Deoxycytidylate deaminase

Overview
NameDeoxycytidylate deaminase
Smed IDSMED30009032
Length (bp)857
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Deoxycytidylate deaminase (SMED30009032) t-SNE clustered cells

Violin plots show distribution of expression levels for Deoxycytidylate deaminase (SMED30009032) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Deoxycytidylate deaminase (SMED30009032) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Deoxycytidylate deaminase (SMED30009032) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30009032

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30009032SMESG000023231.1 SmedASXL_004592SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30009032SMESG000023231.1 SmedASXL_004592SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
neoblastSMED30009032SMESG000023231.1 dd_Smed_v4_6803_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30009032SMESG000023231.1 dd_Smed_v6_6803_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
zeta neoblastSMED30009032SMESG000023231.1 dd_Smed_v4_6803_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
neoblastSMED30009032SMESG000023231.1 SMED_05867_V2_1GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30009032SMESG000023231.1 SMED_05867_V2_1GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30009032SMESG000023231.1 SMED_05867_V2_1rGPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30009032SMESG000023231.1 SMED_05867_V2_1rGPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Deoxycytidylate deaminase vs. Ensembl Human
Match: DCTD (dCMP deaminase [Source:HGNC Symbol;Acc:HGNC:2710])

HSP 1 Score: 187.578 bits (475), Expect = 3.268e-59
Identity = 84/157 (53.50%), Postives = 113/157 (71.97%), Query Frame = 3
Query:  159 SSAKRNDYINWDEYFMSIAILSSMRSKDPVTQVGACIVNDKNQVVGVGYNGMPRGLPDDEMPWEKHNADRLLNKYFYVVHAELNAVLNKNCIDLMNCKIYTTLFPCNECTKVIIQSGITEVIYLSDKKHNAEPSKASKFMLEKAKVKLTAF---CSK 620
            S  KR+DY+ W EYFM++A LS+ RSKDP +QVGACIVN +N++VG+GYNGMP G  DD +PW +   ++L  KY YV HAELNA++NKN  D+  C +Y  LFPCNEC K+IIQ+GI EVI++SDK H+++ + A++ +   A V    F   CSK
Sbjct:    5 SCKKRDDYLEWPEYFMAVAFLSAQRSKDPNSQVGACIVNSENKIVGIGYNGMPNGCSDDVLPWRRTAENKLDTKYPYVCHAELNAIMNKNSTDVKGCSMYVALFPCNECAKLIIQAGIKEVIFMSDKYHDSDEATAARLLFNMAGVTFRKFIPKCSK 161          
BLAST of Deoxycytidylate deaminase vs. Ensembl Human
Match: DCTD (dCMP deaminase [Source:HGNC Symbol;Acc:HGNC:2710])

HSP 1 Score: 187.963 bits (476), Expect = 3.662e-59
Identity = 84/157 (53.50%), Postives = 113/157 (71.97%), Query Frame = 3
Query:  159 SSAKRNDYINWDEYFMSIAILSSMRSKDPVTQVGACIVNDKNQVVGVGYNGMPRGLPDDEMPWEKHNADRLLNKYFYVVHAELNAVLNKNCIDLMNCKIYTTLFPCNECTKVIIQSGITEVIYLSDKKHNAEPSKASKFMLEKAKVKLTAF---CSK 620
            S  KR+DY+ W EYFM++A LS+ RSKDP +QVGACIVN +N++VG+GYNGMP G  DD +PW +   ++L  KY YV HAELNA++NKN  D+  C +Y  LFPCNEC K+IIQ+GI EVI++SDK H+++ + A++ +   A V    F   CSK
Sbjct:    5 SCKKRDDYLEWPEYFMAVAFLSAQRSKDPNSQVGACIVNSENKIVGIGYNGMPNGCSDDVLPWRRTAENKLDTKYPYVCHAELNAIMNKNSTDVKGCSMYVALFPCNECAKLIIQAGIKEVIFMSDKYHDSDEATAARLLFNMAGVTFRKFIPKCSK 161          
BLAST of Deoxycytidylate deaminase vs. Ensembl Human
Match: DCTD (dCMP deaminase [Source:HGNC Symbol;Acc:HGNC:2710])

HSP 1 Score: 187.963 bits (476), Expect = 3.662e-59
Identity = 84/157 (53.50%), Postives = 113/157 (71.97%), Query Frame = 3
Query:  159 SSAKRNDYINWDEYFMSIAILSSMRSKDPVTQVGACIVNDKNQVVGVGYNGMPRGLPDDEMPWEKHNADRLLNKYFYVVHAELNAVLNKNCIDLMNCKIYTTLFPCNECTKVIIQSGITEVIYLSDKKHNAEPSKASKFMLEKAKVKLTAF---CSK 620
            S  KR+DY+ W EYFM++A LS+ RSKDP +QVGACIVN +N++VG+GYNGMP G  DD +PW +   ++L  KY YV HAELNA++NKN  D+  C +Y  LFPCNEC K+IIQ+GI EVI++SDK H+++ + A++ +   A V    F   CSK
Sbjct:    5 SCKKRDDYLEWPEYFMAVAFLSAQRSKDPNSQVGACIVNSENKIVGIGYNGMPNGCSDDVLPWRRTAENKLDTKYPYVCHAELNAIMNKNSTDVKGCSMYVALFPCNECAKLIIQAGIKEVIFMSDKYHDSDEATAARLLFNMAGVTFRKFIPKCSK 161          
BLAST of Deoxycytidylate deaminase vs. Ensembl Human
Match: DCTD (dCMP deaminase [Source:HGNC Symbol;Acc:HGNC:2710])

HSP 1 Score: 187.963 bits (476), Expect = 5.604e-59
Identity = 84/157 (53.50%), Postives = 113/157 (71.97%), Query Frame = 3
Query:  159 SSAKRNDYINWDEYFMSIAILSSMRSKDPVTQVGACIVNDKNQVVGVGYNGMPRGLPDDEMPWEKHNADRLLNKYFYVVHAELNAVLNKNCIDLMNCKIYTTLFPCNECTKVIIQSGITEVIYLSDKKHNAEPSKASKFMLEKAKVKLTAF---CSK 620
            S  KR+DY+ W EYFM++A LS+ RSKDP +QVGACIVN +N++VG+GYNGMP G  DD +PW +   ++L  KY YV HAELNA++NKN  D+  C +Y  LFPCNEC K+IIQ+GI EVI++SDK H+++ + A++ +   A V    F   CSK
Sbjct:   16 SCKKRDDYLEWPEYFMAVAFLSAQRSKDPNSQVGACIVNSENKIVGIGYNGMPNGCSDDVLPWRRTAENKLDTKYPYVCHAELNAIMNKNSTDVKGCSMYVALFPCNECAKLIIQAGIKEVIFMSDKYHDSDEATAARLLFNMAGVTFRKFIPKCSK 172          
BLAST of Deoxycytidylate deaminase vs. Ensembl Human
Match: DCTD (dCMP deaminase [Source:HGNC Symbol;Acc:HGNC:2710])

HSP 1 Score: 157.918 bits (398), Expect = 2.848e-48
Identity = 68/116 (58.62%), Postives = 88/116 (75.86%), Query Frame = 3
Query:  159 SSAKRNDYINWDEYFMSIAILSSMRSKDPVTQVGACIVNDKNQVVGVGYNGMPRGLPDDEMPWEKHNADRLLNKYFYVVHAELNAVLNKNCIDLMNCKIYTTLFPCNECTKVIIQS 506
            S  KR+DY+ W EYFM++A LS+ RSKDP +QVGACIVN +N++VG+GYNGMP G  DD +PW +   ++L  KY YV HAELNA++NKN  D+  C +Y  LFPCNEC K+IIQ+
Sbjct:    5 SCKKRDDYLEWPEYFMAVAFLSAQRSKDPNSQVGACIVNSENKIVGIGYNGMPNGCSDDVLPWRRTAENKLDTKYPYVCHAELNAIMNKNSTDVKGCSMYVALFPCNECAKLIIQA 120          
BLAST of Deoxycytidylate deaminase vs. Ensembl Celegans
Match: ZK643.2 (Probable deoxycytidylate deaminase [Source:UniProtKB/Swiss-Prot;Acc:P30648])

