Postreplication repair E3 ubiquitin-protein ligase RAD18

Overview
NamePostreplication repair E3 ubiquitin-protein ligase RAD18
Smed IDSMED30009041
Length (bp)1079
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Postreplication repair E3 ubiquitin-protein ligase RAD18 (SMED30009041) t-SNE clustered cells

Violin plots show distribution of expression levels for Postreplication repair E3 ubiquitin-protein ligase RAD18 (SMED30009041) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30009041

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
testisSMED30009041h1SMcG0012500 PL06011B2H10smed_ncbi_20240424PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
reproductive organSMED30009041h1SMcG0012500 Contig37817newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30009041h1SMcG0012500 Contig37817uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
testisSMED30009041h1SMcG0012500 Contig4845GPL15192PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
testisSMED30009041h1SMcG0017082 Contig4845GPL15192PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Postreplication repair E3 ubiquitin-protein ligase RAD18 vs. Ensembl Human
Match: RNF8 (ring finger protein 8 [Source:HGNC Symbol;Acc:HGNC:10071])

HSP 1 Score: 64.6994 bits (156), Expect = 8.016e-11
Identity = 31/108 (28.70%), Postives = 57/108 (52.78%), Query Frame = 1
Query:  256 ETNIEQSAHAETMKAEIYKALLSSIEHDLECGICKEVYLDCCILPCGHIFCSFCIRMWFLNADSCPICRLVTEFIIGTKIIDNFLSKLLSIVDKEFADARQEMIIDRR 579
            E   E+    +  K E+   +   +E++L+C IC E +++   L C H FCS+CI  W      CPICR   +    + ++DN ++K+++ +  E  + R  +I +R+
Sbjct:  373 EQTKEEKEKMQAQKEEVLSHMNDVLENELQCIICSEYFIEAVTLNCAHSFCSYCINEWMKRKIECPICRKDIKSKTYSLVLDNCINKMVNNLSSEVKERRIVLIRERK 480          
BLAST of Postreplication repair E3 ubiquitin-protein ligase RAD18 vs. Ensembl Human
Match: TRIM65 (tripartite motif containing 65 [Source:HGNC Symbol;Acc:HGNC:27316])

HSP 1 Score: 51.9878 bits (123), Expect = 1.027e-6
Identity = 29/70 (41.43%), Postives = 37/70 (52.86%), Query Frame = 1
Query:  328 IEHDLECGICKEVYLDCCILPCGHIFCSFCIRMWFLN-ADSCPICRLVTEFIIGTKIIDNF-LSKLLSIV 531
            +E  L C IC  +Y D   LPCGH FC  CIR W+     +CP CR    F  G ++  N  LS +L +V
Sbjct:    6 LEEKLTCAICLGLYQDPVTLPCGHNFCGACIRDWWDRCGKACPECR--EPFPDGAELRRNVALSGVLEVV 73          
BLAST of Postreplication repair E3 ubiquitin-protein ligase RAD18 vs. Ensembl Human
Match: RNF141 (ring finger protein 141 [Source:HGNC Symbol;Acc:HGNC:21159])

HSP 1 Score: 49.2914 bits (116), Expect = 3.129e-6
Identity = 26/74 (35.14%), Postives = 38/74 (51.35%), Query Frame = 1
Query:  244 TQTTETNIEQSAHAETMKAEIYKALLSSIEHDLECGICKEVYLDCCILPCGHIFCSFCIRMWFLNADSCPICRL 465
            + T+E   E S+   + +A ++   +  +  + EC IC +   D  ILPC H FC  CI  W     +CPICRL
Sbjct:  121 SSTSEEPDENSSSVTSCQASLWMGRVKQLTDEEECCICMDGRADL-ILPCAHSFCQKCIDKWSDRHRNCPICRL 193          
BLAST of Postreplication repair E3 ubiquitin-protein ligase RAD18 vs. Ensembl Human
Match: CHFR (checkpoint with forkhead and ring finger domains [Source:HGNC Symbol;Acc:HGNC:20455])

HSP 1 Score: 50.447 bits (119), Expect = 3.932e-6
Identity = 35/110 (31.82%), Postives = 50/110 (45.45%), Query Frame = 1
Query:  271 QSAHAETMKAEIYKALLSSIEHDLECGICKEVYLDCCIL-PCGHIFCSFCIRMWFLNADSCPICRLVTEFIIGTKIIDNFLSKLL--------SIVDKEFADARQEMIID 573
            Q+ H E ++A   K     +E  L C IC+++  DC  L PC H FC+ C   W   +  CP CR   E I    I++N +   L        S  D +  DAR ++  D
Sbjct:  282 QTVH-EDVRAAAGKP--DKMEETLTCIICQDLLHDCVSLQPCMHTFCAACYSGWMERSSLCPTCRCPVERICKNHILNNLVEAYLIQHPDKSRSEEDVQSMDARNKITQD 388          
BLAST of Postreplication repair E3 ubiquitin-protein ligase RAD18 vs. Ensembl Human
Match: CBLC (Cbl proto-oncogene C [Source:HGNC Symbol;Acc:HGNC:15961])

HSP 1 Score: 50.0618 bits (118), Expect = 4.029e-6
Identity = 29/98 (29.59%), Postives = 46/98 (46.94%), Query Frame = 1
Query:  172 RIQEWSDEQTDKILYMKKSFTEKSTQTTETNIEQSAHAETMKAEIYKALLSSIEHDLECGICKEVYLDCCILPCGHIFCSFCIRMW-FLNADSCPICR 462
            R+Q   D+    +    K+     T+  +   +Q  H    + ++Y A+ S+ E    C IC E   D  I PCGH+ CS C+  W   ++ +CP CR
Sbjct:  250 RLQACRDKPGSYLYPDGKTHNPDLTELGQAEPQQRIHVSEEQLQLYWAMDSTFE---LCKICAESNKDVKIEPCGHLLCSCCLAAWQHSDSQTCPFCR 344          
BLAST of Postreplication repair E3 ubiquitin-protein ligase RAD18 vs. Ensembl Celegans
Match: T02C1.1 (Uncharacterized RING finger protein T02C1.1 [Source:UniProtKB/Swiss-Prot;Acc:Q03605])

HSP 1 Score: 45.8246 bits (107), Expect = 8.534e-6
Identity = 17/47 (36.17%), Postives = 27/47 (57.45%), Query Frame = 1
Query:  331 EHDLECGICKEVYLDCCILPCGHIFCSFCIRMWFLNADSCPICRLVT 471
            + D  C +C + +++ CI+ CGH +C FCI       + CP+CR  T
Sbjct:    3 DEDFCCAVCLDFFVEPCIIECGHSYCRFCIESHLNINEKCPLCRAHT 49          
BLAST of Postreplication repair E3 ubiquitin-protein ligase RAD18 vs. Ensembl Fly
Match: CG13605 (gene:FBgn0039150 transcript:FBtr0300705)

HSP 1 Score: 51.2174 bits (121), Expect = 1.020e-6
Identity = 17/39 (43.59%), Postives = 24/39 (61.54%), Query Frame = 1
Query:  346 CGICKEVYLDCCILPCGHIFCSFCIRMWFLNADSCPICR 462
            C IC + +    +L CGHIFC  C++ WF    +CP+CR
Sbjct:  610 CPICHDAFNTPTVLECGHIFCDECVQTWFKREQTCPMCR 648          
BLAST of Postreplication repair E3 ubiquitin-protein ligase RAD18 vs. Ensembl Fly
Match: CG7694 (gene:FBgn0038627 transcript:FBtr0290211)

HSP 1 Score: 47.3654 bits (111), Expect = 2.643e-6
Identity = 23/72 (31.94%), Postives = 38/72 (52.78%), Query Frame = 1
Query:  256 ETNIEQSAHAETMKAEIYKALLSSIEHDLECGICKEVYLDCC---ILPCGHIFCSFCIRMWFLNADSCPICR 462
            E  + +++    ++  +++ + S    DLEC +CKE   +     ILPC H F   CI +W    +SCP+CR
Sbjct:   40 EIEVPEASKRAILELPVHEIVKSDEGGDLECSVCKEPAEEGQKYRILPCKHEFHEECILLWLKKTNSCPLCR 111          
BLAST of Postreplication repair E3 ubiquitin-protein ligase RAD18 vs. Ensembl Fly
Match: CG7694 (gene:FBgn0038627 transcript:FBtr0083632)

HSP 1 Score: 47.3654 bits (111), Expect = 2.643e-6
Identity = 23/72 (31.94%), Postives = 38/72 (52.78%), Query Frame = 1
Query:  256 ETNIEQSAHAETMKAEIYKALLSSIEHDLECGICKEVYLDCC---ILPCGHIFCSFCIRMWFLNADSCPICR 462
            E  + +++    ++  +++ + S    DLEC +CKE   +     ILPC H F   CI +W    +SCP+CR
Sbjct:   40 EIEVPEASKRAILELPVHEIVKSDEGGDLECSVCKEPAEEGQKYRILPCKHEFHEECILLWLKKTNSCPLCR 111          
BLAST of Postreplication repair E3 ubiquitin-protein ligase RAD18 vs. Ensembl Fly
Match: CG7694 (gene:FBgn0038627 transcript:FBtr0344291)

HSP 1 Score: 47.3654 bits (111), Expect = 2.643e-6
Identity = 23/72 (31.94%), Postives = 38/72 (52.78%), Query Frame = 1
Query:  256 ETNIEQSAHAETMKAEIYKALLSSIEHDLECGICKEVYLDCC---ILPCGHIFCSFCIRMWFLNADSCPICR 462
            E  + +++    ++  +++ + S    DLEC +CKE   +     ILPC H F   CI +W    +SCP+CR
Sbjct:   40 EIEVPEASKRAILELPVHEIVKSDEGGDLECSVCKEPAEEGQKYRILPCKHEFHEECILLWLKKTNSCPLCR 111          
BLAST of Postreplication repair E3 ubiquitin-protein ligase RAD18 vs. Ensembl Fly
Match: snama (gene:FBgn0086129 transcript:FBtr0307174)

