIQKKSEIKE-GNVISTTISPYSLI---TTHHNSPNDNCNTSRIHGYDKPSYSYAYLIKLAIESSNSKKMKLNEIYSWISETFPYYKYMQKDNNKGWKNAIRHNLSLNKIFKRCAKDSSQ-LGKGSFWTID 485
            D+ LT ++WL+    + K+ +   G+ +  ++SP   +   T    +P+D    ++ +   KP YS++ LI +AIE + SK++ + +IY+WI E FPY+     +   GWKN++RHNLSLNK FK+  KD SQ +GKGS W ID
Sbjct:   59 DEELTNLNWLH----ESKNLLNSFGDPVLRSVSPVQELDDDTPPSPAPSDLPYDAKQNPNCKPPYSFSCLIFMAIEDAPSKRLPVKDIYNWILEHFPYF----ANAPTGWKNSVRHNLSLNKCFKKVDKDRSQSIGKGSLWCID 194          
BLAST of Fork-head domain-containing protein vs. Ensembl Sea Lamprey
Match: foxj3 (forkhead box J3 [Source:ZFIN;Acc:ZDB-GENE-101005-1])

HSP 1 Score: 100.908 bits (250), Expect = 1.381e-22
Identity = 50/98 (51.02%), Postives = 61/98 (62.24%), Query Frame = 3
Query:  210 CNTSRIHGYDKPSYSYAYLIKLAIESSNSKKMKLNEIYSWISETFPYYKYMQKDNNKGWKNAIRHNLSLNKIFKRCAKDSSQLGKGSFWTIDSSLDDD 503
            C+T    G  KP YSYA LI  AI SS  K+M L+EIY WI + FPYY    K+   GWKN+IRHNLSLNK F +  +     GKGS+W ID +  D+
Sbjct:   60 CSTGSKDG--KPPYSYANLITFAINSSARKRMTLSEIYQWICDNFPYY----KEAGIGWKNSIRHNLSLNKCFIKVPRSRDDPGKGSYWAIDQNPSDE 151          
BLAST of Fork-head domain-containing protein vs. Ensembl Sea Lamprey
Match: FOXC2 (forkhead box C2 [Source:HGNC Symbol;Acc:HGNC:3801])

HSP 1 Score: 90.5077 bits (223), Expect = 2.103e-21
Identity = 46/116 (39.66%), Postives = 70/116 (60.34%), Query Frame = 3
Query:  138 GNVISTTISPYSLITTHHNSPNDNCNTSRIHGYDKPSYSYAYLIKLAIESSNSKKMKLNEIYSWISETFPYYKYMQKDNNKGWKNAIRHNLSLNKIFKRCAKDSSQLGKGSFWTID 485
            G   +    PYS   + H  P  + + +      KP YSY  LI +AI+S+  KK+ LN IY +I + FP+Y+    +N +GW+N+IRHNLSLN+ F +  +D  + GKGS+W++D
Sbjct:   44 GMYSAANADPYSAGLSRHYGPYSHPHQAP-KDLVKPPYSYIALITMAIQSAPDKKVTLNGIYQFIMDKFPFYR----ENKQGWQNSIRHNLSLNECFVKVPRDDKKPGKGSYWSLD 154          
BLAST of Fork-head domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002547.1 (pep scaffold:Pmarinus_7.0:GL485262:1354:7435:1 gene:ENSPMAG00000002324.1 transcript:ENSPMAT00000002547.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 90.8929 bits (224), Expect = 8.788e-21
Identity = 40/82 (48.78%), Postives = 57/82 (69.51%), Query Frame = 3
Query:  240 KPSYSYAYLIKLAIESSNSKKMKLNEIYSWISETFPYYKYMQKDNNKGWKNAIRHNLSLNKIFKRCAKDSSQLGKGSFWTID 485
            KP YSY  LI +AI++S   +  L+ IY +I+  FP+Y+    +N +GW+N+IRHNLSLN+ F   A+D  + GKGSFWT+D
Sbjct:   26 KPPYSYIALIAMAIQNSAEGRATLSAIYQFIAGRFPFYR----ENKQGWQNSIRHNLSLNECFVTVARDDRRPGKGSFWTLD 103          
BLAST of Fork-head domain-containing protein vs. Ensembl Sea Lamprey
Match: foxk1 (forkhead box K1 [Source:ZFIN;Acc:ZDB-GENE-030131-6402])

HSP 1 Score: 93.5893 bits (231), Expect = 3.256e-20
Identity = 42/84 (50.00%), Postives = 59/84 (70.24%), Query Frame = 3
Query:  240 KPSYSYAYLIKLAIESSNSKKMKLNEIYSWISETFPYYKYMQKDNNKGWKNAIRHNLSLNKIFKRCAKDSSQLGKGSFWTIDSS 491
            KP YSYA LI  AI S+ SK++ L+ IY++IS+ +PYY+     ++KGW+N+IRHNLSLN+ F +  +     GKGSFW ID +
Sbjct:  199 KPPYSYAQLIVQAITSAASKQLTLSGIYAYISKHYPYYR----ASDKGWQNSIRHNLSLNRYFVKVPRSQEDPGKGSFWRIDPA 278          
BLAST of Fork-head domain-containing protein vs. Ensembl Sea Lamprey
Match: foxk1 (forkhead box K1 [Source:ZFIN;Acc:ZDB-GENE-030131-6402])

HSP 1 Score: 93.5893 bits (231), Expect = 3.340e-20
Identity = 42/84 (50.00%), Postives = 59/84 (70.24%), Query Frame = 3
Query:  240 KPSYSYAYLIKLAIESSNSKKMKLNEIYSWISETFPYYKYMQKDNNKGWKNAIRHNLSLNKIFKRCAKDSSQLGKGSFWTIDSS 491
            KP YSYA LI  AI S+ SK++ L+ IY++IS+ +PYY+     ++KGW+N+IRHNLSLN+ F +  +     GKGSFW ID +
Sbjct:  199 KPPYSYAQLIVQAITSAASKQLTLSGIYAYISKHYPYYR----ASDKGWQNSIRHNLSLNRYFVKVPRSQEDPGKGSFWRIDPA 278          
BLAST of Fork-head domain-containing protein vs. Ensembl Yeast
Match: HCM1 (Forkhead transcription factor; drives S-phase activation of genes involved in chromosome segregation, spindle dynamics, budding; also activates genes involved in respiration, use of alternative energy sources (like proline), NAD synthesis, oxidative stress resistance; key factor in early adaptation to nutrient deficiency and diauxic shift; suppressor of calmodulin mutants with specific SPB assembly defects; ortholog of C. elegans lifespan regulator PHA-4 [Source:SGD;Acc:S000000661])