HSP 1 Score: 133.65 bits (335), Expect = 3.016e-38
Identity = 73/169 (43.20%), Postives = 106/169 (62.72%), Query Frame = 3
Query:  102 TKMENLSINVTDEKYNFNGSSAKRNDYINWD----EYFMSIAILSSMRSKDPVTQVGACIVNDKNQVVGVGYNGMPRGLPDDEMPWEKHNADRLLNKYFYVVHAELNAVLNKNCIDLMNCKIYTTLFPCNECTKVIIQSGITEVIYLSDKKHNAEPSKASKFMLEKAKV 596
            T +E L IN+         S AK+    N D    + F+ IA ++S+RSKDP TQVG  IV+  N +V VGYNG P G+ DD   W+K + +   NK+ YVVHAE+NA++NK C  L +C +Y TLFPCN+C +++IQS + +V +L ++   A   +ASK ML+ A++
Sbjct:   25 TTLERLKINI--------NSDAKKLVDTNGDLKKHQRFLRIAKVTSLRSKDPNTQVGCVIVDKDNCIVSVGYNGFPIGVDDDVFRWDKEDPED--NKHLYVVHAEMNAIINKRCTTLHDCTVYVTLFPCNKCAQMLIQSRVKKVYFLENRDELA--FRASKKMLDHARL 181          
BLAST of Deoxycytidylate deaminase vs. Ensembl Fly
Match: CG6951 (gene:FBgn0036959 transcript:FBtr0074829)

HSP 1 Score: 173.711 bits (439), Expect = 1.358e-53
Identity = 82/161 (50.93%), Postives = 110/161 (68.32%), Query Frame = 3
Query:  162 SAKRNDYINWDEYFMSIAILSSMRSKDPVTQVGACIVNDKNQVVGVGYNGMPRGLPDDEMPWEK-----HNADRLLNKYFYVVHAELNAVLNKNCIDLMNCKIYTTLFPCNECTKVIIQSGITEVIYLSDKKHNAEPSKASKFMLEKAKVKLTAFCSKNKS 629
            S KR +Y++WD+YFM+ ++LS+ RSKDPVTQVGACIV+ +N++V +GYNG PR   DD  PW K        D L +K  YVVHAE NA+LN N + L   ++YTTLFPCNEC K+IIQ GI++V+YLSDK  +    +ASK ML+   V+      + K+
Sbjct:   19 SHKRKEYLHWDDYFMATSLLSAKRSKDPVTQVGACIVDSQNRIVAIGYNGFPRNCSDDVFPWSKAKKGSQEFDPLEDKKMYVVHAEANAILNSNGMSLSGTRLYTTLFPCNECAKLIIQVGISQVLYLSDKYADKPTYRASKRMLDAVGVEYKRHIPQKKT 179          
BLAST of Deoxycytidylate deaminase vs. Ensembl Fly
Match: CG6951 (gene:FBgn0036959 transcript:FBtr0074828)

HSP 1 Score: 173.711 bits (439), Expect = 1.358e-53
Identity = 82/161 (50.93%), Postives = 110/161 (68.32%), Query Frame = 3
Query:  162 SAKRNDYINWDEYFMSIAILSSMRSKDPVTQVGACIVNDKNQVVGVGYNGMPRGLPDDEMPWEK-----HNADRLLNKYFYVVHAELNAVLNKNCIDLMNCKIYTTLFPCNECTKVIIQSGITEVIYLSDKKHNAEPSKASKFMLEKAKVKLTAFCSKNKS 629
            S KR +Y++WD+YFM+ ++LS+ RSKDPVTQVGACIV+ +N++V +GYNG PR   DD  PW K        D L +K  YVVHAE NA+LN N + L   ++YTTLFPCNEC K+IIQ GI++V+YLSDK  +    +ASK ML+   V+      + K+
Sbjct:   19 SHKRKEYLHWDDYFMATSLLSAKRSKDPVTQVGACIVDSQNRIVAIGYNGFPRNCSDDVFPWSKAKKGSQEFDPLEDKKMYVVHAEANAILNSNGMSLSGTRLYTTLFPCNECAKLIIQVGISQVLYLSDKYADKPTYRASKRMLDAVGVEYKRHIPQKKT 179          
BLAST of Deoxycytidylate deaminase vs. Ensembl Zebrafish
Match: dctd (dCMP deaminase [Source:ZFIN;Acc:ZDB-GENE-050417-116])

HSP 1 Score: 186.808 bits (473), Expect = 1.411e-58
Identity = 88/170 (51.76%), Postives = 114/170 (67.06%), Query Frame = 3
Query:  117 LSINVTDEKYNFNGSSA-----KRNDYINWDEYFMSIAILSSMRSKDPVTQVGACIVNDKNQVVGVGYNGMPRGLPDDEMPWEKHNADRLLNKYFYVVHAELNAVLNKNCIDLMNCKIYTTLFPCNECTKVIIQSGITEVIYLSDKKHNAEPSKASKFMLEKAKVKLTAF 611
            + +   DE    NG+ +     KR DY+ W EYFM++A LS+ RSKDP +QVGACIVN +N++VG+GYNGMP G  DD +PW +   ++L  KY YV HAELNA++NKN  D+  C IY  LFPCNEC K+IIQ+GI +VIYLSDK H+     AS+ +L  A V    F
Sbjct:    1 MDVKGKDEIVQLNGNHSECLTKKRQDYLEWPEYFMAVAFLSAQRSKDPNSQVGACIVNQENKIVGIGYNGMPNGCDDDLLPWSRSADNKLDTKYPYVCHAELNAIMNKNSADVKGCSIYVALFPCNECAKLIIQAGIKDVIYLSDKYHDTPEMTASRRLLNLAGVTYKQF 170          
BLAST of Deoxycytidylate deaminase vs. Ensembl Zebrafish
Match: cdadc1 (cytidine and dCMP deaminase domain containing 1 [Source:NCBI gene;Acc:492807])

HSP 1 Score: 55.4546 bits (132), Expect = 2.624e-8
Identity = 42/125 (33.60%), Postives = 60/125 (48.00%), Query Frame = 3
Query:  213 AILSSMRSKDPVTQVGACIVNDKNQ----------VVGVGYNGMPRGLPDDEMPWEKHNADRLLN-KYFYVVHAELNAVLNKNCIDLM--NCKIYTTLFPCNECTKVIIQSGITEVIYLSDKKHN 548
            A L + R++DP   VGA I  +  Q          +VG GYN  P G    E P   H  +   N KY Y++HAE NA+  ++       N  ++ T  PC+EC  +I  +GI + IY +D   N
Sbjct:  321 ARLLACRTEDPKVGVGAVIWAEGKQSQCDGTGQLYLVGCGYNAYPVGSQYAEYPQMDHKQEERQNRKYRYILHAEQNALTFRSAEIKAEDNTMMFVTKCPCDECVPLIGCAGIKQ-IYTTDLDSN 444          
BLAST of Deoxycytidylate deaminase vs. Ensembl Zebrafish
Match: cdadc1 (cytidine and dCMP deaminase domain containing 1 [Source:NCBI gene;Acc:492807])

HSP 1 Score: 55.4546 bits (132), Expect = 2.927e-8
Identity = 42/125 (33.60%), Postives = 60/125 (48.00%), Query Frame = 3
Query:  213 AILSSMRSKDPVTQVGACIVNDKNQ----------VVGVGYNGMPRGLPDDEMPWEKHNADRLLN-KYFYVVHAELNAVLNKNCIDLM--NCKIYTTLFPCNECTKVIIQSGITEVIYLSDKKHN 548
            A L + R++DP   VGA I  +  Q          +VG GYN  P G    E P   H  +   N KY Y++HAE NA+  ++       N  ++ T  PC+EC  +I  +GI + IY +D   N
Sbjct:  321 ARLLACRTEDPKVGVGAVIWAEGKQSQCDGTGQLYLVGCGYNAYPVGSQYAEYPQMDHKQEERQNRKYRYILHAEQNALTFRSAEIKAEDNTMMFVTKCPCDECVPLIGCAGIKQ-IYTTDLDSN 444          
BLAST of Deoxycytidylate deaminase vs. Ensembl Xenopus
Match: dctd (dCMP deaminase [Source:NCBI gene;Acc:549019])

