SCP domain-containing protein

Overview
NameSCP domain-containing protein
Smed IDSMED30009031
Length (bp)4191
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SCP domain-containing protein (SMED30009031) t-SNE clustered cells

Violin plots show distribution of expression levels for SCP domain-containing protein (SMED30009031) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SCP domain-containing protein (SMED30009031) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SCP domain-containing protein (SMED30009031) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30009031

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
cephalic gangliaSMED30009031SMESG000035186.1 dd_Smed_v4_5321_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30009031SMESG000035186.1 dd_Smed_v4_5321_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30009031SMESG000035186.1 dd_Smed_v4_5321_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30009031SMESG000035186.1 Contig40779newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30009031SMESG000035186.1 Contig40779uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30009031SMESG000035186.1 Contig22801newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30009031SMESG000035186.1 Contig22801uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
body wall musculatureSMED30009031SMESG000035186.1 dd_Smed_v4_5321_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
musculature systemSMED30009031SMESG000035186.1 dd_Smed_v6_5321_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of SCP domain-containing protein vs. Ensembl Human
Match: PI16 (peptidase inhibitor 16 [Source:HGNC Symbol;Acc:HGNC:21245])

HSP 1 Score: 66.2402 bits (160), Expect = 2.178e-10
Identity = 48/185 (25.95%), Postives = 79/185 (42.70%), Query Frame = 2
Query:  299 LKSMDKQLILDLHNWYRAQISRGDIFQQPESSDMTVVEWDDRLAEIALIRAQKCL----KEKKVNDYEMSSFQHDLLGRMAINEYFTNDTDNYTKKAIHSWFKNHINFEYENGTCTKSD-CQSYKNMIFSNVFVLGCEAYKC-----VNSISVICIYSNSERTD--KGEDLYKSGLSCTSCPQDY 817
            L   +K+L+++LHN YRAQ+S       P +SDM  + WD+ LA  A   A++C+    KE+               GR   N +   D       A+  W     ++     TC+    C  Y  ++++    +GC ++ C     V   ++  +  N E     KG+  Y+ G  C+ CP  Y
Sbjct:   28 LTDEEKRLMVELHNLYRAQVS-------PTASDMLHMRWDEELAAFAKAYARQCVWGHNKER---------------GRRGENLFAITDEGMDVPLAMEEWHHEREHYNLSAATCSPGQMCGHYTQVVWAKTERIGCGSHFCEKLQGVEETNIELLVCNYEPPGNVKGKRPYQEGTPCSQCPSGY 190          
BLAST of SCP domain-containing protein vs. Ensembl Human
Match: PI16 (peptidase inhibitor 16 [Source:HGNC Symbol;Acc:HGNC:21245])

HSP 1 Score: 66.2402 bits (160), Expect = 2.178e-10
Identity = 48/185 (25.95%), Postives = 79/185 (42.70%), Query Frame = 2
Query:  299 LKSMDKQLILDLHNWYRAQISRGDIFQQPESSDMTVVEWDDRLAEIALIRAQKCL----KEKKVNDYEMSSFQHDLLGRMAINEYFTNDTDNYTKKAIHSWFKNHINFEYENGTCTKSD-CQSYKNMIFSNVFVLGCEAYKC-----VNSISVICIYSNSERTD--KGEDLYKSGLSCTSCPQDY 817
            L   +K+L+++LHN YRAQ+S       P +SDM  + WD+ LA  A   A++C+    KE+               GR   N +   D       A+  W     ++     TC+    C  Y  ++++    +GC ++ C     V   ++  +  N E     KG+  Y+ G  C+ CP  Y
Sbjct:   28 LTDEEKRLMVELHNLYRAQVS-------PTASDMLHMRWDEELAAFAKAYARQCVWGHNKER---------------GRRGENLFAITDEGMDVPLAMEEWHHEREHYNLSAATCSPGQMCGHYTQVVWAKTERIGCGSHFCEKLQGVEETNIELLVCNYEPPGNVKGKRPYQEGTPCSQCPSGY 190          
BLAST of SCP domain-containing protein vs. Ensembl Human
Match: PI16 (peptidase inhibitor 16 [Source:HGNC Symbol;Acc:HGNC:21245])

HSP 1 Score: 66.2402 bits (160), Expect = 2.178e-10
Identity = 48/185 (25.95%), Postives = 79/185 (42.70%), Query Frame = 2
Query:  299 LKSMDKQLILDLHNWYRAQISRGDIFQQPESSDMTVVEWDDRLAEIALIRAQKCL----KEKKVNDYEMSSFQHDLLGRMAINEYFTNDTDNYTKKAIHSWFKNHINFEYENGTCTKSD-CQSYKNMIFSNVFVLGCEAYKC-----VNSISVICIYSNSERTD--KGEDLYKSGLSCTSCPQDY 817
            L   +K+L+++LHN YRAQ+S       P +SDM  + WD+ LA  A   A++C+    KE+               GR   N +   D       A+  W     ++     TC+    C  Y  ++++    +GC ++ C     V   ++  +  N E     KG+  Y+ G  C+ CP  Y
Sbjct:   28 LTDEEKRLMVELHNLYRAQVS-------PTASDMLHMRWDEELAAFAKAYARQCVWGHNKER---------------GRRGENLFAITDEGMDVPLAMEEWHHEREHYNLSAATCSPGQMCGHYTQVVWAKTERIGCGSHFCEKLQGVEETNIELLVCNYEPPGNVKGKRPYQEGTPCSQCPSGY 190          
BLAST of SCP domain-containing protein vs. Ensembl Human
Match: CLEC18B (C-type lectin domain family 18 member B [Source:HGNC Symbol;Acc:HGNC:33849])

HSP 1 Score: 60.8474 bits (146), Expect = 6.216e-9
Identity = 65/248 (26.21%), Postives = 97/248 (39.11%), Query Frame = 2
Query:  299 LKSMDKQLILDLHNWYRAQISRGDIFQQPESSDMTVVEWDDRLAEIALIRAQKCLKEKKVNDYEMSSFQHDLLGRMAINEYFTNDTDNYTKKAIHSWFKNHINFEYENGTCTK-SDCQSYKNMIFSNVFVLGCEAYKCVNSISVI----CIYS---NSERTDKGEDLYKSGLSCTSCPQDYSFCMD-----GSLC-ASKFHCRDSKISKTCRCLVLPKLCTKHGDYDSSKCRCRCQPGWTGLNCEKPC 1000
            L   +  L+L LHN  R+ +       QP ++DM  ++W D LA++A  RA  C     +    ++S     L ++  N            + +  WF     + +  G C + + C  Y  ++++    LGC  + C    + I    C YS   N E   K    YK G  C+ C    S C       G LC   +  CR S              C  HG  + S C C C PG+TG  C+  C
Sbjct:   43 LNRKESFLLLSLHNRLRSWV-------QPPAADMRRLDWSDSLAQLAQARAALC----GIPTPSLASGLWRTL-QVGWNMQLLPAGLASFVEVVSLWFAEGQRYSHAAGECARNATCTHYTQLVWATSSQLGCGRHLCSAGQTAIEAFVCAYSPRGNWEVNGKTIIPYKKGAWCSLCTASVSGCFKAWDHAGGLCEVPRNPCRMS--------------CQNHGRLNISTCHCHCPPGYTGRYCQVRC 264          
BLAST of SCP domain-containing protein vs. Ensembl Human
Match: CLEC18C (C-type lectin domain family 18 member C [Source:HGNC Symbol;Acc:HGNC:28538])

HSP 1 Score: 58.5362 bits (140), Expect = 6.834e-8
Identity = 65/248 (26.21%), Postives = 97/248 (39.11%), Query Frame = 2
Query:  299 LKSMDKQLILDLHNWYRAQISRGDIFQQPESSDMTVVEWDDRLAEIALIRAQKCLKEKKVNDYEMSSFQHDLLGRMAINEYFTNDTDNYTKKAIHSWFKNHINFEYENGTCTK-SDCQSYKNMIFSNVFVLGCEAYKCVNSISVI----CIYS---NSERTDKGEDLYKSGLSCTSCPQDYSFCMD-----GSLC-ASKFHCRDSKISKTCRCLVLPKLCTKHGDYDSSKCRCRCQPGWTGLNCEKPC 1000
            L   +  L+L LHN  R+ +       QP ++DM  ++W D LA++A  RA  C     +    ++S     L ++  N            + +  WF     + +  G C + + C  Y  ++++    LGC  + C    + I    C YS   N E   K    YK G  C+ C    S C       G LC   +  CR S              C  HG  + S C C C PG+TG  C+  C
Sbjct:   43 LNRKESFLLLSLHNRLRSWV-------QPPAADMRRLDWSDSLAQLAQARAALC----GIPTPSLASGLWRTL-QVGWNMQLLPAGLASFVEVVSLWFAEGQRYSHAAGECARNATCTHYTQLVWATSSQLGCGRHLCSAGQAAIEAFVCAYSPRGNWEVNGKTIVPYKKGAWCSLCTASVSGCFKAWDHAGGLCEVPRNPCRMS--------------CQNHGRLNISTCHCHCPPGYTGRYCQVRC 264          
BLAST of SCP domain-containing protein vs. Ensembl Celegans
Match: scl-9 (SCP-Like extracellular protein [Source:UniProtKB/TrEMBL;Acc:Q93747])

HSP 1 Score: 58.5362 bits (140), Expect = 4.022e-9
Identity = 60/222 (27.03%), Postives = 95/222 (42.79%), Query Frame = 2
Query:  242 LILLLSATINCEPWSTSFKLKSMDKQL-ILDLHNWYRAQISRGDI----FQQPESSDMTVVEWDDRLAEIALIRAQKCLKEKKV--NDYEMSSFQH------------DLLGRMAINEYFTNDTDNYTKKAIHSWFKNHINFEYENGTCTKSDCQSYKNMIFSNVFVLGCEAYKCV-----NSISVICIYSNSERTDKGEDLYKSGLSCTSCPQDYSFCMDG 835
            L+LL ++ I    WS +F   S + QL +L++HN +R+Q++ G +     ++P +S M  + W  +L   A   A+ C K   V  N  E S F H             L  +   NE+ TN  D        S   NH +  ++ G   +        M +     +GC   KC       ++ V+C Y      + GE +Y  G +CT CP++Y  C  G
Sbjct:    5 LLLLFASAIGV--WSDNF---SKEGQLNLLNVHNEFRSQLALGQLSFRGVKKPSASMMRKISWSKKLTNAATKFAETCPKNHSVVMNTGE-SIFWHFSSSLSTPEQYATLAPQKWWNEFETNGWD--------SLIYNHASQRFQIGHAVQ--------MAWHTTSKVGCGYSKCAVGTPEQTMVVVCRYFQKGNIE-GEPIYNEGETCTKCPEEYQKCPSG 203          
BLAST of SCP domain-containing protein vs. Ensembl Celegans
Match: scl-3 (SCP-Like extracellular protein [Source:UniProtKB/TrEMBL;Acc:G5EF50])

HSP 1 Score: 54.299 bits (129), Expect = 1.168e-7
Identity = 46/205 (22.44%), Postives = 86/205 (41.95%), Query Frame = 2
Query:  242 LILLLSATINCEPWSTSFKLKSMDKQLILDLHNWYRAQISRGDIFQQ----PESSDMTVVEWDDRLAEIALIRAQKCLKEKKVNDYEMSSFQHDLLGRMAINEYFTNDTDNYTKKAIHSWFKNHINFEYENGTCTKSDCQS----YKNMIFSNVFVLGCEAYKC--------VNSISVICIYSNSERTDKGEDLYKSGLSCTSCP 808
              LL+  T+    ++   + +   +Q I+DLHN  R  I++G    +       S++  ++WD  LA  A   A  C +         +    +L  R +   +  +  D Y   A  +W +    + +   T T++   +       M ++N  ++GC    C         N   V+C Y  ++    G+D+YKSG +C++CP
Sbjct:    4 FTLLVLVTLQIGAYA---QFRESTQQFIVDLHNKLRTSIAKGTYVAKGTTKAAGSNLLKMKWDTTLATAAQTFANTCPRGHS----NAAGVGENLYWRWSSLPF--SGMDIYGGAASVAWEQEFQQYGWTTNTFTQALANTGIGHATQMAWANTGLIGCGVKNCGPDPELNNYNRAVVVCQY-KAQGNYLGQDIYKSGTTCSACP 198          
BLAST of SCP domain-containing protein vs. Ensembl Celegans
Match: scl-13 (SCP-Like extracellular protein [Source:UniProtKB/TrEMBL;Acc:Q9N5N4])

HSP 1 Score: 51.9878 bits (123), Expect = 7.240e-7
Identity = 54/225 (24.00%), Postives = 91/225 (40.44%), Query Frame = 2
Query:  236 KFLILLLSATINCEPWSTSFKLKSMDKQLILDLHNWYRAQISRGDIF----QQPESSDMTVVEWDDRLAEIALIRAQKCLKEKKVNDYEMSSFQH---------DLLGRMAINEYFTNDTDNYTKKAIHSWFKNHINFEYENGTCTKSDCQSYKNMIFSNVFVLGCEAYKC--------VNSISVICIYSNSERTDKGEDLYKSGLSCTSCPQDYSFCMDGSLCA 847
            KF + LL A   C     + +  S  +  I+D HN  R+ I++G       Q+P +S+M  + WD+ +A  A   A+ C  +     Y  + +           D  G  A N + +     + K    S F +   F    G  T+        M ++    +GC    C        +  ++V+C Y +S       D+Y+ G +C++C +D S   D  LCA
Sbjct:    2 KFALCLL-AIFGC----ATAQFSSTAQGQIVDAHNKLRSAIAQGSYVAAGTQEPSASNMRKIVWDETVAAAAQEYAEGCPDDHSGTSYGENLYWSWSSSAPSSLDKFGVAASNSWESE----FQKYGWTSTFLDEAGFATGIGHATQ--------MAWAETSKIGCGIKNCGKDANKKNMYKVAVVCQY-DSAGNMMDSDIYQQGETCSACSEDASCEQDSGLCA 208          
BLAST of SCP domain-containing protein vs. Ensembl Celegans
Match: scl-5 (SCP-Like extracellular protein [Source:UniProtKB/TrEMBL;Acc:Q18543])

HSP 1 Score: 50.447 bits (119), Expect = 1.925e-6
Identity = 53/223 (23.77%), Postives = 89/223 (39.91%), Query Frame = 2
Query:  245 ILLLSATINCEPWSTSFKLKSMDKQLILDLHNWYRAQISRGDIFQQ----PESSDMTVVEWDDRLAEIALIRAQKCLKEKKVNDYEMSSFQHDLLGRMAINE----YFTNDT----DNYTKKAIHSWFKNHINFEYENGTCTKS----DCQSYKNMIFSNVFVLGCEAYKC------VNSISVICIYSNSERTDKGEDLYKSGLSCTSCPQDYSFCMDGSLCA 847
            ILLL+A   C      F      +  IL++HN  R++I++G    +    P +SDM  ++WD  +A  A   A KC                   G   + E    Y+T+ T    D +      +W K   ++ + + T + S           M ++   ++GC    C       N ++V+C Y   +     +++Y SG +C+ CP   S      LCA
Sbjct:    5 ILLLTAL--CAGAYAQFSAN--GQAAILNVHNTLRSRIAKGTYVAKGTAKPAASDMLKMKWDATVAASAQAYANKCPTGHS--------------GAAGLGENLYWYWTSATITNIDQFGATGSAAWEKEFQDYGWSSNTLSMSLFNTGIGHATQMAWAKTNLIGCGVKNCGKDTNGFNKVTVVCQY-KPQGNYLNQNIYTSGTTCSKCPSGTSCEAATGLCA 208          
BLAST of SCP domain-containing protein vs. Ensembl Celegans
Match: scl-20 (SCP-Like extracellular protein [Source:UniProtKB/TrEMBL;Acc:O62508])

HSP 1 Score: 50.0618 bits (118), Expect = 3.472e-6
Identity = 51/208 (24.52%), Postives = 83/208 (39.90%), Query Frame = 2
Query:  236 KFLILLLSATINCEPWSTSFKLKSMDKQLILDLHNWYRAQISRGDI----FQQPESSDMTVVEWDDRLAEIALIRAQKCLKEKKVNDYEMSSFQHDLLGRMAINEYFTNDTDNYTKKAIHSWFKNHINFEYENGTCTKSD----CQSYKNMIFSNVFVLGCEAYKC---------VNSISVICIYSNSERTDKGEDLYKSGLSCTSCP 808
            +FL +L     NC      F+     ++ I+D HN  R+Q++ GD       +P + DM  ++WD  LA +A   A  C       D +M     +   R+A     +   D Y   A+  W +      ++N             S   M+++    +GC    C          N + VIC Y  S+    G  +YK G +C++CP
Sbjct:    2 RFLPILFLIFPNC---LCDFRFGPTAQREIVDFHNSLRSQLANGDYVVDGVPKPPAKDMMKMKWDPILAGMAKNNAATC--PSLFTDSKM--LGRNYYHRLA--NVTSGSLDKYALFAVKKWERQFQERGWKNQEFRMFGDHRLLTSATQMVWATTRHVGCGVNICDAEKNLFGYRNKVVVICEY-QSKGNIHGLPIYKEGPTCSACP 199          
BLAST of SCP domain-containing protein vs. Ensembl Fly
Match: CG9400 (gene:FBgn0030562 transcript:FBtr0073920)