HSP 1 Score: 48.9062 bits (115), Expect = 4.535e-6
Identity = 19/48 (39.58%), Postives = 30/48 (62.50%), Query Frame = 1
Query:  328 IEHDLECGICKEVYLDCCILP-CGHIFCSFCIRMWFLNADS--CPICR 462
            I  DL CGIC+++++D  ++P CG  FC  C+R   L ++   CP C+
Sbjct:  211 IPEDLICGICRDIFVDAVMIPCCGSSFCDDCVRTSLLESEDSECPDCK 258          
BLAST of Postreplication repair E3 ubiquitin-protein ligase RAD18 vs. Ensembl Zebrafish
Match: rnf8 (ring finger protein 8, E3 ubiquitin protein ligase [Source:NCBI gene;Acc:404050])

HSP 1 Score: 61.2326 bits (147), Expect = 7.581e-10
Identity = 30/131 (22.90%), Postives = 63/131 (48.09%), Query Frame = 1
Query:  202 DKILYMKKSFTE---KSTQTTETNIEQSAHAETMKAEIYKALLSSIEHDLECGICKEVYLDCCILPCGHIFCSFCIRMWFLNADSCPICRLVTEFIIGTKIIDNFLSKLLSIVDKEFADARQEMIIDRRNV 585
            +++ + ++ F E      +  E   E+   A+  K E+   +   +E +L+C IC E++++   L C H FC  CI  W    D CP+C         + ++DN + +++  +  +  + R  +I +R+ +
Sbjct:  341 EELKHARQGFKEVLQAKDKELEVTKEEKEKAKAQKEEVVTQMTEVLESELQCSICSELFIEAVTLNCAHSFCQHCISEWRNRKDKCPMCWQNITSQTRSLVLDNCIDRMVENLSADMRERRLVLINERKGL 471          
BLAST of Postreplication repair E3 ubiquitin-protein ligase RAD18 vs. Ensembl Zebrafish
Match: rnf8 (ring finger protein 8, E3 ubiquitin protein ligase [Source:NCBI gene;Acc:404050])

HSP 1 Score: 60.4622 bits (145), Expect = 1.095e-9
Identity = 30/130 (23.08%), Postives = 62/130 (47.69%), Query Frame = 1
Query:  202 DKILYMKKSFTE---KSTQTTETNIEQSAHAETMKAEIYKALLSSIEHDLECGICKEVYLDCCILPCGHIFCSFCIRMWFLNADSCPICRLVTEFIIGTKIIDNFLSKLLSIVDKEFADARQEMIIDRRN 582
            +++ + ++ F E      +  E   E+   A+  K E+   +   +E +L+C IC E++++   L C H FC  CI  W    D CP+C         + ++DN + +++  +  +  + R  +I +R+ 
Sbjct:  341 EELKHARQGFKEVLQAKDKELEVTKEEKEKAKAQKEEVVTQMTEVLESELQCSICSELFIEAVTLNCAHSFCQHCISEWRNRKDKCPMCWQNITSQTRSLVLDNCIDRMVENLSADMRERRLVLINERKG 470          
BLAST of Postreplication repair E3 ubiquitin-protein ligase RAD18 vs. Ensembl Zebrafish
Match: chfr (checkpoint with forkhead and ring finger domains, E3 ubiquitin protein ligase [Source:NCBI gene;Acc:564271])

HSP 1 Score: 57.3806 bits (137), Expect = 1.296e-8
Identity = 56/261 (21.46%), Postives = 112/261 (42.91%), Query Frame = 1
Query:  154 PTRKRIRIQEWSDEQTDKILYMKKSFTEK-----STQTTETNIEQSAHAETMKAEIYKALLSSIEHDLECGICKEVYLDC-CILPCGHIFCSFCIRMWFLNADSCPICRLVTEFIIGTKIIDNFLSKLL--------SIVDKEFADAR----QEMI---IDRRNVLQQAESNWVSQNNNHYYTPPDMWQEWLNLQSNNAENDESRNINSEILARHARMSEEVAYDTNNSIQRTSRNIWPWSSNETLAEMSIYRAADNVAHL 873
            P + R++   W+D + ++ +  K+  T++      +  ++ + +      + K +   A    +E  L C IC+++  DC  + PC H FC+ C   W   +  CP CR   E I    I++N +   L        +  D    DAR    Q+M+   ++R    ++A S+++ + +++     DM Q ++  +       E   ++S +    +  SE +A        +T+ +    SS+ T A    +R     +HL
Sbjct:  208 PAQTRLKWTCWTDGEPEEEMQRKRRKTDRDDPGFGSAHSDASADIPLRGASGKEKTEGATTDKMEESLTCIICQDLLYDCISVQPCMHTFCAACYSGWMERSSFCPTCRCPVERIRKNHILNNLVEAYLLQHPEKCRTEDDLRSMDARNKITQDMLQPKVERSFSDEEASSDYLFELSDNDSDISDMSQPYMMCRQCPGYRKE---LSSALWICESAQSESLA--------KTAGDGPSTSSDSTTAAPQEFRCPPQASHL 457          
BLAST of Postreplication repair E3 ubiquitin-protein ligase RAD18 vs. Ensembl Zebrafish
Match: chfr (checkpoint with forkhead and ring finger domains, E3 ubiquitin protein ligase [Source:NCBI gene;Acc:564271])

HSP 1 Score: 56.6102 bits (135), Expect = 2.204e-8
Identity = 31/129 (24.03%), Postives = 59/129 (45.74%), Query Frame = 1
Query:  154 PTRKRIRIQEWSDEQTDKILYMKKSFTEK-----STQTTETNIEQSAHAETMKAEIYKALLSSIEHDLECGICKEVYLDC-CILPCGHIFCSFCIRMWFLNADSCPICRLVTEFIIGTKIIDNFLSKLL 522
            P + R++   W+D + ++ +  K+  T++      +  ++ + +      + K +   A    +E  L C IC+++  DC  + PC H FC+ C   W   +  CP CR   E I    I++N +   L
Sbjct:  208 PAQTRLKWTCWTDGEPEEEMQRKRRKTDRDDPGFGSAHSDASADIPLRGASGKEKTEGATTDKMEESLTCIICQDLLYDCISVQPCMHTFCAACYSGWMERSSFCPTCRCPVERIRKNHILNNLVEAYL 336          
BLAST of Postreplication repair E3 ubiquitin-protein ligase RAD18 vs. Ensembl Zebrafish
Match: pdzrn3b (PDZ domain containing RING finger 3b [Source:NCBI gene;Acc:100005518])

HSP 1 Score: 52.7582 bits (125), Expect = 5.309e-7
Identity = 22/68 (32.35%), Postives = 38/68 (55.88%), Query Frame = 1
Query:  322 SSIEHDLECGICKEVYLDCCILPCGHIFCSFCIRMWFLNADSCPI-C-RLVTEFIIGTKIIDNFLSKL 519
             +++ D +C +C +V  D    PCGH+FC+ C+  W +   SCP+ C R+ T+ +     + N + KL
Sbjct:   10 GAVDPDFKCNLCNKVLEDPLTTPCGHVFCAGCVLPWVVQQSSCPVKCQRISTKELNHVLPLKNLILKL 77          
BLAST of Postreplication repair E3 ubiquitin-protein ligase RAD18 vs. Ensembl Xenopus
Match: bmpr1a (bone morphogenetic protein receptor type 1A [Source:Xenbase;Acc:XB-GENE-485616])

HSP 1 Score: 68.9366 bits (167), Expect = 3.444e-12
Identity = 35/127 (27.56%), Postives = 69/127 (54.33%), Query Frame = 1
Query:  238 KSTQTTETNIEQSAHAETMKAEIYKALLSSIEHDLECGICKEVYLDCCILPCGHIFCSFCIRMWFLNADSCPICRLVTEFIIGTK--IIDNFLSKLLSIVDKEFADARQEMIIDRRNVLQQAESNWV 612
            K+ +  ET  E+       K E+   +   ++++L+C IC E +++   L C H FCS+CI+ W    + CPICR   E +  T+  ++DN +  +++ +  E  + R  +I++R+ ++Q  E + +
Sbjct:  345 KNKELQETK-EEKEKVRAQKEEVLNHMNDVLDNELQCIICSEHFIEAVTLNCAHSFCSYCIKSWRKRKEECPICR--QEILSETRSLVLDNCIDSMVAKLSPEMKNRRAALILERKEMVQVEEPSPI 468          
BLAST of Postreplication repair E3 ubiquitin-protein ligase RAD18 vs. Ensembl Xenopus
Match: bmpr1a (bone morphogenetic protein receptor type 1A [Source:Xenbase;Acc:XB-GENE-485616])

HSP 1 Score: 68.1662 bits (165), Expect = 5.714e-12
Identity = 32/117 (27.35%), Postives = 64/117 (54.70%), Query Frame = 1
Query:  268 EQSAHAETMKAEIYKALLSSIEHDLECGICKEVYLDCCILPCGHIFCSFCIRMWFLNADSCPICRLVTEFIIGTK--IIDNFLSKLLSIVDKEFADARQEMIIDRRNVLQQAESNWV 612
            E+       K E+   +   ++++L+C IC E +++   L C H FCS+CI+ W    + CPICR   E +  T+  ++DN +  +++ +  E  + R  +I++R+ ++Q  E + +
Sbjct:  324 EEKEKVRAQKEEVLNHMNDVLDNELQCIICSEHFIEAVTLNCAHSFCSYCIKSWRKRKEECPICR--QEILSETRSLVLDNCIDSMVAKLSPEMKNRRAALILERKEMVQVEEPSPI 438          
BLAST of Postreplication repair E3 ubiquitin-protein ligase RAD18 vs. Ensembl Xenopus
Match: adi1 (acireductone dioxygenase 1 [Source:Xenbase;Acc:XB-GENE-952513])

HSP 1 Score: 53.1434 bits (126), Expect = 4.013e-7
Identity = 32/88 (36.36%), Postives = 47/88 (53.41%), Query Frame = 1
Query:  304 IYKALLSS-IEHDLECGICKEVYLDCCILPCGHIFCSFCIRM---WFLNAD---SCPICR---LVTEFIIGTKIIDNFLSKLLSIVDK 537
            ++ A+ S+ +  +L C IC+++Y D   LPCGH FC  CIR    W  + +   SCP CR    +   +I  + +DN   K LSI  K
Sbjct:   22 VFLAMASAELRDELTCSICQDIYADPVTLPCGHNFCRGCIRRHWDWQKSIEEDPSCPECRQRYRIEPELITNEELDNIAKKFLSIPPK 109          
BLAST of Postreplication repair E3 ubiquitin-protein ligase RAD18 vs. Ensembl Xenopus
Match: chfr (checkpoint with forkhead and ring finger domains, E3 ubiquitin protein ligase [Source:NCBI gene;Acc:395009])