HSP 1 Score: 193.741 bits (491), Expect = 2.802e-61
Identity = 86/158 (54.43%), Postives = 115/158 (72.78%), Query Frame = 3
Query:  153 NGSSAKRNDYINWDEYFMSIAILSSMRSKDPVTQVGACIVNDKNQVVGVGYNGMPRGLPDDEMPWEKHNADRLLNKYFYVVHAELNAVLNKNCIDLMNCKIYTTLFPCNECTKVIIQSGITEVIYLSDKKHNAEPSKASKFMLEKAKVKLTAFCSKNK 626
            N  S KR DY+ W EYFM++A L++ RSKDP +QVGACIVN +N++VG+GYNGMP G  DD +PW +   DRL  KY YV HAELNA++NKN  D+  C +Y  LFPCNEC K++IQ+GI EVI++SDK H++   KA++ M + A +K T F  K++
Sbjct:   14 NSLSKKREDYLEWCEYFMAVAFLAAQRSKDPNSQVGACIVNSENKIVGIGYNGMPNGCHDDVLPWARTAEDRLDTKYPYVCHAELNAIMNKNTADVKGCTMYVALFPCNECAKLVIQAGIKEVIFMSDKYHDSPDMKAARHMFDLAGIKYTKFIPKHR 171          
BLAST of Deoxycytidylate deaminase vs. Ensembl Xenopus
Match: slc35f1 (solute carrier family 35 member F1 [Source:Xenbase;Acc:XB-GENE-5866569])

HSP 1 Score: 50.447 bits (119), Expect = 1.521e-6
Identity = 38/124 (30.65%), Postives = 58/124 (46.77%), Query Frame = 3
Query:  213 AILSSMRSKDPVTQVGACIVNDKN------------QVVGVGYNGMPRGLPDDEMP-WEKHNADRLLNKYFYVVHAELNAVLNKNCIDL---MNCKIYTTLFPCNECTKVIIQSGITEVIYLSD 536
            A L + R +D  T VGA I  ++               +G GYN  P G    + P  +    DR + K+ Y++HAE NA+  + C ++       I+ T  PC+EC  +I  +GI + IY  D
Sbjct:  302 ARLLAYRGEDHKTGVGAVIWAERKFGGVDCDGTGSLYFLGCGYNAFPVGSEYADFPHMDDKQKDREIRKFRYIIHAEQNAITFR-CNEINPEEKTMIFVTKCPCDECVPLIKGAGIQQ-IYAGD 423          
BLAST of Deoxycytidylate deaminase vs. Ensembl Mouse
Match: Dctd (dCMP deaminase [Source:MGI Symbol;Acc:MGI:2444529])

HSP 1 Score: 190.274 bits (482), Expect = 4.175e-60
Identity = 83/154 (53.90%), Postives = 112/154 (72.73%), Query Frame = 3
Query:  159 SSAKRNDYINWDEYFMSIAILSSMRSKDPVTQVGACIVNDKNQVVGVGYNGMPRGLPDDEMPWEKHNADRLLNKYFYVVHAELNAVLNKNCIDLMNCKIYTTLFPCNECTKVIIQSGITEVIYLSDKKHNAEPSKASKFMLEKAKVKLTAFCSK 620
            S  KR+DY+ W EYFM++A LS+ RSKDP +QVGACIVN +N++VG+GYNGMP G  DD +PW +   ++L  KY YV HAELNA++NKN  D+  C +Y  LFPCNEC K+IIQ+GI EVI++SDK H++E + A++ + + A V    F  K
Sbjct:   11 SCKKRDDYLEWPEYFMAVAFLSAQRSKDPSSQVGACIVNTENKIVGIGYNGMPNGCSDDLLPWRRTAENKLDTKYPYVCHAELNAIMNKNSADVKGCSMYVALFPCNECAKLIIQAGIKEVIFMSDKYHDSEETTAARLLFKLAGVTFRKFTPK 164          
BLAST of Deoxycytidylate deaminase vs. Ensembl Mouse
Match: Dctd (dCMP deaminase [Source:MGI Symbol;Acc:MGI:2444529])

HSP 1 Score: 190.274 bits (482), Expect = 4.175e-60
Identity = 83/154 (53.90%), Postives = 112/154 (72.73%), Query Frame = 3
Query:  159 SSAKRNDYINWDEYFMSIAILSSMRSKDPVTQVGACIVNDKNQVVGVGYNGMPRGLPDDEMPWEKHNADRLLNKYFYVVHAELNAVLNKNCIDLMNCKIYTTLFPCNECTKVIIQSGITEVIYLSDKKHNAEPSKASKFMLEKAKVKLTAFCSK 620
            S  KR+DY+ W EYFM++A LS+ RSKDP +QVGACIVN +N++VG+GYNGMP G  DD +PW +   ++L  KY YV HAELNA++NKN  D+  C +Y  LFPCNEC K+IIQ+GI EVI++SDK H++E + A++ + + A V    F  K
Sbjct:   11 SCKKRDDYLEWPEYFMAVAFLSAQRSKDPSSQVGACIVNTENKIVGIGYNGMPNGCSDDLLPWRRTAENKLDTKYPYVCHAELNAIMNKNSADVKGCSMYVALFPCNECAKLIIQAGIKEVIFMSDKYHDSEETTAARLLFKLAGVTFRKFTPK 164          
BLAST of Deoxycytidylate deaminase vs. Ensembl Mouse
Match: Dctd (dCMP deaminase [Source:MGI Symbol;Acc:MGI:2444529])

HSP 1 Score: 190.274 bits (482), Expect = 4.175e-60
Identity = 83/154 (53.90%), Postives = 112/154 (72.73%), Query Frame = 3
Query:  159 SSAKRNDYINWDEYFMSIAILSSMRSKDPVTQVGACIVNDKNQVVGVGYNGMPRGLPDDEMPWEKHNADRLLNKYFYVVHAELNAVLNKNCIDLMNCKIYTTLFPCNECTKVIIQSGITEVIYLSDKKHNAEPSKASKFMLEKAKVKLTAFCSK 620
            S  KR+DY+ W EYFM++A LS+ RSKDP +QVGACIVN +N++VG+GYNGMP G  DD +PW +   ++L  KY YV HAELNA++NKN  D+  C +Y  LFPCNEC K+IIQ+GI EVI++SDK H++E + A++ + + A V    F  K
Sbjct:   11 SCKKRDDYLEWPEYFMAVAFLSAQRSKDPSSQVGACIVNTENKIVGIGYNGMPNGCSDDLLPWRRTAENKLDTKYPYVCHAELNAIMNKNSADVKGCSMYVALFPCNECAKLIIQAGIKEVIFMSDKYHDSEETTAARLLFKLAGVTFRKFTPK 164          
BLAST of Deoxycytidylate deaminase vs. Ensembl Mouse
Match: Dctd (dCMP deaminase [Source:MGI Symbol;Acc:MGI:2444529])

HSP 1 Score: 158.688 bits (400), Expect = 2.608e-48
Identity = 68/116 (58.62%), Postives = 88/116 (75.86%), Query Frame = 3
Query:  159 SSAKRNDYINWDEYFMSIAILSSMRSKDPVTQVGACIVNDKNQVVGVGYNGMPRGLPDDEMPWEKHNADRLLNKYFYVVHAELNAVLNKNCIDLMNCKIYTTLFPCNECTKVIIQS 506
            S  KR+DY+ W EYFM++A LS+ RSKDP +QVGACIVN +N++VG+GYNGMP G  DD +PW +   ++L  KY YV HAELNA++NKN  D+  C +Y  LFPCNEC K+IIQ+
Sbjct:   11 SCKKRDDYLEWPEYFMAVAFLSAQRSKDPSSQVGACIVNTENKIVGIGYNGMPNGCSDDLLPWRRTAENKLDTKYPYVCHAELNAIMNKNSADVKGCSMYVALFPCNECAKLIIQA 126          
BLAST of Deoxycytidylate deaminase vs. Ensembl Mouse
Match: Dctd (dCMP deaminase [Source:MGI Symbol;Acc:MGI:2444529])

HSP 1 Score: 103.99 bits (258), Expect = 1.173e-27
Identity = 44/77 (57.14%), Postives = 58/77 (75.32%), Query Frame = 3
Query:  159 SSAKRNDYINWDEYFMSIAILSSMRSKDPVTQVGACIVNDKNQVVGVGYNGMPRGLPDDEMPWEKHNADRLLNKYFY 389
            S  KR+DY+ W EYFM++A LS+ RSKDP +QVGACIVN +N++VG+GYNGMP G  DD +PW +   ++L  KY Y
Sbjct:   11 SCKKRDDYLEWPEYFMAVAFLSAQRSKDPSSQVGACIVNTENKIVGIGYNGMPNGCSDDLLPWRRTAENKLDTKYPY 87          
BLAST of Deoxycytidylate deaminase vs. UniProt/SwissProt
Match: sp|Q5RC69|DCTD_PONAB (Deoxycytidylate deaminase OS=Pongo abelii OX=9601 GN=DCTD PE=2 SV=1)