HSP 1 Score: 80.4925 bits (197), Expect = 3.734e-16
Identity = 46/89 (51.69%), Postives = 54/89 (60.67%), Query Frame = 3
Query:  222 RIHG--YDKPSYSYAYLIKLAIESSNSKKMKLNEIYSWISETFPYYKYMQKDNNKGWKNAIRHNLSLNKIFKRCAKDSSQLGKGSFWTI 482
            RI+G    KP YSYA LI LAI  S   K+ L++IY WI   FPYYK  QKD    W+N+IRHNLSLN  F +  K     GKG FW +
Sbjct:  101 RINGELAKKPPYSYATLICLAILQSQEGKLTLSQIYHWIHVHFPYYK--QKD--ASWQNSIRHNLSLNDAFIKTEKSCD--GKGHFWEV 183          
BLAST of Fork-head domain-containing protein vs. Ensembl Yeast
Match: FHL1 (Regulator of ribosomal protein (RP) transcription; has forkhead associated domain that binds phosphorylated proteins; recruits coactivator Ifh1p or corepressor Crf1p to RP gene promoters; also has forkhead DNA-binding domain though in vitro DNA binding assays give inconsistent results; computational analyses suggest it binds DNA directly at highly active RP genes and indirectly through Rap1p motifs at others; suppresses RNA pol III and splicing factor prp4 mutants [Source:SGD;Acc:S000006308])

HSP 1 Score: 75.8702 bits (185), Expect = 1.493e-14
Identity = 37/83 (44.58%), Postives = 53/83 (63.86%), Query Frame = 3
Query:  240 KPSYSYAYLIKLAIES-SNSKKMKLNEIYSWISETFPYYKYMQKDNNKGWKNAIRHNLSLNKIFKRCAKDSSQLGKGSFWTID 485
            KP+ SY+ ++   I   S +K M L+EIY+ I E FPYYKY       GW++++RHNLSLNK F++ +K+    GKG  W +D
Sbjct:  461 KPTVSYSAMLTTCIRKYSTAKGMSLSEIYAGIRELFPYYKYCP----DGWQSSVRHNLSLNKSFRKVSKE----GKGWLWGLD 535          
BLAST of Fork-head domain-containing protein vs. Ensembl Yeast
Match: FKH1 (Forkhead family transcription factor; rate-limiting replication origin activator; evolutionarily conserved lifespan regulator; binds multiple chromosomal elements with distinct specificities, cell cycle dynamics; regulates transcription elongation, chromatin silencing at mating loci, expression of G2/M phase genes; facilitates clustering, activation of early-firing replication origins; binds HML recombination enhancer, regulates donor preference during mating-type switching [Source:SGD;Acc:S000001393])

HSP 1 Score: 74.3294 bits (181), Expect = 2.347e-14
Identity = 36/90 (40.00%), Postives = 53/90 (58.89%), Query Frame = 3
Query:  234 YDKPSYSYAYLIKLAIESSNSKKMKLNEIYSWISETFPYYKYMQKDNNKGWKNAIRHNLSLNKIFKRCAKDSSQLGKGSFWTIDSSLDDD 503
            Y KP  SYA +I  AI S+    + L +IY +IS+ + +Y++ Q      W+N++RHNLSLNK F++  K + Q GKG  W I   +  D
Sbjct:  301 YIKPPQSYASMITQAILSTPEGSISLADIYKFISDNYAFYRFSQM----AWQNSVRHNLSLNKAFEKVPKRAGQQGKGMNWKISDEVRRD 386          
BLAST of Fork-head domain-containing protein vs. Ensembl Yeast
Match: FKH2 (Forkhead family transcription factor; rate-limiting activator of replication origins; evolutionarily conserved regulator of lifespan; binds multiple chromosomal elements with distinct specificities, cell cycle dynamics; positively regulates transcriptional elongation; facilitates clustering, activation of early-firing replication origins; negative role in chromatin silencing at HML and HMR; major role in expression of G2/M phase genes; relocalizes to cytosol under hypoxia [Source:SGD;Acc:S000005012])

HSP 1 Score: 74.3294 bits (181), Expect = 3.968e-14
Identity = 36/84 (42.86%), Postives = 52/84 (61.90%), Query Frame = 3
Query:  240 KPSYSYAYLIKLAIESSNSKKMKLNEIYSWISETFPYYKYMQKDNNKGWKNAIRHNLSLNKIFKRCAKDSSQLGKGSFWTIDSS 491
            KP +SYA +I  AI SS    + L +IY +IS  + YY++ +     GW+N+IRHNLSLNK F++  +  ++ GKG  W I  S
Sbjct:  340 KPPHSYATMITQAILSSPEGVISLADIYKYISSNYAYYRFAKS----GWQNSIRHNLSLNKAFEKVPRRPNEPGKGMKWRISES 419          
BLAST of Fork-head domain-containing protein vs. Ensembl Nematostella
Match: EDO49084 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RI36])

HSP 1 Score: 92.0485 bits (227), Expect = 1.441e-22
Identity = 43/86 (50.00%), Postives = 60/86 (69.77%), Query Frame = 3
Query:  240 KPSYSYAYLIKLAIESSNSKKMKLNEIYSWISETFPYYKYMQKDNNKGWKNAIRHNLSLNKIFKRCAKDSSQ-LGKGSFWTIDSSL 494
            KP YS++ LI +AIE S +K++ + +IY+WI + FPY+    +D   GWKN++RHNLSLNK FK+  KD  Q +GKGS WT+D   
Sbjct:    2 KPPYSFSSLIFMAIEESPNKRLPVKDIYNWIMDHFPYF----RDARLGWKNSVRHNLSLNKCFKKVDKDKGQNVGKGSLWTVDPDF 83          
BLAST of Fork-head domain-containing protein vs. Ensembl Nematostella
Match: EDO46828 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RP00])

