ATP-dependent RNA helicase DDX3X

Overview
NameATP-dependent RNA helicase DDX3X
Smed IDSMED30009026
Length (bp)1766
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of ATP-dependent RNA helicase DDX3X (SMED30009026) t-SNE clustered cells

Violin plots show distribution of expression levels for ATP-dependent RNA helicase DDX3X (SMED30009026) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of ATP-dependent RNA helicase DDX3X (SMED30009026) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for ATP-dependent RNA helicase DDX3X (SMED30009026) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30009026

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 12

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30009026SMESG000046974.1 SMESG000046953.1 dd_Smed_v4_799_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30009026SMESG000046974.1 SMESG000046953.1 dd_Smed_v4_799_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30009026SMESG000046974.1 SMESG000046953.1 dd_Smed_v4_799_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30009026SMESG000046974.1 SMESG000046953.1 dd_Smed_v4_799_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30009026SMESG000046974.1 SMESG000046953.1 SMESG000066843.1 Contig39129uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30009026SMESG000046974.1 SMESG000046953.1 SMESG000066843.1 Contig39129newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30009026SMESG000063381.1 Contig4919GPL15192PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30009026SMESG000046952.1 SMESG000046974.1 Contig4919GPL15192PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
central nervous systemSMED30009026SMESG000046952.1 DN312326ncbi_smed_estsPMID:16344473
Zayas et al., 2005
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
ovarySMED30009026SMESG000046952.1 DN312326ncbi_smed_estsPMID:16344473
Zayas et al., 2005
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
testisSMED30009026SMESG000046952.1 DN312326ncbi_smed_estsPMID:16344473
Zayas et al., 2005
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
neoblastSMED30009026SMESG000046974.1 SMESG000046953.1 dd_Smed_v6_799_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of ATP-dependent RNA helicase DDX3X vs. Ensembl Human
Match: DDX3X (DEAD-box helicase 3 X-linked [Source:HGNC Symbol;Acc:HGNC:2745])

HSP 1 Score: 293.893 bits (751), Expect = 1.926e-92
Identity = 161/385 (41.82%), Postives = 234/385 (60.78%), Query Frame = 1
Query:  394 TQIQKSTFDILNRQLLDLLGSAETGSGKTVAYLTPLLNSILKSYPEEMMASLKENSST---VQYPLILVLAPTRELVIQISKEAKKLLTFTQLRTVSVIGGADPGGQIGSIFKGCHALVATPGRLKDFIQRGLLSLKYCNKLVIDEADRMLDMGFEPQIREIMFDFDMPPVKERHTSLFSATFPNSVMSLTRTLLKPKHGKVMIGKNAGSSE------ACVPESINQKFILTNQGSMFRDCFKFIKENPVKTIVFCNRKIEVETFCRFATNQCLRVSSLHGDYNQSRRESEFNFFKNNDSKILVATSIASRGLDVTDVECVINIGLPMEVEEYMHRVGRCGRMGRPGTAVTFVQETDLSLSVVKDLVNMMRRTKMEVPEFLSTSA 1521
            T +QK    I+ ++  DL+  A+TGSGKT A+L P+L+ I    P E + ++KEN       QYP+ LVLAPTREL +QI +EA+K    +++R   V GGAD G QI  + +GCH LVATPGRL D ++RG + L +C  LV+DEADRMLDMGFEPQIR I+    MPP   RHT +FSATFP  +  L R  L  ++  + +G+   +SE        V ES  + F+L    +  +D           T+VF   K   ++   F  ++    +S+HGD +Q  RE   + F++  S ILVAT++A+RGLD+++V+ VIN  LP ++EEY+HR+GR GR+G  G A +F  E +++++  KDL++++   K EVP +L   A
Sbjct:   18 TPVQKHAIPII-KEKRDLMACAQTGSGKTAAFLLPILSQIYSDGPGEALRAMKENGRYGRRKQYPISLVLAPTRELAVQIYEEARKFSYRSRVRPCVVYGGADIGQQIRDLERGCHLLVATPGRLVDMMERGKIGLDFCKYLVLDEADRMLDMGFEPQIRRIVEQDTMPPKGVRHTMMFSATFPKEIQMLARDFLD-EYIFLAVGRVGSTSENITQKVVWVEESDKRSFLLDLLNATGKDSL---------TLVFVETKKGADSLEDFLYHEGYACTSIHGDRSQRDREEALHQFRSGKSPILVATAVAARGLDISNVKHVINFDLPSDIEEYVHRIGRTGRVGNLGLATSFFNERNINIT--KDLLDLLVEAKQEVPSWLENMA 389          
BLAST of ATP-dependent RNA helicase DDX3X vs. Ensembl Human
Match: DDX3X (DEAD-box helicase 3 X-linked [Source:HGNC Symbol;Acc:HGNC:2745])