HSP 1 Score: 53.1434 bits (126), Expect = 5.017e-7
Identity = 29/90 (32.22%), Postives = 41/90 (45.56%), Query Frame = 1
Query:  328 IEHDLECGICKEVYLDCCIL-PCGHIFCSFCIRMWFLNADSCPICRLVTEFIIGTKIIDNFLSKLLSIVDKEFADARQEMIIDRRNVLQQ 594
            +E  L C IC+E+  DC  L PC H FC+ C   W   +  CP CR   E I    I++N +   L    ++         +D RN + Q
Sbjct:  261 MEETLTCIICQELLHDCVSLQPCMHTFCAACYSGWMERSSLCPTCRCPVERICKNHILNNLVEAYLIQHPEKCRSEEDRCSMDARNKITQ 350          
BLAST of Postreplication repair E3 ubiquitin-protein ligase RAD18 vs. Ensembl Xenopus
Match: chfr (checkpoint with forkhead and ring finger domains, E3 ubiquitin protein ligase [Source:NCBI gene;Acc:395009])

HSP 1 Score: 52.7582 bits (125), Expect = 5.206e-7
Identity = 29/90 (32.22%), Postives = 41/90 (45.56%), Query Frame = 1
Query:  328 IEHDLECGICKEVYLDCCIL-PCGHIFCSFCIRMWFLNADSCPICRLVTEFIIGTKIIDNFLSKLLSIVDKEFADARQEMIIDRRNVLQQ 594
            +E  L C IC+E+  DC  L PC H FC+ C   W   +  CP CR   E I    I++N +   L    ++         +D RN + Q
Sbjct:  227 MEETLTCIICQELLHDCVSLQPCMHTFCAACYSGWMERSSLCPTCRCPVERICKNHILNNLVEAYLIQHPEKCRSEEDRCSMDARNKITQ 316          
BLAST of Postreplication repair E3 ubiquitin-protein ligase RAD18 vs. Ensembl Mouse
Match: Rnf8 (ring finger protein 8 [Source:MGI Symbol;Acc:MGI:1929069])

HSP 1 Score: 70.4774 bits (171), Expect = 6.839e-13
Identity = 40/124 (32.26%), Postives = 63/124 (50.81%), Query Frame = 1
Query:  220 KKSFTEKSTQTTETNIEQSAH----AETMKAEIYKALLSSIEHDLECGICKEVYLDCCILPCGHIFCSFCIRMWFLNADSCPICRLVTEFIIGTKIIDNFLSKLLSIVDKEFADARQEMIIDRR 579
            KK F EK  Q     +EQ+       +  K E+   +   +E++L+C IC E +++   L C H FCSFCI  W      CPICR   E    + ++DN +SK++  +  +  + R  +I +RR
Sbjct:  361 KKDF-EKIIQAKNKELEQTKEEKDKVQAQKEEVLSHMNDLLENELQCIICSEYFIEAVTLNCAHSFCSFCINEWMKRKVECPICRKDIESRTNSLVLDNCISKMVDNLSSDVKERRSVLIRERR 483          
BLAST of Postreplication repair E3 ubiquitin-protein ligase RAD18 vs. Ensembl Mouse
Match: Gm28043 (predicted gene, 28043 [Source:MGI Symbol;Acc:MGI:5547779])

HSP 1 Score: 70.8626 bits (172), Expect = 8.155e-13
Identity = 40/124 (32.26%), Postives = 63/124 (50.81%), Query Frame = 1
Query:  220 KKSFTEKSTQTTETNIEQSAH----AETMKAEIYKALLSSIEHDLECGICKEVYLDCCILPCGHIFCSFCIRMWFLNADSCPICRLVTEFIIGTKIIDNFLSKLLSIVDKEFADARQEMIIDRR 579
            KK F EK  Q     +EQ+       +  K E+   +   +E++L+C IC E +++   L C H FCSFCI  W      CPICR   E    + ++DN +SK++  +  +  + R  +I +RR
Sbjct:  361 KKDF-EKIIQAKNKELEQTKEEKDKVQAQKEEVLSHMNDLLENELQCIICSEYFIEAVTLNCAHSFCSFCINEWMKRKVECPICRKDIESRTNSLVLDNCISKMVDNLSSDVKERRSVLIRERR 483          
BLAST of Postreplication repair E3 ubiquitin-protein ligase RAD18 vs. Ensembl Mouse
Match: Chfr (checkpoint with forkhead and ring finger domains [Source:MGI Symbol;Acc:MGI:2444898])

HSP 1 Score: 51.6026 bits (122), Expect = 9.985e-7
Identity = 42/156 (26.92%), Postives = 73/156 (46.79%), Query Frame = 1
Query:  139 NDNLIPTRKRIRIQEWSDEQTDKILYMKKSFTEKSTQTTETNIEQSAHAETMKAEIYKALLSSIEHDLECGICKEVYLDCCIL-PCGHIFCSFCIRMWFLNADSCPICRLVTEFIIGTKIIDNFL-SKLLSIVDKEFA--DARQEMIIDRRNVLQQ 594
            ++ L P +K+++     D + D  L +  S    + QT+  +++ +    ++K +        +E  L C IC+++  DC  L PC H FC+ C   W   +  CP CR   E I    I++N + + L+   DK  +  D R    +D RN + Q
Sbjct:  249 HEELEPAKKKMK----GDGELDTNLQLLVSGQRGNAQTSSEDVKDA----SVKPD-------KMEETLTCIICQDLLHDCVSLQPCMHTFCAACYSGWMERSSLCPTCRCPVERICKNHILNNLVEAYLIQHPDKSRSEEDVRS---MDARNKITQ 386          
BLAST of Postreplication repair E3 ubiquitin-protein ligase RAD18 vs. Ensembl Mouse
Match: Chfr (checkpoint with forkhead and ring finger domains [Source:MGI Symbol;Acc:MGI:2444898])

HSP 1 Score: 51.6026 bits (122), Expect = 1.034e-6
Identity = 42/156 (26.92%), Postives = 73/156 (46.79%), Query Frame = 1
Query:  139 NDNLIPTRKRIRIQEWSDEQTDKILYMKKSFTEKSTQTTETNIEQSAHAETMKAEIYKALLSSIEHDLECGICKEVYLDCCIL-PCGHIFCSFCIRMWFLNADSCPICRLVTEFIIGTKIIDNFL-SKLLSIVDKEFA--DARQEMIIDRRNVLQQ 594
            ++ L P +K+++     D + D  L +  S    + QT+  +++ +    ++K +        +E  L C IC+++  DC  L PC H FC+ C   W   +  CP CR   E I    I++N + + L+   DK  +  D R    +D RN + Q
Sbjct:  249 HEELEPAKKKMK----GDGELDTNLQLLVSGQRGNAQTSSEDVKDA----SVKPD-------KMEETLTCIICQDLLHDCVSLQPCMHTFCAACYSGWMERSSLCPTCRCPVERICKNHILNNLVEAYLIQHPDKSRSEEDVRS---MDARNKITQ 386          
BLAST of Postreplication repair E3 ubiquitin-protein ligase RAD18 vs. Ensembl Mouse
Match: Rnf181 (ring finger protein 181 [Source:MGI Symbol;Acc:MGI:1913760])

HSP 1 Score: 48.9062 bits (115), Expect = 1.269e-6
Identity = 31/114 (27.19%), Postives = 57/114 (50.00%), Query Frame = 1
Query:  139 NDNLIPTRKRIRIQEWSDEQTDKILYMKKSFTEKSTQTTETNIEQSAHAETMKAEIYKALLSSIEHDLECGIC------KEVYLDCCILPCGHIFCSFCIRMWFLNADSCPICR 462
            N+ L+   +R+R   WS     + L+ +  F +      E ++   A A+ +   + + ++SS + DL+C +C      +E  ++   +PC H+F S CI  W    +SCP+CR
Sbjct:   21 NNMLLELARRVR-GAWSWAPGGRSLFNRMDFEDLGLVDWEHHLPPPA-AKAVVESLPRTVISSAKADLKCPVCLLEFEAEETVIE---MPCHHLFHSNCILPWLSKTNSCPLCR 129          
BLAST of Postreplication repair E3 ubiquitin-protein ligase RAD18 vs. UniProt/SwissProt
Match: sp|Q7ZX20|RNF8A_XENLA (E3 ubiquitin-protein ligase rnf8-A OS=Xenopus laevis OX=8355 GN=rnf8-A PE=2 SV=1)

HSP 1 Score: 73.559 bits (179), Expect = 5.810e-13
Identity = 34/108 (31.48%), Postives = 62/108 (57.41%), Query Frame = 1
Query:  295 KAEIYKALLSSIEHDLECGICKEVYLDCCILPCGHIFCSFCIRMWFLNADSCPICRLVTEFIIGTK--IIDNFLSKLLSIVDKEFADARQEMIIDRRNVLQQAESNWV 612
            K E+   +   ++++L+C IC E +++   L C H FCS+CI+ W    + CPICR   E +  T+  ++DN +  ++  +  E  + R  +I++R+ ++Q  ESN V
Sbjct:  365 KEEVLNHMNDVLDNELQCIICSEHFIEAVTLNCAHSFCSYCIKSWKKRKEECPICR--QEIVTETRSLVLDNCIDSMVDKLSPEMKNRRAALILERKEMVQAEESNPV 470          
BLAST of Postreplication repair E3 ubiquitin-protein ligase RAD18 vs. UniProt/SwissProt
Match: sp|Q6NRG0|RNF8B_XENLA (E3 ubiquitin-protein ligase rnf8-B OS=Xenopus laevis OX=8355 GN=rnf8-B PE=2 SV=1)