HSP 1 Score: 191.045 bits (484), Expect = 1.165e-59
Identity = 84/157 (53.50%), Postives = 115/157 (73.25%), Query Frame = 3
Query:  159 SSAKRNDYINWDEYFMSIAILSSMRSKDPVTQVGACIVNDKNQVVGVGYNGMPRGLPDDEMPWEKHNADRLLNKYFYVVHAELNAVLNKNCIDLMNCKIYTTLFPCNECTKVIIQSGITEVIYLSDKKHNAEPSKASKFMLEKAKVKLTAF---CSK 620
            S  KR+DY+ W EYFM++A LS+ RSKDP +QVGACIVN +N++VG+GYNGMP G  DD++PW +   ++L  KY YV HAELNA++NKN  D+  C +Y  LFPCNEC K+IIQ+GI EVI++SDK H+++ + A++ + + A V    F   CSK
Sbjct:    5 SCKKRDDYLEWPEYFMAVAFLSAQRSKDPNSQVGACIVNSENKIVGIGYNGMPNGCSDDQLPWRRTAKNKLDTKYPYVCHAELNAIMNKNSTDVKGCSMYVALFPCNECAKLIIQAGIKEVIFMSDKYHDSDEATAARLLFDMAGVTFRKFIPKCSK 161          
BLAST of Deoxycytidylate deaminase vs. UniProt/SwissProt
Match: sp|Q5M9G0|DCTD_RAT (Deoxycytidylate deaminase OS=Rattus norvegicus OX=10116 GN=Dctd PE=2 SV=1)

HSP 1 Score: 190.274 bits (482), Expect = 2.385e-59
Identity = 83/154 (53.90%), Postives = 112/154 (72.73%), Query Frame = 3
Query:  159 SSAKRNDYINWDEYFMSIAILSSMRSKDPVTQVGACIVNDKNQVVGVGYNGMPRGLPDDEMPWEKHNADRLLNKYFYVVHAELNAVLNKNCIDLMNCKIYTTLFPCNECTKVIIQSGITEVIYLSDKKHNAEPSKASKFMLEKAKVKLTAFCSK 620
            S  KR+DY+ W EYFM++A LS+ RSKDP +QVGACIVN +N++VG+GYNGMP G  DD +PW +   ++L  KY YV HAELNA++NKN  D+  C +Y  LFPCNEC K+IIQ+GI EVI++SDK H++E + A++ + + A V    F  K
Sbjct:    5 SCKKRDDYLEWPEYFMAVAFLSAQRSKDPSSQVGACIVNTENKIVGIGYNGMPNGCSDDLLPWRRTAENKLDTKYPYVCHAELNAIMNKNSADVKGCSMYVALFPCNECAKLIIQAGIKEVIFMSDKYHDSEETTAARLLFKLAGVTFRKFTPK 158          
BLAST of Deoxycytidylate deaminase vs. UniProt/SwissProt
Match: sp|Q8K2D6|DCTD_MOUSE (Deoxycytidylate deaminase OS=Mus musculus OX=10090 GN=Dctd PE=2 SV=1)

HSP 1 Score: 190.274 bits (482), Expect = 2.385e-59
Identity = 83/154 (53.90%), Postives = 112/154 (72.73%), Query Frame = 3
Query:  159 SSAKRNDYINWDEYFMSIAILSSMRSKDPVTQVGACIVNDKNQVVGVGYNGMPRGLPDDEMPWEKHNADRLLNKYFYVVHAELNAVLNKNCIDLMNCKIYTTLFPCNECTKVIIQSGITEVIYLSDKKHNAEPSKASKFMLEKAKVKLTAFCSK 620
            S  KR+DY+ W EYFM++A LS+ RSKDP +QVGACIVN +N++VG+GYNGMP G  DD +PW +   ++L  KY YV HAELNA++NKN  D+  C +Y  LFPCNEC K+IIQ+GI EVI++SDK H++E + A++ + + A V    F  K
Sbjct:    5 SCKKRDDYLEWPEYFMAVAFLSAQRSKDPSSQVGACIVNTENKIVGIGYNGMPNGCSDDLLPWRRTAENKLDTKYPYVCHAELNAIMNKNSADVKGCSMYVALFPCNECAKLIIQAGIKEVIFMSDKYHDSEETTAARLLFKLAGVTFRKFTPK 158          
BLAST of Deoxycytidylate deaminase vs. UniProt/SwissProt
Match: sp|P32321|DCTD_HUMAN (Deoxycytidylate deaminase OS=Homo sapiens OX=9606 GN=DCTD PE=1 SV=2)

HSP 1 Score: 187.963 bits (476), Expect = 1.758e-58
Identity = 84/157 (53.50%), Postives = 113/157 (71.97%), Query Frame = 3
Query:  159 SSAKRNDYINWDEYFMSIAILSSMRSKDPVTQVGACIVNDKNQVVGVGYNGMPRGLPDDEMPWEKHNADRLLNKYFYVVHAELNAVLNKNCIDLMNCKIYTTLFPCNECTKVIIQSGITEVIYLSDKKHNAEPSKASKFMLEKAKVKLTAF---CSK 620
            S  KR+DY+ W EYFM++A LS+ RSKDP +QVGACIVN +N++VG+GYNGMP G  DD +PW +   ++L  KY YV HAELNA++NKN  D+  C +Y  LFPCNEC K+IIQ+GI EVI++SDK H+++ + A++ +   A V    F   CSK
Sbjct:    5 SCKKRDDYLEWPEYFMAVAFLSAQRSKDPNSQVGACIVNSENKIVGIGYNGMPNGCSDDVLPWRRTAENKLDTKYPYVCHAELNAIMNKNSTDVKGCSMYVALFPCNECAKLIIQAGIKEVIFMSDKYHDSDEATAARLLFNMAGVTFRKFIPKCSK 161          
BLAST of Deoxycytidylate deaminase vs. UniProt/SwissProt
Match: sp|Q9VWA2|DCTD_DROME (Probable deoxycytidylate deaminase OS=Drosophila melanogaster OX=7227 GN=CG6951 PE=2 SV=1)

HSP 1 Score: 173.711 bits (439), Expect = 1.361e-52
Identity = 82/161 (50.93%), Postives = 110/161 (68.32%), Query Frame = 3
Query:  162 SAKRNDYINWDEYFMSIAILSSMRSKDPVTQVGACIVNDKNQVVGVGYNGMPRGLPDDEMPWEK-----HNADRLLNKYFYVVHAELNAVLNKNCIDLMNCKIYTTLFPCNECTKVIIQSGITEVIYLSDKKHNAEPSKASKFMLEKAKVKLTAFCSKNKS 629
            S KR +Y++WD+YFM+ ++LS+ RSKDPVTQVGACIV+ +N++V +GYNG PR   DD  PW K        D L +K  YVVHAE NA+LN N + L   ++YTTLFPCNEC K+IIQ GI++V+YLSDK  +    +ASK ML+   V+      + K+
Sbjct:   19 SHKRKEYLHWDDYFMATSLLSAKRSKDPVTQVGACIVDSQNRIVAIGYNGFPRNCSDDVFPWSKAKKGSQEFDPLEDKKMYVVHAEANAILNSNGMSLSGTRLYTTLFPCNECAKLIIQVGISQVLYLSDKYADKPTYRASKRMLDAVGVEYKRHIPQKKT 179          
BLAST of Deoxycytidylate deaminase vs. TrEMBL
Match: A0A4S2LK20 (CMP/dCMP-type deaminase domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_006611 PE=4 SV=1)