HSP 1 Score: 293.508 bits (750), Expect = 2.376e-92
Identity = 161/385 (41.82%), Postives = 234/385 (60.78%), Query Frame = 1
Query:  394 TQIQKSTFDILNRQLLDLLGSAETGSGKTVAYLTPLLNSILKSYPEEMMASLKENSST---VQYPLILVLAPTRELVIQISKEAKKLLTFTQLRTVSVIGGADPGGQIGSIFKGCHALVATPGRLKDFIQRGLLSLKYCNKLVIDEADRMLDMGFEPQIREIMFDFDMPPVKERHTSLFSATFPNSVMSLTRTLLKPKHGKVMIGKNAGSSE------ACVPESINQKFILTNQGSMFRDCFKFIKENPVKTIVFCNRKIEVETFCRFATNQCLRVSSLHGDYNQSRRESEFNFFKNNDSKILVATSIASRGLDVTDVECVINIGLPMEVEEYMHRVGRCGRMGRPGTAVTFVQETDLSLSVVKDLVNMMRRTKMEVPEFLSTSA 1521
            T +QK    I+ ++  DL+  A+TGSGKT A+L P+L+ I    P E + ++KEN       QYP+ LVLAPTREL +QI +EA+K    +++R   V GGAD G QI  + +GCH LVATPGRL D ++RG + L +C  LV+DEADRMLDMGFEPQIR I+    MPP   RHT +FSATFP  +  L R  L  ++  + +G+   +SE        V ES  + F+L    +  +D           T+VF   K   ++   F  ++    +S+HGD +Q  RE   + F++  S ILVAT++A+RGLD+++V+ VIN  LP ++EEY+HR+GR GR+G  G A +F  E +++++  KDL++++   K EVP +L   A
Sbjct:   18 TPVQKHAIPII-KEKRDLMACAQTGSGKTAAFLLPILSQIYSDGPGEALRAMKENGRYGRRKQYPISLVLAPTRELAVQIYEEARKFSYRSRVRPCVVYGGADIGQQIRDLERGCHLLVATPGRLVDMMERGKIGLDFCKYLVLDEADRMLDMGFEPQIRRIVEQDTMPPKGVRHTMMFSATFPKEIQMLARDFLD-EYIFLAVGRVGSTSENITQKVVWVEESDKRSFLLDLLNATGKDSL---------TLVFVETKKGADSLEDFLYHEGYACTSIHGDRSQRDREEALHQFRSGKSPILVATAVAARGLDISNVKHVINFDLPSDIEEYVHRIGRTGRVGNLGLATSFFNERNINIT--KDLLDLLVEAKQEVPSWLENMA 389          
BLAST of ATP-dependent RNA helicase DDX3X vs. Ensembl Human
Match: DDX3X (DEAD-box helicase 3 X-linked [Source:HGNC Symbol;Acc:HGNC:2745])

HSP 1 Score: 293.508 bits (750), Expect = 2.376e-92
Identity = 161/385 (41.82%), Postives = 234/385 (60.78%), Query Frame = 1
Query:  394 TQIQKSTFDILNRQLLDLLGSAETGSGKTVAYLTPLLNSILKSYPEEMMASLKENSST---VQYPLILVLAPTRELVIQISKEAKKLLTFTQLRTVSVIGGADPGGQIGSIFKGCHALVATPGRLKDFIQRGLLSLKYCNKLVIDEADRMLDMGFEPQIREIMFDFDMPPVKERHTSLFSATFPNSVMSLTRTLLKPKHGKVMIGKNAGSSE------ACVPESINQKFILTNQGSMFRDCFKFIKENPVKTIVFCNRKIEVETFCRFATNQCLRVSSLHGDYNQSRRESEFNFFKNNDSKILVATSIASRGLDVTDVECVINIGLPMEVEEYMHRVGRCGRMGRPGTAVTFVQETDLSLSVVKDLVNMMRRTKMEVPEFLSTSA 1521
            T +QK    I+ ++  DL+  A+TGSGKT A+L P+L+ I    P E + ++KEN       QYP+ LVLAPTREL +QI +EA+K    +++R   V GGAD G QI  + +GCH LVATPGRL D ++RG + L +C  LV+DEADRMLDMGFEPQIR I+    MPP   RHT +FSATFP  +  L R  L  ++  + +G+   +SE        V ES  + F+L    +  +D           T+VF   K   ++   F  ++    +S+HGD +Q  RE   + F++  S ILVAT++A+RGLD+++V+ VIN  LP ++EEY+HR+GR GR+G  G A +F  E +++++  KDL++++   K EVP +L   A
Sbjct:   18 TPVQKHAIPII-KEKRDLMACAQTGSGKTAAFLLPILSQIYSDGPGEALRAMKENGRYGRRKQYPISLVLAPTRELAVQIYEEARKFSYRSRVRPCVVYGGADIGQQIRDLERGCHLLVATPGRLVDMMERGKIGLDFCKYLVLDEADRMLDMGFEPQIRRIVEQDTMPPKGVRHTMMFSATFPKEIQMLARDFLD-EYIFLAVGRVGSTSENITQKVVWVEESDKRSFLLDLLNATGKDSL---------TLVFVETKKGADSLEDFLYHEGYACTSIHGDRSQRDREEALHQFRSGKSPILVATAVAARGLDISNVKHVINFDLPSDIEEYVHRIGRTGRVGNLGLATSFFNERNINIT--KDLLDLLVEAKQEVPSWLENMA 389          
BLAST of ATP-dependent RNA helicase DDX3X vs. Ensembl Human
Match: DDX3X (DEAD-box helicase 3 X-linked [Source:HGNC Symbol;Acc:HGNC:2745])