HSP 1 Score: 53.1434 bits (126), Expect = 8.080e-7
Identity = 40/192 (20.83%), Postives = 82/192 (42.71%), Query Frame = 2
Query:  272 CEPWSTSFKLKSMDKQLILDLHNWYRAQISRGDIFQQPESSDMTVVEWDDRLAEIALIRAQKC-LKEKKVNDYEMSSFQHDLLGRMAINEYFTNDTDNYTKKAIHSWFKNHIN-----FEYENGTCTKSDCQSYKNMIFSNVFVLGCEAYKCVNSIS------VICIYSNSERTDKGEDLYKSGLSCTSCPQ 811
            C P     ++    +QL+LD+HN  R++I+ G++     ++ M ++ WD  L ++A + A++C     K  +     F    +G   I   F + +    K  + +WF+ H +      +  +          +  ++   V  +GC   + +   S      + C Y  +   +  E +Y+SG + + CPQ
Sbjct:   82 CGPEPKLLEMSERRRQLLLDMHNLARSKIASGNLDGYRSAAHMPLLRWDTELEQMAALHAKRCQFAHDKCRNTPRFKFSGQNIGYFWIGREFKSHSRR-MKSFVINWFREHQDANQSFIDRYHPHPQGKKIGHFTLLVSDRVNRVGCAGVRFLEPKSNRFQFMLTCNYDYNNIFN--EPIYQSGPAGSKCPQ 270          
BLAST of SCP domain-containing protein vs. Ensembl Zebrafish
Match: r3hdml (R3H domain containing-like [Source:ZFIN;Acc:ZDB-GENE-090313-275])

HSP 1 Score: 58.151 bits (139), Expect = 1.523e-8
Identity = 48/199 (24.12%), Postives = 82/199 (41.21%), Query Frame = 2
Query:  299 LKSMDKQLILDLHNWYRAQISRGDIFQQPESSDMTVVEWDDRLAEIALIRAQKCLKEKKVNDYEMSSFQHDLLGRMAINEYFTNDTDNYTKKAIHSWFKNHINFEYENGTCTKSDCQSYKNMIFSNVFVLGCEAYKCVN----------SISVICIYSNSERTDKGEDLYKSGLSCTSCPQDYSFCMDGSLCASKFHCR 865
            +   D   +LD HN  R+Q+        P +++M  + WD+RLA+ A   A +C+ E            H  L  +  N    +         + SW+    +F Y +  C+ S C  Y  M+++    +GC   KC +          +  ++C Y+  +    GE  YK G  C++CP  Y    + + C S+   R
Sbjct:   61 ISGKDMTALLDYHNRVRSQVF-------PPAANMEYMVWDERLAKSAEFWASQCIWEHG---------PHHFLQHIGQNLSIISGRYKSIIDLVKSWYDERHSFSYPS-RCSGSVCTHYTQMVWAASNKIGCAIKKCSDIFVFGSMWKQATLLVCNYA-IKGNWVGEAPYKIGRPCSACPSSYGGSCNKNQCDSRPKSR 241          
BLAST of SCP domain-containing protein vs. Ensembl Zebrafish
Match: r3hdml (R3H domain containing-like [Source:ZFIN;Acc:ZDB-GENE-090313-275])

HSP 1 Score: 58.151 bits (139), Expect = 1.523e-8
Identity = 48/199 (24.12%), Postives = 82/199 (41.21%), Query Frame = 2
Query:  299 LKSMDKQLILDLHNWYRAQISRGDIFQQPESSDMTVVEWDDRLAEIALIRAQKCLKEKKVNDYEMSSFQHDLLGRMAINEYFTNDTDNYTKKAIHSWFKNHINFEYENGTCTKSDCQSYKNMIFSNVFVLGCEAYKCVN----------SISVICIYSNSERTDKGEDLYKSGLSCTSCPQDYSFCMDGSLCASKFHCR 865
            +   D   +LD HN  R+Q+        P +++M  + WD+RLA+ A   A +C+ E            H  L  +  N    +         + SW+    +F Y +  C+ S C  Y  M+++    +GC   KC +          +  ++C Y+  +    GE  YK G  C++CP  Y    + + C S+   R
Sbjct:   61 ISGKDMTALLDYHNRVRSQVF-------PPAANMEYMVWDERLAKSAEFWASQCIWEHG---------PHHFLQHIGQNLSIISGRYKSIIDLVKSWYDERHSFSYPS-RCSGSVCTHYTQMVWAASNKIGCAIKKCSDIFVFGSMWKQATLLVCNYA-IKGNWVGEAPYKIGRPCSACPSSYGGSCNKNQCDSRPKSR 241          
BLAST of SCP domain-containing protein vs. Ensembl Zebrafish
Match: crispld2 (cysteine-rich secretory protein LCCL domain containing 2 [Source:ZFIN;Acc:ZDB-GENE-130131-1])

HSP 1 Score: 59.6918 bits (143), Expect = 2.073e-8
Identity = 66/266 (24.81%), Postives = 109/266 (40.98%), Query Frame = 2
Query:  161 IFLFFCFNPAAAFLFIFH--RLRKMFGKFLILL-LSATINCEPWSTSFKLKSMDKQLILDLHNWYRAQISRGDIFQQPESSDMTVVEWDDRLAEIALIRAQKCLKEKKVNDYEMSSFQHDLLGRMAINEYFTNDTDNYTKKAIH--SWFKNHINFEYE---------NGTCTKSDCQSYKNMIFSNVFVLGCEAYKCV----------NSISVICIYSNSERTDKGEDLYKSGLSCTSCPQDYSFCMDGSLCASKFHCRDSKISKT 886
            I L F     AA LF+     LR++  ++   L  ++T    P  T   ++  D++ IL LHN       RG+++  P +S+M  + WDD L   A   A++C  E             DLL  M+I +        Y   A H  +W+    ++ Y             C+   C  Y  ++++    +GC  + C           N++ ++C YS  +    GE  Y+ G  C+ CP  Y      +LC    + RDS+  +T
Sbjct:   11 IALLFLGVSLAASLFLPDSLELRQLMQRYQEELEPNSTKPDAPVRTRRAIEWSDREEILKLHN-----KLRGEVY--PTASNMEYMIWDDELERSATSWAEQCQWEHG---------PQDLL--MSIGQNLAVHWGRYRSPAYHVQAWYDEVKDYTYPYPHECNPWCPERCSGPMCTHYTQLVWATTNRVGCAVHVCPRMNVWGEIWENAVYLVCNYS-PKGNWIGEAPYQHGRPCSQCPPSYGGVCRDNLC----YKRDSERQET 253          
BLAST of SCP domain-containing protein vs. Ensembl Zebrafish
Match: glipr1a (GLI pathogenesis-related 1a [Source:ZFIN;Acc:ZDB-GENE-110309-2])

HSP 1 Score: 54.6842 bits (130), Expect = 2.847e-7
Identity = 48/202 (23.76%), Postives = 83/202 (41.09%), Query Frame = 2
Query:  248 LLLSATINCEPWSTSFKLKSMDKQLI---LDLHNWYRAQISRGDIFQQPESSDMTVVEWDDRLAEIALIRAQKCLKEKKVNDYEMSSFQHDLLGRMAINEYFTNDTDNYT-KKAIHSWFKNHINFEYENGTCT-KSDCQSYKNMIFSNVFVLGCEAYKCVNSIS-----------VICIYSNSERTDKGEDLYKSGLSCTSC 805
            LL+SA      +S+ +     D+  I   +  HN  R+ +S       P +++M  + WD  LA  A   A+ CL +  ++  E     H     +  N +       +T K A+ SW     ++ Y N  C  K  C  Y  +++++ + +GC    C N ++            +C Y+ +     G   YK G SC+ C
Sbjct:   15 LLISACFLLGVFSSEYLFDITDRAFIDECVREHNQNRSSVS-------PTAANMRYMTWDAALAVTARAWARFCLFKHNIHLREAKRV-HPTFTTVGENIWAGAPYSRFTVKSAVFSWVNELKDYNYNNNQCNDKKVCGHYTQVVWADSYKVGCAVQTCPNGVAETHFSNIQGVIFVCNYATAGNF-AGRSPYKQGASCSGC 207          
BLAST of SCP domain-containing protein vs. Ensembl Zebrafish
Match: crispld1b (cysteine-rich secretory protein LCCL domain containing 1b [Source:ZFIN;Acc:ZDB-GENE-040426-1204])

HSP 1 Score: 55.8398 bits (133), Expect = 3.350e-7
Identity = 52/210 (24.76%), Postives = 77/210 (36.67%), Query Frame = 2
Query:  299 LKSMDKQLILDLHNWYRAQISRGDIFQQPESSDMTVVEWDDRLAEIALIRAQKCLKEKKVNDYEMSSFQHDLLGRMAINEYFTNDTDNYTKKAIHSWFKNHINFEYENGT---------CTKSDCQSYKNMIFSNVFVLGCEAYKCVN----------SISVICIYSNSERTDKGEDLYKSGLSCTSCPQDYSFCMDGSLC----ASKFH 859
            +   D QLILDLHN  R Q+        P +S+M  + WD  L   A   A  CL E   +          LL R+  N       D      + +W+    +F Y             C+   C  Y  ++++    +GC    C N          ++ ++C YS       G   YK G  C++CP  Y      +LC     S +H
Sbjct:   58 ISQSDMQLILDLHNKLRGQV-------YPPASNMEYMVWDTELERSAEHWAHTCLWEHGPS---------HLLTRIGQNLGAHWGRDRPPTFHVQAWYDEVRDFSYPYPQECNPHCPYRCSGPVCTHYTQLVWATSNKIGCAINVCYNMNVWGMIWAKAVYLVCNYSPPGNW-WGHAPYKHGTPCSACPPSYGGGCRNNLCYKDDGSNYH 250          
BLAST of SCP domain-containing protein vs. Ensembl Xenopus
Match: ENSXETT00000010663.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:KV460357.1:2036819:2079188:-1 gene:ENSXETG00000001370.1 transcript:ENSXETT00000010663.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 63.1586 bits (152), Expect = 2.486e-10
Identity = 56/215 (26.05%), Postives = 94/215 (43.72%), Query Frame = 2
Query:  236 KFLILLLSATINCEPWSTSFKLKSMD---KQLILDLHNWYRAQISRGDIFQQPESSDMTVVEWDDRLAEIALIRAQKC-LKEKKVNDYEMSSFQHDLLGRMAINEYFTNDTDNYTKKAIHSWFKNHINFEYENGTCTKSDCQS-YKNMIFSNVFVLGCEAYKC----VNSISVICIYSNSERTDKGEDLYKSGLSCTSCPQDYSFCMDGSLCASK 853
            K LI+ +SAT + + +  +  +  +D   +  I+D HN+YR+ ++       P ++DM  + WD+     A   A  C  K   ++  +     +   G   +N YF +  +      I+ WF  H+N+EY  GT  +      +  +I++    L C   KC     N   V   Y    R DK +  Y++G +C  C +D     D  LC SK
Sbjct:    7 KNLIICISATFH-QTYHNNKTVPVLDPNNRNFIVDKHNYYRSWVN-------PPAADMLKMHWDNYYLAKAKEWALTCSFKHSNLSFRQYGVDFYYSAGENIMNSYFRHSWE----YVINYWFNEHVNWEYAVGTTKEGAVTGHFTQIIWAPTHALACYVAKCYGTPYNYFYVCIYYPTGNREDKVKTPYQNGTTCGLCQKD----CDDQLCFSK 205          
BLAST of SCP domain-containing protein vs. Ensembl Xenopus
Match: ENSXETT00000036788.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:KV464547.1:593:5826:1 gene:ENSXETG00000015856.1 transcript:ENSXETT00000036788.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 63.5438 bits (153), Expect = 1.328e-9
Identity = 54/198 (27.27%), Postives = 84/198 (42.42%), Query Frame = 2
Query:  293 FKLKSMDKQLILDLHNWYRAQISRGDIFQQPESSDMTVVEWDDRLAEIALIRAQKCLKEKKVNDYEMSSFQHDLLGRMAINEYFTNDTDNYTKKAIHSWFKNHINFEYENGTCTKSD-CQSYKNMIFSNVFVLGC--------EAYKCVNSISVICIYSNSERTDKGEDLYKSGLSCTSCPQDYSFCMDGSLCASKFH 859
              L   +K++ILD HN+YR+Q        +P +SDM  + WD  L  +A   A+KC+ E   +            G +  N +  + +       +  W K    + +  G C +   C  Y  M+++    +GC        E     N   ++C Y      + GE  YK G  CT CP D+  C+ GSLC  K+H
Sbjct:   28 LALNYEEKRIILDKHNFYRSQT-------EPSASDMIKLTWDSALEAMAKSYAEKCIWEHNKDR-----------GFIGENLFVMSGSSLDVALGLDDWHKERGYYNFTTGMCQEGQMCGHYTQMVWAGTERVGCGQNFCPKLEGVDDENMYLLVCNYEPPGNFE-GESPYKEGSRCTECPSDH-VCI-GSLCG-KYH 203          
BLAST of SCP domain-containing protein vs. Ensembl Xenopus
Match: crispld2 (cysteine-rich secretory protein LCCL domain containing 2 [Source:NCBI gene;Acc:613091])

HSP 1 Score: 59.3066 bits (142), Expect = 3.396e-8
Identity = 59/248 (23.79%), Postives = 96/248 (38.71%), Query Frame = 2
Query:  239 FLILLLSATINCEPWS-TSFKLKSMDKQLILDLHNWYRAQISRGDIFQQPESSDMTVVEWDDRLAEIALIRAQKCLKEKKVNDYEMSSFQHDLLGRMAINEYFTNDTDNYTKKAIH--SWFKNHINFEYENG---------TCTKSDCQSYKNMIFSNVFVLGCEAYKCV----------NSISVICIYSNSERTDKGEDLYKSGLSCTSCPQDYSFCMDGSLC--ASKFHCRDSKISKTCRCLVLPK 910
            FL  LL+   +  P S T   +   DK+ I+ LHN  R Q+        P +S+M  + WDD L + A   A++C+ E       MS           I +        Y + A H  SW+    ++ Y             C+   C  Y  ++++    +GC    C           N++ ++C YS  +    GE  YK+G  C+ CP  Y      +LC    K + R+  ++        P+
Sbjct:   31 FLENLLNKYKDTTPHSRTRRAILRTDKEEIIQLHNKLRGQV-------HPSASNMEYMTWDDELEKSAEAWAEECIWEHGPTALLMS-----------IGQNLAVHWGRYRQPAYHVQSWYDEVKDYTYPYPHECNPYCPERCSGPMCTHYTQIVWATTTKVGCAVNVCKRMNVWGDIWENAVYLVCNYS-PKGNWIGEAPYKNGRPCSECPPSYGGNCQNNLCYKGDKHYGREGIVTNEVETPRFPE 259          
BLAST of SCP domain-containing protein vs. Ensembl Xenopus
Match: crispld2 (cysteine-rich secretory protein LCCL domain containing 2 [Source:NCBI gene;Acc:613091])