HSP 1 Score: 219.935 bits (559), Expect = 1.287e-68
Identity = 100/158 (63.29%), Postives = 122/158 (77.22%), Query Frame = 3
Query:  138 EKYNFNGSSAKRNDYINWDEYFMSIAILSSMRSKDPVTQVGACIVNDKNQVVGVGYNGMPRGLPDDEMPWEKHNADRLLNKYFYVVHAELNAVLNKNCIDLMNCKIYTTLFPCNECTKVIIQSGITEVIYLSDKKHNAEPSKASKFMLEKAKVKLTAF 611
            E  N NGS  KR DYI+WDEYFMS+A+LS+MRSKDP TQVGACI N++N++VG+GYNGMPRGL DDEMPW K + + LLNKYFYV HAELNAVLN+N      C +Y ++FPCNEC KV+IQ+GI EV+Y  +KK +     ASK MLEKA V++  F
Sbjct:    2 EHLNLNGSQ-KRTDYISWDEYFMSVALLSAMRSKDPTTQVGACITNEENKIVGIGYNGMPRGLSDDEMPWGKTSENELLNKYFYVCHAELNAVLNRNHATSSGCTLYASMFPCNECAKVLIQAGIKEVVYFDEKKGDIGEYVASKLMLEKAGVRIRQF 158          
BLAST of Deoxycytidylate deaminase vs. TrEMBL
Match: H2KQE4 (Deoxycytidylate deaminase OS=Clonorchis sinensis OX=79923 GN=Dctd PE=4 SV=1)

HSP 1 Score: 219.935 bits (559), Expect = 2.328e-68
Identity = 100/158 (63.29%), Postives = 122/158 (77.22%), Query Frame = 3
Query:  138 EKYNFNGSSAKRNDYINWDEYFMSIAILSSMRSKDPVTQVGACIVNDKNQVVGVGYNGMPRGLPDDEMPWEKHNADRLLNKYFYVVHAELNAVLNKNCIDLMNCKIYTTLFPCNECTKVIIQSGITEVIYLSDKKHNAEPSKASKFMLEKAKVKLTAF 611
            E  N NGS  KR DYI+WDEYFMS+A+LS+MRSKDP TQVGACI N++N++VG+GYNGMPRGL DDEMPW K + + LLNKYFYV HAELNAVLN+N      C +Y ++FPCNEC KV+IQ+GI EV+Y  +KK +     ASK MLEKA V++  F
Sbjct:   22 EHLNLNGSQ-KRTDYISWDEYFMSVALLSAMRSKDPTTQVGACITNEENKIVGIGYNGMPRGLSDDEMPWGKTSENELLNKYFYVCHAELNAVLNRNHATSSGCTLYASMFPCNECAKVLIQAGIKEVVYFDEKKGDIGEYVASKLMLEKAGVRIRQF 178          
BLAST of Deoxycytidylate deaminase vs. TrEMBL
Match: A0A1W4X1H6 (deoxycytidylate deaminase-like OS=Agrilus planipennis OX=224129 GN=LOC108740210 PE=4 SV=1)

HSP 1 Score: 217.238 bits (552), Expect = 3.777e-67
Identity = 99/156 (63.46%), Postives = 120/156 (76.92%), Query Frame = 3
Query:  162 SAKRNDYINWDEYFMSIAILSSMRSKDPVTQVGACIVNDKNQVVGVGYNGMPRGLPDDEMPWEKHNADRLLNKYFYVVHAELNAVLNKNCIDLMNCKIYTTLFPCNECTKVIIQSGITEVIYLSDKKHNAEPSKASKFMLEKAKVKLTAFCSKNKS 629
            S KR DY++WDEYFM+ AIL++ RSKDP TQVGACIVNDK Q+VGVGYNGMPRG  DDE PW K NAD L NKY+YV HAE+NA+LNKN   + NC++Y  LFPCNEC K IIQSGI E++Y+SDK H+   + ASK ML+ A VK   F  ++K+
Sbjct:   29 SGKREDYLSWDEYFMATAILAAKRSKDPSTQVGACIVNDKKQIVGVGYNGMPRGCSDDEFPWGKGNADELKNKYYYVCHAEMNAILNKNSAGVENCRMYVALFPCNECAKFIIQSGIREIVYMSDKDHDKNRTIASKRMLDAAGVKYWPFTPQHKT 184          
BLAST of Deoxycytidylate deaminase vs. TrEMBL
Match: A0A1S8X7K1 (Cytidine and deoxycytidylate deaminase zinc-binding region (Fragment) OS=Opisthorchis viverrini OX=6198 GN=X801_01404 PE=4 SV=1)

HSP 1 Score: 215.312 bits (547), Expect = 4.184e-67
Identity = 98/155 (63.23%), Postives = 121/155 (78.06%), Query Frame = 3
Query:  138 EKYNFNGSSAKRNDYINWDEYFMSIAILSSMRSKDPVTQVGACIVNDKNQVVGVGYNGMPRGLPDDEMPWEKHNADRLLNKYFYVVHAELNAVLNKNCIDLMNCKIYTTLFPCNECTKVIIQSGITEVIYLSDKKHNAEPSKASKFMLEKAKVKL 602
            E  N NGS  KR DYI+WDEYFMS+A+LS+MRSKDP TQVGACI N++N++VG+GYNGMPRGL DDEMPW K + + LLNKYFYV HAELNAVLN+N      C +Y ++FPCNEC KV+IQ+GI EV+Y  +K+ +     ASK MLEKA V++
Sbjct:    2 EHLNINGSQ-KRTDYISWDEYFMSVALLSAMRSKDPTTQVGACITNEENKIVGIGYNGMPRGLSDDEMPWGKTSENELLNKYFYVCHAELNAVLNRNHATSSGCTLYASMFPCNECAKVLIQAGIKEVVYFDEKEGDIGEYVASKLMLEKAGVRI 155          
BLAST of Deoxycytidylate deaminase vs. TrEMBL
Match: A0A0R3WKY4 (CMP/dCMP-type deaminase domain-containing protein OS=Hydatigena taeniaeformis OX=6205 GN=TTAC_LOCUS1396 PE=4 SV=1)

HSP 1 Score: 211.846 bits (538), Expect = 1.324e-65
Identity = 99/149 (66.44%), Postives = 115/149 (77.18%), Query Frame = 3
Query:  159 SSAKRNDYINWDEYFMSIAILSSMRSKDPVTQVGACIVNDKNQVVGVGYNGMPRGLPDDEMPWEKHNADRLLNKYFYVVHAELNAVLNKNCIDLMNCKIYTTLFPCNECTKVIIQSGITEVIYLSDKKHNAEPSKASKFMLEKAKVKLT 605
              AKRNDY+ WDEYFM++A+LS+MRSKDPVTQVGACIV+++N++V VGYNGMP GL DDE+PW K   D L NK FYV HAELNAVLNKN + +  CK+YTTLFPC EC KV+IQSGI EVIY  +KK       ASK M  KA VKLT
Sbjct:   11 QQAKRNDYLQWDEYFMALALLSAMRSKDPVTQVGACIVDNENKIVSVGYNGMPVGLSDDELPWTKRQEDPLQNKNFYVCHAELNAVLNKNTLSVKGCKVYTTLFPCYECAKVMIQSGIREVIYFDEKKTITPSGDASKIMFLKANVKLT 159          
BLAST of Deoxycytidylate deaminase vs. Ensembl Cavefish
Match: dctd (dCMP deaminase [Source:NCBI gene;Acc:111191300])

HSP 1 Score: 192.586 bits (488), Expect = 6.496e-61
Identity = 89/163 (54.60%), Postives = 114/163 (69.94%), Query Frame = 3
Query:  132 TDEKYNFNGS---SAKRNDYINWDEYFMSIAILSSMRSKDPVTQVGACIVNDKNQVVGVGYNGMPRGLPDDEMPWEKHNADRLLNKYFYVVHAELNAVLNKNCIDLMNCKIYTTLFPCNECTKVIIQSGITEVIYLSDKKHNAEPSKASKFMLEKAKVKLTAF 611
            T   Y+ NG    + KR DY+ W EYFM++A LS+ RSKDP +QVGACIVN +N++VG+GYNGMP G  DD MPW +   D+L  KY YV HAELNA++NKN  D+  C +Y  LFPCNEC K+IIQ+GI +VIYLSDK H++    AS+ +L  A V+   F
Sbjct:    6 TKAAYSCNGEVTVTRKRQDYLEWPEYFMAVAFLSAQRSKDPSSQVGACIVNQENKIVGIGYNGMPNGCDDDLMPWSRSAEDKLDTKYPYVCHAELNAIMNKNSADVKGCSMYVALFPCNECAKLIIQAGIKDVIYLSDKYHDSPEMTASRRLLNLAGVQYRQF 168          
BLAST of Deoxycytidylate deaminase vs. Ensembl Cavefish
Match: dctd (dCMP deaminase [Source:NCBI gene;Acc:111191300])