HSP 1 Score: 293.508 bits (750), Expect = 2.376e-92
Identity = 161/385 (41.82%), Postives = 234/385 (60.78%), Query Frame = 1
Query:  394 TQIQKSTFDILNRQLLDLLGSAETGSGKTVAYLTPLLNSILKSYPEEMMASLKENSST---VQYPLILVLAPTRELVIQISKEAKKLLTFTQLRTVSVIGGADPGGQIGSIFKGCHALVATPGRLKDFIQRGLLSLKYCNKLVIDEADRMLDMGFEPQIREIMFDFDMPPVKERHTSLFSATFPNSVMSLTRTLLKPKHGKVMIGKNAGSSE------ACVPESINQKFILTNQGSMFRDCFKFIKENPVKTIVFCNRKIEVETFCRFATNQCLRVSSLHGDYNQSRRESEFNFFKNNDSKILVATSIASRGLDVTDVECVINIGLPMEVEEYMHRVGRCGRMGRPGTAVTFVQETDLSLSVVKDLVNMMRRTKMEVPEFLSTSA 1521
            T +QK    I+ ++  DL+  A+TGSGKT A+L P+L+ I    P E + ++KEN       QYP+ LVLAPTREL +QI +EA+K    +++R   V GGAD G QI  + +GCH LVATPGRL D ++RG + L +C  LV+DEADRMLDMGFEPQIR I+    MPP   RHT +FSATFP  +  L R  L  ++  + +G+   +SE        V ES  + F+L    +  +D           T+VF   K   ++   F  ++    +S+HGD +Q  RE   + F++  S ILVAT++A+RGLD+++V+ VIN  LP ++EEY+HR+GR GR+G  G A +F  E +++++  KDL++++   K EVP +L   A
Sbjct:   18 TPVQKHAIPII-KEKRDLMACAQTGSGKTAAFLLPILSQIYSDGPGEALRAMKENGRYGRRKQYPISLVLAPTRELAVQIYEEARKFSYRSRVRPCVVYGGADIGQQIRDLERGCHLLVATPGRLVDMMERGKIGLDFCKYLVLDEADRMLDMGFEPQIRRIVEQDTMPPKGVRHTMMFSATFPKEIQMLARDFLD-EYIFLAVGRVGSTSENITQKVVWVEESDKRSFLLDLLNATGKDSL---------TLVFVETKKGADSLEDFLYHEGYACTSIHGDRSQRDREEALHQFRSGKSPILVATAVAARGLDISNVKHVINFDLPSDIEEYVHRIGRTGRVGNLGLATSFFNERNINIT--KDLLDLLVEAKQEVPSWLENMA 389          
BLAST of ATP-dependent RNA helicase DDX3X vs. Ensembl Human
Match: DDX3X (DEAD-box helicase 3 X-linked [Source:HGNC Symbol;Acc:HGNC:2745])

HSP 1 Score: 293.508 bits (750), Expect = 1.215e-90
Identity = 161/385 (41.82%), Postives = 233/385 (60.52%), Query Frame = 1
Query:  394 TQIQKSTFDILNRQLLDLLGSAETGSGKTVAYLTPLLNSILKSYPEEMMASLKENSST---VQYPLILVLAPTRELVIQISKEAKKLLTFTQLRTVSVIGGADPGGQIGSIFKGCHALVATPGRLKDFIQRGLLSLKYCNKLVIDEADRMLDMGFEPQIREIMFDFDMPPVKERHTSLFSATFPNSVMSLTRTLLKPKHGKVMIGKNAGSSE------ACVPESINQKFILTNQGSMFRDCFKFIKENPVKTIVFCNRKIEVETFCRFATNQCLRVSSLHGDYNQSRRESEFNFFKNNDSKILVATSIASRGLDVTDVECVINIGLPMEVEEYMHRVGRCGRMGRPGTAVTFVQETDLSLSVVKDLVNMMRRTKMEVPEFLSTSA 1521
            T +QK    I+ ++  DL+  A+TGSGKT A+L P+L+ I    P E + ++KEN       QYP+ LVLAPTREL +QI +EA+K    +++R   V GGAD G QI  + +GCH LVATPGRL D ++RG + L +C  LV+DEADRMLDMGFEPQIR I+    MPP   RHT +FSATFP  +  L R  L  ++  + +G+   +SE        V ES  + F+L    +  +D           T+VF   K   ++   F  ++    +S+HGD +Q  RE   + F++  S ILVAT++A+RGLD+++V+ VIN  LP ++EEY+HR+GR GR+G  G A +F  E +  +++ KDL++++   K EVP +L   A
Sbjct:  165 TPVQKHAIPII-KEKRDLMACAQTGSGKTAAFLLPILSQIYSDGPGEALRAMKENGRYGRRKQYPISLVLAPTRELAVQIYEEARKFSYRSRVRPCVVYGGADIGQQIRDLERGCHLLVATPGRLVDMMERGKIGLDFCKYLVLDEADRMLDMGFEPQIRRIVEQDTMPPKGVRHTMMFSATFPKEIQMLARDFLD-EYIFLAVGRVGSTSENITQKVVWVEESDKRSFLLDLLNATGKDSL---------TLVFVETKKGADSLEDFLYHEGYACTSIHGDRSQRDREEALHQFRSGKSPILVATAVAARGLDISNVKHVINFDLPSDIEEYVHRIGRTGRVGNLGLATSFFNERN--INITKDLLDLLVEAKQEVPSWLENMA 536          
BLAST of ATP-dependent RNA helicase DDX3X vs. Ensembl Celegans
Match: laf-1 (ATP-dependent RNA helicase laf-1 [Source:UniProtKB/Swiss-Prot;Acc:D0PV95])