HSP 1 Score: 59.3066 bits (142), Expect = 3.810e-8
Identity = 59/248 (23.79%), Postives = 96/248 (38.71%), Query Frame = 2
Query:  239 FLILLLSATINCEPWS-TSFKLKSMDKQLILDLHNWYRAQISRGDIFQQPESSDMTVVEWDDRLAEIALIRAQKCLKEKKVNDYEMSSFQHDLLGRMAINEYFTNDTDNYTKKAIH--SWFKNHINFEYENG---------TCTKSDCQSYKNMIFSNVFVLGCEAYKCV----------NSISVICIYSNSERTDKGEDLYKSGLSCTSCPQDYSFCMDGSLC--ASKFHCRDSKISKTCRCLVLPK 910
            FL  LL+   +  P S T   +   DK+ I+ LHN  R Q+        P +S+M  + WDD L + A   A++C+ E       MS           I +        Y + A H  SW+    ++ Y             C+   C  Y  ++++    +GC    C           N++ ++C YS  +    GE  YK+G  C+ CP  Y      +LC    K + R+  ++        P+
Sbjct:   31 FLENLLNKYKDTTPHSRTRRAILRTDKEEIIQLHNKLRGQV-------HPSASNMEYMTWDDELEKSAEAWAEECIWEHGPTALLMS-----------IGQNLAVHWGRYRQPAYHVQSWYDEVKDYTYPYPHECNPYCPERCSGPMCTHYTQIVWATTTKVGCAVNVCKRMNVWGDIWENAVYLVCNYS-PKGNWIGEAPYKNGRPCSECPPSYGGNCQNNLCYKGDKHYGREGIVTNEVETPRFPE 259          
BLAST of SCP domain-containing protein vs. Ensembl Xenopus
Match: crispld2 (cysteine-rich secretory protein LCCL domain containing 2 [Source:NCBI gene;Acc:613091])

HSP 1 Score: 57.7658 bits (138), Expect = 9.483e-8
Identity = 56/224 (25.00%), Postives = 88/224 (39.29%), Query Frame = 2
Query:  239 FLILLLSATINCEPWS-TSFKLKSMDKQLILDLHNWYRAQISRGDIFQQPESSDMTVVEWDDRLAEIALIRAQKCLKEKKVNDYEMSSFQHDLLGRMAINEYFTNDTDNYTKKAIH--SWFKNHINFEYENG---------TCTKSDCQSYKNMIFSNVFVLGCEAYKCV----------NSISVICIYSNSERTDKGEDLYKSGLSCTSCPQDYSFCMDGSLC 844
            FL  LL+   +  P S T   +   DK+ I+ LHN  R Q+        P +S+M  + WDD L + A   A++C+ E       MS           I +        Y + A H  SW+    ++ Y             C+   C  Y  ++++    +GC    C           N++ ++C YS  +    GE  YK+G  C+ CP  Y      +LC
Sbjct:   31 FLENLLNKYKDTTPHSRTRRAILRTDKEEIIQLHNKLRGQV-------HPSASNMEYMTWDDELEKSAEAWAEECIWEHGPTALLMS-----------IGQNLAVHWGRYRQPAYHVQSWYDEVKDYTYPYPHECNPYCPERCSGPMCTHYTQIVWATTTKVGCAVNVCKRMNVWGDIWENAVYLVCNYS-PKGNWIGEAPYKNGRPCSECPPSYGGNCQNNLC 235          
BLAST of SCP domain-containing protein vs. Ensembl Mouse
Match: Pi16 (peptidase inhibitor 16 [Source:MGI Symbol;Acc:MGI:1921366])

HSP 1 Score: 77.411 bits (189), Expect = 4.356e-15
Identity = 57/195 (29.23%), Postives = 86/195 (44.10%), Query Frame = 2
Query:  299 LKSMDKQLILDLHNWYRAQISRGDIFQQPESSDMTVVEWDDRLAEIALIRAQKCLKEKKVNDYEMSSFQHDL-LGRMAINEYFTNDTDNYTKKAIHSWFKNHINFEYENGTCTKSD-CQSYKNMIFSNVFVLGCEAYKC--------VNSISVICIYSNSERTDKGEDLYKSGLSCTSCPQDYSFCMDGSLCASK 853
            L   +KQ ++DLHN YRAQ+S       P +SDM  + WDD LA  A   AQKC+            + H+   GR   N +   D       A+ +W + H  + +   TC  +  C  Y  +++S    +GC ++ C         N   ++C Y       KG   Y+ G  C+ CP  YS   + SLC ++
Sbjct:   30 LTEDEKQTMVDLHNQYRAQVS-------PPASDMLQMRWDDELAAFAKAYAQKCV------------WGHNKERGRRGENLFAITDEGMDVPLAVGNWHEEHEYYNFSTATCDPNQMCGHYTQVVWSKTERIGCGSHFCETLQGVEEANIHLLVCNYEPPGNV-KGRKPYQEGTPCSQCPLGYS--CENSLCGAE 202          
BLAST of SCP domain-containing protein vs. Ensembl Mouse
Match: Pi16 (peptidase inhibitor 16 [Source:MGI Symbol;Acc:MGI:1921366])

HSP 1 Score: 77.0258 bits (188), Expect = 9.363e-15
Identity = 54/184 (29.35%), Postives = 80/184 (43.48%), Query Frame = 2
Query:  299 LKSMDKQLILDLHNWYRAQISRGDIFQQPESSDMTVVEWDDRLAEIALIRAQKCLKEKKVNDYEMSSFQHDL-LGRMAINEYFTNDTDNYTKKAIHSWFKNHINFEYENGTCTKSD-CQSYKNMIFSNVFVLGCEAYKC--------VNSISVICIYSNSERTDKGEDLYKSGLSCTSCPQDYS 820
            L   +KQ ++DLHN YRAQ+S       P +SDM  + WDD LA  A   AQKC+            + H+   GR   N +   D       A+ +W + H  + +   TC  +  C  Y  +++S    +GC ++ C         N   ++C Y       KG   Y+ G  C+ CP  YS
Sbjct:   30 LTEDEKQTMVDLHNQYRAQVS-------PPASDMLQMRWDDELAAFAKAYAQKCV------------WGHNKERGRRGENLFAITDEGMDVPLAVGNWHEEHEYYNFSTATCDPNQMCGHYTQVVWSKTERIGCGSHFCETLQGVEEANIHLLVCNYEPPGNV-KGRKPYQEGTPCSQCPLGYS 193          
BLAST of SCP domain-containing protein vs. Ensembl Mouse
Match: Pi16 (peptidase inhibitor 16 [Source:MGI Symbol;Acc:MGI:1921366])

HSP 1 Score: 77.0258 bits (188), Expect = 9.363e-15
Identity = 54/184 (29.35%), Postives = 80/184 (43.48%), Query Frame = 2
Query:  299 LKSMDKQLILDLHNWYRAQISRGDIFQQPESSDMTVVEWDDRLAEIALIRAQKCLKEKKVNDYEMSSFQHDL-LGRMAINEYFTNDTDNYTKKAIHSWFKNHINFEYENGTCTKSD-CQSYKNMIFSNVFVLGCEAYKC--------VNSISVICIYSNSERTDKGEDLYKSGLSCTSCPQDYS 820
            L   +KQ ++DLHN YRAQ+S       P +SDM  + WDD LA  A   AQKC+            + H+   GR   N +   D       A+ +W + H  + +   TC  +  C  Y  +++S    +GC ++ C         N   ++C Y       KG   Y+ G  C+ CP  YS
Sbjct:   30 LTEDEKQTMVDLHNQYRAQVS-------PPASDMLQMRWDDELAAFAKAYAQKCV------------WGHNKERGRRGENLFAITDEGMDVPLAVGNWHEEHEYYNFSTATCDPNQMCGHYTQVVWSKTERIGCGSHFCETLQGVEEANIHLLVCNYEPPGNV-KGRKPYQEGTPCSQCPLGYS 193          
BLAST of SCP domain-containing protein vs. Ensembl Mouse
Match: Pi16 (peptidase inhibitor 16 [Source:MGI Symbol;Acc:MGI:1921366])

HSP 1 Score: 76.6406 bits (187), Expect = 1.177e-13
Identity = 54/182 (29.67%), Postives = 79/182 (43.41%), Query Frame = 2
Query:  311 DKQLILDLHNWYRAQISRGDIFQQPESSDMTVVEWDDRLAEIALIRAQKCL----KEKKVNDYEMSSFQHDLLGRMAINEYFTNDTDNYTKKAIHSWFKNHINFEYENGTCTKSD-CQSYKNMIFSNVFVLG-----CEAYKCVNSISVICIYSNSERTD--KGEDLYKSGLSCTSCPQDYS 820
            +KQ ++DLHN YRAQ+S       P +SDM  + WDD LA  A   AQKC+    KE+               GR   N +   D       A+ +W + H  + +   TC  +  C  Y  +++S    +G     CE  + V   ++  +  N E     KG   Y+ G  C+ CP  YS
Sbjct:   34 EKQTMVDLHNQYRAQVS-------PPASDMLQMRWDDELAAFAKAYAQKCVWGHNKER---------------GRRGENLFAITDEGMDVPLAVGNWHEEHEYYNFSTATCDPNQMCGHYTQVVWSKTERIGCGSHFCETLQGVEEANIHLLVCNYEPPGNVKGRKPYQEGTPCSQCPLGYS 193          
BLAST of SCP domain-containing protein vs. Ensembl Mouse
Match: Clec18a (C-type lectin domain family 18, member A [Source:MGI Symbol;Acc:MGI:2672935])

HSP 1 Score: 64.3142 bits (155), Expect = 6.213e-10
Identity = 62/241 (25.73%), Postives = 97/241 (40.25%), Query Frame = 2
Query:  320 LILDLHNWYRAQISRGDIFQQPESSDMTVVEWDDRLAEIALIRAQKCLKEKKVNDYEMSSFQHDLLGRMAINEYFTNDTDNYTKKAIHSWFKNHINFEYENGTCT-KSDCQSYKNMIFSNVFVLGCEAYKCVNSI----SVICIYS---NSERTDKGEDLYKSGLSCTSCPQDYSFCMD-----GSLC-ASKFHCRDSKISKTCRCLVLPKLCTKHGDYDSSKCRCRCQPGWTGLNCEKPC 1000
            LIL  HN  R+++        P +++M  ++W + LA++A  RA  C+    V     S+  H+    +  N            + ++ WF   + + + +  C   + C  Y  ++++    LGC    C        + +C YS   N +   K    YK G  C+ C    S C       G LC   +  CR S     CR L         G  + S CRC CQPG+TG  C+  C
Sbjct:   76 LILTAHNRLRSRV-------HPPAANMQRMDWSESLAQLAEARAALCVT--SVTPNLASTPGHN--SHVGWNVQLMPMGSASFVEVVNLWFAEGLQYRHGDAECAHNATCAHYTQLVWATSSQLGCGRQPCFVDQEAMEAFVCAYSPGGNWDINGKTVAPYKKGTWCSLCTARVSGCFKAWDHAGGLCEVPRNPCRMS-----CRNL---------GHLNISTCRCHCQPGYTGRYCQVRC 291          
BLAST of SCP domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9ET66|PI16_MOUSE (Peptidase inhibitor 16 OS=Mus musculus OX=10090 GN=Pi16 PE=1 SV=2)

HSP 1 Score: 76.6406 bits (187), Expect = 8.234e-13
Identity = 54/182 (29.67%), Postives = 79/182 (43.41%), Query Frame = 2
Query:  311 DKQLILDLHNWYRAQISRGDIFQQPESSDMTVVEWDDRLAEIALIRAQKCL----KEKKVNDYEMSSFQHDLLGRMAINEYFTNDTDNYTKKAIHSWFKNHINFEYENGTCTKSD-CQSYKNMIFSNVFVLG-----CEAYKCVNSISVICIYSNSERTD--KGEDLYKSGLSCTSCPQDYS 820
            +KQ ++DLHN YRAQ+S       P +SDM  + WDD LA  A   AQKC+    KE+               GR   N +   D       A+ +W + H  + +   TC  +  C  Y  +++S    +G     CE  + V   ++  +  N E     KG   Y+ G  C+ CP  YS
Sbjct:   34 EKQTMVDLHNQYRAQVS-------PPASDMLQMRWDDELAAFAKAYAQKCVWGHNKER---------------GRRGENLFAITDEGMDVPLAVGNWHEEHEYYNFSTATCDPNQMCGHYTQVVWSKTERIGCGSHFCETLQGVEEANIHLLVCNYEPPGNVKGRKPYQEGTPCSQCPLGYS 193          
BLAST of SCP domain-containing protein vs. UniProt/SwissProt
Match: sp|Q7YT83|TX31_CONTE (Cysteine-rich venom protein OS=Conus textile OX=6494 PE=1 SV=1)

HSP 1 Score: 68.5514 bits (166), Expect = 6.823e-11
Identity = 69/293 (23.55%), Postives = 119/293 (40.61%), Query Frame = 2
Query:  275 EPWSTSFKLKSMDKQLILDLHNWYRAQISRGDIFQQPESSDMTVVEWDDRLAEIALIRAQKCLKEKKVNDYEMSSFQHDLLGRMAINEYFTNDTDNYTKKAIHSWFKNHINFEYENGTCTKSDCQSYKNMIFSNVFVLGCEAYKCVNSISVICIYSNSERTDKGEDLYKSGLSCTSCPQDYSFCMDGSLCASKFHCRDS--KISKTCRCLVLPKLCTKHGDYDSSKCRCRCQPGWTGLNCEK---PCHDSSPLCENRKWACTDVTHKSQMF-------KACPQTCKWCQNNPN 1117
            +P + +  L    +  IL++HN  RA ++        ++++M  +EWD+RLA +A   A +C+    +        + DL G +  N  +++    +   A+  W    ++F+Y  G  T      Y   +F+    +GC    C N+   +C Y    +   G++ Y+ G  C+ C    S C          H R S  +    C C   P  C   G ++ + C+C C   W G +C++   P  D   +C        D   + Q +         CP  C +C  NPN
Sbjct:   45 KPNAVAVPLTQETEHEILEMHNKIRADVT--------DAANMLKMEWDERLATVAQKWAMQCI----LGHDSGRRGEPDLPGSVGQNVAWSSGDLTFLG-AVQMWADEIVDFQY--GVWTDGTGH-YIQQVFAGASRIGCGQSACGNNKYFVCNYY---KGTMGDEPYQLGRPCSQC---RSSCQ---------HIRGSQGRWGSLCDCTNGPDACFNGGIFNINTCQCECSGIWGGADCQEKHCPNEDFDDMCRY-----PDALRRPQHWCQYDNFQSDCPILCGYCP-NPN 300          
BLAST of SCP domain-containing protein vs. UniProt/SwissProt
Match: sp|Q6UXB8|PI16_HUMAN (Peptidase inhibitor 16 OS=Homo sapiens OX=9606 GN=PI16 PE=1 SV=1)

HSP 1 Score: 66.2402 bits (160), Expect = 1.046e-9
Identity = 48/185 (25.95%), Postives = 79/185 (42.70%), Query Frame = 2
Query:  299 LKSMDKQLILDLHNWYRAQISRGDIFQQPESSDMTVVEWDDRLAEIALIRAQKCL----KEKKVNDYEMSSFQHDLLGRMAINEYFTNDTDNYTKKAIHSWFKNHINFEYENGTCTKSD-CQSYKNMIFSNVFVLGCEAYKC-----VNSISVICIYSNSERTD--KGEDLYKSGLSCTSCPQDY 817
            L   +K+L+++LHN YRAQ+S       P +SDM  + WD+ LA  A   A++C+    KE+               GR   N +   D       A+  W     ++     TC+    C  Y  ++++    +GC ++ C     V   ++  +  N E     KG+  Y+ G  C+ CP  Y
Sbjct:   28 LTDEEKRLMVELHNLYRAQVS-------PTASDMLHMRWDEELAAFAKAYARQCVWGHNKER---------------GRRGENLFAITDEGMDVPLAMEEWHHEREHYNLSAATCSPGQMCGHYTQVVWAKTERIGCGSHFCEKLQGVEETNIELLVCNYEPPGNVKGKRPYQEGTPCSQCPSGY 190          
BLAST of SCP domain-containing protein vs. UniProt/SwissProt
Match: sp|Q7TSQ1|CL18A_MOUSE (C-type lectin domain family 18 member A OS=Mus musculus OX=10090 GN=Clec18a PE=2 SV=1)

HSP 1 Score: 63.5438 bits (153), Expect = 9.336e-9
Identity = 63/248 (25.40%), Postives = 98/248 (39.52%), Query Frame = 2
Query:  299 LKSMDKQLILDLHNWYRAQISRGDIFQQPESSDMTVVEWDDRLAEIALIRAQKCLKEKKVNDYEMSSFQHDLLGRMAINEYFTNDTDNYTKKAIHSWFKNHINFEYENGTCT-KSDCQSYKNMIFSNVFVLGCEAYKCVNSI----SVICIYSNSERTD---KGEDLYKSGLSCTSCPQDYSFCMD-----GSLC-ASKFHCRDSKISKTCRCLVLPKLCTKHGDYDSSKCRCRCQPGWTGLNCEKPC 1000
            L   +  LIL  HN  R+++        P +++M  ++W + LA++A  RA  C+     N    S+  H+    +  N            + ++ WF   + + + +  C   + C  Y  ++++    LGC    C        + +C YS     D   K    YK G  C+ C    S C       G LC   +  CR S     CR L         G  + S CRC CQPG+TG  C+  C
Sbjct:  130 LSRKESFLILTAHNRLRSRV-------HPPAANMQRMDWSESLAQLAEARAALCVTSVTPN--LASTPGHN--SHVGWNVQLMPMGSASFVEVVNLWFAEGLQYRHGDAECAHNATCAHYTQLVWATSSQLGCGRQPCFVDQEAMEAFVCAYSPGGNWDINGKTVAPYKKGTWCSLCTARVSGCFKAWDHAGGLCEVPRNPCRMS-----CRNL---------GHLNISTCRCHCQPGYTGRYCQVRC 352          
BLAST of SCP domain-containing protein vs. UniProt/SwissProt
Match: sp|A1BQQ5|MR30_CONMR (Cysteine-rich venom protein Mr30 OS=Conus marmoreus OX=42752 PE=1 SV=1)