HSP 1 Score: 72.0182 bits (175), Expect = 2.023e-12
Identity = 34/108 (31.48%), Postives = 62/108 (57.41%), Query Frame = 1
Query:  295 KAEIYKALLSSIEHDLECGICKEVYLDCCILPCGHIFCSFCIRMWFLNADSCPICRLVTEFIIGTK--IIDNFLSKLLSIVDKEFADARQEMIIDRRNVLQQAESNWV 612
            K E+   +   ++++L+C IC E +++   L C H FCS+CI+ W    + CPICR   E +  T+  ++DN +  ++  +  E  + R  +I++R+ ++Q  ESN V
Sbjct:  360 KEEVLNHMNDVLDNELQCIICSEHFIEAVTLNCAHSFCSYCIKSWRKRKEECPICR--QEILSETRSLVLDNCIDSMVDKLSPEMKNRRAALILERKEMVQAEESNPV 465          
BLAST of Postreplication repair E3 ubiquitin-protein ligase RAD18 vs. UniProt/SwissProt
Match: sp|Q8VC56|RNF8_MOUSE (E3 ubiquitin-protein ligase RNF8 OS=Mus musculus OX=10090 GN=Rnf8 PE=1 SV=1)

HSP 1 Score: 70.4774 bits (171), Expect = 4.784e-12
Identity = 40/124 (32.26%), Postives = 63/124 (50.81%), Query Frame = 1
Query:  220 KKSFTEKSTQTTETNIEQSAH----AETMKAEIYKALLSSIEHDLECGICKEVYLDCCILPCGHIFCSFCIRMWFLNADSCPICRLVTEFIIGTKIIDNFLSKLLSIVDKEFADARQEMIIDRR 579
            KK F EK  Q     +EQ+       +  K E+   +   +E++L+C IC E +++   L C H FCSFCI  W      CPICR   E    + ++DN +SK++  +  +  + R  +I +RR
Sbjct:  361 KKDF-EKIIQAKNKELEQTKEEKDKVQAQKEEVLSHMNDLLENELQCIICSEYFIEAVTLNCAHSFCSFCINEWMKRKVECPICRKDIESRTNSLVLDNCISKMVDNLSSDVKERRSVLIRERR 483          
BLAST of Postreplication repair E3 ubiquitin-protein ligase RAD18 vs. UniProt/SwissProt
Match: sp|Q4KLN8|RNF8_RAT (E3 ubiquitin-protein ligase RNF8 OS=Rattus norvegicus OX=10116 GN=Rnf8 PE=2 SV=1)

HSP 1 Score: 69.707 bits (169), Expect = 9.847e-12
Identity = 34/108 (31.48%), Postives = 56/108 (51.85%), Query Frame = 1
Query:  256 ETNIEQSAHAETMKAEIYKALLSSIEHDLECGICKEVYLDCCILPCGHIFCSFCIRMWFLNADSCPICRLVTEFIIGTKIIDNFLSKLLSIVDKEFADARQEMIIDRR 579
            E   E+    +  K E+   +   +E++L+C IC E +++   L C H FCSFCI  W      CPICR   E    + ++DN +SK++  +  +  + R  +I +RR
Sbjct:  375 ERTKEEKDKVQAQKEEVLSHMNDVLENELQCIICSEYFIEAVTLNCAHSFCSFCISEWMKRKVECPICRKDIESRTNSLVLDNCISKMVERLSSDVKERRSVLIRERR 482          
BLAST of Postreplication repair E3 ubiquitin-protein ligase RAD18 vs. UniProt/SwissProt
Match: sp|Q2HJ46|RNF8_BOVIN (E3 ubiquitin-protein ligase RNF8 OS=Bos taurus OX=9913 GN=RNF8 PE=2 SV=1)

HSP 1 Score: 67.781 bits (164), Expect = 3.886e-11
Identity = 32/109 (29.36%), Postives = 57/109 (52.29%), Query Frame = 1
Query:  256 ETNIEQSAHAETMKAEIYKALLSSIEHDLECGICKEVYLDCCILPCGHIFCSFCIRMWFLNADSCPICRLVTEFIIGTKIIDNFLSKLLSIVDKEFADARQEMIIDRRN 582
            E   E+    +  K E+   +   +E++L+C IC E +++   L C H FCS+CI  W      CPICR   +    + ++DN +SK++  ++ E  + R  +I +R+ 
Sbjct:  375 EQTKEEKEKVQAQKEEVLSHMNDVLENELQCIICSEYFVEAVTLNCAHSFCSYCINEWMKRKVECPICRKDIKSKTRSLVLDNCISKMVDNLNSEVKERRIVLIRERKG 483          
BLAST of Postreplication repair E3 ubiquitin-protein ligase RAD18 vs. TrEMBL
Match: A0A482VSY2 (E3 ubiquitin-protein ligase RNF8-B-like OS=Asbolus verrucosus OX=1661398 GN=BDFB_002762 PE=4 SV=1)

HSP 1 Score: 80.8777 bits (198), Expect = 3.026e-13
Identity = 44/131 (33.59%), Postives = 67/131 (51.15%), Query Frame = 1
Query:  193 EQTDKILYMKKSFTEKSTQTTETNIEQSAHAETMKAEIYKALLSSIEHDLECGICKEVYLDCCILPCGHIFCSFCIRMWFLNADSCPICRLVTEFIIGTKIIDNFLSKLLSIVDKEFADARQEMIIDRRNV 585
            E+T + +   K  TE + Q  ET  ++S +      +I       +E++L C IC E+++    L C H FC FCI  W  N  SCPICR     +  T ++DNF+ K++S  D E  + R+ +I  R  V
Sbjct:  148 EETGESVKTSKLQTELTPQNAETKEDKSKNETGQSLDI-------MENELTCSICSELFIKAVTLNCSHTFCKFCIEEWKKNKSSCPICRKFITTVAPTLVLDNFIEKIISTQDDEVKETRKVLIQQREEV 271          
BLAST of Postreplication repair E3 ubiquitin-protein ligase RAD18 vs. TrEMBL
Match: A0A226ER25 (E3 ubiquitin-protein ligase RNF8 OS=Folsomia candida OX=158441 GN=Fcan01_05331 PE=4 SV=1)

HSP 1 Score: 81.2629 bits (199), Expect = 6.967e-13
Identity = 36/109 (33.03%), Postives = 64/109 (58.72%), Query Frame = 1
Query:  268 EQSAHAETMKAEIYKALLSSIEHDLECGICKEVYLDCCILPCGHIFCSFCIRMWFLNADSCPICRLVTEFIIGTKIID--NFLSKLLSIVDKEFADARQEMIIDRRNVL 588
            E  +  E  + E +K +++ +E +  C IC E++L+  ++ CGH FCS+CI  W      CPICR     II TK ++  NF++K+ +++ ++  D R E++ +R N +
Sbjct:  133 ELKSQTEVFQLEFFKDVVALLETEFSCVICCEIFLEPAVIDCGHTFCSYCINEWKKEKKECPICR--KPIIICTKHVEMQNFVTKIHTMMSQDIQDKRNELVSERENTI 239          
BLAST of Postreplication repair E3 ubiquitin-protein ligase RAD18 vs. TrEMBL
Match: A0A1D2NJZ4 (E3 ubiquitin-protein ligase RNF8 OS=Orchesella cincta OX=48709 GN=Ocin01_01090 PE=4 SV=1)

HSP 1 Score: 78.9518 bits (193), Expect = 3.359e-12
Identity = 41/131 (31.30%), Postives = 68/131 (51.91%), Query Frame = 1
Query:  208 ILYMKKSFTEKSTQTTETNIEQSAHAETMKAEIYKALLSSIEHDLECGICKEVYLDCCILPCGHIFCSFCIRMWFLNADSCPICRLVTEFIIGTKII--DNFLSKLLSIVDKEFADARQEMIIDRRNVLQQ 594
            +L M ++   +  +  E + E S   E  K E++K +L  +E +L C +C EV++   ++ CGH FCSFCI  W      CPICR    F   ++ I  +NF+ K+      E A  R+  I +R + +++
Sbjct:  303 MLQMDRNIEREEFRRKEKDAESSN--EAFKEEMFKKILELMESELSCSVCNEVFIQATVIECGHTFCSFCIHEWSRKKQECPICR--KRFASRSRHIEVENFILKMFESFSGEIASKRKASIKEREDQVKK 429          
BLAST of Postreplication repair E3 ubiquitin-protein ligase RAD18 vs. TrEMBL
Match: A0A3Q2DNY5 (E3 ubiquitin-protein ligase RNF8 OS=Cyprinodon variegatus OX=28743 GN=RNF8 PE=3 SV=1)

HSP 1 Score: 78.5666 bits (192), Expect = 4.147e-12
Identity = 38/129 (29.46%), Postives = 66/129 (51.16%), Query Frame = 1
Query:  202 DKILYMKKSFTE---KSTQTTETNIEQSAHAETMKAEIYKALLSSIEHDLECGICKEVYLDCCILPCGHIFCSFCIRMWFLNADSCPICRLVTEFIIGTKIIDNFLSKLLSIVDKEFADARQEMIIDRR 579
            D++   +K F E      +  E  +E+   A   K E+   +   +E++L+C IC E++++  IL C H FCSFCI+ W    D CPICR   +       +DN + +++  +  +    RQ +I +R+
Sbjct:  330 DELALSRKGFEEIISAKNKELEVTMEEKEKARAQKEEVVTQVTEVLENELQCIICSELFIEAVILNCAHSFCSFCIKQWRNKKDECPICRQAIQSQTRCLALDNCIDRMVENLSLDMKARRQTLITERK 458          
BLAST of Postreplication repair E3 ubiquitin-protein ligase RAD18 vs. TrEMBL
Match: E9H7V5 (Uncharacterized protein OS=Daphnia pulex OX=6669 GN=DAPPUDRAFT_326474 PE=4 SV=1)