HSP 1 Score: 190.66 bits (483), Expect = 3.727e-60
Identity = 85/148 (57.43%), Postives = 108/148 (72.97%), Query Frame = 3
Query:  168 KRNDYINWDEYFMSIAILSSMRSKDPVTQVGACIVNDKNQVVGVGYNGMPRGLPDDEMPWEKHNADRLLNKYFYVVHAELNAVLNKNCIDLMNCKIYTTLFPCNECTKVIIQSGITEVIYLSDKKHNAEPSKASKFMLEKAKVKLTAF 611
            KR DY+ W EYFM++A LS+ RSKDP +QVGACIVN +N++VG+GYNGMP G  DD MPW +   D+L  KY YV HAELNA++NKN  D+  C +Y  LFPCNEC K+IIQ+GI +VIYLSDK H++    AS+ +L  A V+   F
Sbjct:   21 KRQDYLEWPEYFMAVAFLSAQRSKDPSSQVGACIVNQENKIVGIGYNGMPNGCDDDLMPWSRSAEDKLDTKYPYVCHAELNAIMNKNSADVKGCSMYVALFPCNECAKLIIQAGIKDVIYLSDKYHDSPEMTASRRLLNLAGVQYRQF 168          
BLAST of Deoxycytidylate deaminase vs. Ensembl Cavefish
Match: dctd (dCMP deaminase [Source:NCBI gene;Acc:111191300])

HSP 1 Score: 187.578 bits (475), Expect = 1.069e-58
Identity = 84/146 (57.53%), Postives = 108/146 (73.97%), Query Frame = 3
Query:  162 SAKRNDYINWDEYFMSIAILSSMRSKDPVTQVGACIVNDKNQVVGVGYNGMPRGLPDDEMPWEKHNADRLLNKYFYVVHAELNAVLNKNCIDLMNCKIYTTLFPCNECTKVIIQSGITEVIYLSDKKHNAEPSKASKFMLEKAKVK 599
            + KR DY+ W EYFM++A LS+ RSKDP +QVGACIVN +N++VG+GYNGMP G  DD MPW +   D+L  KY YV HAELNA++NKN  D+  C +Y  LFPCNEC K+IIQ+GI +VIYLSDK H++    AS+ +L  A V+
Sbjct:   52 TRKRQDYLEWPEYFMAVAFLSAQRSKDPSSQVGACIVNQENKIVGIGYNGMPNGCDDDLMPWSRSAEDKLDTKYPYVCHAELNAIMNKNSADVKGCSMYVALFPCNECAKLIIQAGIKDVIYLSDKYHDSPEMTASRRLLNLAGVQ 197          
BLAST of Deoxycytidylate deaminase vs. Ensembl Cavefish
Match: cdadc1 (cytidine and dCMP deaminase domain containing 1 [Source:NCBI gene;Acc:103045753])

HSP 1 Score: 56.6102 bits (135), Expect = 9.624e-9
Identity = 48/157 (30.57%), Postives = 74/157 (47.13%), Query Frame = 3
Query:  213 AILSSMRSKDPVTQVGACI-VNDKNQ----------VVGVGYNGMPRGLPDDEMP-WEKHNADRLLNKYFYVVHAELNAVLNKNCIDLMNCK--IYTTLFPCNECTKVIIQSGITEVIYLSD-----KKHN------AEPSKASKFMLEKAKVKLTA 608
            A L + R++DP   VG  I   DK Q          +VG GYN  P G    E P  +    +R   KY Y++HAE NA+  ++       K  ++ T  PC+EC  +I  +GI + IY +D      KH+      ++ S+  KF+ +K+    +A
Sbjct:  310 AALLAYRTEDPKVGVGTVIWAEDKWQSECDGMGTMYLVGCGYNAYPAGSKYAEFPQMDTRQEERCNRKYRYIIHAEQNALTFRSTEVRGQEKTMLFVTKCPCDECVPLICGAGIKQ-IYTTDLDSGKDKHDISYMRFSQLSQVQKFIWQKSPAARSA 465          
BLAST of Deoxycytidylate deaminase vs. Ensembl Yeast
Match: DCD1 (Deoxycytidine monophosphate (dCMP) deaminase; involved in dUMP and dTMP biosynthesis; expression is NOT cell cycle regulated [Source:SGD;Acc:S000001187])

HSP 1 Score: 65.0846 bits (157), Expect = 1.275e-12
Identity = 44/133 (33.08%), Postives = 67/133 (50.38%), Query Frame = 3
Query:  186 NWDEYFMSIAILSSMRSKDPVTQVGACIVNDKNQVVGVGYNGMPRGLPD---DEMPWEKHNADRLLNKYFYVVHAELNAVLNKNCIDL-MNCKIYTTLFPCNECTKVIIQSGITEVIYLSDKKHNAEPSKASK 572
            +WD YFM +A L++ RS     +VG C++  + +V+  GYNG PR L +      P       R L+     +HAE NA+L      +  N  +Y    PC  C+  I+Q+GI+EV+Y    + + E  K  K
Sbjct:  162 SWDSYFMKLATLAASRSNCMKRRVG-CVIVRECRVIATGYNGTPRHLTNCFNGGCPRCNDGDSRNLHTCL-CLHAEENALLEAGRDRVGQNATLYCDTCPCLTCSVKIVQTGISEVVYSQSYRMDEESFKVLK 292          
BLAST of Deoxycytidylate deaminase vs. Ensembl Yeast
Match: FCY1 (Cytosine deaminase; zinc metalloenzyme that catalyzes the hydrolytic deamination of cytosine to uracil; of biomedical interest because it also catalyzes the deamination of 5-fluorocytosine (5FC) to form anticancer drug 5-fluorouracil (5FU) [Source:SGD;Acc:S000006266])

HSP 1 Score: 43.8986 bits (102), Expect = 4.157e-6
Identity = 34/119 (28.57%), Postives = 58/119 (48.74%), Query Frame = 3
Query:  189 WDEYFMSIAIL-SSMRSKDPVTQVGACIVNDKN-QVVGVGYNGMPRGLPDDEMPWEKHNADRLLNKYFYVVHAELNAVLNKNCIDL-----MNCKIYTTLFPCNECTKVIIQSGITEVI 524
            WD+  M IA   +++  K+    +G C++N+K+  V+G G+N          M ++K +A          +H E++ +  +NC  L      +  +YTTL PC+ CT  II  GI   +
Sbjct:   10 WDQKGMDIAYEEAALGYKEGGVPIGGCLINNKDGSVLGRGHN----------MRFQKGSA---------TLHGEISTL--ENCGRLEGKVYKDTTLYTTLSPCDMCTGAIIMYGIPRCV 107          
BLAST of Deoxycytidylate deaminase vs. Ensembl Nematostella
Match: EDO37210 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SGH8])

HSP 1 Score: 197.208 bits (500), Expect = 3.764e-63
Identity = 86/149 (57.72%), Postives = 112/149 (75.17%), Query Frame = 3
Query:  165 AKRNDYINWDEYFMSIAILSSMRSKDPVTQVGACIVNDKNQVVGVGYNGMPRGLPDDEMPWEKHNADRLLNKYFYVVHAELNAVLNKNCIDLMNCKIYTTLFPCNECTKVIIQSGITEVIYLSDKKHNAEPSKASKFMLEKAKVKLTAF 611
             KR DYI+WD+YFMS+A LS+ RSKDP +QVGACIVN + ++VG+GYNGMP G  DDE+PW +H  D L  KY YV HAE+NA+LNKN  D+  C +Y  LFPCNEC+K+IIQ+G+ EV+++SDK H+    KAS+ +L+ A VK   F
Sbjct:   41 TKRTDYISWDDYFMSVAFLSAQRSKDPSSQVGACIVNKERKIVGIGYNGMPNGCSDDELPWNRHADDELDTKYPYVCHAEMNAILNKNSADVKGCTVYVALFPCNECSKIIIQAGLKEVVFVSDKYHDKPSMKASRRLLDLAGVKYRQF 189          
BLAST of Deoxycytidylate deaminase vs. Ensembl Nematostella
Match: EDO47674 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RLD8])