HSP 1 Score: 61.2326 bits (147), Expect = 1.812e-8
Identity = 57/250 (22.80%), Postives = 96/250 (38.40%), Query Frame = 2
Query:  284 STSFKLKSMDKQLILDLHNWYRAQISRGDIFQQPESSDMTVVEWDDRLAEIALIRAQKCLKEKKVNDYEMSSFQHDLLGRMAINEYFTNDTDNYTKKAIHSWFKNHINFEYENGTCTKSDCQSYKNMIFSNVFVLGCEAYKCVNSISVICIYSNSERTDKGEDLYKSGLSCTSCPQDYSFCMDGSLCASKFHCRDSKISKTCRCLVLPKLCTKHGDYDSSKCRCRCQPGWTGLNCEK---PCHDSSPLCE 1024
            + +  L    K  I+ +HN  RA ++        ++++M  +EWDDRLA +A   A +C+     +D   +  + DL G +  N  ++N    +    +  W     ++EY        +   Y   I++    +GC    C      +C Y  S     G   Y  G  C  CP                   +S   + C C   P  C   G  +   C C+C   W+G +C++   P HD   +C+
Sbjct:   48 AVAVTLTQEVKVQIVRMHNVIRATVN--------DAANMMKMEWDDRLAAVAQKWAMQCILG---HDGFANHAEPDLPGYVGQNVGWSNYHMTF-PDVVDLWAAEIEDYEY---GVWNDNTGHYIQQIYAEASRIGCGQSACGEDRYFVCNYYKSTM---GNTPYAQGSRCGQCP-------------------NSCWEELCDCTSGPDACCNGGSLNIDTCECQCPRLWSGADCQEKQCPDHDYEDMCD 260          
BLAST of SCP domain-containing protein vs. TrEMBL
Match: A0A267FTH7 (SCP domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig027161g3 PE=3 SV=1)

HSP 1 Score: 102.834 bits (255), Expect = 6.606e-20
Identity = 76/292 (26.03%), Postives = 131/292 (44.86%), Query Frame = 2
Query:  239 FLILLLSATINCEPWSTS--FKLKSMDKQLILDLHNWYRAQISRGDIFQQPESSDMTVVEWDDRLAEIALIRAQKCLKEKKVNDYEMSSFQHDLLGRMAINEYFTNDTDNYTKKAIHSWFKNHINFEYENGTCTKSDCQSYKNMIFSNVFVLGCEAYKCVN-SISVICIYSNSERTDKGEDLYKSGLSCTSCPQDYSFCMDGSLCASKFHCRDSKISKTCRCLVLPKLCTKHGDYDSSKCRCRCQPGWTGLNCEKPCHDSSPLCENRKWACTDVTHKSQMFKACPQTCKWCQ 1105
            F+  L+ A +     ++     L +  KQ ILD HN  RA+ + G +  QP++++M  +EWDDRL + A    ++C+          S     L G   + + +           +  WF+ + ++ +   +C+ + C  Y  ++++   ++GC   +C N   +++C Y+     + GE  Y SG   + C  +Y F   G LC  K  C     S  C C +    C   G  DS+ C+C C  G+ G  CEKPC DS+   +   +  + +   S     CP+ C  C+
Sbjct:    3 FVFALIWALVATSTMASGELVTLTAEQKQAILDAHNVLRARTAMGLVGNQPKAANMPALEWDDRLMDSANNWVKQCVAGHD------SGSDQALTGYSWVGQNWAGGYSGNFSYYVDLWFREYKDYTFATKSCS-AVCGHYTQVVWAKTTLVGCGVSRCSNYPYTIVCNYATGGNYN-GEYPYVSGDDASQCNGEYVFKQRG-LCMRKDQCN----SGDCTCSI--SSCLNGGVLDSANCKCTCPDGFYGNKCEKPCVDSTLASDYCSY--STICSYSSYAPRCPKKCNLCK 277          
BLAST of SCP domain-containing protein vs. TrEMBL
Match: A0A1I8HQH6 (SCP domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig027161g1 PE=3 SV=1)

HSP 1 Score: 102.834 bits (255), Expect = 7.124e-20
Identity = 76/292 (26.03%), Postives = 131/292 (44.86%), Query Frame = 2
Query:  239 FLILLLSATINCEPWSTS--FKLKSMDKQLILDLHNWYRAQISRGDIFQQPESSDMTVVEWDDRLAEIALIRAQKCLKEKKVNDYEMSSFQHDLLGRMAINEYFTNDTDNYTKKAIHSWFKNHINFEYENGTCTKSDCQSYKNMIFSNVFVLGCEAYKCVN-SISVICIYSNSERTDKGEDLYKSGLSCTSCPQDYSFCMDGSLCASKFHCRDSKISKTCRCLVLPKLCTKHGDYDSSKCRCRCQPGWTGLNCEKPCHDSSPLCENRKWACTDVTHKSQMFKACPQTCKWCQ 1105
            F+  L+ A +     ++     L +  KQ ILD HN  RA+ + G +  QP++++M  +EWDDRL + A    ++C+          S     L G   + + +           +  WF+ + ++ +   +C+ + C  Y  ++++   ++GC   +C N   +++C Y+     + GE  Y SG   + C  +Y F   G LC  K  C     S  C C +    C   G  DS+ C+C C  G+ G  CEKPC DS+   +   +  + +   S     CP+ C  C+
Sbjct:    3 FVFALIWALVATSTMASGELVTLTAEQKQAILDAHNVLRARTAMGLVGNQPKAANMPALEWDDRLMDSANNWVKQCVAGHD------SGSDRALTGYSWVGQNWAGGYSGNFSYYVDLWFREYKDYTFATKSCS-AVCGHYTQVVWAKTTLVGCGVSRCSNYPYTIVCNYATGGNYN-GEYPYVSGDDASQCNGEYVFKQRG-LCMRKDQCN----SGDCTCSI--SSCLNGGVLDSANCKCTCPDGFYGNKCEKPCVDSTLASDYCSY--STICSYSSYAPRCPKKCNLCK 277          
BLAST of SCP domain-containing protein vs. TrEMBL
Match: A0A267ECZ2 (SCP domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig020329g1 PE=3 SV=1)

HSP 1 Score: 88.5817 bits (218), Expect = 1.403e-14
Identity = 56/190 (29.47%), Postives = 89/190 (46.84%), Query Frame = 2
Query:  299 LKSMDKQLILDLHNWYRAQISRGDIFQQPESSDMTVVEWDDRLAEIALIRAQKCLKEKKVNDYEMSSFQHDLLGRMAINEYFTNDTDNYTKKAIHSWFKNHINFEYENGTCTKSD-CQSYKNMIFSNVFVLGCEAYKCVNSISV-ICIYSNSERTDKGEDLYKSGLSCTSCPQDYSFCMDGSLCASKFHC 862
            L   DKQ+ILD HN  RA+ +RG+   QP ++DM ++EWDDRL E A   A +C K       E     H  +G+     + TN         +  W+  H ++ +   TCT    C  Y  +++S   ++GC A  C   + + +C Y++          Y+SG   + C  +Y++   G LC  +  C
Sbjct:   30 LSKADKQIILDTHNVLRARTARGETGSQPSAADMMLLEWDDRLMEKAANWASQC-KVGHDTPAERVIPGHKWVGQNWAGGHSTN-----LSLFVDLWYVEHNDYNFAAKTCTPEKMCGHYTQVVWSRTLLVGCAAATCPGYLRILVCDYADGGNVGT-YPAYESGSPASKCVGEYTY-TSGGLCLRRDQC 211          
BLAST of SCP domain-containing protein vs. TrEMBL
Match: A0A267ERB2 (SCP domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig000984g1 PE=3 SV=1)

HSP 1 Score: 88.5817 bits (218), Expect = 1.429e-14
Identity = 56/190 (29.47%), Postives = 89/190 (46.84%), Query Frame = 2
Query:  299 LKSMDKQLILDLHNWYRAQISRGDIFQQPESSDMTVVEWDDRLAEIALIRAQKCLKEKKVNDYEMSSFQHDLLGRMAINEYFTNDTDNYTKKAIHSWFKNHINFEYENGTCTKSD-CQSYKNMIFSNVFVLGCEAYKCVNSISV-ICIYSNSERTDKGEDLYKSGLSCTSCPQDYSFCMDGSLCASKFHC 862
            L   DKQ+ILD HN  RA+ +RG+   QP ++DM ++EWDDRL E A   A +C K       E     H  +G+     + TN         +  W+  H ++ +   TCT    C  Y  +++S   ++GC A  C   + + +C Y++          Y+SG   + C  +Y++   G LC  +  C
Sbjct:   30 LSKADKQIILDTHNVLRARTARGETGSQPSAADMMLLEWDDRLMEKAANWASQC-KVGHDTPAERVIPGHKWVGQNWAGGHSTN-----LSLFVDLWYVEHNDYNFAAKTCTPEKMCGHYTQVVWSRTLLVGCAAATCPGYLRILVCDYADGGNVGT-YPAYESGSPASKCVGEYTY-TSGGLCLRRDQC 211          
BLAST of SCP domain-containing protein vs. TrEMBL
Match: A0A1I8GSB3 (SCP domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig008689g1 PE=3 SV=1)

HSP 1 Score: 88.5817 bits (218), Expect = 1.429e-14
Identity = 56/190 (29.47%), Postives = 89/190 (46.84%), Query Frame = 2
Query:  299 LKSMDKQLILDLHNWYRAQISRGDIFQQPESSDMTVVEWDDRLAEIALIRAQKCLKEKKVNDYEMSSFQHDLLGRMAINEYFTNDTDNYTKKAIHSWFKNHINFEYENGTCTKSD-CQSYKNMIFSNVFVLGCEAYKCVNSISV-ICIYSNSERTDKGEDLYKSGLSCTSCPQDYSFCMDGSLCASKFHC 862
            L   DKQ+ILD HN  RA+ +RG+   QP ++DM ++EWDDRL E A   A +C K       E     H  +G+     + TN         +  W+  H ++ +   TCT    C  Y  +++S   ++GC A  C   + + +C Y++          Y+SG   + C  +Y++   G LC  +  C
Sbjct:   30 LSKADKQIILDTHNVLRARTARGETGSQPSAADMMLLEWDDRLMEKAANWASQC-KVGHDTPAERVIPGHKWVGQNWAGGHSTN-----LSLFVDLWYVEHNDYNFAAKTCTPEKMCGHYTQVVWSRTLLVGCAAATCPGYLRILVCDYADGGNVGT-YPAYESGSPASKCVGEYTY-TSGGLCLRRDQC 211          
BLAST of SCP domain-containing protein vs. Ensembl Cavefish
Match: CLEC18A (C-type lectin domain family 18 member A [Source:NCBI gene;Acc:103038454])

HSP 1 Score: 75.485 bits (184), Expect = 1.549e-13
Identity = 68/273 (24.91%), Postives = 114/273 (41.76%), Query Frame = 2
Query:  230 FGKFLILLLSATINCEPWST--SFKLKSMDKQLILDLHNWYRAQISRGDIFQQPESSDMTVVEWDDRLAEIALIRAQKCLKEKKVNDYEMSSFQHDLLGRMAINEYFTNDTDNYTKKAIHSWFKNHINFEYENGTC-TKSDCQSYKNMIFSNVFVLGCEAYKCVNSIS----VICIYS---NSERTDKGEDLYKSGLSCTSCPQDYSFCMD-----GSLCAS-KFHCRDSKISKTCRCLVLPKLCTKHGDYDSSKCRCRCQPGWTGLNCEKPC 1000
                L ++LSA   C  W+   +  L   +   I+  HN  R+++        P +++M  +E+ +RLA +A  RA+ C +++        S   +  G +  N   +          I+SWFK   N+ Y++G C     C+ Y  ++++    +GC    C          +C YS   N E   +    YK+G+ C+ C    S C+      G LC + +  CR S              C ++G  + S C C C PG+TG  C+  C
Sbjct:   10 LAPLLTVILSALRTCCSWTGPPAPGLGVKEHFQIVTQHNRLRSRVD-------PMAANMQKMEYSERLARLAQERAESCSEDR--------SLLEEHTGHIGWNVCRSPHGVASFSDIINSWFKEGQNYIYQSGQCRNNGTCKHYTQLVWATSSQVGCAVRVCRGGAVQWDLFVCAYSPGGNWEVNGRHVVPYKAGVYCSLCTSSMSGCLRLWDHVGGLCETPRNPCRMS--------------CGQNGQLNVSLCHCNCAPGFTGRFCQVRC 253          
BLAST of SCP domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000031557.1 (peptidase inhibitor 16 [Source:NCBI gene;Acc:103029846])

HSP 1 Score: 71.2478 bits (173), Expect = 5.811e-13
Identity = 54/201 (26.87%), Postives = 97/201 (48.26%), Query Frame = 2
Query:  311 DKQLILDLHNWYRAQISRGDIFQQPESSDMTVVEWDDRLAEIALIRAQKCLKEKKVNDYEMSSFQHDLLGRMAINEYFTNDTDNYTKKAIHSWFKNHINFEYENGTCTKSD-CQSYKNMIFSNVFVLGCEAYKCV--------NSISVICIYSNSERTDKGEDLYKSGLSCTSCPQDYSFCMDGSLCASKFHCRDSKISKT 886
            D+Q I++LHN +R+ +       +P ++DM  ++W   LA IA   A KC+       +E +    +++G    N + T    +  +KA+  WF  H ++ Y+N TC +++ C  Y  M+++    +GC ++ C         N+  ++C Y        G+  Y+ G  C+ CP D   C+D + C S  H   S ++ T
Sbjct:   29 DQQRIVNLHNHHRSTV-------EPPAADMIHMKWSGELALIAKEYATKCI-------WEHNPDSQNIMGE---NLFITTGPLD-IEKALSDWFMEHKHYSYDNNTCAENEMCGHYTQMVWAKTKEVGCGSHLCETVEALGFKNATLLVCNYLPLGNY-MGQKPYQVGEQCSKCPDDLKNCVDQA-CDSTDHDELSTVNPT 209          
BLAST of SCP domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000036030.1 (peptidase inhibitor 16 [Source:NCBI gene;Acc:103029846])

HSP 1 Score: 70.0922 bits (170), Expect = 1.090e-12
Identity = 49/183 (26.78%), Postives = 89/183 (48.63%), Query Frame = 2
Query:  311 DKQLILDLHNWYRAQISRGDIFQQPESSDMTVVEWDDRLAEIALIRAQKCLKEKKVNDYEMSSFQHDLLGRMAINEYFTNDTDNYTKKAIHSWFKNHINFEYENGTCTKSD-CQSYKNMIFSNVFVLGCEAYKCV--------NSISVICIYSNSERTDKGEDLYKSGLSCTSCPQDYSFCMD 832
            D+Q I++LHN +R+ +       +P ++DM  ++W   LA IA   A KC+       +E +    +++G    N + T    +  +KA+  WF  H ++ Y+N TC +++ C  Y  M+++    +GC ++ C         N+  ++C Y        G+  Y+ G  C+ CP D   C+D
Sbjct:   29 DQQRIVNLHNHHRSTV-------EPPAADMIHMKWSGELALIAKEYATKCI-------WEHNPDSQNIMGE---NLFITTGPLD-IEKALSDWFMEHKHYSYDNNTCAENEMCGHYTQMVWAKTKEVGCGSHLCETVEALGFKNATLLVCNYLPLGNY-MGQKPYQVGEQCSKCPDDLKNCVD 192          
BLAST of SCP domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000029824.1 (peptidase inhibitor 16 [Source:NCBI gene;Acc:103029846])