HSP 1 Score: 88.5817 bits (218), Expect = 2.872e-21
Identity = 40/88 (45.45%), Postives = 60/88 (68.18%), Query Frame = 3
Query:  237 DKPSYSYAYLIKLAIESSNSKKMKLNEIYSWISETFPYYKYMQKDNNKGWKNAIRHNLSLNKIFKRCAKDSSQLGKGSFWTIDSSLDD 500
            +KP++SY  LI +AI  S  K++ L+ IY +I + FPYY+    +N +GW+N+IRHNLSLNK F +  ++    GKG++W +D S DD
Sbjct:    1 EKPAFSYNALIMMAIRGSEEKRLTLSGIYEYIMKNFPYYR----NNKQGWQNSIRHNLSLNKCFVKVPRNYDDPGKGNYWMLDPSADD 84          
BLAST of Fork-head domain-containing protein vs. Ensembl Nematostella
Match: EDO42654 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S0W7])

HSP 1 Score: 87.0409 bits (214), Expect = 8.887e-21
Identity = 40/87 (45.98%), Postives = 58/87 (66.67%), Query Frame = 3
Query:  240 KPSYSYAYLIKLAIESSNSKKMKLNEIYSWISETFPYYKYMQKDNNKGWKNAIRHNLSLNKIFKRCAKDSSQLGKGSFWTIDSSLDD 500
            KP YSY  LI +AI+ S  +K+ L+ IY +I E FPYY+     N +GW+N+IRHNLSLNK F +  ++ S  GKG +W +D + ++
Sbjct:    3 KPPYSYVALISMAIKQSKGQKITLSGIYQFIIENFPYYRL----NKRGWQNSIRHNLSLNKCFVKIPRERSDPGKGCYWALDPAYEE 85          
BLAST of Fork-head domain-containing protein vs. Ensembl Nematostella
Match: EDO36951 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SH30])

HSP 1 Score: 86.2705 bits (212), Expect = 2.008e-20
Identity = 42/98 (42.86%), Postives = 62/98 (63.27%), Query Frame = 3
Query:  240 KPSYSYAYLIKLAIESSNSKKMKLNEIYSWISETFPYYKYMQKDNNKGWKNAIRHNLSLNKIFKRCAKDSSQLGKGSFWTIDSSLDDDVQYPPVKKMK 533
            KP YSYA LI  AI S+  K++ L+ IY+ I++ +PYY+      +KGW+N+IRHNLSLN+ F +  +   + GKGSFW ID S +  +     +K +
Sbjct:    4 KPPYSYAQLIVQAILSATDKQLTLSGIYAHITKNYPYYRTA----DKGWQNSIRHNLSLNRYFVKVPRAQDEPGKGSFWRIDPSCEQKLAEQAFRKRR 97          
BLAST of Fork-head domain-containing protein vs. Ensembl Nematostella
Match: EDO33900 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SQU5])

HSP 1 Score: 93.9745 bits (232), Expect = 2.590e-20
Identity = 41/82 (50.00%), Postives = 59/82 (71.95%), Query Frame = 3
Query:  240 KPSYSYAYLIKLAIESSNSKKMKLNEIYSWISETFPYYKYMQKDNNKGWKNAIRHNLSLNKIFKRCAKDSSQLGKGSFWTID 485
            KP YSY  LI +AI+S+  K++ L+ IYS+I + FPYY+    +N +GW+N+IRHNLSLN+ F +  +D  + GKGSFW +D
Sbjct:   79 KPPYSYIALIAMAIQSAPEKRITLSGIYSFIMDRFPYYR----NNKQGWQNSIRHNLSLNECFVKVPRDDKKPGKGSFWMLD 156          
BLAST of Fork-head domain-containing protein vs. Ensembl Medaka
Match: FOXJ3 (forkhead box protein J3 [Source:NCBI gene;Acc:101158100])

HSP 1 Score: 111.309 bits (277), Expect = 5.009e-25
Identity = 62/152 (40.79%), Postives = 84/152 (55.26%), Query Frame = 3
Query:   66 FDDSLTEIDWLNSLCIQ---KKSEIKEGNVISTTISPYSLITTHHNSPNDNCNTSRI--HGYDKPSYSYAYLIKLAIESSNSKKMKLNEIYSWISETFPYYKYMQKDNNKGWKNAIRHNLSLNKIFKRCAKDSSQLGKGSFWTIDSSLDDDV 506
             + SLT +DWL  L +Q   +K++ +  N     +   S +  H    N   +   +  H   KP YSYA LI  AI SS  KKM L+EIY WI + FPYY+    +   GWKN+IRHNLSLNK F + A+     GKGS+W ID++  +D 
Sbjct:    5 LESSLTSMDWLPQLTMQAAIRKADAQ--NAHGPGMGKKSTLLDH----NTTLDQEEVQQHKDGKPPYSYASLITFAINSSPKKKMTLSEIYQWICDNFPYYR----EAGSGWKNSIRHNLSLNKCFLKVARSKDDPGKGSYWAIDTNPKEDA 146          
BLAST of Fork-head domain-containing protein vs. Ensembl Medaka
Match: foxj2 (forkhead box protein J2 [Source:NCBI gene;Acc:101166414])

HSP 1 Score: 108.612 bits (270), Expect = 3.619e-24
Identity = 46/88 (52.27%), Postives = 62/88 (70.45%), Query Frame = 3
Query:  240 KPSYSYAYLIKLAIESSNSKKMKLNEIYSWISETFPYYKYMQKDNNKGWKNAIRHNLSLNKIFKRCAKDSSQLGKGSFWTIDSSLDDD 503
            KP +SYA LI +AI ++  K++ LN+IY+WIS+TFPYY        +GWKN+IRHNLSLNK F++  +  S  GKGS+WT+D   D D
Sbjct:   62 KPPHSYATLIAMAIAAAPEKRLSLNDIYTWISDTFPYYSRA----GRGWKNSIRHNLSLNKCFRKVPRPQSDPGKGSYWTMDGPSDAD 145          
BLAST of Fork-head domain-containing protein vs. Ensembl Medaka
Match: foxj2 (forkhead box protein J2 [Source:NCBI gene;Acc:101166414])