HSP 1 Score: 77.0258 bits (188), Expect = 1.266e-11
Identity = 46/171 (26.90%), Postives = 85/171 (49.71%), Query Frame = 1
Query:  112 ETTNQSNVTNDNLIPTRKRIRIQEWSDEQTDKILYMKKSFTEKSTQTTETNIEQSAHAETMKAEIYKALLSSIEHDLECGICKEVYLDCCILPCGHIFCSFCIRMWFLNADSCPICRLVTEFIIGTKIIDNFLSKLLSIVDKEFADARQEMIIDRRNVLQQAESNWVSQNN 624
            E TNQ ++T   L   R+ +R+Q+  +EQ  +              +++  ++   H E++           +E++L+CGIC E+ +    L C H FC  C+R W  N   CPICR          ++DN +  ++S + +E  + R+E++I R+ ++++A    + QNN
Sbjct:  404 EATNQPSLTEQELERVREELRVQKELNEQQQQA-------------SSKACVDIVGHMESI-----------MENELQCGICSELMVFATSLNCMHTFCQHCVREWKKNKVECPICRAPITTEGRNLLVDNMIDAMVSSLSEETKNRRKELVIQRQELVKRA---SIEQNN 547          
BLAST of Postreplication repair E3 ubiquitin-protein ligase RAD18 vs. Ensembl Cavefish
Match: rnf8 (ring finger protein 8 [Source:NCBI gene;Acc:103022192])

HSP 1 Score: 67.0106 bits (162), Expect = 8.294e-12
Identity = 33/130 (25.38%), Postives = 63/130 (48.46%), Query Frame = 1
Query:  202 DKILYMKKSFTE---KSTQTTETNIEQSAHAETMKAEIYKALLSSIEHDLECGICKEVYLDCCILPCGHIFCSFCIRMWFLNADSCPICRLVTEFIIGTKIIDNFLSKLLSIVDKEFADARQEMIIDRRN 582
            +++ + ++ F E      +  E   E+   A   K E+   +   +E++L+C IC E++++   L C H FC  CI  W    D CPICR        + ++DN + +++  +  E  + R  +I +R+ 
Sbjct:  329 EELQHARQGFKEVLQAKDKELEVTKEEKEKARAQKEEVVTQMTEVLENELQCIICSELFIEAVTLNCAHSFCLHCISDWRRRKDECPICRQAILSQTRSLVLDNCIDRMVENLSAEMRERRVALIRERKG 458          
BLAST of Postreplication repair E3 ubiquitin-protein ligase RAD18 vs. Ensembl Cavefish
Match: rnf8 (ring finger protein 8 [Source:NCBI gene;Acc:103022192])

HSP 1 Score: 63.1586 bits (152), Expect = 1.565e-10
Identity = 28/96 (29.17%), Postives = 50/96 (52.08%), Query Frame = 1
Query:  295 KAEIYKALLSSIEHDLECGICKEVYLDCCILPCGHIFCSFCIRMWFLNADSCPICRLVTEFIIGTKIIDNFLSKLLSIVDKEFADARQEMIIDRRN 582
            K E+   +   +E++L+C IC E++++   L C H FC  CI  W    D CPICR        + ++DN + +++  +  E  + R  +I +R+ 
Sbjct:  333 KEEVVTQMTEVLENELQCIICSELFIEAVTLNCAHSFCLHCISDWRRRKDECPICRQAILSQTRSLVLDNCIDRMVENLSAEMRERRVALIRERKG 428          
BLAST of Postreplication repair E3 ubiquitin-protein ligase RAD18 vs. Ensembl Cavefish
Match: ENSAMXT00000050225.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02001709.1:22410:25173:1 gene:ENSAMXG00000040549.1 transcript:ENSAMXT00000050225.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 54.6842 bits (130), Expect = 6.327e-8
Identity = 34/84 (40.48%), Postives = 50/84 (59.52%), Query Frame = 1
Query:  313 ALLSSIEHDLECGICKEVYLDCCILPCGHIFCSFCIRMWFLNADS---CPICRLVTEFIIGTKI-IDNFLSKLLSIVDKEFADA 552
            +LLS  E  L+C IC +V+ D    PCGH FC  C+R ++ N+ S   CP+C+   EF    ++ I+ F+S L  I +KE AD+
Sbjct:    6 SLLS--EDQLQCSICLDVFTDPVSTPCGHNFCMVCLRKYW-NSSSHCQCPVCK--REFPQRPELSINTFISGLAKIREKEEADS 84          
BLAST of Postreplication repair E3 ubiquitin-protein ligase RAD18 vs. Ensembl Cavefish
Match: pdzrn3b (PDZ domain containing ring finger 3 [Source:NCBI gene;Acc:103033977])

HSP 1 Score: 52.373 bits (124), Expect = 5.823e-7
Identity = 19/48 (39.58%), Postives = 29/48 (60.42%), Query Frame = 1
Query:  322 SSIEHDLECGICKEVYLDCCILPCGHIFCSFCIRMWFLNADSCPI-CR 462
             S++ DL+C +C++V  +    PCGH+FC+ C+  W     SCP  CR
Sbjct:   10 GSVDPDLKCNLCQKVLEEPLTTPCGHVFCARCVLPWVAQRSSCPARCR 57          
BLAST of Postreplication repair E3 ubiquitin-protein ligase RAD18 vs. Ensembl Cavefish
Match: chfr (checkpoint with forkhead and ring finger domains, E3 ubiquitin protein ligase [Source:NCBI gene;Acc:564271])

HSP 1 Score: 51.6026 bits (122), Expect = 8.697e-7
Identity = 38/126 (30.16%), Postives = 60/126 (47.62%), Query Frame = 1
Query:  328 IEHDLECGICKEVYLDCCIL-PCGHIFCSFCIRMWFLNADSCPICRLVTEFIIGTKIIDNFLSKLL-----SIVDKEFADAR----QEMI---IDRRNVLQQAESNWVSQNNNHYYTPPDMWQEWL 666
            +E  L C IC+++  DC  L PC H FC+ C   W   +  CP CR   E I    I++N +   L     S  D    DAR    Q+M+   +DR    ++  S+++ + +++     DM Q +L
Sbjct:  241 MEESLTCIICQDLLHDCVSLQPCMHTFCAACYSGWMERSSLCPTCRCPVERIRKNHILNNLVEAYLLQSGRSEEDLRSMDARNKITQDMLQPKVDRSFSDEEGSSDYLFELSDNDSDTSDMSQPYL 366          
BLAST of Postreplication repair E3 ubiquitin-protein ligase RAD18 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008284.1 (pep scaffold:Pmarinus_7.0:GL492550:1249:4726:-1 gene:ENSPMAG00000007497.1 transcript:ENSPMAT00000008284.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 60.8474 bits (146), Expect = 1.271e-10
Identity = 28/101 (27.72%), Postives = 53/101 (52.48%), Query Frame = 1
Query:  286 ETMKAEIYKALLSSIEHDLECGICKEVYLDCCILPCGHIFCSFCIRMWFLNADSCPICRLVTEFIIGTKIIDNFLSKLLSIVDKEFADARQEMIIDRRNVL 588
            +T K ++  +  + +E++L+C IC E+++    L C H FC  CI  W    + CPICR        + ++DN +++++  + +E    R E+    R+ L
Sbjct:  326 KTEKKQVICSFENVMENELQCIICSELFIQATTLSCAHTFCRNCIEEWLKQKELCPICRASPTSSTPSLVLDNCIARMVESLGQEKKAERDEIPKGHRHRL 426          
BLAST of Postreplication repair E3 ubiquitin-protein ligase RAD18 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008283.1 (pep scaffold:Pmarinus_7.0:GL492550:1249:4726:-1 gene:ENSPMAG00000007497.1 transcript:ENSPMAT00000008283.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 60.8474 bits (146), Expect = 1.432e-10
Identity = 28/101 (27.72%), Postives = 53/101 (52.48%), Query Frame = 1
Query:  286 ETMKAEIYKALLSSIEHDLECGICKEVYLDCCILPCGHIFCSFCIRMWFLNADSCPICRLVTEFIIGTKIIDNFLSKLLSIVDKEFADARQEMIIDRRNVL 588
            +T K ++  +  + +E++L+C IC E+++    L C H FC  CI  W    + CPICR        + ++DN +++++  + +E    R E+    R+ L
Sbjct:  327 KTEKKQVICSFENVMENELQCIICSELFIQATTLSCAHTFCRNCIEEWLKQKELCPICRASPTSSTPSLVLDNCIARMVESLGQEKKAERDEIPKGHRHRL 427          
BLAST of Postreplication repair E3 ubiquitin-protein ligase RAD18 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010742.1 (pep scaffold:Pmarinus_7.0:GL476415:275167:281055:1 gene:ENSPMAG00000009730.1 transcript:ENSPMAT00000010742.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 45.8246 bits (107), Expect = 1.531e-6
Identity = 32/78 (41.03%), Postives = 42/78 (53.85%), Query Frame = 1
Query:  325 SIEHDLECGICKEVYLDCCILPCGHIFCSFCI-RMWFLNADSCPICRLVTEFIIGTK------IIDNFLSKLLSIVDK 537
             +E +L C IC  +Y+D  +L C H FC  CI  +W   A +CP CR V  F  G+K      +  NF  KL SIVD+
Sbjct:    8 GLEEELTCSICLHLYVDPVLLGCPHTFCRECIVSVWRDGACACPECRRVLPF--GSKEEMRKQLEKNF--KLASIVDR 81          
BLAST of Postreplication repair E3 ubiquitin-protein ligase RAD18 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010759.1 (pep scaffold:Pmarinus_7.0:GL476415:846545:851388:1 gene:ENSPMAG00000009743.1 transcript:ENSPMAT00000010759.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 45.4394 bits (106), Expect = 2.125e-6
Identity = 32/77 (41.56%), Postives = 42/77 (54.55%), Query Frame = 1
Query:  328 IEHDLECGICKEVYLDCCILPCGHIFCSFCI-RMWFLNADSCPICRLVTEFIIGTK------IIDNFLSKLLSIVDK 537
            +E +L C IC  +Y+D  +L C H FC  CI  +W   A +CP CR V  F  G+K      +  NF  KL SIVD+
Sbjct:    1 LEEELTCSICLHLYVDPVLLGCPHTFCRECIVSVWRDGACACPECRRVLPF--GSKEEMRKQLEKNF--KLASIVDR 73          
BLAST of Postreplication repair E3 ubiquitin-protein ligase RAD18 vs. Ensembl Sea Lamprey
Match: cop1 (COP1 E3 ubiquitin ligase [Source:ZFIN;Acc:ZDB-GENE-070410-134])