HSP 1 Score: 70.0922 bits (170), Expect = 1.776e-12
Identity = 49/183 (26.78%), Postives = 89/183 (48.63%), Query Frame = 2
Query:  311 DKQLILDLHNWYRAQISRGDIFQQPESSDMTVVEWDDRLAEIALIRAQKCLKEKKVNDYEMSSFQHDLLGRMAINEYFTNDTDNYTKKAIHSWFKNHINFEYENGTCTKSD-CQSYKNMIFSNVFVLGCEAYKCV--------NSISVICIYSNSERTDKGEDLYKSGLSCTSCPQDYSFCMD 832
            D+Q I++LHN +R+ +       +P ++DM  ++W   LA IA   A KC+       +E +    +++G    N + T    +  +KA+  WF  H ++ Y+N TC +++ C  Y  M+++    +GC ++ C         N+  ++C Y        G+  Y+ G  C+ CP D   C+D
Sbjct:   29 DQQRIVNLHNHHRSTV-------EPPAADMIHMKWSGELALIAKEYATKCI-------WEHNPDSQNIMGE---NLFITTGPLD-IEKALSDWFMEHKHYSYDNNTCAENEMCGHYTQMVWAKTKEVGCGSHLCETVEALGFKNATLLVCNYLPLGNY-MGQKPYQVGEQCSKCPDDLKNCVD 192          
BLAST of SCP domain-containing protein vs. Ensembl Cavefish
Match: CLEC18A (C-type lectin domain family 18 member A [Source:NCBI gene;Acc:103038454])

HSP 1 Score: 70.4774 bits (171), Expect = 5.656e-12
Identity = 61/240 (25.42%), Postives = 102/240 (42.50%), Query Frame = 2
Query:  323 ILDLHNWYRAQISRGDIFQQPESSDMTVVEWDDRLAEIALIRAQKCLKEKKVNDYEMSSFQHDLLGRMAINEYFTNDTDNYTKKAIHSWFKNHINFEYENGTC-TKSDCQSYKNMIFSNVFVLGCEAYKCVNSIS----VICIYS---NSERTDKGEDLYKSGLSCTSCPQDYSFCMD-----GSLCAS-KFHCRDSKISKTCRCLVLPKLCTKHGDYDSSKCRCRCQPGWTGLNCEKPC 1000
            I+  HN  R+++        P +++M  +E+ +RLA +A  RA+ C +++        S   +  G +  N   +          I+SWFK   N+ Y++G C     C+ Y  ++++    +GC    C          +C YS   N E   +    YK+G+ C+ C    S C+      G LC + +  CR S              C ++G  + S C C C PG+TG  C+  C
Sbjct:   67 IVTQHNRLRSRVD-------PMAANMQKMEYSERLARLAQERAESCSEDR--------SLLEEHTGHIGWNVCRSPHGVASFSDIINSWFKEGQNYIYQSGQCRNNGTCKHYTQLVWATSSQVGCAVRVCRGGAVQWDLFVCAYSPGGNWEVNGRHVVPYKAGVYCSLCTSSMSGCLRLWDHVGGLCETPRNPCRMS--------------CGQNGQLNVSLCHCNCAPGFTGRFCQVRC 277          
BLAST of SCP domain-containing protein vs. Ensembl Sea Lamprey
Match: CLEC18A (C-type lectin domain family 18 member A [Source:HGNC Symbol;Acc:HGNC:30388])

HSP 1 Score: 60.4622 bits (145), Expect = 1.971e-9
Identity = 60/246 (24.39%), Postives = 96/246 (39.02%), Query Frame = 2
Query:  332 LHNWYRAQISRGDIFQQPESSDMTVVEWDDRLAEIALIRAQKC-------------LKEKKVNDYEMSSFQHDLLGRMAINEYFTNDTDNYTKKAIHSWFKNHINFEYENGTCTKS-DCQSYKNMIFSNVFVLGCEAYKCVNSISVI----CIYSNSERTDKGEDLYKSGLSCTSCPQDYSFCMDGSLCASKFHCRDSKISKTC-----RCLVLPKLCTKHGDYDSSKCRCRCQPGWTGLNCEKPC 1000
            LHN  RA +       QP +++M  +EWDD LA++A   A                + EK       +  +     R+ +N +            + SWF    N++Y    C  +  C+ Y  M++++   +GC    C +  S +    C+Y        G D+  S  S  + P          L  S F   + +   TC     RC +    C +HG  DS+ CRC C  G++G  C+  C
Sbjct:   56 LHNKLRATV-------QPSAANMEKMEWDDSLAQVAHEWAAVACENPRAAEGTSAEIPEKPGIQGTGAGGRGGGQRRLGVNLHRAPHGATSFASVLASWFSEGQNYDYARPGCAHNRTCRHYTQMVWASASRVGCAKRWCRDPGSRVEAFACVYL------PGNDVRLSLRSLATSPLCCCCYCCWLLIVSWFLSSNDESPGTCEVPQNRCRMN---CGRHGHLDSASCRCSCASGFSGKYCQVKC 285          
BLAST of SCP domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000374.1 (pep scaffold:Pmarinus_7.0:GL476650:75849:87118:-1 gene:ENSPMAG00000000334.1 transcript:ENSPMAT00000000374.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 54.299 bits (129), Expect = 1.347e-7
Identity = 43/197 (21.83%), Postives = 80/197 (40.61%), Query Frame = 2
Query:  311 DKQLILDLHNWYRAQISRGDIFQQPESSDMTVVEWDDRLAEIALIRAQKCLKEKKVNDYEMSSFQHDLLGRMAINEYFTNDTDNYTKKAIHSWFKNHINFEYEN---------GTCTKSDCQSYKNMIFSNVFVLGCEAYKCVN----------SISVICIYSNSERTDKGEDLYKSGLSCTSCPQDYSFCMDGSLC 844
            +++ + + HN  RA +        P+++DM  + WD  LA +A   A++C      +D      Q D +G+   N      ++      + +WF     ++Y            TC    C  Y  ++++    +GC  + C++          ++ ++C YS  +    GE  Y+ G  C+ CP  Y     G LC
Sbjct:    5 ERRALTEYHNRLRASV-------HPQAADMEHMSWDWELAGMAEAWAKQCKWGHGPSD------QLDAIGQ---NLAVYVGSERPLAYHVQAWFDEEEWYQYPEEKECSPECPHTCRGPICTHYTQLVWAESRRVGCAVHTCLDISVWDAVWPYALYLVCNYS-PKGNWIGEAPYRQGTPCSRCPPRYGGSCRGGLC 184          
BLAST of SCP domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000023160.2 (peptidase inhibitor 16 [Source:NCBI gene;Acc:101164782])

HSP 1 Score: 66.2402 bits (160), Expect = 9.197e-11
Identity = 49/194 (25.26%), Postives = 87/194 (44.85%), Query Frame = 2
Query:  299 LKSMDKQLILDLHNWYRAQISRGDIFQQPESSDMTVVEWDDRLAEIALIRAQKCLKEKKVNDYEMSSFQHDLLGRMAINEYFTNDTDNYTKKAIHSWFKNHINFEYENGTCTKSD-CQSYKNMIFSNVFVLGCEAYKC-------VNSIS-VICIYSNSERTDKGEDLYKSGLSCTSCPQDYSFCMDGSLCASK 853
            L    ++++++LHN YR Q+S       P ++ M  ++WD  L  +A   A KC+ E      +         G++ ++E            A+  WF   +++ YEN +C +   C  Y  M++++   +GC  + C        N++S ++C Y  +   D  E  Y  G  C+ CP+D   C +  LC  K
Sbjct:   57 LTDQQEEMLVELHNHYRGQVS-------PSAAAMLPLKWDGNLKLVAEGYAAKCIWEHNTELEDTGENLFAGTGKLDLSE------------AVEKWFLERLDYSYENNSCDEDKMCGHYTQMVWADTHRVGCAVHFCNTIENLDWNNVSYLVCNYFPAGNYDD-ERPYVEGDWCSRCPEDLDVCQN-HLCVKK 229          
BLAST of SCP domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000020676.2 (cysteine-rich venom protein pseudecin-like [Source:NCBI gene;Acc:101157728])

HSP 1 Score: 57.7658 bits (138), Expect = 1.405e-8
Identity = 38/164 (23.17%), Postives = 69/164 (42.07%), Query Frame = 2
Query:  323 ILDLHNWYRAQISRGDIFQQPESSDMTVVEWDDRLAEIALIRAQKCLKEKKVNDYEMSSFQHDLLGRMAINEYFTNDTDNYTKKAIHSWFKNHINFEYENGTCTKSDCQSYKNMIFSNVFVLGCEAYKCVNSISVICIYSNSERTDKGEDLYKSGLSCTSCPQD 814
            I+D+HN +R  +       +P ++DM ++ + + LA  A     KC+ +       M      L G       F + +    K  I++W+K   +F + N +        Y  +++++ + +GC    C N+I +   +       K    YK G  C SCP D
Sbjct:   19 IVDVHNAFRRAV-------EPPAADMLMMSYSEELAVSAQAWVDKCVLDHGPPSSRM------LNGYELGENLFYSTSPMLWKSIINAWYKEVSHFAFPNASTNGKPVGHYTQVVWNSSYKVGCGVTLCSNNIYLYGCHYYRAGNFKRWPPYKVGTPCASCPND 169          
BLAST of SCP domain-containing protein vs. Ensembl Medaka
Match: CLEC18A (C-type lectin domain family 18 member A [Source:HGNC Symbol;Acc:HGNC:30388])

HSP 1 Score: 57.3806 bits (137), Expect = 1.634e-8
Identity = 54/244 (22.13%), Postives = 102/244 (41.80%), Query Frame = 2
Query:  299 LKSMDKQLILDLHNWYRAQISRGDIFQQPESSDMTVVEWDDRLAEIALIRAQKCLKEKKVNDYEMSSFQHDLLGRMAINEYFTNDTDNYTKKAIHSWFKNHINFEYENGTCTK-SDCQSYKNMIFSNVFVLGCEAYKCVNSISV----ICIYSNSERTDKGE--DLYKSGLSCTSCPQ----DYSFCMDGSLCASKFHCRDSKISKTCRCLVLPKLCTKHGDYDSSKCRCRCQPGWTGLNCEKP 997
            L    + +I+ LHN  R+++       +P +++M  +EWD R+A +A  +A +C  +    +   S         +  N + +          IH+WF+   +F + +G C + + CQ Y  ++++    +GC +  C+    +    +C Y        G   ++ K+     SC Q    + SFC     C   F  R  ++  + +C+        HG +   +C C C  G+ G  C  P
Sbjct:    1 LGIKQRSVIVALHNRLRSRV-------RPMAANMQKMEWDGRMAILAEKQAMRCGADLSPQNGPFSR-------HIGWNTHLSTHRIASFSDIIHAWFEEGNDFFFLSGKCRENAACQHYTQLVWATSSHVGCASQLCLRDGDIWEIFVCAYYPGLWDHVGGLCEIPKNPFW-MSCGQHGHLNVSFCK--CKCDPGFTGRFCQVRCSVQCV--------HGRFKEEQCSCLCHVGFGGRRCLFP 219          
BLAST of SCP domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000020674.2 (cysteine-rich venom protein pseudecin-like [Source:NCBI gene;Acc:101157728])

HSP 1 Score: 57.3806 bits (137), Expect = 2.023e-8
Identity = 38/170 (22.35%), Postives = 71/170 (41.76%), Query Frame = 2
Query:  323 ILDLHNWYRAQISRGDIFQQPESSDMTVVEWDDRLAEIALIRAQKCL------KEKKVNDYEMSSFQHDLLGRMAINEYFTNDTDNYTKKAIHSWFKNHINFEYENGTCTKSDCQSYKNMIFSNVFVLGCEAYKCVNSISVICIYSNSERTDKGEDLYKSGLSCTSCPQD 814
            I+D+HN +R  +       +P ++DM ++ + + LA  A     KC+        + +N YE+                F + +    K  I++W+K   +F + N +        Y  +++++ + +GC    C N+I +   +       K    YK G  C SCP D
Sbjct:   34 IVDVHNAFRRAV-------EPPAADMLMMSYSEELAVSAQAWVDKCVLDHGPPSSRMLNGYELG------------ENLFYSTSPMLWKSIINAWYKEVSHFAFPNASTNGKPVGHYTQVVWNSSYKVGCGVTLCSNNIYLYGCHYYRAGNFKRWPPYKVGTPCASCPND 184          
BLAST of SCP domain-containing protein vs. Ensembl Medaka
Match: CLEC18A (C-type lectin domain family 18 member A [Source:HGNC Symbol;Acc:HGNC:30388])

HSP 1 Score: 54.299 bits (129), Expect = 4.696e-7
Identity = 52/236 (22.03%), Postives = 100/236 (42.37%), Query Frame = 2
Query:  314 KQLILDLHNWYRAQISRGDIFQQPESSDMTVVEWDDRLAEIALIRAQKCLKEKKVNDYEMSSFQHDLLGRMAINEYFTNDTDNYTKKAIHSWFKNHINFEYENGTCTK-SDCQSYKNMIFSNVFVLGCEAYKCVNSISV----ICIYSNSERTDKGE--DLYKSGLSCTSCPQ----DYSFCMDGSLCASKFHCRDSKISKTCRCLVLPKLCTKHGDYDSSKCRCRCQPGWTGLNC 988
            + +I+ LHN  R+++       +P +++M  +EWD R+A +A  +A +C  +    +   S         +  N + +          IH+WF+   +F + +G C + + CQ Y  ++++    +GC +  C+    +    +C Y        G   ++ K+     SC Q    + SFC     C   F  R  ++  + +C+        HG +   +C C C  G+ G  C
Sbjct:    3 RSVIVALHNRLRSRV-------RPMAANMQKMEWDGRMAILAEKQAMRCGADLSPQNGPFSR-------HIGWNTHLSTHRIASFSDIIHAWFEEGNDFFFLSGKCRENAACQHYTQLVWATSSHVGCASQLCLRDGDIWEIFVCAYYPGLWDHVGGLCEIPKNPF-WMSCGQHGHLNVSFCK--CKCDPGFTGRFCQVRCSVQCV--------HGRFKEEQCSCLCHVGFGGAEC 213          
BLAST of SCP domain-containing protein vs. Planmine SMEST
Match: SMESG000035186.1 (SMESG000035186.1)