HSP 1 Score: 108.612 bits (270), Expect = 3.619e-24
Identity = 46/88 (52.27%), Postives = 62/88 (70.45%), Query Frame = 3
Query:  240 KPSYSYAYLIKLAIESSNSKKMKLNEIYSWISETFPYYKYMQKDNNKGWKNAIRHNLSLNKIFKRCAKDSSQLGKGSFWTIDSSLDDD 503
            KP +SYA LI +AI ++  K++ LN+IY+WIS+TFPYY        +GWKN+IRHNLSLNK F++  +  S  GKGS+WT+D   D D
Sbjct:   62 KPPHSYATLIAMAIAAAPEKRLSLNDIYTWISDTFPYYSRA----GRGWKNSIRHNLSLNKCFRKVPRPQSDPGKGSYWTMDGPSDAD 145          
BLAST of Fork-head domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000031716.1 (forkhead box protein J3 [Source:NCBI gene;Acc:101156973])

HSP 1 Score: 97.8265 bits (242), Expect = 6.903e-23
Identity = 58/154 (37.66%), Postives = 75/154 (48.70%), Query Frame = 3
Query:   66 FDDSLTEIDWLNSLCIQKKSEIKEGNVISTTISPYSLITTH-----HNSPNDNCNTSRI--HGYDKPSYSYAYLIKLAIESSNSKKMKLNEIYSWISETFPYYKYMQKDNNKGWKNAIRHNLSLNKIFKRCAKDSSQLGKGSFWTIDSSLDDDV 506
             + SLT +DWL  L ++              I    L   H     H  P    +      H   KP YSYA LI  AI  S  K+M L+EIY WI + FPYY+    +   GWKN+IRHNLSLNK F +  +     GKGS+W ID++  +D 
Sbjct:   23 LESSLTSMDWLPQLSMR------------AAIQKVDLRNHHGKKMVHLDPGTTLDQEEAAQHRDGKPPYSYASLITFAINGSPRKRMTLSEIYQWICDNFPYYR----EAGSGWKNSIRHNLSLNKCFLKVPRSKDDPGKGSYWAIDNNPKEDT 160          
BLAST of Fork-head domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000042706.1 (forkhead box protein J3 [Source:NCBI gene;Acc:101156973])

HSP 1 Score: 98.5969 bits (244), Expect = 5.630e-21
Identity = 46/93 (49.46%), Postives = 58/93 (62.37%), Query Frame = 3
Query:  228 HGYDKPSYSYAYLIKLAIESSNSKKMKLNEIYSWISETFPYYKYMQKDNNKGWKNAIRHNLSLNKIFKRCAKDSSQLGKGSFWTIDSSLDDDV 506
            H   KP YSYA LI  AI  S  K+M L+EIY WI + FPYY+    +   GWKN+IRHNLSLNK F +  +     GKGS+W ID++  +D 
Sbjct:   73 HRDGKPPYSYASLITFAINGSPRKRMTLSEIYQWICDNFPYYR----EAGSGWKNSIRHNLSLNKCFLKVPRSKDDPGKGSYWAIDNNPKEDT 161          
BLAST of Fork-head domain-containing protein vs. Planmine SMEST
Match: SMESG000044628.1 (SMESG000044628.1)

HSP 1 Score: 995.727 bits (2573), Expect = 0.000e+0
Identity = 504/505 (99.80%), Postives = 504/505 (99.80%), Query Frame = 3
Query:   57 MCAFDDSLTEIDWLNSLCIQKKSEIKEGNVISTTISPYSLITTHHNSPNDNCNTSRIHGYDKPSYSYAYLIKLAIESSNSKKMKLNEIYSWISETFPYYKYMQKDNNKGWKNAIRHNLSLNKIFKRCAKDSSQLGKGSFWTIDSSLDDDVQYPPVKKMKLMLNSTETVRSSSIEKLDLIHSTEITQNISKEMPIPVSIVYTXXXXXXXXXXXXXXXXATPMSNISTSSLEMMPEKTQITFATLESRVLPNNSAFTVYSNEIENHNFSKEPCNDLGYSCQISYSNQPIYRNCLFKSNVSTTELNPMLSTVECSREILHPKVLNKHLNSDPISSKNDLFTDKLEVDEDIMSVKSANNDFVVKTPVLSQINSQPVELGGNNSEIKEVYEENELTKGSLRDSHLISSLPQDTIDNLNSFDNLSFYDSFASIPQPLFDSESRSFELSQSTRKYLYNLSGVKENLLHRSQWLDLQEEDYQNQSLSETFFETLRSEEMRRNYKAETYPDSPN 1571
            MCAFDDSLTEIDWLNSLCIQKKSEIKEGNVISTTISPYSLITTHHNSPNDNCNTSRIHGYDKPSYSYAYLIKLAIESSNSKKMKLNEIYSWISETFPYYKYMQKDNNKGWKNAIRHNLSLNKIFKRCAKDSSQLGKGSFWTIDSSLDDDVQYPPVKKMKLMLNSTETVRSSSIEKLDLIHSTEITQNISKEM IPVSIVYTLLSSSSNNEYNLNESSATPMSNISTSSLEMMPEKTQITFATLESRVLPNNSAFTVYSNEIENHNFSKEPCNDLGYSCQISYSNQPIYRNCLFKSNVSTTELNPMLSTVECSREILHPKVLNKHLNSDPISSKNDLFTDKLEVDEDIMSVKSANNDFVVKTPVLSQINSQPVELGGNNSEIKEVYEENELTKGSLRDSHLISSLPQDTIDNLNSFDNLSFYDSFASIPQPLFDSESRSFELSQSTRKYLYNLSGVKENLLHRSQWLDLQEEDYQNQSLSETFFETLRSEEMRRNYKAETYPDSPN
Sbjct:    1 MCAFDDSLTEIDWLNSLCIQKKSEIKEGNVISTTISPYSLITTHHNSPNDNCNTSRIHGYDKPSYSYAYLIKLAIESSNSKKMKLNEIYSWISETFPYYKYMQKDNNKGWKNAIRHNLSLNKIFKRCAKDSSQLGKGSFWTIDSSLDDDVQYPPVKKMKLMLNSTETVRSSSIEKLDLIHSTEITQNISKEMSIPVSIVYTLLSSSSNNEYNLNESSATPMSNISTSSLEMMPEKTQITFATLESRVLPNNSAFTVYSNEIENHNFSKEPCNDLGYSCQISYSNQPIYRNCLFKSNVSTTELNPMLSTVECSREILHPKVLNKHLNSDPISSKNDLFTDKLEVDEDIMSVKSANNDFVVKTPVLSQINSQPVELGGNNSEIKEVYEENELTKGSLRDSHLISSLPQDTIDNLNSFDNLSFYDSFASIPQPLFDSESRSFELSQSTRKYLYNLSGVKENLLHRSQWLDLQEEDYQNQSLSETFFETLRSEEMRRNYKAETYPDSPN 505          
BLAST of Fork-head domain-containing protein vs. Planmine SMEST
Match: SMESG000044628.1 (SMESG000044628.1)