HSP 1 Score: 46.9802 bits (110), Expect = 4.630e-6
Identity = 39/135 (28.89%), Postives = 57/135 (42.22%), Query Frame = 1
Query:  295 KAEIYKALLSSIE---HDLECGICKEVYLDCCILPCGHIFCSFCIRMWFLNADSCPICRLVTEFIIGTKIIDNFLSKLLSIVDKEFADARQEMIIDRRNVLQQAESNWVSQNNNHYYTPPDMWQEWLNLQSNNAE 690
            +A IY  L++S E   +D  C IC ++  +  I  CGH FC  CIR      + CP C  V E     +I  NFL                E+I+ +R  L++        +  H++T     QE L L  +  E
Sbjct:   23 QAPIYNGLVNSYEDKNNDFVCPICFDMIEEAYITKCGHSFCCKCIRRSLEENNRCPKCNYVIE--NPNQIFPNFL--------------LNELILKQRQRLEEKRMKMEQPSGQHWHT----IQELLALDQDGLE 137          
BLAST of Postreplication repair E3 ubiquitin-protein ligase RAD18 vs. Ensembl Yeast
Match: RAD18 (E3 ubiquitin ligase; forms heterodimer with Rad6p to monoubiquitinate PCNA-K164; heterodimer binds single-stranded DNA and has single-stranded DNA dependent ATPase activity; required for postreplication repair; SUMO-targeted ubiquitin ligase (STUbl) that contains a SUMO-interacting motif (SIM) which stimulates its ubiquitin ligase activity towards the sumoylated form of PCNA [Source:SGD;Acc:S000000662])

HSP 1 Score: 55.4546 bits (132), Expect = 5.828e-9
Identity = 27/72 (37.50%), Postives = 40/72 (55.56%), Query Frame = 1
Query:  340 LECGICKEVYLDCCILPCGHIFCSFCIRMWFLNADSCPIC-------RLVTEFIIGTKIIDNFLSKLLSIVD 534
            L C ICK+      + PCGH FCS CIR    N  +CP+C        L +EF++ ++II ++ S   S++D
Sbjct:   26 LRCHICKDFLKVPVLTPCGHTFCSLCIRTHLNNQPNCPLCLFEFRESLLRSEFLV-SEIIQSYTSLRSSLLD 96          
BLAST of Postreplication repair E3 ubiquitin-protein ligase RAD18 vs. Ensembl Nematostella
Match: EDO48594 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RIZ5])

HSP 1 Score: 62.003 bits (149), Expect = 1.853e-10
Identity = 35/141 (24.82%), Postives = 73/141 (51.77%), Query Frame = 1
Query:  223 KSFTEKSTQTTETNIEQSAHAETMKAEIYKALLSSIEHDLECGICKEVYLDCCILPCGHIFCSFCIRMWFLNADSCPICR-LVTEFIIGTKIIDNFLSKLLSIVDKEFADARQEMIIDRRNVLQQAESNWVSQNNNHYYTP 642
            +S  EK  +     +E +  AE    E  K+++  +E +  C +C+E+++    L C H FC +C++ W    ++CPICR  V    + + ++DN ++K++  +D    + R+ ++ +R       +S  ++Q++    TP
Sbjct:  419 QSLMEKKDRELLKQMEVTKKAEE---EARKSVVEEMEDEFSCIVCQELFIRATTLTCSHSFCEYCLQSWLRKRNTCPICRCAVQSQPVRSIVLDNAIAKMVDSMDVASKERRRAVMEERAE-----KSRELAQSSGSQRTP 551          
BLAST of Postreplication repair E3 ubiquitin-protein ligase RAD18 vs. Ensembl Nematostella
Match: EDO48236 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RKF3])

HSP 1 Score: 47.7506 bits (112), Expect = 2.740e-6
Identity = 19/47 (40.43%), Postives = 26/47 (55.32%), Query Frame = 1
Query:  316 LLSSIEHDLECGICKEVYLDCCILPCGHIFCSFCIRMWFLNADSCPI 456
             L  +E D +CGIC  V  D  +  CGH+FCS C+  W     +CP+
Sbjct:    8 FLDPVEDDFKCGICFGVLEDPLVTTCGHVFCSQCLVHWIAENGTCPL 54          
BLAST of Postreplication repair E3 ubiquitin-protein ligase RAD18 vs. Ensembl Nematostella
Match: EDO30997 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SZ68])

HSP 1 Score: 43.5134 bits (101), Expect = 3.082e-6
Identity = 18/42 (42.86%), Postives = 20/42 (47.62%), Query Frame = 1
Query:  346 CGICKEVYLDCCILPCGHIFCSFCIRMWF---LNADSCPICR 462
            C ICKEV       PC H FC  CI  W     N   CP+C+
Sbjct:   16 CAICKEVLTQPIATPCDHYFCVLCICEWLDQTYNKSGCPVCK 57          
BLAST of Postreplication repair E3 ubiquitin-protein ligase RAD18 vs. Ensembl Nematostella
Match: EDO32314 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SVE0])

HSP 1 Score: 43.1282 bits (100), Expect = 4.938e-6
Identity = 18/42 (42.86%), Postives = 20/42 (47.62%), Query Frame = 1
Query:  346 CGICKEVYLDCCILPCGHIFCSFCIRMWF---LNADSCPICR 462
            C ICKEV       PC H FC  CI  W     N   CP+C+
Sbjct:   16 CAICKEVLTQPLATPCDHYFCVLCICEWLDQTYNKSGCPVCK 57          
BLAST of Postreplication repair E3 ubiquitin-protein ligase RAD18 vs. Ensembl Nematostella
Match: EDO48322 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RJT0])

HSP 1 Score: 43.1282 bits (100), Expect = 5.447e-6
Identity = 18/42 (42.86%), Postives = 20/42 (47.62%), Query Frame = 1
Query:  346 CGICKEVYLDCCILPCGHIFCSFCIRMWF---LNADSCPICR 462
            C ICKEV       PC H FC  CI  W     N   CP+C+
Sbjct:   16 CAICKEVLTQPIATPCDHYFCVLCICEWLDQTYNKSGCPVCK 57          
BLAST of Postreplication repair E3 ubiquitin-protein ligase RAD18 vs. Ensembl Medaka
Match: rnf8 (ring finger protein 8 [Source:NCBI gene;Acc:101166923])

HSP 1 Score: 74.3294 bits (181), Expect = 2.826e-14
Identity = 42/148 (28.38%), Postives = 70/148 (47.30%), Query Frame = 1
Query:  139 NDNLIPTRKRIRIQEWSDEQTDKILYMKKSFTEKSTQTTETNIEQSAHAETMKAEIYKALLSSIEHDLECGICKEVYLDCCILPCGHIFCSFCIRMWFLNADSCPICRLVTEFIIGTKIIDNFLSKLLSIVDKEFADARQEMIIDRRN 582
            ND L   +K I     S +  +KIL  K        +  E   E+   A   K E+   +   +E++L+C IC E++++   L C H FCS+CI  W    + CPICR           +DNF+ +++  +  +  + RQ +I +R+ 
Sbjct:  315 NDALQEQKKVIVEHALSRQAFEKILSAK-------NKELEATKEEKERARAQKDEVVTQMTEVLENELQCIICSELFIEAVTLNCAHSFCSYCITQWRKKKEECPICRQAITSQSRCLALDNFIERMMENLSLDVKEKRQSVINERKG 455          
BLAST of Postreplication repair E3 ubiquitin-protein ligase RAD18 vs. Ensembl Medaka
Match: rnf8 (ring finger protein 8 [Source:NCBI gene;Acc:101166923])

HSP 1 Score: 73.9442 bits (180), Expect = 5.118e-14
Identity = 42/147 (28.57%), Postives = 70/147 (47.62%), Query Frame = 1
Query:  139 NDNLIPTRKRIRIQEWSDEQTDKILYMKKSFTEKSTQTTETNIEQSAHAETMKAEIYKALLSSIEHDLECGICKEVYLDCCILPCGHIFCSFCIRMWFLNADSCPICRLVTEFIIGTKIIDNFLSKLLSIVDKEFADARQEMIIDRR 579
            ND L   +K I     S +  +KIL  K        +  E   E+   A   K E+   +   +E++L+C IC E++++   L C H FCS+CI  W    + CPICR           +DNF+ +++  +  +  + RQ +I +R+
Sbjct:  315 NDALQEQKKVIVEHALSRQAFEKILSAK-------NKELEATKEEKERARAQKDEVVTQMTEVLENELQCIICSELFIEAVTLNCAHSFCSYCITQWRKKKEECPICRQAITSQSRCLALDNFIERMMENLSLDVKEKRQSVINERK 454          
BLAST of Postreplication repair E3 ubiquitin-protein ligase RAD18 vs. Ensembl Medaka
Match: rnf8 (ring finger protein 8 [Source:NCBI gene;Acc:101166923])

HSP 1 Score: 72.4034 bits (176), Expect = 1.295e-13
Identity = 39/144 (27.08%), Postives = 70/144 (48.61%), Query Frame = 1
Query:  154 PTRKRIRIQEWSDEQT-DKILYMKKSFTEKSTQTTETNIEQSAHAETMKAEIYKALLSSIEHDLECGICKEVYLDCCILPCGHIFCSFCIRMWFLNADSCPICRLVTEFIIGTKIIDNFLSKLLSIVDKEFADARQEMIIDRRN 582
            P +K++ ++     Q  +KIL  K        +  E   E+   A   K E+   +   +E++L+C IC E++++   L C H FCS+CI  W    + CPICR           +DNF+ +++  +  +  + RQ +I +R+ 
Sbjct:  299 PEQKKVIVEHALSRQAFEKILSAK-------NKELEATKEEKERARAQKDEVVTQMTEVLENELQCIICSELFIEAVTLNCAHSFCSYCITQWRKKKEECPICRQAITSQSRCLALDNFIERMMENLSLDVKEKRQSVINERKG 435          
BLAST of Postreplication repair E3 ubiquitin-protein ligase RAD18 vs. Ensembl Medaka
Match: chfr (checkpoint with forkhead and ring finger domains [Source:NCBI gene;Acc:101162609])