HSP 1 Score: 1928.68 bits (4995), Expect = 0.000e+0
Identity = 1259/1268 (99.29%), Postives = 1264/1268 (99.68%), Query Frame = 2
Query:  227 MFGKFLILLLSATINCEPWSTSFKLKSMDKQLILDLHNWYRAQISRGDIFQQPESSDMTVVEWDDRLAEIALIRAQKCLKEKKVNDYEMSSFQHDLLGRMAINEYFTNDTDNYTKKAIHSWFKNHINFEYENGTCTKSDCQSYKNMIFSNVFVLGCEAYKCVNSISVICIYSNSERTDKGEDLYKSGLSCTSCPQDYSFCMDGSLCASKFHCRDSKISKTCRCLVLPKLCTKHGDYDSSKCRCRCQPGWTGLNCEKPCHDSSPLCENRKWACTDVTHKSQMFKACPQTCKWCQNNPNSIPIYNENEIKVNTIYDPTNFELEDQSDGICKDNKMECGAWASKGFCNLESVKRVCKLTCKVCEGTQGRVITTQKSMNCEDHPTCVPEFQPYCNIMIQISLKCPKLCGRCXXXXXXXXXXXXXXXXXXIKKEFVDCLETWDRKETCISIAMANLCYKPDMQEHCPITCRHPACRXXXXXXXXXXXXXXXXXXXXXXXXXXVPESKVCKFLPCNEPGVPSFCQKKCSGISTSTVNPMIRESYEYCNIYPCSVMFVRQTCKKCFDPEICVSLDCNYNGVQKLCKNKCQXXXXXXXXXXXXXXXXXXXXXXXXPLCVTLPCGFPDVEKMCPNKCSKSTTMFTSTTQPKSSKISTPMQSSTTLIDSPLCISLPCSIPRIELLCPTKCGSTSVKSTTAISTSPSSDSPLCKSLPCEIQKVKEFCPQKCGSTSTMKSTSILPTDLPICITLPCHIPQFQLICPMKCHSMLSPXXXXXXXXXXXXXXXXXXDPPFCVMLPCDVPQVQLACPXXXXXXXXXXXXXXXXXXXXDPEFCVRLTCDMPQVPLLCIKKCGXXXXXXXXXXXXXXXDSVLCSVLSCGIPQVSKICPNKCXXXXXXXXXXXXXXQKTDAPLCTFVICGSSGAKAICPQKCLXXXXXXXXXXXXXXXXXXVCAFFACDMPKVPIVCPNKCXXXXXXXXXXXXXXXXXXXXXXXXXXXXDPEICQTLPCSIAAIQAICPKKCXXXXXXXXXXXXXXXXXXDHPLCIVWPCSHKVFTSLCPNKCSSTTVSLSTSPFKPTDPSFCSNFPCEFPQVKIFCPIKCGKMTSIVXXXXXXXXXXXXXXKPTDFPMCIFVSCDSIEALMACPVKCXXXXXXXXXXXXXXXXXXXXXXXXXXXDNPICAQLPCSNAGVQALCKKKCEDKPICKSLPCSNAGVRQLCTIKCADYXXXXXXXXXXXXXXXXXXXDPAFCSVFSCNIQGMSYACPNRCGIPSSKAKRL 4030
            MFGKFLILLLSATINCEPWSTSFKLKSMDKQLILDLHNWYRAQISRGDIFQQPESSDMTVVEWDDRLAEIALIRAQKCLKEKKVNDYE+SSFQHDLLGRMAINEYFTNDTDNYTKKA+HSWFKNHINFEYENGTCTKSDCQSYKNMIFSNVFVLGCEAYKCVNSISVICIYSNSERTDKGEDLYKSGLSCTSCPQDYSFCMDGSLCASKFHCRDSKISKTCRCLVLPKLCTKHGDYDSSKCRCRCQPGWTGLNCEKPCH+SSPLCENRKWACTDVTHKSQMFKACPQTCKWCQNNPNSIPIYNENEIKVNTIYDPTNFELEDQSDGICKDNKMECGAWASKGFCNLESVKRVCKLTCKVCEGTQGRVITTQKSMNCEDHPTCVPEFQPYCNIMIQISLKCPKLCGRCTATSSSTLKSSSTVSTSTIKKEFVDCLETWDRKETCISIAMANLCYKPDMQEHCPITCRHPACRKPSPSTQPTTTKTTPAKTTTTFMSSTVPESKVCKFLPCNEPGVPSFCQKKCSGISTSTVNPMIRESYEYCNIYPCSVMFVRQTCKKCFDPEICVSLDCNYNGVQKLCKNKCQTSTSMSSTAISSSSTKTPTKSTDSPLCVTLPCGFPDVEKMCPNKCSKSTTMFTSTTQPKSSKISTPMQSSTTLIDSPLCISLPCSIPRIELLCPTKCGSTSVKSTTAISTSPSSDSPLCKSLPCEIQKVKEFCPQKCGSTSTMKSTSILPTDLPICITLPCHIPQFQLICPMKCHSMLSP TSATKLSTSISSSTKSTDPPFCVMLPCDVPQVQLACPLKCLSSSSKGSTTALSTKSTDPEFCVRLTCDMPQVPLLCIKKCGSTTPKLTS LSTKSTDSVLCSVLSCGIPQVSKICPNKCSSTTVKMTTSVLTTQKTDAPLCTFVICGSSGAKAICPQKCLSTSSPSSSAKTTKSTDSPVCAFFACD+PKVPIVCPNKCASTTSKTSSTMTTASTVKSSSITSTKSTDPEICQTLPCSIAAIQAICPKKCSSSTAKSSSTVSVTTKSTDHPLCIVWPCSHKVFTSLCPNKCSSTTVSLSTS FKPTDPSFCSNFPCEFPQVKIFCP+KCGKMTSIVTSTTSKASTLSTGTKPTDFPMCIFVSCDSIEALMACPVKCSSSSILSTTKS TASTTTVMSSTMSETDNPICAQLPCSNAGVQALCKKKCEDKPICKSLPCSNAGVRQLCTIKCADYKTTKSSTLASSVSSTLKSTDPAFCSVFSCNIQGMSYACPNRCGIPSSKAKRL
Sbjct:    1 MFGKFLILLLSATINCEPWSTSFKLKSMDKQLILDLHNWYRAQISRGDIFQQPESSDMTVVEWDDRLAEIALIRAQKCLKEKKVNDYEISSFQHDLLGRMAINEYFTNDTDNYTKKAVHSWFKNHINFEYENGTCTKSDCQSYKNMIFSNVFVLGCEAYKCVNSISVICIYSNSERTDKGEDLYKSGLSCTSCPQDYSFCMDGSLCASKFHCRDSKISKTCRCLVLPKLCTKHGDYDSSKCRCRCQPGWTGLNCEKPCHNSSPLCENRKWACTDVTHKSQMFKACPQTCKWCQNNPNSIPIYNENEIKVNTIYDPTNFELEDQSDGICKDNKMECGAWASKGFCNLESVKRVCKLTCKVCEGTQGRVITTQKSMNCEDHPTCVPEFQPYCNIMIQISLKCPKLCGRCTATSSSTLKSSSTVSTSTIKKEFVDCLETWDRKETCISIAMANLCYKPDMQEHCPITCRHPACRKPSPSTQPTTTKTTPAKTTTTFMSSTVPESKVCKFLPCNEPGVPSFCQKKCSGISTSTVNPMIRESYEYCNIYPCSVMFVRQTCKKCFDPEICVSLDCNYNGVQKLCKNKCQTSTSMSSTAISSSSTKTPTKSTDSPLCVTLPCGFPDVEKMCPNKCSKSTTMFTSTTQPKSSKISTPMQSSTTLIDSPLCISLPCSIPRIELLCPTKCGSTSVKSTTAISTSPSSDSPLCKSLPCEIQKVKEFCPQKCGSTSTMKSTSILPTDLPICITLPCHIPQFQLICPMKCHSMLSPTTSATKLSTSISSSTKSTDPPFCVMLPCDVPQVQLACPLKCLSSSSKGSTTALSTKSTDPEFCVRLTCDMPQVPLLCIKKCGSTTPKLTSALSTKSTDSVLCSVLSCGIPQVSKICPNKCSSTTVKMTTSVLTTQKTDAPLCTFVICGSSGAKAICPQKCLSTSSPSSSAKTTKSTDSPVCAFFACDIPKVPIVCPNKCASTTSKTSSTMTTASTVKSSSITSTKSTDPEICQTLPCSIAAIQAICPKKCSSSTAKSSSTVSVTTKSTDHPLCIVWPCSHKVFTSLCPNKCSSTTVSLSTSTFKPTDPSFCSNFPCEFPQVKIFCPLKCGKMTSIVTSTTSKASTLSTGTKPTDFPMCIFVSCDSIEALMACPVKCSSSSILSTTKSKTASTTTVMSSTMSETDNPICAQLPCSNAGVQALCKKKCEDKPICKSLPCSNAGVRQLCTIKCADYKTTKSSTLASSVSSTLKSTDPAFCSVFSCNIQGMSYACPNRCGIPSSKAKRL 1268          
BLAST of SCP domain-containing protein vs. Planmine SMEST
Match: SMESG000035186.1 (SMESG000035186.1)

HSP 1 Score: 1873.98 bits (4853), Expect = 0.000e+0
Identity = 1232/1241 (99.27%), Postives = 1237/1241 (99.68%), Query Frame = 2
Query:  308 MDKQLILDLHNWYRAQISRGDIFQQPESSDMTVVEWDDRLAEIALIRAQKCLKEKKVNDYEMSSFQHDLLGRMAINEYFTNDTDNYTKKAIHSWFKNHINFEYENGTCTKSDCQSYKNMIFSNVFVLGCEAYKCVNSISVICIYSNSERTDKGEDLYKSGLSCTSCPQDYSFCMDGSLCASKFHCRDSKISKTCRCLVLPKLCTKHGDYDSSKCRCRCQPGWTGLNCEKPCHDSSPLCENRKWACTDVTHKSQMFKACPQTCKWCQNNPNSIPIYNENEIKVNTIYDPTNFELEDQSDGICKDNKMECGAWASKGFCNLESVKRVCKLTCKVCEGTQGRVITTQKSMNCEDHPTCVPEFQPYCNIMIQISLKCPKLCGRCXXXXXXXXXXXXXXXXXXIKKEFVDCLETWDRKETCISIAMANLCYKPDMQEHCPITCRHPACRXXXXXXXXXXXXXXXXXXXXXXXXXXVPESKVCKFLPCNEPGVPSFCQKKCSGISTSTVNPMIRESYEYCNIYPCSVMFVRQTCKKCFDPEICVSLDCNYNGVQKLCKNKCQXXXXXXXXXXXXXXXXXXXXXXXXPLCVTLPCGFPDVEKMCPNKCSKSTTMFTSTTQPKSSKISTPMQSSTTLIDSPLCISLPCSIPRIELLCPTKCGSTSVKSTTAISTSPSSDSPLCKSLPCEIQKVKEFCPQKCGSTSTMKSTSILPTDLPICITLPCHIPQFQLICPMKCHSMLSPXXXXXXXXXXXXXXXXXXDPPFCVMLPCDVPQVQLACPXXXXXXXXXXXXXXXXXXXXDPEFCVRLTCDMPQVPLLCIKKCGXXXXXXXXXXXXXXXDSVLCSVLSCGIPQVSKICPNKCXXXXXXXXXXXXXXQKTDAPLCTFVICGSSGAKAICPQKCLXXXXXXXXXXXXXXXXXXVCAFFACDMPKVPIVCPNKCXXXXXXXXXXXXXXXXXXXXXXXXXXXXDPEICQTLPCSIAAIQAICPKKCXXXXXXXXXXXXXXXXXXDHPLCIVWPCSHKVFTSLCPNKCSSTTVSLSTSPFKPTDPSFCSNFPCEFPQVKIFCPIKCGKMTSIVXXXXXXXXXXXXXXKPTDFPMCIFVSCDSIEALMACPVKCXXXXXXXXXXXXXXXXXXXXXXXXXXXDNPICAQLPCSNAGVQALCKKKCEDKPICKSLPCSNAGVRQLCTIKCADYXXXXXXXXXXXXXXXXXXXDPAFCSVFSCNIQGMSYACPNRCGIPSSKAKRL 4030
            MDKQLILDLHNWYRAQISRGDIFQQPESSDMTVVEWDDRLAEIALIRAQKCLKEKKVNDYE+SSFQHDLLGRMAINEYFTNDTDNYTKKA+HSWFKNHINFEYENGTCTKSDCQSYKNMIFSNVFVLGCEAYKCVNSISVICIYSNSERTDKGEDLYKSGLSCTSCPQDYSFCMDGSLCASKFHCRDSKISKTCRCLVLPKLCTKHGDYDSSKCRCRCQPGWTGLNCEKPCH+SSPLCENRKWACTDVTHKSQMFKACPQTCKWCQNNPNSIPIYNENEIKVNTIYDPTNFELEDQSDGICKDNKMECGAWASKGFCNLESVKRVCKLTCKVCEGTQGRVITTQKSMNCEDHPTCVPEFQPYCNIMIQISLKCPKLCGRCTATSSSTLKSSSTVSTSTIKKEFVDCLETWDRKETCISIAMANLCYKPDMQEHCPITCRHPACRKPSPSTQPTTTKTTPAKTTTTFMSSTVPESKVCKFLPCNEPGVPSFCQKKCSGISTSTVNPMIRESYEYCNIYPCSVMFVRQTCKKCFDPEICVSLDCNYNGVQKLCKNKCQTSTSMSSTAISSSSTKTPTKSTDSPLCVTLPCGFPDVEKMCPNKCSKSTTMFTSTTQPKSSKISTPMQSSTTLIDSPLCISLPCSIPRIELLCPTKCGSTSVKSTTAISTSPSSDSPLCKSLPCEIQKVKEFCPQKCGSTSTMKSTSILPTDLPICITLPCHIPQFQLICPMKCHSMLSP TSATKLSTSISSSTKSTDPPFCVMLPCDVPQVQLACPLKCLSSSSKGSTTALSTKSTDPEFCVRLTCDMPQVPLLCIKKCGSTTPKLTS LSTKSTDSVLCSVLSCGIPQVSKICPNKCSSTTVKMTTSVLTTQKTDAPLCTFVICGSSGAKAICPQKCLSTSSPSSSAKTTKSTDSPVCAFFACD+PKVPIVCPNKCASTTSKTSSTMTTASTVKSSSITSTKSTDPEICQTLPCSIAAIQAICPKKCSSSTAKSSSTVSVTTKSTDHPLCIVWPCSHKVFTSLCPNKCSSTTVSLSTS FKPTDPSFCSNFPCEFPQVKIFCP+KCGKMTSIVTSTTSKASTLSTGTKPTDFPMCIFVSCDSIEALMACPVKCSSSSILSTTKS TASTTTVMSSTMSETDNPICAQLPCSNAGVQALCKKKCEDKPICKSLPCSNAGVRQLCTIKCADYKTTKSSTLASSVSSTLKSTDPAFCSVFSCNIQGMSYACPNRCGIPSSKAKRL
Sbjct:    1 MDKQLILDLHNWYRAQISRGDIFQQPESSDMTVVEWDDRLAEIALIRAQKCLKEKKVNDYEISSFQHDLLGRMAINEYFTNDTDNYTKKAVHSWFKNHINFEYENGTCTKSDCQSYKNMIFSNVFVLGCEAYKCVNSISVICIYSNSERTDKGEDLYKSGLSCTSCPQDYSFCMDGSLCASKFHCRDSKISKTCRCLVLPKLCTKHGDYDSSKCRCRCQPGWTGLNCEKPCHNSSPLCENRKWACTDVTHKSQMFKACPQTCKWCQNNPNSIPIYNENEIKVNTIYDPTNFELEDQSDGICKDNKMECGAWASKGFCNLESVKRVCKLTCKVCEGTQGRVITTQKSMNCEDHPTCVPEFQPYCNIMIQISLKCPKLCGRCTATSSSTLKSSSTVSTSTIKKEFVDCLETWDRKETCISIAMANLCYKPDMQEHCPITCRHPACRKPSPSTQPTTTKTTPAKTTTTFMSSTVPESKVCKFLPCNEPGVPSFCQKKCSGISTSTVNPMIRESYEYCNIYPCSVMFVRQTCKKCFDPEICVSLDCNYNGVQKLCKNKCQTSTSMSSTAISSSSTKTPTKSTDSPLCVTLPCGFPDVEKMCPNKCSKSTTMFTSTTQPKSSKISTPMQSSTTLIDSPLCISLPCSIPRIELLCPTKCGSTSVKSTTAISTSPSSDSPLCKSLPCEIQKVKEFCPQKCGSTSTMKSTSILPTDLPICITLPCHIPQFQLICPMKCHSMLSPTTSATKLSTSISSSTKSTDPPFCVMLPCDVPQVQLACPLKCLSSSSKGSTTALSTKSTDPEFCVRLTCDMPQVPLLCIKKCGSTTPKLTSALSTKSTDSVLCSVLSCGIPQVSKICPNKCSSTTVKMTTSVLTTQKTDAPLCTFVICGSSGAKAICPQKCLSTSSPSSSAKTTKSTDSPVCAFFACDIPKVPIVCPNKCASTTSKTSSTMTTASTVKSSSITSTKSTDPEICQTLPCSIAAIQAICPKKCSSSTAKSSSTVSVTTKSTDHPLCIVWPCSHKVFTSLCPNKCSSTTVSLSTSTFKPTDPSFCSNFPCEFPQVKIFCPLKCGKMTSIVTSTTSKASTLSTGTKPTDFPMCIFVSCDSIEALMACPVKCSSSSILSTTKSKTASTTTVMSSTMSETDNPICAQLPCSNAGVQALCKKKCEDKPICKSLPCSNAGVRQLCTIKCADYKTTKSSTLASSVSSTLKSTDPAFCSVFSCNIQGMSYACPNRCGIPSSKAKRL 1241          
BLAST of SCP domain-containing protein vs. Planmine SMEST
Match: SMESG000035186.1 (SMESG000035186.1)