HSP 1 Score: 825.854 bits (2132), Expect = 0.000e+0
Identity = 436/505 (86.34%), Postives = 439/505 (86.93%), Query Frame = 3
Query:   57 MCAFDDSLTEIDWLNSLCIQKKSEIKEGNVISTTISPYSLITTHHNSPNDNCNTSRIHGYDKPSYSYAYLIKLAIESSNSKKMKLNEIYSWISETFPYYKYMQKDNNKGWKNAIRHNLSLNKIFKRCAKDSSQLGKGSFWTIDSSLDDDVQYPPVKKMKLMLNSTETVRSSSIEKLDLIHSTEITQNISKEMPIPVSIVYTXXXXXXXXXXXXXXXXATPMSNISTSSLEMMPEKTQITFATLESRVLPNNSAFTVYSNEIENHNFSKEPCNDLGYSCQISYSNQPIYRNCLFKSNVSTTELNPMLSTVECSREILHPKVLNKHLNSDPISSKNDLFTDKLEVDEDIMSVKSANNDFVVKTPVLSQINSQPVELGGNNSEIKEVYEENELTKGSLRDSHLISSLPQDTIDNLNSFDNLSFYDSFASIPQPLFDSESRSFELSQSTRKYLYNLSGVKENLLHRSQWLDLQEEDYQNQSLSETFFETLRSEEMRRNYKAETYPDSPN 1571
            MCAFDDSLTEIDWLNSLCIQKKSEIKEGNVISTTISPYSLITTHHNSPNDNCNTSRIHGYDKPSYSYAYLIKLAIESSNSKKMKLNEIYSWISETFPYYKYMQKDNNKGWKNAIRHNLSLNKIFKRCAKDSSQLGKGSFWTIDSSLDDDVQYPPVKKMKLMLNSTETVRSSSIEKLDLIHSTEITQNISKEM IPVSIVYTLLSSSSNNEYNLNESSATPMSNISTSSLEMMPEKTQITFATLESRVLPNNSAFTVYSNEIENHNFSKEPCNDLGYSCQISY                          +E   +I+  K  N                                NDFVVKTPVLSQINSQPVELGGNNSEIKEVYEENELTKGSLRDSHLISSLPQDTIDNLNSFDNLSFYDSFASIPQPLFDSESRSFELSQSTRKYLYNLSGVKENLLHRSQWLDLQEEDYQNQSLSETFFETLRSEEMRRNYKAETYPDSPN
Sbjct:    1 MCAFDDSLTEIDWLNSLCIQKKSEIKEGNVISTTISPYSLITTHHNSPNDNCNTSRIHGYDKPSYSYAYLIKLAIESSNSKKMKLNEIYSWISETFPYYKYMQKDNNKGWKNAIRHNLSLNKIFKRCAKDSSQLGKGSFWTIDSSLDDDVQYPPVKKMKLMLNSTETVRSSSIEKLDLIHSTEITQNISKEMSIPVSIVYTLLSSSSNNEYNLNESSATPMSNISTSSLEMMPEKTQITFATLESRVLPNNSAFTVYSNEIENHNFSKEPCNDLGYSCQISY--------------------------LEVDEDIMSVKSAN--------------------------------NDFVVKTPVLSQINSQPVELGGNNSEIKEVYEENELTKGSLRDSHLISSLPQDTIDNLNSFDNLSFYDSFASIPQPLFDSESRSFELSQSTRKYLYNLSGVKENLLHRSQWLDLQEEDYQNQSLSETFFETLRSEEMRRNYKAETYPDSPN 447          
BLAST of Fork-head domain-containing protein vs. Planmine SMEST
Match: SMESG000010270.1 (SMESG000010270.1)

HSP 1 Score: 94.7449 bits (234), Expect = 2.434e-21
Identity = 43/95 (45.26%), Postives = 64/95 (67.37%), Query Frame = 3
Query:  216 TSRIHGYDKPSYSYAYLIKLAIESSNSKKMKLNEIYSWISETFPYYKYMQKDNNKGWKNAIRHNLSLNKIFKRCAKDSSQLGKGSFWTIDSSLDD 500
            +S I G++KP +SY  LI +AI +S+ K++ LN IY +I   FPYYK    +N +GW+N+IRHNLSLNK F +  +     GKG++W +D + +D
Sbjct:   37 SSTIAGHEKPPFSYNALIMMAIRNSDQKRLTLNGIYEFIMRNFPYYK----NNKQGWQNSIRHNLSLNKCFIKVPRGYDDPGKGNYWMVDPACED 127          
BLAST of Fork-head domain-containing protein vs. Planmine SMEST
Match: SMESG000061695.1 (SMESG000061695.1)