HSP 1 Score: 67.3958 bits (163), Expect = 9.028e-13
Identity = 44/147 (29.93%), Postives = 73/147 (49.66%), Query Frame = 3
Query:  180 YINWDEYFMSIAILSSMRSKDPVTQVGACIVNDKNQVVGVGYNGMPRGLPDDEMPWEKHNADRLLNKYFYVVHAELNAVLNKN--CIDLMNC-----KIYTTLFPCNECTKVIIQSGITEVIYLSDKKHNAEPSKASKFMLEKAKVK 599
            + N+  +   +A + S RS DP+  VG C++  +N+V+ +G++G P      E P       R   K  Y++HA  NAVL KN   I   +C     ++Y +  PC EC  ++++ G+  VI    +  +       K ML+K K+K
Sbjct:  283 WQNFALHMTRLAQMLSQRSDDPIRGVG-CVLMYENEVISIGWSGFPAKATYGEFP-------RSACKKPYIIHAAENAVLTKNQQIIRKADCLTSSAQLYISKIPCRECVHMLVEVGVKHVILPGSEHDDDAKDDVFKEMLQKDKLK 421          
BLAST of Deoxycytidylate deaminase vs. Ensembl Nematostella
Match: EDO45395 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RT49])

HSP 1 Score: 54.6842 bits (130), Expect = 1.357e-8
Identity = 36/134 (26.87%), Postives = 66/134 (49.25%), Query Frame = 3
Query:  153 NGSSAKRNDYINWDEYFM--SIAILSSMRSKDPVTQVGACIVNDKNQVVGVGYNGMPRG----LPD--DEMPWEKHNADRLLNKYFYVVHAELNAVLNKNCIDLM--NCKIYTTLFPCNECTKVIIQSGITEVI 524
            +    +R +  + +E+     +A L S  S DP   +G C++    ++VG G+N    G     P   D   +   + D+L  KY +VVHAE NA++++N  D+      ++ T  PC+EC  +++  G+   +
Sbjct:  262 SAGQGERQEDADHEEFLHLSRVAQLLSYASDDPHVGIG-CVITKDRELVGFGWNHFLNGGYGTFPQASDSPDFSHVSKDQL--KYPFVVHAEQNAIISRNTRDISGPGTTMFATRSPCDECMPLLLGVGVKRFV 392          
BLAST of Deoxycytidylate deaminase vs. Ensembl Nematostella
Match: EDO37110 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SGR7])

HSP 1 Score: 51.6026 bits (122), Expect = 1.775e-7
Identity = 34/129 (26.36%), Postives = 61/129 (47.29%), Query Frame = 3
Query:  198 YFMSIAILSSMRSKDPVTQVGACIVNDKNQVVGVGYNGMPRGLPDDEMPWEKHNADRLLNK-YFYVVHAELNAVLNKNCIDLMN--CKIYTTLFPCNECTKVIIQSGITEVIYLSDKKHNAEPSKASKF 575
            + + +A + S  S DP   VGA I+ + N +VG G+N         + P        + NK Y + +H E + +L++   D+ +    I+    PC+EC  ++++ G+  V++         P KA KF
Sbjct:  345 HMVRMAHILSKYSDDPTRGVGAVILKE-NSIVGAGWNCYTSDALYGDFPRAASKHVHIKNKRYPFSIHGEQSVILHRFVTDIKDESTTIFVNKMPCDECVPLMLRVGVKNVVF--------PPEKAKKF 464          
BLAST of Deoxycytidylate deaminase vs. Ensembl Medaka
Match: dctd (dCMP deaminase [Source:NCBI gene;Acc:101161120])

HSP 1 Score: 189.889 bits (481), Expect = 5.671e-60
Identity = 86/154 (55.84%), Postives = 110/154 (71.43%), Query Frame = 3
Query:  159 SSAKRNDYINWDEYFMSIAILSSMRSKDPVTQVGACIVNDKNQVVGVGYNGMPRGLPDDEMPWEKHNADRLLNKYFYVVHAELNAVLNKNCIDLMNCKIYTTLFPCNECTKVIIQSGITEVIYLSDKKHNAEPSKASKFMLEKAKVKLTAFCSK 620
            S+ KR DY+ W EYFM++A LS+ RSKDP +QVGACIVN +N++VG+GYNGMP G  DD +PW +   DRL  KY YV HAELNA++NKN  D+  C +Y  LFPCNEC K+IIQ+G+ EVIYLSDK H+     AS+ +L  A ++   F  K
Sbjct:   21 SAKKREDYLEWPEYFMAVAFLSAQRSKDPNSQVGACIVNQENKIVGIGYNGMPNGCDDDLLPWSRSADDRLDTKYPYVCHAELNAIMNKNSADVKGCTMYVALFPCNECAKLIIQAGLKEVIYLSDKYHDTPEMMASRRLLNMAGIQYRQFQPK 174          
BLAST of Deoxycytidylate deaminase vs. Ensembl Medaka
Match: cdadc1 (cytidine and dCMP deaminase domain containing 1 [Source:NCBI gene;Acc:101165538])

HSP 1 Score: 57.7658 bits (138), Expect = 3.914e-9
Identity = 42/125 (33.60%), Postives = 59/125 (47.20%), Query Frame = 3
Query:  213 AILSSMRSKDPVTQVGACIVNDKNQV----------VGVGYNGMPRGLPDDEMP-WEKHNADRLLNKYFYVVHAELNAVL--NKNCIDLMNCKIYTTLFPCNECTKVIIQSGITEVIYLSDKKHN 548
            A L + R++DP   VGA I     +V          VG GYN  P G    E P  +    DR   KY Y++HAE NA+    ++        ++ T  PC+EC  +I  +GIT  IY SD+  +
Sbjct:  319 ARLLAYRTEDPKVGVGAVIWAKGKRVGFGGTGRLSLVGCGYNAYPAGSKYAEYPQMDTKQEDRQRRKYRYMIHAEQNALTFRTRDIRAEEPTMLFVTKCPCDECVPLIRGAGITH-IYTSDQDRD 442          
BLAST of Deoxycytidylate deaminase vs. Planmine SMEST
Match: SMESG000023231.1 (SMESG000023231.1)