HSP 1 Score: 1649.8 bits (4271), Expect = 0.000e+0
Identity = 1100/1298 (84.75%), Postives = 1138/1298 (87.67%), Query Frame = 2
Query:  227 MFGKFLILLLSATINCEPWSTSFKLKSMDKQLILDLHNWYRAQISRGDIFQQPESSDMTVVEWDDRLAEIALIRAQKCLKEKKVNDYEMSSFQHDLLGRMAINEYFTNDTDNYTKKAIHSWFKNHINFEYENGTCTKSDCQSYKNMIFSNVFVLGCEAYKCVNSISVICIYSNSERTDKGEDLYKSGLSCTSCPQDYSFCMDGSLCASKFHCRDSKISKTCRCLVLPKLCTKHGDYDSSKCRCRCQPGWTGLNCEKPCHDSSPLCENRKWACTDVTHKSQMFKACPQTCKWCQNNPNSIPIYNENEIKVNTIYDPTNFELEDQSDGICKDNKMECGAWASKGFCNLESVKRVCKLTCKVCEGTQGRVITTQKSMNCEDHPTCVPEFQPYCNIMIQISLKCPKLCGRCXXXXXXXXXXXXXXXXXXIKKEFVDCLETWDRKETCISIAMANLCYKPDMQEHCPITCRHPACRXXXXXXXXXXXXXXXXXXXXXXXXXXVPESKVCKFLPCNEPGVPSFCQKKCSGISTSTVNPMIRESYEYCNIYPCSVMFVRQTCKKCFDPEICVSLDCNYNGVQKLCKNKCQXXXXXX--------------------XXXXXXXXXXXXXXXXXXPLCVTLPCGFPDVEKMCPNKCSKSTTMFTSTTQPKSSKISTPMQSSTTLIDSPLCISLPCSIPRIELLCPTKCGSTSVKSTTAISTSPSSDSPLCKSLPCEIQKVKEFCPQKCGSTSTMKSTS----------ILPTDLPICITLPCHIPQFQLICPMKCHSMLSPXXXXXXXXXXXXXXXXXXDPPFCVMLPCDVPQVQLACPXXXXXXXXXXXXXXXXXXXXDPEFCVRLTCDMPQVPLLCIKKCGXXXXXXXXXXXXXXXDSVLCSVLSCGIPQVSKICPNKCXXXXXXXXXXXXXXQKTDAPLCTFVICGSSGAKAICPQKCLXXXXXXXXXXXXXXXXXXVCAFFACDMPKVPIVCPNKCXXXXXXXXXXXXXXXXXXXXXXXXXXXXDPEICQTLPCSIAAIQAICPKKCXXXXXXXXXXXXXXXXXXDHPLCIVWPCSHKVFTSLCPNKCSSTTVSLSTSPFKPTDPSFCSNFPCEFPQVKIFCPIKCGKMTSIVXXXXXXXXXXXXXXKPTDFPMCIFVSCDSIEALMACPVKCXXXXXXXXXXXXXXXXXXXXXXXXXXXDNPICAQLPCSNAGVQALCKKKCEDKPICKSLPCSNAGVRQLCTIKCADYXXXXXXXXXXXXXXXXXXXDPAFCSVFSCNIQGMSYACPNRCGIPSSKAKRL 4030
            MFGKFLILLLSATINCEPWSTSFKLKSMDKQLILDLHNWYRAQISRGDIFQQPESSDMTVVEWDDRLAEIALIRAQKCLKEKKVNDYE+SSFQHDLLGRMAINEYFTNDTDNYTKKA+HSWFKNHINFEYENGTCTKSDCQSYKNMIFSNVFVLGCEAYKCVNSISVICIYSNSERTDKGEDLYKSGLSCTSCPQDYSFCMDGSLCASKFHCRDSKISKTCRCLVLPKLCTKHGDYDSSKCRCRCQPGWTGLNCEKPCH+SSPLCENRKWACTDVTHKSQMFKACPQTCKWCQNNPNSIPIYNENEIKVNTIYDPTNFELEDQSDGICKDNKMECGAWASKGFCNLESVKRVCKLTCKVCEGTQGRVITTQKSMNCEDHPTCVPEFQPYCNIMIQISLKCPKLCGRCTATSSSTLKSSSTVSTSTIKKEFVDCLETWDRKETCISIAMANLCYKPDMQEHCPITCRHPACRKPSPSTQPTTTKTTPAKTTTTFMSSTVPESKVCKFLPCNEPGVPSFCQKKCSGISTSTVNPMIRESYEYCNIYPCSVMFVRQTCKKCFDPEICVSLDCNYNGVQKLCKNKCQTSTSMS                     ++  S+  ++ T   DSPLC++LPC  P +E +CP KC        ST+   ++ IST   S     DSPLC SLPC I +++  CP KCGSTS   +T+I     +D P+C +LPC I + +  CP KC S  +  +++             TD P C+ LPC +PQ QL CP+KC S  S         ++ + STKSTDP FCV L CD+PQ                                        VPLLCIKKCGSTTPKLTS LSTKSTDSVLCSVLSCGIPQVSKICPNKCSSTTVKMTTSVLTTQKTDAPLCTFVICGSSGAKAICPQKCLSTSSPSSSAKTTKSTDSPVCAFFACD+PKVPIVCPNKCASTTSKTSSTMTTASTVKSSSITSTKSTDPEICQTLPCSIAAIQAICPKKCSSSTAKSSSTVSVTTKSTDHPLCIVWPCSHKVFTSLCPNKCSSTTVSLSTS FKPTDPSFCSNFPCEFPQVKIFCP+KCGKMTSIVTSTTSKASTLSTGTKPTDFPMCIFVSCDSIEALMACPVKCSSSSILSTTKS TASTTTVMSSTMSETDNPICAQLPCSNAGVQALCKKKCEDKPICKSLPCSNAGVRQLCTIKCADYKTTKSSTLASSVSSTLKSTDPAFCSVFSCNIQGMSYACPNRCGIPSSKAKRL
Sbjct:    1 MFGKFLILLLSATINCEPWSTSFKLKSMDKQLILDLHNWYRAQISRGDIFQQPESSDMTVVEWDDRLAEIALIRAQKCLKEKKVNDYEISSFQHDLLGRMAINEYFTNDTDNYTKKAVHSWFKNHINFEYENGTCTKSDCQSYKNMIFSNVFVLGCEAYKCVNSISVICIYSNSERTDKGEDLYKSGLSCTSCPQDYSFCMDGSLCASKFHCRDSKISKTCRCLVLPKLCTKHGDYDSSKCRCRCQPGWTGLNCEKPCHNSSPLCENRKWACTDVTHKSQMFKACPQTCKWCQNNPNSIPIYNENEIKVNTIYDPTNFELEDQSDGICKDNKMECGAWASKGFCNLESVKRVCKLTCKVCEGTQGRVITTQKSMNCEDHPTCVPEFQPYCNIMIQISLKCPKLCGRCTATSSSTLKSSSTVSTSTIKKEFVDCLETWDRKETCISIAMANLCYKPDMQEHCPITCRHPACRKPSPSTQPTTTKTTPAKTTTTFMSSTVPESKVCKFLPCNEPGVPSFCQKKCSGISTSTVNPMIRESYEYCNIYPCSVMFVRQTCKKCFDPEICVSLDCNYNGVQKLCKNKCQTSTSMSSTAISSSSTKTPTKSSTTQPKSSKISTPMQSSTTLIDSPLCISLPCSIPRIELLCPTKCG-------STSVKSTTAISTSPSS-----DSPLCKSLPCEIQKVKEFCPQKCGSTSTMKSTSIL---PTDLPICITLPCHIPQFQLICPMKCHSMLSPTTSATKLSTSISSSTKSTDPPFCVMLPCDVPQVQLACPLKCLSSSS-------KGSTTALSTKSTDPEFCVRLTCDMPQ----------------------------------------VPLLCIKKCGSTTPKLTSALSTKSTDSVLCSVLSCGIPQVSKICPNKCSSTTVKMTTSVLTTQKTDAPLCTFVICGSSGAKAICPQKCLSTSSPSSSAKTTKSTDSPVCAFFACDIPKVPIVCPNKCASTTSKTSSTMTTASTVKSSSITSTKSTDPEICQTLPCSIAAIQAICPKKCSSSTAKSSSTVSVTTKSTDHPLCIVWPCSHKVFTSLCPNKCSSTTVSLSTSTFKPTDPSFCSNFPCEFPQVKIFCPLKCGKMTSIVTSTTSKASTLSTGTKPTDFPMCIFVSCDSIEALMACPVKCSSSSILSTTKSKTASTTTVMSSTMSETDNPICAQLPCSNAGVQALCKKKCEDKPICKSLPCSNAGVRQLCTIKCADYKTTKSSTLASSVSSTLKSTDPAFCSVFSCNIQGMSYACPNRCGIPSSKAKRL 1236          
BLAST of SCP domain-containing protein vs. Planmine SMEST
Match: SMESG000066348.1 (SMESG000066348.1)

HSP 1 Score: 202.601 bits (514), Expect = 2.655e-55
Identity = 147/504 (29.17%), Postives = 229/504 (45.44%), Query Frame = 2
Query:  299 LKSMDKQLILDLHNWYRAQISRGDIFQQPESSDMTVVEWDDRLAEIALIRAQKCLKEKKVNDYEMSSFQHDLLGRMAINEYFTNDTD--NYTKKAIHSWFKNHINFEYENGTCTKSD--CQSYKNMIFSNVFVLGCEAYKCVN--SISVICIYSNSERTDKGEDLYKSGLSCTSCPQDYSFCMDGSLCASKFHCRDSKISKTCRCLVLPKLCTKHGDYDSSKCRCRCQPGWTGLNCEKPCHDSSPLCENRKWACTDVTHKSQMFKACPQTCKWCQNNPNSIPIYN--ENEIKVNTIYDPTNFELEDQSDGICKDNKMECGAWASKGFCNLESVKRVCKLTCKVCEGTQG-----------------------------------------------RVITTQKSMNCEDHPTCVPEF--QPYCNIMIQISLKCPKLCGRCXXXXXXXXXXXXXXXXXXIKKEFVDCLETWDRKETCISIAMANLCYKPDMQEHCPITCRHPACR 1639
            L+  +KQL LDLHNWYRA+ +R     QP ++DM  ++WD++LA  +    + CL   + + +    F  D+ G ++ ++   +     ++ K A + W K   N E +   C K+   C + K +++S     GC    C N  ++   C+Y+      +   +++ G SC+ C Q+  FC+DGSLCA+K  C+   ++  CRC +  K C  HG      C CRC+PG+ G  C++ C D    C+  +  C+  +HK  M K CP+TC+ C N  +  PI +  EN + +NTI DP   E E  +D +C DN+ EC  WA  G+CN +SVK +C  +CK+C                                                    R +  Q S  C D+    P +  Q YC+ M  I  +C   C  C  +  +                 + C E+  +   C+ +   NLC  PDMQ+ CPITC +  C 
Sbjct:   26 LRKSEKQLFLDLHNWYRAKFTRNTYGDQPVAADMNALDWDEKLAWKSKNVVKLCLNSSEESHFVKHQFGSDI-GIVSFSKTINDSQSLSDFLKTAFNIWIKYSTNLEND---CDKNSVICDNIKQILYSRGENFGCAKNFCENDKTVHFACLYNYKFNKSR---IFQHGDSCSLCQQNQPFCLDGSLCATKSQCKRKNVNSHCRCAINYKSCHPHGILKLDSCNCRCKPGYYGPTCKEQCIDLQEDCQRMRHHCSLKSHKEYMSKNCPKTCQLC-NLRSHAPIQSGSENNMIMNTIIDPLKSE-EYINDKLCYDNRKECSEWAKAGYCNEKSVKTLCSKSCKLCFNANTSNNIAKHDPEICSTLTQFCGKNDITLYCPKTCYEFLENEKEKLNKFFRDVMIQDSAGCVDNNPNCPNWKDQNYCH-MENIQQQCRLSCKMCLNSGKN-----------------IVCDESSQKTSACLRVQNLNLCTAPDMQKICPITCNYKKCE 502          
BLAST of SCP domain-containing protein vs. Planmine SMEST
Match: SMESG000077815.1 (SMESG000077815.1)