HSP 1 Score: 95.9005 bits (237), Expect = 4.772e-20
Identity = 44/118 (37.29%), Postives = 74/118 (62.71%), Query Frame = 3
Query:  228 HGYD--KPSYSYAYLIKLAIESSNSKKMKLNEIYSWISETFPYYKYMQKDNNKGWKNAIRHNLSLNKIFKRCAKDSSQLGKGSFWTIDSSLDDDVQYPPVKKMKLMLNSTETVRSSSI 575
            HG D  KP YSYA LI  A+ ++  +++ LN IY++IS+ +PY+K     ++KGW+N++RHNLSLN+ F +  +   + GKGSFW +D + ++ +     +K +L  N++  V    +
Sbjct:  289 HGSDTQKPPYSYAQLIVQAVSTARDRQLTLNGIYNYISKNYPYFKA----HDKGWQNSVRHNLSLNRYFIKVPRGQDEPGKGSFWRVDPAYENKLIAQAFRKRRLRNNASGIVNEDGL 402          
BLAST of Fork-head domain-containing protein vs. Planmine SMEST
Match: SMESG000061695.1 (SMESG000061695.1)

HSP 1 Score: 95.9005 bits (237), Expect = 4.819e-20
Identity = 44/118 (37.29%), Postives = 74/118 (62.71%), Query Frame = 3
Query:  228 HGYD--KPSYSYAYLIKLAIESSNSKKMKLNEIYSWISETFPYYKYMQKDNNKGWKNAIRHNLSLNKIFKRCAKDSSQLGKGSFWTIDSSLDDDVQYPPVKKMKLMLNSTETVRSSSI 575
            HG D  KP YSYA LI  A+ ++  +++ LN IY++IS+ +PY+K     ++KGW+N++RHNLSLN+ F +  +   + GKGSFW +D + ++ +     +K +L  N++  V    +
Sbjct:  306 HGSDTQKPPYSYAQLIVQAVSTARDRQLTLNGIYNYISKNYPYFKA----HDKGWQNSVRHNLSLNRYFIKVPRGQDEPGKGSFWRVDPAYENKLIAQAFRKRRLRNNASGIVNEDGL 419          
The following BLAST results are available for this feature:
BLAST of Fork-head domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
FOXJ31.058e-2638.71forkhead box J3 [Source:HGNC Symbol;Acc:HGNC:29178... [more]
FOXJ23.204e-2644.30forkhead box J2 [Source:HGNC Symbol;Acc:HGNC:24818... [more]
FOXJ23.393e-2644.30forkhead box J2 [Source:HGNC Symbol;Acc:HGNC:24818... [more]
FOXJ36.268e-2638.17forkhead box J3 [Source:HGNC Symbol;Acc:HGNC:29178... [more]
FOXJ31.433e-2541.77forkhead box J3 [Source:HGNC Symbol;Acc:HGNC:29178... [more]
back to top
BLAST of Fork-head domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fkh-27.861e-2043.33ForKHead transcription factor family [Source:UniP... [more]
pha-49.500e-2048.24Defective pharyngeal development protein 4 [Sourc... [more]
pha-41.072e-1948.24Defective pharyngeal development protein 4 [Sourc... [more]
pha-41.197e-1948.24Defective pharyngeal development protein 4 [Sourc... [more]
fkh-62.205e-1845.88ForKHead transcription factor family [Source:UniP... [more]
back to top
BLAST of Fork-head domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
croc1.471e-2153.66gene:FBgn0014143 transcript:FBtr0078395[more]
FoxK2.970e-2051.81gene:FBgn0036134 transcript:FBtr0332653[more]
FoxK2.975e-2051.81gene:FBgn0036134 transcript:FBtr0300783[more]
FoxK2.975e-2051.81gene:FBgn0036134 transcript:FBtr0300784[more]
FoxK2.975e-2051.81gene:FBgn0036134 transcript:FBtr0300786[more]
back to top
BLAST of Fork-head domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
foxj23.207e-2540.79forkhead box J2 [Source:ZFIN;Acc:ZDB-GENE-100922-2... [more]
foxj21.071e-2440.79forkhead box J2 [Source:ZFIN;Acc:ZDB-GENE-100922-2... [more]
foxj31.993e-2339.33forkhead box J3 [Source:ZFIN;Acc:ZDB-GENE-101005-1... [more]
foxj32.235e-2339.33forkhead box J3 [Source:ZFIN;Acc:ZDB-GENE-101005-1... [more]
foxc1b4.638e-2152.44forkhead box C1b [Source:NCBI gene;Acc:79375][more]
back to top
BLAST of Fork-head domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ndel11.186e-2337.02nudE neurodevelopment protein 1 like 1 [Source:Xen... [more]
ndel11.196e-2337.02nudE neurodevelopment protein 1 like 1 [Source:Xen... [more]
ndel13.983e-2339.13nudE neurodevelopment protein 1 like 1 [Source:Xen... [more]
ndel14.512e-2339.13nudE neurodevelopment protein 1 like 1 [Source:Xen... [more]
ndel15.296e-2339.13nudE neurodevelopment protein 1 like 1 [Source:Xen... [more]
back to top
BLAST of Fork-head domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Foxj29.928e-2943.62forkhead box J2 [Source:MGI Symbol;Acc:MGI:1926805... [more]
Foxj23.587e-2643.62forkhead box J2 [Source:MGI Symbol;Acc:MGI:1926805... [more]
Foxj23.587e-2643.62forkhead box J2 [Source:MGI Symbol;Acc:MGI:1926805... [more]
Foxj31.896e-2537.63forkhead box J3 [Source:MGI Symbol;Acc:MGI:2443432... [more]
Foxj34.564e-2541.14forkhead box J3 [Source:MGI Symbol;Acc:MGI:2443432... [more]
back to top
BLAST of Fork-head domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9P0K8|FOXJ2_HUMAN1.539e-2544.30Forkhead box protein J2 OS=Homo sapiens OX=9606 GN... [more]
sp|Q9ES18|FOXJ2_MOUSE2.509e-2543.62Forkhead box protein J2 OS=Mus musculus OX=10090 G... [more]
sp|Q28EM1|FOXJ2_XENTR3.046e-2538.99Forkhead box protein J2 OS=Xenopus tropicalis OX=8... [more]
sp|Q68EZ2|FOXJ2_XENLA3.716e-2538.36Forkhead box protein J2 OS=Xenopus laevis OX=8355 ... [more]
sp|Q9UPW0|FOXJ3_HUMAN6.882e-2541.77Forkhead box protein J3 OS=Homo sapiens OX=9606 GN... [more]
back to top
BLAST of Fork-head domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0R3U8K12.112e-2847.59Fork-head domain-containing protein OS=Mesocestoid... [more]
Q3U3U91.799e-2543.62Fork-head domain-containing protein (Fragment) OS=... [more]
A0A0N4SWA42.058e-2543.62Forkhead box protein J2 (Fragment) OS=Mus musculus... [more]
A0A452Q7R96.283e-2543.62Fork-head domain-containing protein OS=Ursus ameri... [more]
A0A2I7MLF06.389e-2542.14Foxj2 OS=Andrias davidianus OX=141262 PE=2 SV=1[more]
back to top