HSP 1 Score: 362.844 bits (930), Expect = 1.649e-128
Identity = 174/174 (100.00%), Postives = 174/174 (100.00%), Query Frame = 3
Query:  108 MENLSINVTDEKYNFNGSSAKRNDYINWDEYFMSIAILSSMRSKDPVTQVGACIVNDKNQVVGVGYNGMPRGLPDDEMPWEKHNADRLLNKYFYVVHAELNAVLNKNCIDLMNCKIYTTLFPCNECTKVIIQSGITEVIYLSDKKHNAEPSKASKFMLEKAKVKLTAFCSKNKS 629
            MENLSINVTDEKYNFNGSSAKRNDYINWDEYFMSIAILSSMRSKDPVTQVGACIVNDKNQVVGVGYNGMPRGLPDDEMPWEKHNADRLLNKYFYVVHAELNAVLNKNCIDLMNCKIYTTLFPCNECTKVIIQSGITEVIYLSDKKHNAEPSKASKFMLEKAKVKLTAFCSKNKS
Sbjct:    1 MENLSINVTDEKYNFNGSSAKRNDYINWDEYFMSIAILSSMRSKDPVTQVGACIVNDKNQVVGVGYNGMPRGLPDDEMPWEKHNADRLLNKYFYVVHAELNAVLNKNCIDLMNCKIYTTLFPCNECTKVIIQSGITEVIYLSDKKHNAEPSKASKFMLEKAKVKLTAFCSKNKS 174          
The following BLAST results are available for this feature:
BLAST of Deoxycytidylate deaminase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DCTD3.268e-5953.50dCMP deaminase [Source:HGNC Symbol;Acc:HGNC:2710][more]
DCTD3.662e-5953.50dCMP deaminase [Source:HGNC Symbol;Acc:HGNC:2710][more]
DCTD3.662e-5953.50dCMP deaminase [Source:HGNC Symbol;Acc:HGNC:2710][more]
DCTD5.604e-5953.50dCMP deaminase [Source:HGNC Symbol;Acc:HGNC:2710][more]
DCTD2.848e-4858.62dCMP deaminase [Source:HGNC Symbol;Acc:HGNC:2710][more]
back to top
BLAST of Deoxycytidylate deaminase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ZK643.23.016e-3843.20Probable deoxycytidylate deaminase [Source:UniPro... [more]
back to top
BLAST of Deoxycytidylate deaminase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
CG69511.358e-5350.93gene:FBgn0036959 transcript:FBtr0074829[more]
CG69511.358e-5350.93gene:FBgn0036959 transcript:FBtr0074828[more]
back to top
BLAST of Deoxycytidylate deaminase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
dctd1.411e-5851.76dCMP deaminase [Source:ZFIN;Acc:ZDB-GENE-050417-11... [more]
cdadc12.624e-833.60cytidine and dCMP deaminase domain containing 1 [S... [more]
cdadc12.927e-833.60cytidine and dCMP deaminase domain containing 1 [S... [more]
back to top
BLAST of Deoxycytidylate deaminase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
dctd2.802e-6154.43dCMP deaminase [Source:NCBI gene;Acc:549019][more]
slc35f11.521e-630.65solute carrier family 35 member F1 [Source:Xenbase... [more]
back to top
BLAST of Deoxycytidylate deaminase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Dctd4.175e-6053.90dCMP deaminase [Source:MGI Symbol;Acc:MGI:2444529][more]
Dctd4.175e-6053.90dCMP deaminase [Source:MGI Symbol;Acc:MGI:2444529][more]
Dctd4.175e-6053.90dCMP deaminase [Source:MGI Symbol;Acc:MGI:2444529][more]
Dctd2.608e-4858.62dCMP deaminase [Source:MGI Symbol;Acc:MGI:2444529][more]
Dctd1.173e-2757.14dCMP deaminase [Source:MGI Symbol;Acc:MGI:2444529][more]
back to top
BLAST of Deoxycytidylate deaminase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5RC69|DCTD_PONAB1.165e-5953.50Deoxycytidylate deaminase OS=Pongo abelii OX=9601 ... [more]
sp|Q5M9G0|DCTD_RAT2.385e-5953.90Deoxycytidylate deaminase OS=Rattus norvegicus OX=... [more]
sp|Q8K2D6|DCTD_MOUSE2.385e-5953.90Deoxycytidylate deaminase OS=Mus musculus OX=10090... [more]
sp|P32321|DCTD_HUMAN1.758e-5853.50Deoxycytidylate deaminase OS=Homo sapiens OX=9606 ... [more]
sp|Q9VWA2|DCTD_DROME1.361e-5250.93Probable deoxycytidylate deaminase OS=Drosophila m... [more]
back to top
BLAST of Deoxycytidylate deaminase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4S2LK201.287e-6863.29CMP/dCMP-type deaminase domain-containing protein ... [more]
H2KQE42.328e-6863.29Deoxycytidylate deaminase OS=Clonorchis sinensis O... [more]
A0A1W4X1H63.777e-6763.46deoxycytidylate deaminase-like OS=Agrilus planipen... [more]
A0A1S8X7K14.184e-6763.23Cytidine and deoxycytidylate deaminase zinc-bindin... [more]
A0A0R3WKY41.324e-6566.44CMP/dCMP-type deaminase domain-containing protein ... [more]
back to top
BLAST of Deoxycytidylate deaminase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
dctd6.496e-6154.60dCMP deaminase [Source:NCBI gene;Acc:111191300][more]
dctd3.727e-6057.43dCMP deaminase [Source:NCBI gene;Acc:111191300][more]
dctd1.069e-5857.53dCMP deaminase [Source:NCBI gene;Acc:111191300][more]
cdadc19.624e-930.57cytidine and dCMP deaminase domain containing 1 [S... [more]
back to top
BLAST of Deoxycytidylate deaminase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Deoxycytidylate deaminase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
DCD11.275e-1233.08Deoxycytidine monophosphate (dCMP) deaminase; invo... [more]
FCY14.157e-628.57Cytosine deaminase; zinc metalloenzyme that cataly... [more]
back to top
BLAST of Deoxycytidylate deaminase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 4
Match NameE-valueIdentityDescription
EDO372103.764e-6357.72Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO476749.028e-1329.93Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO453951.357e-826.87Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO371101.775e-726.36Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Deoxycytidylate deaminase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
dctd5.671e-6055.84dCMP deaminase [Source:NCBI gene;Acc:101161120][more]
cdadc13.914e-933.60cytidine and dCMP deaminase domain containing 1 [S... [more]
back to top
BLAST of Deoxycytidylate deaminase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000023231.11.649e-128100.00SMESG000023231.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30009032 ID=SMED30009032|Name=Deoxycytidylate deaminase|organism=Schmidtea mediterranea sexual|type=transcript|length=857bp
TTTAAAATTTGTTACTTATTTTAGTCACTGTTTAAAACCTTCATTTTCAA
AATAGCAAATTCATGTTTTGTAAGACATTTATAATTTGTAAATAGTACTT
AACTAAAATGGAAAATTTGTCAATAAATGTTACTGATGAAAAATATAATT
TCAATGGTAGCAGTGCAAAACGAAATGATTACATAAATTGGGATGAATAT
TTCATGTCAATTGCCATTTTATCTAGCATGAGAAGCAAAGATCCAGTTAC
ACAGGTCGGTGCTTGCATAGTAAATGATAAAAATCAAGTAGTTGGAGTTG
GTTATAACGGAATGCCAAGAGGATTACCCGATGATGAAATGCCTTGGGAG
AAACATAATGCAGACCGTTTGCTAAATAAATATTTTTATGTCGTCCACGC
AGAATTGAATGCTGTGCTTAATAAAAACTGCATTGACTTGATGAATTGTA
AAATATATACAACTTTGTTTCCTTGCAATGAATGCACCAAAGTAATCATC
CAAAGTGGGATAACTGAAGTGATTTATCTATCAGATAAAAAGCATAATGC
TGAACCTTCAAAAGCAAGCAAATTTATGCTTGAAAAGGCCAAAGTAAAAC
TAACTGCATTTTGTTCCAAAAACAAATCTTTGACTTTGAATTTGAACTGA
GCAGTAAATATTTAAATTATCACAATTTTTAAAGAATTTTAAATTAAATA
GTTTATGACTTGAATAGAAATTTTTTGTCATTTATTGTTAATTTTGTTTG
TCATGAAAATTTTGAATCTTTTTTATATTTATTTGACAGTTTAAATATGT
ATGGAACAAAGCATTTAAACCCAAATTATGTATTAGTTCGGTTAATTTTA
AATTGTA
back to top

protein sequence of SMED30009032-orf-1

>SMED30009032-orf-1 ID=SMED30009032-orf-1|Name=SMED30009032-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=181bp
MENLSINVTDEKYNFNGSSAKRNDYINWDEYFMSIAILSSMRSKDPVTQV
GACIVNDKNQVVGVGYNGMPRGLPDDEMPWEKHNADRLLNKYFYVVHAEL
NAVLNKNCIDLMNCKIYTTLFPCNECTKVIIQSGITEVIYLSDKKHNAEP
SKASKFMLEKAKVKLTAFCSKNKSLTLNLN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0004132dCMP deaminase activity
GO:0046872metal ion binding
GO:0008270zinc ion binding
GO:0016787hydrolase activity
GO:0003824catalytic activity
Vocabulary: biological process
TermDefinition
GO:0006220pyrimidine nucleotide metabolic process
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000420parapharyngeal region
PLANA:0000429neoblast
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR016473dCMP_deaminase
IPR015517dCMP_deaminase-rel
IPR035105Deoxycytidylate_deaminase_dom
IPR002125CMP_dCMP_dom
IPR016192APOBEC/CMP_deaminase_Zn-bd
IPR016193Cytidine_deaminase-like
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR016473Deoxycytidylate deaminasePIRSFPIRSF006019dCMP_deaminasecoord: 18..175
e-value: 2.4E-47
score: 157.9
NoneNo IPR availableGENE3DG3DSA:3.40.140.10coord: 18..180
e-value: 7.5E-56
score: 190.3
IPR002125Cytidine and deoxycytidylate deaminase domainPFAMPF00383dCMP_cyt_deam_1coord: 27..141
e-value: 9.5E-26
score: 89.6
IPR002125Cytidine and deoxycytidylate deaminase domainPROSITEPS51747CYT_DCMP_DEAMINASES_2coord: 27..151
score: 22.104
IPR015517Deoxycytidylate deaminase-relatedPANTHERPTHR11086DEOXYCYTIDYLATE DEAMINASE-RELATEDcoord: 8..175
IPR016192APOBEC/CMP deaminase, zinc-bindingPROSITEPS00903CYT_DCMP_DEAMINASES_1coord: 97..130
IPR035105Deoxycytidylate deaminase domainCDDcd01286deoxycytidylate_deaminasecoord: 29..159
e-value: 5.81125E-52
score: 160.903
IPR016193Cytidine deaminase-likeSUPERFAMILYSSF53927Cytidine deaminase-likecoord: 29..165