HSP 1 Score: 115.161 bits (287), Expect = 3.292e-26
Identity = 111/459 (24.18%), Postives = 189/459 (41.18%), Query Frame = 2
Query:  311 DKQLILDLHNWYRAQISRGDIFQQPESSDMTVVEWDDRLAEIALIRAQKCLKEKKVNDYEMSSFQHDLLGRMAINEYFT--NDTDNYTKKAIHSWFKNHINFEYENG---TCTKSDCQSYKNMIFS-NVFVLGCEAYKCVNSISVI-CIYSNSERTDKGEDLYKSGLSCTSCPQDYSFCMDGSLCASKFHCRDSKISKTCRCLVLPKLCTKHGDYDSSKCRCRCQPGWTGLNCEKPCHDSSPLCENRKWACTDVTHKSQMFKACPQTCKWCQNNPNSIPIYNENEIKVNTIYDPT-NFELEDQSDGICKDNKMECGAWASKGFCNLESVKRVCKLTCKVCEGTQGRVITTQKSMNCEDHPT-CVPEF--------QPYCNIMIQISLKCPKLCGRCXXXXXXXXXXXXXXXXXXIKKEFVDCLETWDRKETCISIAMANLCYKPDMQEHCPITCRHPAC 1636
            +KQ ILD HNW RA +++G +   P +S+M V++W++ L +          K K  N    SSF    +   A   Y T    +  +T + I +     I  +  +     C  +     +N I    +  +GC   +C    +++ C Y++    +   +    G  C++C      C++  LCA + HC  +  +K C C++  + C  HG + + KC C C+PG+ G +C+                  D+  KS++                     +     +NT   P  N E + +    C D   EC  WA+ G C L++V+  C  +C+ CE  +  +   +  +  +D  + CV +         + YC I   + + CP++C  C                    ++FV C E   R  TC  +    LCY PDM+E CP+TC +  C
Sbjct:   29 EKQFILDSHNWIRAYVAKG-VHGLPPTSNMRVMDWNEELEQ----------KSKTYNKCRGSSFNSYEIKFRANTPYLTIKYKSKEFTNRIIITNLIESIVHQLNSSFYIECMGNILCLVRNQILEPQLSAIGCSVTECEPFTNILTCTYNSKAILNSFLESTNIGFPCSNCSSRNMNCLNDVLCAKESHCYKTP-TKQCSCMITKESCLNHGIFLADKCTCICKPGYKGSDCQ------------------DIVFKSEV---------------------DRTRFLINTENKPNPNIETKIR----CNDQLWECPNWAAMGLCFLKTVRSSCSESCEKCESDEQLISHFKSILMLKDAGSECVDKRSECQMWADKNYCYIK-AVQITCPRVCALCPDPPE--------------PEKFV-CKEDPPRAATCKQVIGNYLCYSPDMKEVCPVTCGNTKC 416          
The following BLAST results are available for this feature:
BLAST of SCP domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PI162.178e-1025.95peptidase inhibitor 16 [Source:HGNC Symbol;Acc:HGN... [more]
PI162.178e-1025.95peptidase inhibitor 16 [Source:HGNC Symbol;Acc:HGN... [more]
PI162.178e-1025.95peptidase inhibitor 16 [Source:HGNC Symbol;Acc:HGN... [more]
CLEC18B6.216e-926.21C-type lectin domain family 18 member B [Source:HG... [more]
CLEC18C6.834e-826.21C-type lectin domain family 18 member C [Source:HG... [more]
back to top
BLAST of SCP domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
scl-94.022e-927.03SCP-Like extracellular protein [Source:UniProtKB/... [more]
scl-31.168e-722.44SCP-Like extracellular protein [Source:UniProtKB/... [more]
scl-137.240e-724.00SCP-Like extracellular protein [Source:UniProtKB/... [more]
scl-51.925e-623.77SCP-Like extracellular protein [Source:UniProtKB/... [more]
scl-203.472e-624.52SCP-Like extracellular protein [Source:UniProtKB/... [more]
back to top
BLAST of SCP domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
CG94008.080e-720.83gene:FBgn0030562 transcript:FBtr0073920[more]
back to top
BLAST of SCP domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
r3hdml1.523e-824.12R3H domain containing-like [Source:ZFIN;Acc:ZDB-GE... [more]
r3hdml1.523e-824.12R3H domain containing-like [Source:ZFIN;Acc:ZDB-GE... [more]
crispld22.073e-824.81cysteine-rich secretory protein LCCL domain contai... [more]
glipr1a2.847e-723.76GLI pathogenesis-related 1a [Source:ZFIN;Acc:ZDB-G... [more]
crispld1b3.350e-724.76cysteine-rich secretory protein LCCL domain contai... [more]
back to top
BLAST of SCP domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000010663.12.486e-1026.05pep primary_assembly:Xenopus_tropicalis_v9.1:KV460... [more]
ENSXETT00000036788.11.328e-927.27pep primary_assembly:Xenopus_tropicalis_v9.1:KV464... [more]
crispld23.396e-823.79cysteine-rich secretory protein LCCL domain contai... [more]
crispld23.810e-823.79cysteine-rich secretory protein LCCL domain contai... [more]
crispld29.483e-825.00cysteine-rich secretory protein LCCL domain contai... [more]
back to top
BLAST of SCP domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pi164.356e-1529.23peptidase inhibitor 16 [Source:MGI Symbol;Acc:MGI:... [more]
Pi169.363e-1529.35peptidase inhibitor 16 [Source:MGI Symbol;Acc:MGI:... [more]
Pi169.363e-1529.35peptidase inhibitor 16 [Source:MGI Symbol;Acc:MGI:... [more]
Pi161.177e-1329.67peptidase inhibitor 16 [Source:MGI Symbol;Acc:MGI:... [more]
Clec18a6.213e-1025.73C-type lectin domain family 18, member A [Source:M... [more]
back to top
BLAST of SCP domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9ET66|PI16_MOUSE8.234e-1329.67Peptidase inhibitor 16 OS=Mus musculus OX=10090 GN... [more]
sp|Q7YT83|TX31_CONTE6.823e-1123.55Cysteine-rich venom protein OS=Conus textile OX=64... [more]
sp|Q6UXB8|PI16_HUMAN1.046e-925.95Peptidase inhibitor 16 OS=Homo sapiens OX=9606 GN=... [more]
sp|Q7TSQ1|CL18A_MOUSE9.336e-925.40C-type lectin domain family 18 member A OS=Mus mus... [more]
sp|A1BQQ5|MR30_CONMR1.812e-822.80Cysteine-rich venom protein Mr30 OS=Conus marmoreu... [more]
back to top
BLAST of SCP domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267FTH76.606e-2026.03SCP domain-containing protein OS=Macrostomum ligna... [more]
A0A1I8HQH67.124e-2026.03SCP domain-containing protein OS=Macrostomum ligna... [more]
A0A267ECZ21.403e-1429.47SCP domain-containing protein OS=Macrostomum ligna... [more]
A0A267ERB21.429e-1429.47SCP domain-containing protein OS=Macrostomum ligna... [more]
A0A1I8GSB31.429e-1429.47SCP domain-containing protein OS=Macrostomum ligna... [more]
back to top
BLAST of SCP domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CLEC18A1.549e-1324.91C-type lectin domain family 18 member A [Source:NC... [more]
ENSAMXT00000031557.15.811e-1326.87peptidase inhibitor 16 [Source:NCBI gene;Acc:10302... [more]
ENSAMXT00000036030.11.090e-1226.78peptidase inhibitor 16 [Source:NCBI gene;Acc:10302... [more]
ENSAMXT00000029824.11.776e-1226.78peptidase inhibitor 16 [Source:NCBI gene;Acc:10302... [more]
CLEC18A5.656e-1225.42C-type lectin domain family 18 member A [Source:NC... [more]
back to top
BLAST of SCP domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
CLEC18A1.971e-924.39C-type lectin domain family 18 member A [Source:HG... [more]
ENSPMAT00000000374.11.347e-721.83pep scaffold:Pmarinus_7.0:GL476650:75849:87118:-1 ... [more]
back to top
BLAST of SCP domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SCP domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SCP domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000023160.29.197e-1125.26peptidase inhibitor 16 [Source:NCBI gene;Acc:10116... [more]
ENSORLT00000020676.21.405e-823.17cysteine-rich venom protein pseudecin-like [Source... [more]
CLEC18A1.634e-822.13C-type lectin domain family 18 member A [Source:HG... [more]
ENSORLT00000020674.22.023e-822.35cysteine-rich venom protein pseudecin-like [Source... [more]
CLEC18A4.696e-722.03C-type lectin domain family 18 member A [Source:HG... [more]
back to top
BLAST of SCP domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000035186.10.000e+099.29SMESG000035186.1[more]
SMESG000035186.10.000e+099.27SMESG000035186.1[more]
SMESG000035186.10.000e+084.75SMESG000035186.1[more]
SMESG000066348.12.655e-5529.17SMESG000066348.1[more]
SMESG000077815.13.292e-2624.18SMESG000077815.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30009031 ID=SMED30009031|Name=SCP domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=4191bp
GGCATTTATTCAACCGTTGAAACAAATAATTGACGTGTCTGCATCAGCAG
TCACAGCTTGGTTTTAGCGGGGAAAAATCCTCCGCTCTCCAATCCATTCA
CGAGGCCTATACCATTTGACTTCGTTTAGTTGAATTTGATTTTTCTCTGA
AAATAATTTAATTTTCTTATTTTTTTGTTTTAATCCCGCAGCTGCATTTT
TATTCATTTTCCATCGACTAAGAAAAATGTTTGGGAAATTTTTGATTCTT
TTACTATCGGCTACGATAAACTGTGAGCCATGGTCTACTAGCTTCAAATT
AAAGTCTATGGATAAGCAATTAATTCTTGATCTCCACAATTGGTATAGAG
CTCAGATTTCAAGAGGGGATATTTTTCAACAACCAGAATCATCCGATATG
ACAGTCGTGGAATGGGATGATAGATTGGCAGAAATTGCTTTAATTCGGGC
TCAAAAATGTTTAAAAGAAAAGAAAGTGAATGACTACGAAATGTCATCGT
TTCAACACGATTTACTTGGTCGAATGGCAATAAATGAATATTTTACTAAT
GATACCGACAATTACACCAAAAAGGCTATTCATTCATGGTTTAAAAATCA
TATAAACTTCGAATACGAAAACGGGACATGCACTAAGAGTGACTGTCAAT
CTTATAAAAATATGATATTCTCAAATGTGTTTGTTCTTGGATGTGAAGCT
TATAAATGTGTAAATAGCATTTCTGTTATTTGCATTTATTCAAATAGTGA
AAGAACTGACAAAGGAGAAGATCTGTATAAAAGCGGTTTATCATGTACAT
CATGCCCTCAGGATTATTCGTTCTGTATGGATGGGAGCTTATGCGCCTCG
AAATTTCATTGTCGTGATTCGAAGATTTCTAAAACATGTCGATGCTTAGT
TCTACCAAAACTTTGTACAAAGCATGGGGATTACGATTCATCAAAATGCC
GATGCCGATGTCAGCCAGGCTGGACTGGGCTTAATTGCGAAAAACCCTGC
CACGATAGCAGTCCTTTGTGTGAAAACCGAAAATGGGCATGTACGGACGT
CACACATAAGAGTCAAATGTTCAAAGCGTGCCCACAGACATGTAAATGGT
GTCAAAACAATCCGAATTCTATTCCAATTTATAACGAGAATGAGATTAAA
GTAAATACAATTTATGATCCCACCAATTTTGAATTGGAGGACCAATCAGA
TGGTATTTGTAAAGATAACAAGATGGAATGTGGAGCTTGGGCGTCGAAAG
GGTTTTGTAACTTGGAATCCGTTAAACGCGTTTGTAAATTGACTTGCAAA
GTTTGCGAAGGTACCCAAGGAAGAGTTATAACCACTCAAAAGTCAATGAA
CTGTGAAGATCACCCAACTTGCGTGCCTGAATTCCAACCATACTGTAATA
TAATGATACAGATATCGTTAAAATGTCCAAAACTTTGTGGTCGCTGCACC
GCCACAAGCTCAAGCACATTAAAATCCTCATCAACAGTGTCAACCTCAAC
AATTAAAAAAGAATTTGTCGACTGCCTTGAGACATGGGATAGAAAAGAGA
CATGTATATCAATTGCAATGGCTAATTTGTGTTACAAACCGGATATGCAA
GAGCACTGTCCCATAACCTGTAGACATCCGGCTTGCAGAAAACCTTCACC
ATCAACTCAACCAACAACAACAAAAACAACACCAGCAAAAACAACAACAA
CATTTATGTCATCGACTGTCCCGGAATCCAAAGTTTGTAAATTTCTCCCA
TGCAATGAACCGGGAGTCCCTTCTTTTTGTCAAAAGAAGTGTTCTGGAAT
ATCAACAAGCACAGTCAATCCAATGATTCGAGAATCCTATGAATATTGTA
ATATTTATCCATGCTCAGTAATGTTCGTCAGGCAGACTTGTAAAAAATGC
TTTGATCCAGAGATCTGTGTCAGCCTTGACTGCAATTACAACGGCGTACA
AAAATTATGCAAAAATAAATGCCAAACAAGCACTTCAATGTCTTCGACAG
CAATTTCAAGCTCATCAACCAAAACACCCACGAAATCAACTGATTCGCCT
TTATGCGTCACACTTCCGTGTGGATTTCCGGATGTTGAGAAAATGTGCCC
AAATAAATGCTCTAAATCAACAACTATGTTTACAAGCACAACTCAACCAA
AATCATCAAAAATTAGCACTCCAATGCAAAGCTCGACGACATTGATTGAT
TCTCCGCTATGCATTTCATTGCCATGCTCTATTCCTCGGATTGAATTGCT
CTGTCCGACCAAATGCGGTTCAACTTCAGTCAAATCTACAACCGCAATAT
CTACCTCACCAAGCAGTGATTCTCCATTATGTAAGTCATTGCCTTGTGAA
ATTCAAAAGGTCAAAGAATTTTGCCCTCAAAAATGCGGATCTACCTCAAC
AATGAAATCAACCTCAATTCTTCCAACTGATTTACCAATTTGTATTACGC
TGCCGTGTCACATTCCACAATTCCAATTAATTTGTCCCATGAAATGTCAT
TCTATGCTTTCTCCGAAAACCTCAGCTACGAAATTGTCAACATCAATTTC
ATCTTCAACAAAATCTACTGATCCACCATTTTGCGTAATGCTGCCTTGTG
ATGTTCCACAAGTCCAGCTTGCGTGCCCACTTAAATGCCTTTCTAGCTCT
TCAAAGGGATCTACAACAGCTTTGTCAACAAAATCTACTGATCCAGAGTT
TTGTGTTCGTCTGACTTGTGACATGCCTCAAGTTCCCTTATTATGTATCA
AGAAATGCGGTTCAACAACACCAAAATTAACCTCTACATTATCCACGAAA
TCAACTGATTCTGTGCTTTGCTCAGTTTTGTCATGTGGAATACCTCAGGT
TTCAAAAATCTGTCCAAATAAATGCTCATCAACTACTGTCAAAATGACTA
CTTCAGTTCTAACTACACAAAAAACTGATGCTCCGTTGTGCACATTTGTT
ATTTGTGGCTCTTCAGGTGCCAAAGCTATTTGTCCACAAAAATGCTTATC
TACTTCGTCACCATCTTCTTCAGCAAAAACAACTAAATCAACCGATTCGC
CAGTTTGTGCTTTCTTTGCCTGCGACATGCCGAAAGTTCCCATTGTTTGT
CCGAATAAATGTGCGTCAACGACTTCAAAGACCTCATCAACTATGACAAC
AGCATCAACGGTGAAATCTTCCTCGATCACTTCCACAAAATCAACTGATC
CTGAGATTTGTCAAACTCTGCCGTGCTCCATAGCTGCTATTCAAGCTATT
TGTCCAAAGAAATGCTCCAGTTCAACGGCCAAATCCTCATCAACAGTTTC
GGTTACAACTAAATCAACTGATCATCCCCTTTGCATCGTTTGGCCCTGTT
CGCATAAGGTCTTTACGTCACTGTGTCCAAATAAATGCAGTTCTACGACG
GTTTCACTTAGTACTTCGCCCTTTAAACCAACTGATCCTTCGTTTTGTTC
TAATTTTCCGTGTGAATTTCCACAAGTTAAAATATTTTGTCCGATAAAAT
GCGGCAAAATGACAAGTATCGTGACTTCAACAACTTCAAAAGCCTCAACC
TTGTCAACAGGAACAAAACCAACTGATTTCCCTATGTGTATTTTTGTATC
ATGCGATTCAATTGAGGCTTTGATGGCCTGTCCAGTCAAATGCTCTTCGT
CTTCCATATTATCAACAACTAAATCATCGACAGCTTCTACCACAACTGTA
ATGTCTTCAACGATGTCAGAAACCGACAATCCGATATGTGCCCAATTGCC
ATGTTCTAATGCTGGTGTCCAAGCGTTGTGCAAAAAGAAATGTGAGGATA
AACCCATTTGTAAATCACTCCCCTGTTCAAATGCTGGCGTTAGACAATTG
TGTACAATTAAATGTGCGGACTACAAGACCACAAAATCATCAACTTTGGC
TTCTTCGGTATCCTCAACGTTGAAATCCACTGACCCAGCTTTCTGCTCGG
TGTTTTCGTGCAACATCCAAGGAATGAGTTATGCGTGTCCAAATAGATGC
GGCATACCCTCCTCCAAGGCCAAAAGATTATAGTCAGGATTACTTTGAAA
GTATTTAAAAGATTGGATAATACCGAACAATTATATCAGTTATTTTGTTT
GAAATCCAATTAATCTTTTATAATGTTGTTTAAATGAAGCAGGTTTTAAA
TATGTATTATTTGTTTAAATTTGGTTTTTTAATTGTTGTAG
back to top

protein sequence of SMED30009031-orf-1

>SMED30009031-orf-1 ID=SMED30009031-orf-1|Name=SMED30009031-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=162bp
MGLSSHFFLHNAWTPALEHGNWAHIGLSVSDIVEDITVVVEAVDDLVVDN
MEDEEHLTGQAIKASIESHDTKIHIGKSVGFVPVDKVEAFEVVEVTILVI
LPHFIGQNILTCGNSHGKLEQNEGSVGLKGEVLSETVVELHLFGHSDVKT
LCEQGQTMQRG*
back to top

protein sequence of SMED30009031-orf-2

>SMED30009031-orf-2 ID=SMED30009031-orf-2|Name=SMED30009031-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1269bp
MFGKFLILLLSATINCEPWSTSFKLKSMDKQLILDLHNWYRAQISRGDIF
QQPESSDMTVVEWDDRLAEIALIRAQKCLKEKKVNDYEMSSFQHDLLGRM
AINEYFTNDTDNYTKKAIHSWFKNHINFEYENGTCTKSDCQSYKNMIFSN
VFVLGCEAYKCVNSISVICIYSNSERTDKGEDLYKSGLSCTSCPQDYSFC
MDGSLCASKFHCRDSKISKTCRCLVLPKLCTKHGDYDSSKCRCRCQPGWT
GLNCEKPCHDSSPLCENRKWACTDVTHKSQMFKACPQTCKWCQNNPNSIP
IYNENEIKVNTIYDPTNFELEDQSDGICKDNKMECGAWASKGFCNLESVK
RVCKLTCKVCEGTQGRVITTQKSMNCEDHPTCVPEFQPYCNIMIQISLKC
PKLCGRCTATSSSTLKSSSTVSTSTIKKEFVDCLETWDRKETCISIAMAN
LCYKPDMQEHCPITCRHPACRKPSPSTQPTTTKTTPAKTTTTFMSSTVPE
SKVCKFLPCNEPGVPSFCQKKCSGISTSTVNPMIRESYEYCNIYPCSVMF
VRQTCKKCFDPEICVSLDCNYNGVQKLCKNKCQTSTSMSSTAISSSSTKT
PTKSTDSPLCVTLPCGFPDVEKMCPNKCSKSTTMFTSTTQPKSSKISTPM
QSSTTLIDSPLCISLPCSIPRIELLCPTKCGSTSVKSTTAISTSPSSDSP
LCKSLPCEIQKVKEFCPQKCGSTSTMKSTSILPTDLPICITLPCHIPQFQ
LICPMKCHSMLSPKTSATKLSTSISSSTKSTDPPFCVMLPCDVPQVQLAC
PLKCLSSSSKGSTTALSTKSTDPEFCVRLTCDMPQVPLLCIKKCGSTTPK
LTSTLSTKSTDSVLCSVLSCGIPQVSKICPNKCSSTTVKMTTSVLTTQKT
DAPLCTFVICGSSGAKAICPQKCLSTSSPSSSAKTTKSTDSPVCAFFACD
MPKVPIVCPNKCASTTSKTSSTMTTASTVKSSSITSTKSTDPEICQTLPC
SIAAIQAICPKKCSSSTAKSSSTVSVTTKSTDHPLCIVWPCSHKVFTSLC
PNKCSSTTVSLSTSPFKPTDPSFCSNFPCEFPQVKIFCPIKCGKMTSIVT
STTSKASTLSTGTKPTDFPMCIFVSCDSIEALMACPVKCSSSSILSTTKS
STASTTTVMSSTMSETDNPICAQLPCSNAGVQALCKKKCEDKPICKSLPC
SNAGVRQLCTIKCADYKTTKSSTLASSVSSTLKSTDPAFCSVFSCNIQGM
SYACPNRCGIPSSKAKRL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000101muscle cell
PLANA:0000240body wall musculature
PLANA:0000428musculature system
PLANA:0003001lateral region of the whole animal
Vocabulary: INTERPRO
TermDefinition
IPR003582ShKT_dom
IPR014044CAP_domain
Vocabulary: cellular component
TermDefinition
GO:0005576extracellular region
GO:0005615extracellular space
GO:0070062extracellular exosome
Vocabulary: biological process
TermDefinition
GO:0010466negative regulation of peptidase activity
GO:0061052negative regulation of cell growth involved in cardiac muscle cell development
Vocabulary: molecular function
TermDefinition
GO:0030414peptidase inhibitor activity