HSP 1 Score: 262.307 bits (669), Expect = 5.420e-79
Identity = 148/394 (37.56%), Postives = 232/394 (58.88%), Query Frame = 1
Query:  343 LDQRLSEVLIKSGHDQMTQIQKSTFDILNRQLLDLLGSAETGSGKTVAYLTPLLNSILKSYPEEMMASLKENSS-TVQYPLILVLAPTRELVIQISKEAKKLLTFTQLRTVSVIGGADP-GGQIGSIFKGCHALVATPGRLKDFIQRGLLSLKYCNKLVIDEADRMLDMGFEPQIREIMFDFDMPPVKERHTSLFSATFPNSVMSLTRTLLKPKHGKVMIGKNAGSSEACVPESINQKFILTNQG---SMFRDCFKFIKENPVKTIVFCNRKIEVETFCRFATNQCLRVSSLHGDYNQSRRESEFNFFKNNDSKILVATSIASRGLDVTDVECVINIGLPMEVEEYMHRVGRCGRMGRPGTAVTFVQETDLSLSVVKDLVNMMRRTKMEVPEFL 1509
            L + + E +  +G+D+ T +QK +   L +   DL+  A+TGSGKT A+L PL+N+IL+  P+ +  S+  +     QYP  LVL+PTREL +QI  E++K    T + +  + GG +    QI  +  GCH L+ATPGRL D + +GL+ ++ C  LV+DEADRMLDMGFEPQIR+I+    MP  +ER T++FSATFP  +  L +  LK  +  + +G+   +S     E+I QK +   +    S   D      ++ + T+VF   K        +   Q   V ++HGD  Q  RE   + F+   + ILVAT++A+RGLD+ +V+ VIN  LP +V+EY+HR+GR GR+G  G A +F    D + ++ ++L++++     E+P++L
Sbjct:  173 LHEWIEENIKTAGYDRPTPVQKYSIPAL-QGGRDLMSCAQTGSGKTAAFLVPLVNAILQDGPDAVHRSVTSSGGRKKQYPSALVLSPTRELSLQIFNESRKFAYRTPITSALLYGGRENYKDQIHKLRLGCHILIATPGRLIDVMDQGLIGMEGCRYLVLDEADRMLDMGFEPQIRQIVECNRMPSKEERITAMFSATFPKEIQLLAQDFLKENYVFLAVGRVGSTS-----ENIMQKIVWVEEDEKRSYLMDLLDATGDSSL-TLVFVETKRGASDLAYYLNRQNYEVVTIHGDLKQFEREKHLDLFRTGTAPILVATAVAARGLDIPNVKHVINYDLPSDVDEYVHRIGRTGRVGNVGLATSFF--NDKNRNIARELMDLIVEANQELPDWL 557          
BLAST of ATP-dependent RNA helicase DDX3X vs. Ensembl Celegans
Match: vbh-1 (Vasa-and Belle-like Helicase [Source:UniProtKB/TrEMBL;Acc:Q65XX1])

HSP 1 Score: 260.766 bits (665), Expect = 2.191e-78
Identity = 154/394 (39.09%), Postives = 220/394 (55.84%), Query Frame = 1
Query:  361 EVLIKSGHDQMTQIQKSTFDIL--NRQLLDLLGSAETGSGKTVAYLTPLLNSILKSYPEEMMASLKENSSTVQYPLILVLAPTRELVIQISKEAKKLLTFTQLRTVSVIGG-ADPGGQIGSIFKGCHALVATPGRLKDFIQRGLLSLKYCNKLVIDEADRMLDMGFEPQIREIMFDFDMPPVKERHTSLFSATFPNSVMSLTRTLLKPKHGKVMIGKNAGSSEACVPESINQKFILTNQGSMFRDCFKFI----KENPVKTIVFCNRKIEVETFCRFATNQCLRVSSLHGDYNQSRRESEFNFFKNNDSKILVATSIASRGLDVTDVECVINIGLPMEVEEYMHRVGRCGRMGRPGTAVTFVQETDLSLSVVKDLVNMMRRTKMEVPEFLSTSA 1521
            E + +SG+ + T +QK +   L  NR   DL+  A+TGSGKT A+L P++  IL   P+ +      N     YP  LVL+PTREL IQI KEA K    + ++T  + GG  +   Q+  +  G H L+ATPGRL D I++G + L  C  LV+DEADRMLDMGFEPQIR+I+    MPP   R T++FSATFP  +  L +  LK  +  + +G+   +SE     +I Q+ +  N+     +  + +     EN V  +VF   K        F   Q +R  S+HGD  Q  RE     F++    ILVAT++A+RGLD+ +V  VIN  LP + +EY+HR+GR GR G  G A +F    D +  + +DL N++  +  EVPE+L   A
Sbjct:  133 ENVNRSGYSKPTPVQKHSIPTLLANR---DLMSCAQTGSGKTAAFLLPIIQHILAGGPDMVKPPAFTNGRRTYYPCALVLSPTRELAIQIHKEATKFSYKSNIQTAILYGGRENYRDQVNRLRAGTHILIATPGRLIDIIEQGFIGLAGCRYLVLDEADRMLDMGFEPQIRKIVGQ-GMPPKTARTTAMFSATFPKEIQVLAKDFLKDNYIFLAVGRVGSTSE-----NIEQRLLWVNEMEKRSNLMEILMNEHSENLV--LVFVETKRGANELAYFLNRQQIRSVSIHGDLKQIERERNLELFRSGQCPILVATAVAARGLDIPNVRHVINYDLPGDSDEYVHRIGRTGRCGNLGIATSFF--NDKNRGIGRDLKNLIVESNQEVPEWLHQVA 513          
BLAST of ATP-dependent RNA helicase DDX3X vs. Ensembl Celegans
Match: vbh-1 (Vasa-and Belle-like Helicase [Source:UniProtKB/TrEMBL;Acc:Q65XX1])