BLAST of Fork-head domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
foxj24.993e-2637.19forkhead box protein J2 [Source:NCBI gene;Acc:1030... [more]
foxj31.215e-2339.33forkhead box J3 [Source:NCBI gene;Acc:103033658][more]
foxj31.384e-2339.33forkhead box J3 [Source:NCBI gene;Acc:103033658][more]
foxc1b8.200e-2251.22forkhead box C1b [Source:NCBI gene;Acc:79375][more]
foxn37.231e-2138.89forkhead box N3 [Source:NCBI gene;Acc:103032353][more]
back to top
BLAST of Fork-head domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
foxj31.381e-2251.02forkhead box J3 [Source:ZFIN;Acc:ZDB-GENE-101005-1... [more]
FOXC22.103e-2139.66forkhead box C2 [Source:HGNC Symbol;Acc:HGNC:3801][more]
ENSPMAT00000002547.18.788e-2148.78pep scaffold:Pmarinus_7.0:GL485262:1354:7435:1 gen... [more]
foxk13.256e-2050.00forkhead box K1 [Source:ZFIN;Acc:ZDB-GENE-030131-6... [more]
foxk13.340e-2050.00forkhead box K1 [Source:ZFIN;Acc:ZDB-GENE-030131-6... [more]
back to top
BLAST of Fork-head domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 4
Match NameE-valueIdentityDescription
HCM13.734e-1651.69Forkhead transcription factor; drives S-phase acti... [more]
FHL11.493e-1444.58Regulator of ribosomal protein (RP) transcription;... [more]
FKH12.347e-1440.00Forkhead family transcription factor; rate-limitin... [more]
FKH23.968e-1442.86Forkhead family transcription factor; rate-limitin... [more]
back to top
BLAST of Fork-head domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO490841.441e-2250.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO468282.872e-2145.45Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO426548.887e-2145.98Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO369512.008e-2042.86Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO339002.590e-2050.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Fork-head domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
FOXJ35.009e-2540.79forkhead box protein J3 [Source:NCBI gene;Acc:1011... [more]
foxj23.619e-2452.27forkhead box protein J2 [Source:NCBI gene;Acc:1011... [more]
foxj23.619e-2452.27forkhead box protein J2 [Source:NCBI gene;Acc:1011... [more]
ENSORLT00000031716.16.903e-2337.66forkhead box protein J3 [Source:NCBI gene;Acc:1011... [more]
ENSORLT00000042706.15.630e-2149.46forkhead box protein J3 [Source:NCBI gene;Acc:1011... [more]
back to top
BLAST of Fork-head domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000044628.10.000e+099.80SMESG000044628.1[more]
SMESG000044628.10.000e+086.34SMESG000044628.1[more]
SMESG000010270.12.434e-2145.26SMESG000010270.1[more]
SMESG000061695.14.772e-2037.29SMESG000061695.1[more]
SMESG000061695.14.819e-2037.29SMESG000061695.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30009043 ID=SMED30009043|Name=Fork-head domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2273bp
GATACTTCTAAGCGTCAGTGCTACGAAAATTTAAATTATATGAATACGAT
ATTCGTATGTGTGCGTTTGATGATAGTTTGACCGAAATCGATTGGCTAAA
TTCGTTATGTATTCAGAAAAAAAGTGAAATTAAGGAAGGGAATGTCATTT
CTACTACAATATCACCATATAGCCTTATTACAACACATCATAATTCTCCA
AATGACAATTGTAATACTTCACGAATTCATGGATATGATAAACCTTCATA
TAGCTATGCATATTTGATAAAGCTGGCTATTGAAAGTTCAAATAGTAAAA
AGATGAAGTTAAATGAAATTTATTCGTGGATTAGTGAAACATTTCCTTAT
TATAAATATATGCAAAAAGATAATAACAAAGGTTGGAAGAATGCAATACG
GCACAATCTCTCTTTGAATAAAATTTTTAAACGTTGTGCTAAAGATTCCT
CCCAATTGGGAAAGGGCTCTTTTTGGACGATCGACTCTAGTCTCGACGAT
GATGTCCAATACCCACCGGTCAAGAAAATGAAATTGATGCTTAATTCAAC
AGAAACAGTTAGATCTTCTTCCATCGAAAAACTGGATCTTATCCATTCGA
CTGAAATCACTCAAAATATCTCAAAAGAAATGCCAATTCCGGTTTCGATA
GTTTACACTTTATTATCTTCAAGCAGCAATAATGAGTATAATTTAAACGA
ATCAAGTGCTACACCGATGTCGAACATCAGCACGTCAAGTTTAGAAATGA
TGCCCGAGAAAACCCAAATAACATTTGCCACCCTCGAGTCACGCGTCCTA
CCGAACAATAGTGCATTTACGGTGTATTCCAATGAGATTGAAAATCATAA
TTTCTCAAAAGAACCTTGTAATGACCTTGGATATTCTTGTCAAATTAGCT
ATTCTAACCAACCGATCTATAGAAACTGTCTATTTAAATCAAATGTCTCA
ACCACGGAATTAAACCCGATGTTGTCAACAGTGGAATGCTCAAGAGAAAT
ACTTCATCCAAAGGTACTAAACAAACATTTAAATTCAGACCCAATTTCAT
CCAAGAATGACCTTTTCACAGACAAGCTCGAGGTTGATGAAGACATTATG
TCTGTTAAAAGTGCCAACAATGATTTTGTAGTAAAAACTCCAGTGCTCAG
CCAAATCAATTCTCAGCCTGTAGAGTTGGGAGGGAACAATTCGGAAATCA
AAGAAGTTTATGAGGAAAATGAATTGACTAAAGGTTCATTGCGAGATTCA
CATTTAATTTCAAGCCTACCCCAAGATACGATTGATAATCTTAATAGTTT
TGATAATTTGAGTTTTTATGATTCTTTTGCTTCTATCCCTCAGCCTTTGT
TTGACTCTGAATCACGCAGTTTTGAACTTTCCCAAAGCACAAGAAAATAT
CTATATAATTTATCTGGTGTTAAAGAAAATCTGCTACACCGATCTCAGTG
GTTAGATCTGCAGGAAGAAGACTATCAAAATCAATCTCTGAGTGAGACAT
TTTTTGAAACTCTAAGATCTGAAGAAATGCGACGAAATTATAAAGCAGAA
ACCTATCCAGATAGTCCTAATCGCGTTTTAGAAATTACTATGAAGAGGTG
GCATATTCAATCAAGAGCCAGTAATAAGGAAACTCAAGACAAAGCTCAAA
ACAAGGCTTCTAAAAATAAAAGAAAATCATCATCAACAACAAGAAAAAGG
AAATACAATGAAACTTTTTTAAATTTTGGATTCACAATTAGAAATATCAA
TCTAGAAGAAACTTTAGAAAGTGAGAGTTCTAAACCGACCAAATTGAAAA
GGCATTTGGAAAAGATTCACCCAGAGCTTTGTAATAAATCTGTTGAGTTT
TTTCAAAGGAAATTAAAAGAATTTACACAAAGATAAATTATTTTCAAAGG
CCACTTAAAATGAAATGAAAAAGTTCTCAGAGCTTCTTATAAAGCAAGTT
ATCTTATTACCAAAGCTTAAAAACCTTTACGATAGCCTATCGTAGATTCT
TACGTCACAGAAAATTTTTGTAGAATATATAACTTTTTCTTCCTCAACAG
ATTAATCAAGTAGAAGATGACGAAATCTTCCTGTCTATAGAAGCCATCAA
ATGATATAATTTGCAGCAAAGAAGTATTTTTTTGTCGAGGTGAATATGTG
GAGGCGTCACTGTGTTACTCAAAAATATATTTCAATGGACTTTTTTTCAA
TAAAACTTTACCTATTTCAACAGCCACAGCTAAACGATCTTTTTTCTAGG
TTGCGTAGAATTAAGACTTACTT
back to top