HSP 1 Score: 55.8398 bits (133), Expect = 3.784e-8
Identity = 38/152 (25.00%), Postives = 65/152 (42.76%), Query Frame = 1
Query:  142 DNLIPTRKRIRIQEWSDEQTDKILYMKKSFTEKSTQTTETNIEQSAHAETMKAEIYKALLSSIEHDLECGICKEVYLDCCIL-PCGHIFCSFCIRMWFLNADSCPICRLVTEFIIGTKIIDNFLSKLLSIVDKEFADARQEMIIDRRNVLQQ 594
            D+L P  KR ++ +  D++    L            T    +  SA  ++ K+ + +     +E  L C IC+++  DC  L PC H+FC+ C   W   +  CP CR   E I     ++N +   L+   ++         +D RN + Q
Sbjct:  206 DHLEPKLKRRKMSDVLDKECASDLPF----------TACPEVAGSADKDSSKSAVKETKTDKMEESLTCVICQDLLHDCISLQPCMHVFCAACYSGWMERSSLCPTCRCPVERICKNHFLNNLVEAYLTQHPEKCRSEEDLKSMDSRNKITQ 347          
BLAST of Postreplication repair E3 ubiquitin-protein ligase RAD18 vs. Ensembl Medaka
Match: pdzrn3b (PDZ domain containing ring finger 3 [Source:NCBI gene;Acc:101166295])

HSP 1 Score: 51.6026 bits (122), Expect = 8.772e-7
Identity = 18/51 (35.29%), Postives = 31/51 (60.78%), Query Frame = 1
Query:  322 SSIEHDLECGICKEVYLDCCILPCGHIFCSFCIRMWFLNADSCPI-CRLVT 471
             +++ D +C +C +V  +    PCGH+FCS C+  W +   SCP+ C+ V+
Sbjct:   10 GTVDPDFKCNLCNKVLEEPLTTPCGHVFCSGCVLPWVVQQSSCPVKCQRVS 60          
BLAST of Postreplication repair E3 ubiquitin-protein ligase RAD18 vs. Planmine SMEST
Match: SMESG000073471.1 (SMESG000073471.1)

HSP 1 Score: 597.816 bits (1540), Expect = 0.000e+0
Identity = 271/271 (100.00%), Postives = 271/271 (100.00%), Query Frame = 1
Query:  109 METTNQSNVTNDNLIPTRKRIRIQEWSDEQTDKILYMKKSFTEKSTQTTETNIEQSAHAETMKAEIYKALLSSIEHDLECGICKEVYLDCCILPCGHIFCSFCIRMWFLNADSCPICRLVTEFIIGTKIIDNFLSKLLSIVDKEFADARQEMIIDRRNVLQQAESNWVSQNNNHYYTPPDMWQEWLNLQSNNAENDESRNINSEILARHARMSEEVAYDTNNSIQRTSRNIWPWSSNETLAEMSIYRAADNVAHLENENFVVDLDYDEESN 921
            METTNQSNVTNDNLIPTRKRIRIQEWSDEQTDKILYMKKSFTEKSTQTTETNIEQSAHAETMKAEIYKALLSSIEHDLECGICKEVYLDCCILPCGHIFCSFCIRMWFLNADSCPICRLVTEFIIGTKIIDNFLSKLLSIVDKEFADARQEMIIDRRNVLQQAESNWVSQNNNHYYTPPDMWQEWLNLQSNNAENDESRNINSEILARHARMSEEVAYDTNNSIQRTSRNIWPWSSNETLAEMSIYRAADNVAHLENENFVVDLDYDEESN
Sbjct:    1 METTNQSNVTNDNLIPTRKRIRIQEWSDEQTDKILYMKKSFTEKSTQTTETNIEQSAHAETMKAEIYKALLSSIEHDLECGICKEVYLDCCILPCGHIFCSFCIRMWFLNADSCPICRLVTEFIIGTKIIDNFLSKLLSIVDKEFADARQEMIIDRRNVLQQAESNWVSQNNNHYYTPPDMWQEWLNLQSNNAENDESRNINSEILARHARMSEEVAYDTNNSIQRTSRNIWPWSSNETLAEMSIYRAADNVAHLENENFVVDLDYDEESN 271          
BLAST of Postreplication repair E3 ubiquitin-protein ligase RAD18 vs. Planmine SMEST
Match: SMESG000038388.1 (SMESG000038388.1)

HSP 1 Score: 51.9878 bits (123), Expect = 4.941e-7
Identity = 22/52 (42.31%), Postives = 30/52 (57.69%), Query Frame = 1
Query:  343 ECGICKEVYLDCCILPCGHIFCSFCIRMWFLNADSCPICRLVTEFIIGTKII 498
            +C IC E  + C +LPC H F   C+R WF ++  CP CR+V + I G  I 
Sbjct:  350 KCAICWESLMMCRMLPCKHFFHDACLRPWFEHSSLCPTCRIVIKNISGNSIF 401          
BLAST of Postreplication repair E3 ubiquitin-protein ligase RAD18 vs. Planmine SMEST
Match: SMESG000007981.1 (SMESG000007981.1)

HSP 1 Score: 46.9802 bits (110), Expect = 6.777e-6
Identity = 23/69 (33.33%), Postives = 34/69 (49.28%), Query Frame = 1
Query:  328 IEHDLECGICKEVYLDCCILPCGHIFCSFCIRMWFL----NADSCPICRLVTEFIIGTKIIDNFLSKLL 522
            IE  L C IC+E ++   I  CGH FC  C+  W L       +CP+C+   E+     +I+  +  LL
Sbjct:  119 IEDYLRCQICREYFIKPVITNCGHTFCQSCLDQWALRTRYGGGNCPLCQHQIEYTSRNILIETCVEALL 187          
BLAST of Postreplication repair E3 ubiquitin-protein ligase RAD18 vs. Planmine SMEST
Match: SMESG000075024.1 (SMESG000075024.1)

HSP 1 Score: 46.9802 bits (110), Expect = 7.645e-6
Identity = 22/59 (37.29%), Postives = 32/59 (54.24%), Query Frame = 1
Query:  277 AHAETMKAEIYKALLSSIEHDLECGICKEVYLDCCILPCGHIFCSFCIRMWFLNADSCP 453
            + +E  + +IY      I   L C IC++V+ D   L CGH FC  CI  W ++ +SCP
Sbjct:   19 SKSEKFEDKIYFKDPKKISEHLICQICQDVFNDPWCLSCGHTFCRTCITQWIVSNNSCP 77          
BLAST of Postreplication repair E3 ubiquitin-protein ligase RAD18 vs. Planmine SMEST
Match: SMESG000072524.1 (SMESG000072524.1)