HSP 1 Score: 260.766 bits (665), Expect = 2.191e-78
Identity = 154/394 (39.09%), Postives = 220/394 (55.84%), Query Frame = 1
Query:  361 EVLIKSGHDQMTQIQKSTFDIL--NRQLLDLLGSAETGSGKTVAYLTPLLNSILKSYPEEMMASLKENSSTVQYPLILVLAPTRELVIQISKEAKKLLTFTQLRTVSVIGG-ADPGGQIGSIFKGCHALVATPGRLKDFIQRGLLSLKYCNKLVIDEADRMLDMGFEPQIREIMFDFDMPPVKERHTSLFSATFPNSVMSLTRTLLKPKHGKVMIGKNAGSSEACVPESINQKFILTNQGSMFRDCFKFI----KENPVKTIVFCNRKIEVETFCRFATNQCLRVSSLHGDYNQSRRESEFNFFKNNDSKILVATSIASRGLDVTDVECVINIGLPMEVEEYMHRVGRCGRMGRPGTAVTFVQETDLSLSVVKDLVNMMRRTKMEVPEFLSTSA 1521
            E + +SG+ + T +QK +   L  NR   DL+  A+TGSGKT A+L P++  IL   P+ +      N     YP  LVL+PTREL IQI KEA K    + ++T  + GG  +   Q+  +  G H L+ATPGRL D I++G + L  C  LV+DEADRMLDMGFEPQIR+I+    MPP   R T++FSATFP  +  L +  LK  +  + +G+   +SE     +I Q+ +  N+     +  + +     EN V  +VF   K        F   Q +R  S+HGD  Q  RE     F++    ILVAT++A+RGLD+ +V  VIN  LP + +EY+HR+GR GR G  G A +F    D +  + +DL N++  +  EVPE+L   A
Sbjct:  133 ENVNRSGYSKPTPVQKHSIPTLLANR---DLMSCAQTGSGKTAAFLLPIIQHILAGGPDMVKPPAFTNGRRTYYPCALVLSPTRELAIQIHKEATKFSYKSNIQTAILYGGRENYRDQVNRLRAGTHILIATPGRLIDIIEQGFIGLAGCRYLVLDEADRMLDMGFEPQIRKIVGQ-GMPPKTARTTAMFSATFPKEIQVLAKDFLKDNYIFLAVGRVGSTSE-----NIEQRLLWVNEMEKRSNLMEILMNEHSENLV--LVFVETKRGANELAYFLNRQQIRSVSIHGDLKQIERERNLELFRSGQCPILVATAVAARGLDIPNVRHVINYDLPGDSDEYVHRIGRTGRCGNLGIATSFF--NDKNRGIGRDLKNLIVESNQEVPEWLHQVA 513          
BLAST of ATP-dependent RNA helicase DDX3X vs. Ensembl Celegans
Match: vbh-1 (Vasa-and Belle-like Helicase [Source:UniProtKB/TrEMBL;Acc:Q65XX1])

HSP 1 Score: 260.766 bits (665), Expect = 2.197e-78
Identity = 154/394 (39.09%), Postives = 220/394 (55.84%), Query Frame = 1
Query:  361 EVLIKSGHDQMTQIQKSTFDIL--NRQLLDLLGSAETGSGKTVAYLTPLLNSILKSYPEEMMASLKENSSTVQYPLILVLAPTRELVIQISKEAKKLLTFTQLRTVSVIGG-ADPGGQIGSIFKGCHALVATPGRLKDFIQRGLLSLKYCNKLVIDEADRMLDMGFEPQIREIMFDFDMPPVKERHTSLFSATFPNSVMSLTRTLLKPKHGKVMIGKNAGSSEACVPESINQKFILTNQGSMFRDCFKFI----KENPVKTIVFCNRKIEVETFCRFATNQCLRVSSLHGDYNQSRRESEFNFFKNNDSKILVATSIASRGLDVTDVECVINIGLPMEVEEYMHRVGRCGRMGRPGTAVTFVQETDLSLSVVKDLVNMMRRTKMEVPEFLSTSA 1521
            E + +SG+ + T +QK +   L  NR   DL+  A+TGSGKT A+L P++  IL   P+ +      N     YP  LVL+PTREL IQI KEA K    + ++T  + GG  +   Q+  +  G H L+ATPGRL D I++G + L  C  LV+DEADRMLDMGFEPQIR+I+    MPP   R T++FSATFP  +  L +  LK  +  + +G+   +SE     +I Q+ +  N+     +  + +     EN V  +VF   K        F   Q +R  S+HGD  Q  RE     F++    ILVAT++A+RGLD+ +V  VIN  LP + +EY+HR+GR GR G  G A +F    D +  + +DL N++  +  EVPE+L   A
Sbjct:  136 ENVNRSGYSKPTPVQKHSIPTLLANR---DLMSCAQTGSGKTAAFLLPIIQHILAGGPDMVKPPAFTNGRRTYYPCALVLSPTRELAIQIHKEATKFSYKSNIQTAILYGGRENYRDQVNRLRAGTHILIATPGRLIDIIEQGFIGLAGCRYLVLDEADRMLDMGFEPQIRKIVGQ-GMPPKTARTTAMFSATFPKEIQVLAKDFLKDNYIFLAVGRVGSTSE-----NIEQRLLWVNEMEKRSNLMEILMNEHSENLV--LVFVETKRGANELAYFLNRQQIRSVSIHGDLKQIERERNLELFRSGQCPILVATAVAARGLDIPNVRHVINYDLPGDSDEYVHRIGRTGRCGNLGIATSFF--NDKNRGIGRDLKNLIVESNQEVPEWLHQVA 516          
BLAST of ATP-dependent RNA helicase DDX3X vs. Ensembl Celegans
Match: vbh-1 (Vasa-and Belle-like Helicase [Source:UniProtKB/TrEMBL;Acc:Q65XX1])