protein sequence of SMED30009043-orf-1

>SMED30009043-orf-1 ID=SMED30009043-orf-1|Name=SMED30009043-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=610bp
MCAFDDSLTEIDWLNSLCIQKKSEIKEGNVISTTISPYSLITTHHNSPND
NCNTSRIHGYDKPSYSYAYLIKLAIESSNSKKMKLNEIYSWISETFPYYK
YMQKDNNKGWKNAIRHNLSLNKIFKRCAKDSSQLGKGSFWTIDSSLDDDV
QYPPVKKMKLMLNSTETVRSSSIEKLDLIHSTEITQNISKEMPIPVSIVY
TLLSSSSNNEYNLNESSATPMSNISTSSLEMMPEKTQITFATLESRVLPN
NSAFTVYSNEIENHNFSKEPCNDLGYSCQISYSNQPIYRNCLFKSNVSTT
ELNPMLSTVECSREILHPKVLNKHLNSDPISSKNDLFTDKLEVDEDIMSV
KSANNDFVVKTPVLSQINSQPVELGGNNSEIKEVYEENELTKGSLRDSHL
ISSLPQDTIDNLNSFDNLSFYDSFASIPQPLFDSESRSFELSQSTRKYLY
NLSGVKENLLHRSQWLDLQEEDYQNQSLSETFFETLRSEEMRRNYKAETY
PDSPNRVLEITMKRWHIQSRASNKETQDKAQNKASKNKRKSSSTTRKRKY
NETFLNFGFTIRNINLEETLESESSKPTKLKRHLEKIHPELCNKSVEFFQ
RKLKEFTQR*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR036388WH-like_DNA-bd_sf
IPR036390WH_DNA-bd_sf
IPR001766Fork_head_dom
IPR011991WHTH_DNA-bd_dom
IPR030456TF_fork_head_CS_2
Vocabulary: biological process
TermDefinition
GO:0006355regulation of transcription, DNA-templated
Vocabulary: molecular function
TermDefinition
GO:0003700transcription factor activity, sequence-specific DNA binding
GO:0043565sequence-specific DNA binding
GO:0003677DNA binding
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001766Fork head domainPRINTSPR00053FORKHEADcoord: 110..127
score: 58.69
coord: 62..75
score: 59.07
coord: 83..100
score: 47.18
IPR001766Fork head domainSMARTSM00339forkneu4coord: 60..151
e-value: 5.5E-36
score: 135.6
IPR001766Fork head domainPFAMPF00250Forkheadcoord: 62..148
e-value: 1.6E-30
score: 105.2
IPR001766Fork head domainPROSITEPS50039FORK_HEAD_3coord: 62..150
score: 27.96
IPR001766Fork head domainCDDcd00059FHcoord: 62..143
e-value: 3.30358E-34
score: 122.663
IPR036388Winged helix-like DNA-binding domain superfamilyGENE3DG3DSA:1.10.10.10coord: 50..159
e-value: 4.5E-33
score: 115.3
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 519..535
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 519..547
NoneNo IPR availablePANTHERPTHR46078FAMILY NOT NAMEDcoord: 4..541
IPR030456Fork head domain conserved site 2PROSITEPS00658FORK_HEAD_2coord: 110..116
IPR036390Winged helix DNA-binding domain superfamilySUPERFAMILYSSF46785"Winged helix" DNA-binding domaincoord: 61..146