HSP 1 Score: 48.1358 bits (113), Expect = 7.973e-6
Identity = 37/126 (29.37%), Postives = 56/126 (44.44%), Query Frame = 1
Query:  301 EIYKALLSSIEHDLECGICKEVYLDCCILPCGHIFCSFCIRMW--FLNADSCPICRLVTEFI--------------IGTKIIDNFL--SKLLSIVDKEFADARQEMIIDRRNVLQQAESNWVSQNN 624
            E Y  + SS E    C IC +   +  + PCGH+ C+FC+  W       SCP CRL  + I                 K ID  L   + +S + K+ +D +  +  D  N +  A+ +WVS N+
Sbjct:  362 EAYSLIDSSFE---LCKICSQNNKNIKLEPCGHLLCNFCLSRWQKSFRCQSCPFCRLEIKGIEKISLIPYDSKNENTQNKSIDCPLVPPRQMSFLQKQISDEKCSLSNDNGNKVNYAQLDWVSGND 484          
The following BLAST results are available for this feature:
BLAST of Postreplication repair E3 ubiquitin-protein ligase RAD18 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RNF88.016e-1128.70ring finger protein 8 [Source:HGNC Symbol;Acc:HGNC... [more]
TRIM651.027e-641.43tripartite motif containing 65 [Source:HGNC Symbol... [more]
RNF1413.129e-635.14ring finger protein 141 [Source:HGNC Symbol;Acc:HG... [more]
CHFR3.932e-631.82checkpoint with forkhead and ring finger domains [... [more]
CBLC4.029e-629.59Cbl proto-oncogene C [Source:HGNC Symbol;Acc:HGNC:... [more]
back to top
BLAST of Postreplication repair E3 ubiquitin-protein ligase RAD18 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
T02C1.18.534e-636.17Uncharacterized RING finger protein T02C1.1 [Sour... [more]
back to top
BLAST of Postreplication repair E3 ubiquitin-protein ligase RAD18 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG136051.020e-643.59gene:FBgn0039150 transcript:FBtr0300705[more]
CG76942.643e-631.94gene:FBgn0038627 transcript:FBtr0290211[more]
CG76942.643e-631.94gene:FBgn0038627 transcript:FBtr0083632[more]
CG76942.643e-631.94gene:FBgn0038627 transcript:FBtr0344291[more]
snama4.535e-639.58gene:FBgn0086129 transcript:FBtr0307174[more]
back to top
BLAST of Postreplication repair E3 ubiquitin-protein ligase RAD18 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rnf87.581e-1022.90ring finger protein 8, E3 ubiquitin protein ligase... [more]
rnf81.095e-923.08ring finger protein 8, E3 ubiquitin protein ligase... [more]
chfr1.296e-821.46checkpoint with forkhead and ring finger domains, ... [more]
chfr2.204e-824.03checkpoint with forkhead and ring finger domains, ... [more]
pdzrn3b5.309e-732.35PDZ domain containing RING finger 3b [Source:NCBI ... [more]
back to top
BLAST of Postreplication repair E3 ubiquitin-protein ligase RAD18 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
bmpr1a3.444e-1227.56bone morphogenetic protein receptor type 1A [Sourc... [more]
bmpr1a5.714e-1227.35bone morphogenetic protein receptor type 1A [Sourc... [more]
adi14.013e-736.36acireductone dioxygenase 1 [Source:Xenbase;Acc:XB-... [more]
chfr5.017e-732.22checkpoint with forkhead and ring finger domains, ... [more]
chfr5.206e-732.22checkpoint with forkhead and ring finger domains, ... [more]
back to top
BLAST of Postreplication repair E3 ubiquitin-protein ligase RAD18 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Rnf86.839e-1332.26ring finger protein 8 [Source:MGI Symbol;Acc:MGI:1... [more]
Gm280438.155e-1332.26predicted gene, 28043 [Source:MGI Symbol;Acc:MGI:5... [more]
Chfr9.985e-726.92checkpoint with forkhead and ring finger domains [... [more]
Chfr1.034e-626.92checkpoint with forkhead and ring finger domains [... [more]
Rnf1811.269e-627.19ring finger protein 181 [Source:MGI Symbol;Acc:MGI... [more]
back to top
BLAST of Postreplication repair E3 ubiquitin-protein ligase RAD18 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q7ZX20|RNF8A_XENLA5.810e-1331.48E3 ubiquitin-protein ligase rnf8-A OS=Xenopus laev... [more]
sp|Q6NRG0|RNF8B_XENLA2.023e-1231.48E3 ubiquitin-protein ligase rnf8-B OS=Xenopus laev... [more]
sp|Q8VC56|RNF8_MOUSE4.784e-1232.26E3 ubiquitin-protein ligase RNF8 OS=Mus musculus O... [more]
sp|Q4KLN8|RNF8_RAT9.847e-1231.48E3 ubiquitin-protein ligase RNF8 OS=Rattus norvegi... [more]
sp|Q2HJ46|RNF8_BOVIN3.886e-1129.36E3 ubiquitin-protein ligase RNF8 OS=Bos taurus OX=... [more]
back to top
BLAST of Postreplication repair E3 ubiquitin-protein ligase RAD18 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A482VSY23.026e-1333.59E3 ubiquitin-protein ligase RNF8-B-like OS=Asbolus... [more]
A0A226ER256.967e-1333.03E3 ubiquitin-protein ligase RNF8 OS=Folsomia candi... [more]
A0A1D2NJZ43.359e-1231.30E3 ubiquitin-protein ligase RNF8 OS=Orchesella cin... [more]
A0A3Q2DNY54.147e-1229.46E3 ubiquitin-protein ligase RNF8 OS=Cyprinodon var... [more]
E9H7V51.266e-1126.90Uncharacterized protein OS=Daphnia pulex OX=6669 G... [more]
back to top
BLAST of Postreplication repair E3 ubiquitin-protein ligase RAD18 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rnf88.294e-1225.38ring finger protein 8 [Source:NCBI gene;Acc:103022... [more]
rnf81.565e-1029.17ring finger protein 8 [Source:NCBI gene;Acc:103022... [more]
ENSAMXT00000050225.16.327e-840.48pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
pdzrn3b5.823e-739.58PDZ domain containing ring finger 3 [Source:NCBI g... [more]
chfr8.697e-730.16checkpoint with forkhead and ring finger domains, ... [more]
back to top
BLAST of Postreplication repair E3 ubiquitin-protein ligase RAD18 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000008284.11.271e-1027.72pep scaffold:Pmarinus_7.0:GL492550:1249:4726:-1 ge... [more]
ENSPMAT00000008283.11.432e-1027.72pep scaffold:Pmarinus_7.0:GL492550:1249:4726:-1 ge... [more]
ENSPMAT00000010742.11.531e-641.03pep scaffold:Pmarinus_7.0:GL476415:275167:281055:1... [more]
ENSPMAT00000010759.12.125e-641.56pep scaffold:Pmarinus_7.0:GL476415:846545:851388:1... [more]
cop14.630e-628.89COP1 E3 ubiquitin ligase [Source:ZFIN;Acc:ZDB-GENE... [more]
back to top
BLAST of Postreplication repair E3 ubiquitin-protein ligase RAD18 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
RAD185.828e-937.50E3 ubiquitin ligase; forms heterodimer with Rad6p ... [more]
back to top
BLAST of Postreplication repair E3 ubiquitin-protein ligase RAD18 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO485941.853e-1024.82Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO482362.740e-640.43Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO309973.082e-642.86Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO323144.938e-642.86Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO483225.447e-642.86Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Postreplication repair E3 ubiquitin-protein ligase RAD18 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rnf82.826e-1428.38ring finger protein 8 [Source:NCBI gene;Acc:101166... [more]
rnf85.118e-1428.57ring finger protein 8 [Source:NCBI gene;Acc:101166... [more]
rnf81.295e-1327.08ring finger protein 8 [Source:NCBI gene;Acc:101166... [more]
chfr3.784e-825.00checkpoint with forkhead and ring finger domains [... [more]
pdzrn3b8.772e-735.29PDZ domain containing ring finger 3 [Source:NCBI g... [more]
back to top
BLAST of Postreplication repair E3 ubiquitin-protein ligase RAD18 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000073471.10.000e+0100.00SMESG000073471.1[more]
SMESG000038388.14.941e-742.31SMESG000038388.1[more]
SMESG000007981.16.777e-633.33SMESG000007981.1[more]
SMESG000075024.17.645e-637.29SMESG000075024.1[more]
SMESG000072524.17.973e-629.37SMESG000072524.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30009041 ID=SMED30009041|Name=Postreplication repair E3 ubiquitin-protein ligase RAD18|organism=Schmidtea mediterranea sexual|type=transcript|length=1079bp
TAATGATTTATGATGAAAGGAAAATATTGGCGTTTACATAAACTAAATGG
AATTAAATATGAAATTTGATCAATAAATAATTCAATGTTGAATATATTTT
TATTAAAAATGGAAACGACGAATCAATCCAATGTTACCAATGACAATTTG
ATTCCAACAAGAAAGCGGATTAGAATTCAAGAATGGTCGGACGAGCAGAC
TGATAAGATTCTTTATATGAAAAAATCTTTTACTGAAAAATCTACGCAAA
CGACTGAAACAAATATCGAACAATCCGCTCATGCTGAAACTATGAAAGCT
GAAATATACAAAGCATTGCTTTCAAGTATTGAACATGATTTAGAATGTGG
AATATGTAAAGAAGTTTATTTAGATTGTTGTATTTTGCCATGTGGTCATA
TATTTTGTTCATTTTGTATTAGAATGTGGTTTCTAAATGCTGATTCTTGT
CCCATTTGTAGACTTGTTACAGAATTTATTATCGGAACTAAAATCATAGA
TAATTTTTTATCAAAACTCTTATCAATTGTCGATAAAGAATTTGCAGATG
CGCGTCAGGAAATGATTATCGATCGTAGAAATGTTTTGCAACAAGCAGAG
TCAAATTGGGTATCTCAGAATAATAATCATTATTATACACCTCCAGATAT
GTGGCAAGAATGGTTGAATTTACAGTCAAATAATGCTGAAAATGATGAAA
GTAGAAATATCAATTCGGAAATACTTGCTCGACATGCGAGAATGTCAGAA
GAAGTGGCGTATGATACTAATAATTCCATACAAAGGACTTCTAGAAATAT
ATGGCCCTGGTCAAGTAATGAAACTTTAGCTGAAATGAGCATTTATCGAG
CAGCTGATAATGTTGCACATTTAGAAAATGAAAATTTTGTCGTTGATCTT
GATTATGACGAAGAATCTAACAGTTAGAAATCAAAAATGATTATGATTAA
TGAATTTGATTTCAATAATTACTATTTGTAGCTAAACAATTTAAAAATCA
TGAATTTTCAGATGAAAATAACAGTTTTGATTGAAAAATAATGATTGTGC
AATTAATTTTATACATAATTATTAAAAAT
back to top

protein sequence of SMED30009041-orf-1

>SMED30009041-orf-1 ID=SMED30009041-orf-1|Name=SMED30009041-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=281bp
MLNIFLLKMETTNQSNVTNDNLIPTRKRIRIQEWSDEQTDKILYMKKSFT
EKSTQTTETNIEQSAHAETMKAEIYKALLSSIEHDLECGICKEVYLDCCI
LPCGHIFCSFCIRMWFLNADSCPICRLVTEFIIGTKIIDNFLSKLLSIVD
KEFADARQEMIIDRRNVLQQAESNWVSQNNNHYYTPPDMWQEWLNLQSNN
AENDESRNINSEILARHARMSEEVAYDTNNSIQRTSRNIWPWSSNETLAE
MSIYRAADNVAHLENENFVVDLDYDEESNS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0000790nuclear chromatin
GO:0097505Rad6-Rad18 complex
GO:0000151ubiquitin ligase complex
GO:0000781chromosome, telomeric region
GO:0005634nucleus
GO:0035861site of double-strand break
Vocabulary: molecular function
TermDefinition
GO:0003677DNA binding
GO:0003697single-stranded DNA binding
GO:0017116single-stranded DNA-dependent ATP-dependent DNA helicase activity
GO:0061630ubiquitin protein ligase activity
GO:0008270zinc ion binding
GO:0005515protein binding
GO:0003682chromatin binding
GO:0004842ubiquitin-protein transferase activity
GO:0016740transferase activity
GO:0042393histone binding
GO:0042803protein homodimerization activity
GO:0046872metal ion binding
Vocabulary: biological process
TermDefinition
GO:0006301postreplication repair
GO:0006513protein monoubiquitination
GO:0032508DNA duplex unwinding
GO:0042275error-free postreplication DNA repair
GO:0042276error-prone translesion synthesis
GO:0070987error-free translesion synthesis
GO:0006281DNA repair
GO:0006302double-strand break repair
GO:0006303double-strand break repair via nonhomologous end joining
GO:0006511ubiquitin-dependent protein catabolic process
GO:0006974cellular response to DNA damage stimulus
GO:0007286spermatid development
GO:0010212response to ionizing radiation
GO:0016567protein ubiquitination
GO:0016569covalent chromatin modification
GO:0033522histone H2A ubiquitination
GO:0033523histone H2B ubiquitination
GO:0034244negative regulation of transcription elongation from RNA polymerase II promoter
GO:0043486histone exchange
GO:0045190isotype switching
GO:0045739positive regulation of DNA repair
GO:0070534protein K63-linked ubiquitination
GO:0070535histone H2A K63-linked ubiquitination
GO:0070936protein K48-linked ubiquitination
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000208testis
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR001841Znf_RING
IPR013083Znf_RING/FYVE/PHD
IPR017907Znf_RING_CS