HSP 1 Score: 260.766 bits (665), Expect = 2.197e-78
Identity = 154/394 (39.09%), Postives = 220/394 (55.84%), Query Frame = 1
Query:  361 EVLIKSGHDQMTQIQKSTFDIL--NRQLLDLLGSAETGSGKTVAYLTPLLNSILKSYPEEMMASLKENSSTVQYPLILVLAPTRELVIQISKEAKKLLTFTQLRTVSVIGG-ADPGGQIGSIFKGCHALVATPGRLKDFIQRGLLSLKYCNKLVIDEADRMLDMGFEPQIREIMFDFDMPPVKERHTSLFSATFPNSVMSLTRTLLKPKHGKVMIGKNAGSSEACVPESINQKFILTNQGSMFRDCFKFI----KENPVKTIVFCNRKIEVETFCRFATNQCLRVSSLHGDYNQSRRESEFNFFKNNDSKILVATSIASRGLDVTDVECVINIGLPMEVEEYMHRVGRCGRMGRPGTAVTFVQETDLSLSVVKDLVNMMRRTKMEVPEFLSTSA 1521
            E + +SG+ + T +QK +   L  NR   DL+  A+TGSGKT A+L P++  IL   P+ +      N     YP  LVL+PTREL IQI KEA K    + ++T  + GG  +   Q+  +  G H L+ATPGRL D I++G + L  C  LV+DEADRMLDMGFEPQIR+I+    MPP   R T++FSATFP  +  L +  LK  +  + +G+   +SE     +I Q+ +  N+     +  + +     EN V  +VF   K        F   Q +R  S+HGD  Q  RE     F++    ILVAT++A+RGLD+ +V  VIN  LP + +EY+HR+GR GR G  G A +F    D +  + +DL N++  +  EVPE+L   A
Sbjct:  136 ENVNRSGYSKPTPVQKHSIPTLLANR---DLMSCAQTGSGKTAAFLLPIIQHILAGGPDMVKPPAFTNGRRTYYPCALVLSPTRELAIQIHKEATKFSYKSNIQTAILYGGRENYRDQVNRLRAGTHILIATPGRLIDIIEQGFIGLAGCRYLVLDEADRMLDMGFEPQIRKIVGQ-GMPPKTARTTAMFSATFPKEIQVLAKDFLKDNYIFLAVGRVGSTSE-----NIEQRLLWVNEMEKRSNLMEILMNEHSENLV--LVFVETKRGANELAYFLNRQQIRSVSIHGDLKQIERERNLELFRSGQCPILVATAVAARGLDIPNVRHVINYDLPGDSDEYVHRIGRTGRCGNLGIATSFF--NDKNRGIGRDLKNLIVESNQEVPEWLHQVA 516          
BLAST of ATP-dependent RNA helicase DDX3X vs. Ensembl Fly
Match: bel (gene:FBgn0263231 transcript:FBtr0081888)

HSP 1 Score: 268.47 bits (685), Expect = 5.875e-80
Identity = 153/382 (40.05%), Postives = 225/382 (58.90%), Query Frame = 1
Query:  382 HDQMTQIQKSTFDILNRQLLDLLGSAETGSGKTVAYLTPLLNSILKSYPEEMMASLKENSSTVQYPLILVLAPTRELVIQISKEAKKLLTFTQLRTVSVIGGADPGGQIGSIFKGCHALVATPGRLKDFIQRGLLSLKYCNKLVIDEADRMLDMGFEPQIREIMFDFDMPPVKERHTSLFSATFPNSVMSLTRTLLKPKHGKVMIGKNAGSSEACVPESI------NQKFILTNQGSMFRDCFKFIKENPVKTIVFCNRKIEVETFCRFATNQCLRVSSLHGDYNQSRRESEFNFFKNNDSKILVATSIASRGLDVTDVECVINIGLPMEVEEYMHRVGRCGRMGRPGTAVTFVQETDLSLSVVKDLVNMMRRTKMEVPEFL 1509
            +D+ T +QK    I+     DL+  A+TGSGKT A+L P+LN + +        S ++ S   QYPL LVLAPTREL  QI +EAKK    +++R   + GG +   Q+  + +GCH +VATPGRL+D I RG + L+    LV+DEADRMLDMGFEPQIR I+   +MPP  +R T +FSATFP  +  L    L   +  + +G+  GS+   + ++I      +++  L +  S  RD  ++ K++   T++F   K   ++   F       V+S+HGD  Q  RE     F++ D  ILVAT++A+RGLD+  V+ VIN  LP +VEEY+HR+GR GRMG  G A +F  E +   ++  DL+ ++  TK E+P F+
Sbjct:  315 YDKPTPVQKHAIPIIINGR-DLMACAQTGSGKTAAFLVPILNQMYELGHVPPPQSTRQYSRRKQYPLGLVLAPTRELATQIFEEAKKFAYRSRMRPAVLYGGNNTSEQMRELDRGCHLIVATPGRLEDMITRGKVGLENIRFLVLDEADRMLDMGFEPQIRRIVEQLNMPPTGQRQTLMFSATFPKQIQELASDFLS-NYIFLAVGR-VGSTSENITQTILWVYEPDKRSYLLDLLSSIRDGPEYTKDS--LTLIFVETKKGADSLEEFLYQCNHPVTSIHGDRTQKEREEALRCFRSGDCPILVATAVAARGLDIPHVKHVINFDLPSDVEEYVHRIGRTGRMGNLGVATSFFNEKN--RNICSDLLELLIETKQEIPSFM 689          
BLAST of ATP-dependent RNA helicase DDX3X vs. Ensembl Fly
Match: bel (gene:FBgn0263231 transcript:FBtr0334319)

HSP 1 Score: 268.085 bits (684), Expect = 8.608e-80
Identity = 153/382 (40.05%), Postives = 225/382 (58.90%), Query Frame = 1
Query:  382 HDQMTQIQKSTFDILNRQLLDLLGSAETGSGKTVAYLTPLLNSILKSYPEEMMASLKENSSTVQYPLILVLAPTRELVIQISKEAKKLLTFTQLRTVSVIGGADPGGQIGSIFKGCHALVATPGRLKDFIQRGLLSLKYCNKLVIDEADRMLDMGFEPQIREIMFDFDMPPVKERHTSLFSATFPNSVMSLTRTLLKPKHGKVMIGKNAGSSEACVPESI------NQKFILTNQGSMFRDCFKFIKENPVKTIVFCNRKIEVETFCRFATNQCLRVSSLHGDYNQSRRESEFNFFKNNDSKILVATSIASRGLDVTDVECVINIGLPMEVEEYMHRVGRCGRMGRPGTAVTFVQETDLSLSVVKDLVNMMRRTKMEVPEFL 1509
            +D+ T +QK    I+     DL+  A+TGSGKT A+L P+LN + +        S ++ S   QYPL LVLAPTREL  QI +EAKK    +++R   + GG +   Q+  + +GCH +VATPGRL+D I RG + L+    LV+DEADRMLDMGFEPQIR I+   +MPP  +R T +FSATFP  +  L    L   +  + +G+  GS+   + ++I      +++  L +  S  RD  ++ K++   T++F   K   ++   F       V+S+HGD  Q  RE     F++ D  ILVAT++A+RGLD+  V+ VIN  LP +VEEY+HR+GR GRMG  G A +F  E +   ++  DL+ ++  TK E+P F+
Sbjct:  315 YDKPTPVQKHAIPIIINGR-DLMACAQTGSGKTAAFLVPILNQMYELGHVPPPQSTRQYSRRKQYPLGLVLAPTRELATQIFEEAKKFAYRSRMRPAVLYGGNNTSEQMRELDRGCHLIVATPGRLEDMITRGKVGLENIRFLVLDEADRMLDMGFEPQIRRIVEQLNMPPTGQRQTLMFSATFPKQIQELASDFLS-NYIFLAVGR-VGSTSENITQTILWVYEPDKRSYLLDLLSSIRDGPEYTKDS--LTLIFVETKKGADSLEEFLYQCNHPVTSIHGDRTQKEREEALRCFRSGDCPILVATAVAARGLDIPHVKHVINFDLPSDVEEYVHRIGRTGRMGNLGVATSFFNEKN--RNICSDLLELLIETKQEIPSFM 689          
BLAST of ATP-dependent RNA helicase DDX3X vs. Ensembl Fly
Match: vas (gene:FBgn0283442 transcript:FBtr0445187)

HSP 1 Score: 233.417 bits (594), Expect = 5.599e-68
Identity = 143/403 (35.48%), Postives = 216/403 (53.60%), Query Frame = 1
Query:  373 KSGHDQMTQIQKSTFDILNRQLLDLLGSAETGSGKTVAYLTPLLNSILKSYPEEMMASLKENSSTVQYPLILVLAPTRELVIQISKEAKKLLTFTQLRTVSVIGGADPGGQIGSIFKGCHALVATPGRLKDFIQRGLLSLKYCNKLVIDEADRMLDMGFEPQIREIMFDFDMPPVKERHTSLFSATFPNSVMSLTRTLLKPKHGKVMIGKNAGSSEACVPESINQKFILTNQGSMFRDCFKFIKENPVKTIVFCNRKIEVETFCRFATNQCLRVSSLHGDYNQSRRESEFNFFKNNDSKILVATSIASRGLDVTDVECVINIGLPMEVEEYMHRVGRCGRMGRPGTAVTFVQETDLSLSVVKDLVNMMRRTKMEVPEFLSTSAKNVKSDNSRVDYNRFDSNNR 1581
            KSG+   T IQK +  +++    DL+  A+TGSGKT A+L P+L+ +L+  P E+          +  P +++++PTREL IQI  EA+K    + L+   V GG     Q   I +GCH ++ATPGRL DF+ R  ++ +    +V+DEADRMLDMGF   +R IM    M P  E  T +FSATFP  +  +    LK  +  V IG   G   AC    + Q     N+ +      + + E    TIVF   K   +    F + +    +S+HGD  QS+RE     FKN   K+L+ATS+ASRGLD+ +++ VIN  +P ++++Y+HR+GR GR+G  G A +F  + +   ++  DLV ++  +   VP+FL T         S  ++   D   R
Sbjct:  262 KSGYKIPTPIQKCSIPVISSGR-DLMACAQTGSGKTAAFLLPILSKLLED-PHEL---------ELGRPQVVIVSPTRELAIQIFNEARKFAFESYLKIGIVYGGTSFRHQNECITRGCHVVIATPGRLLDFVDRTFITFEDTRFVVLDEADRMLDMGFSEDMRRIMTHVTMRP--EHQTLMFSATFPEEIQRMAGEFLK-NYVFVAIGIVGG---AC--SDVKQTIYEVNKYAKRSKLIEILSEQADGTIVFVETKRGADFLASFLSEKEFPTTSIHGDRLQSQREQALRDFKNGSMKVLIATSVASRGLDIKNIKHVINYDMPSKIDDYVHRIGRTGRVGNNGRATSFF-DPEKDRAIAADLVKILEGSGQTVPDFLRTCGAGGDGGYSNQNFGGVDVRGR 644          
BLAST of ATP-dependent RNA helicase DDX3X vs. Ensembl Fly
Match: vas (gene:FBgn0283442 transcript:FBtr0445185)

HSP 1 Score: 233.417 bits (594), Expect = 5.599e-68
Identity = 143/403 (35.48%), Postives = 216/403 (53.60%), Query Frame = 1
Query:  373 KSGHDQMTQIQKSTFDILNRQLLDLLGSAETGSGKTVAYLTPLLNSILKSYPEEMMASLKENSSTVQYPLILVLAPTRELVIQISKEAKKLLTFTQLRTVSVIGGADPGGQIGSIFKGCHALVATPGRLKDFIQRGLLSLKYCNKLVIDEADRMLDMGFEPQIREIMFDFDMPPVKERHTSLFSATFPNSVMSLTRTLLKPKHGKVMIGKNAGSSEACVPESINQKFILTNQGSMFRDCFKFIKENPVKTIVFCNRKIEVETFCRFATNQCLRVSSLHGDYNQSRRESEFNFFKNNDSKILVATSIASRGLDVTDVECVINIGLPMEVEEYMHRVGRCGRMGRPGTAVTFVQETDLSLSVVKDLVNMMRRTKMEVPEFLSTSAKNVKSDNSRVDYNRFDSNNR 1581
            KSG+   T IQK +  +++    DL+  A+TGSGKT A+L P+L+ +L+  P E+          +  P +++++PTREL IQI  EA+K    + L+   V GG     Q   I +GCH ++ATPGRL DF+ R  ++ +    +V+DEADRMLDMGF   +R IM    M P  E  T +FSATFP  +  +    LK  +  V IG   G   AC    + Q     N+ +      + + E    TIVF   K   +    F + +    +S+HGD  QS+RE     FKN   K+L+ATS+ASRGLD+ +++ VIN  +P ++++Y+HR+GR GR+G  G A +F  + +   ++  DLV ++  +   VP+FL T         S  ++   D   R
Sbjct:  262 KSGYKIPTPIQKCSIPVISSGR-DLMACAQTGSGKTAAFLLPILSKLLED-PHEL---------ELGRPQVVIVSPTRELAIQIFNEARKFAFESYLKIGIVYGGTSFRHQNECITRGCHVVIATPGRLLDFVDRTFITFEDTRFVVLDEADRMLDMGFSEDMRRIMTHVTMRP--EHQTLMFSATFPEEIQRMAGEFLK-NYVFVAIGIVGG---AC--SDVKQTIYEVNKYAKRSKLIEILSEQADGTIVFVETKRGADFLASFLSEKEFPTTSIHGDRLQSQREQALRDFKNGSMKVLIATSVASRGLDIKNIKHVINYDMPSKIDDYVHRIGRTGRVGNNGRATSFF-DPEKDRAIAADLVKILEGSGQTVPDFLRTCGAGGDGGYSNQNFGGVDVRGR 644          
BLAST of ATP-dependent RNA helicase DDX3X vs. Ensembl Fly
Match: vas (gene:FBgn0283442 transcript:FBtr0445186)

HSP 1 Score: 233.417 bits (594), Expect = 5.599e-68
Identity = 143/403 (35.48%), Postives = 216/403 (53.60%), Query Frame = 1
Query:  373 KSGHDQMTQIQKSTFDILNRQLLDLLGSAETGSGKTVAYLTPLLNSILKSYPEEMMASLKENSSTVQYPLILVLAPTRELVIQISKEAKKLLTFTQLRTVSVIGGADPGGQIGSIFKGCHALVATPGRLKDFIQRGLLSLKYCNKLVIDEADRMLDMGFEPQIREIMFDFDMPPVKERHTSLFSATFPNSVMSLTRTLLKPKHGKVMIGKNAGSSEACVPESINQKFILTNQGSMFRDCFKFIKENPVKTIVFCNRKIEVETFCRFATNQCLRVSSLHGDYNQSRRESEFNFFKNNDSKILVATSIASRGLDVTDVECVINIGLPMEVEEYMHRVGRCGRMGRPGTAVTFVQETDLSLSVVKDLVNMMRRTKMEVPEFLSTSAKNVKSDNSRVDYNRFDSNNR 1581
            KSG+   T IQK +  +++    DL+  A+TGSGKT A+L P+L+ +L+  P E+          +  P +++++PTREL IQI  EA+K    + L+   V GG     Q   I +GCH ++ATPGRL DF+ R  ++ +    +V+DEADRMLDMGF   +R IM    M P  E  T +FSATFP  +  +    LK  +  V IG   G   AC    + Q     N+ +      + + E    TIVF   K   +    F + +    +S+HGD  QS+RE     FKN   K+L+ATS+ASRGLD+ +++ VIN  +P ++++Y+HR+GR GR+G  G A +F  + +   ++  DLV ++  +   VP+FL T         S  ++   D   R
Sbjct:  262 KSGYKIPTPIQKCSIPVISSGR-DLMACAQTGSGKTAAFLLPILSKLLED-PHEL---------ELGRPQVVIVSPTRELAIQIFNEARKFAFESYLKIGIVYGGTSFRHQNECITRGCHVVIATPGRLLDFVDRTFITFEDTRFVVLDEADRMLDMGFSEDMRRIMTHVTMRP--EHQTLMFSATFPEEIQRMAGEFLK-NYVFVAIGIVGG---AC--SDVKQTIYEVNKYAKRSKLIEILSEQADGTIVFVETKRGADFLASFLSEKEFPTTSIHGDRLQSQREQALRDFKNGSMKVLIATSVASRGLDIKNIKHVINYDMPSKIDDYVHRIGRTGRVGNNGRATSFF-DPEKDRAIAADLVKILEGSGQTVPDFLRTCGAGGDGGYSNQNFGGVDVRGR 644          
BLAST of ATP-dependent RNA helicase DDX3X vs. Ensembl Zebrafish
Match: ddx3xb (DEAD-box helicase 3 X-linked b [Source:ZFIN;Acc:ZDB-GENE-980526-150])

HSP 1 Score: 280.411 bits (716), Expect = 3.645e-85
Identity = 158/386 (40.93%), Postives = 227/386 (58.81%), Query Frame = 1
Query:  394 TQIQKSTFDILNRQLLDLLGSAETGSGKTVAYLTPLLNSILKSYPEEMMASLKENSST-------VQYPLILVLAPTRELVIQISKEAKKLLTFTQLRTVSVIGGADPGGQIGSIFKGCHALVATPGRLKDFIQRGLLSLKYCNKLVIDEADRMLDMGFEPQIREIMFDFDMPPVKERHTSLFSATFPNSVMSLTRTLLKPKHGKVMIGKNAGSSEACVPESINQKFILTNQG---SMFRDCFKFIKENPVKTIVFCNRKIEVETFCRFATNQCLRVSSLHGDYNQSRRESEFNFFKNNDSKILVATSIASRGLDVTDVECVINIGLPMEVEEYMHRVGRCGRMGRPGTAVTFVQETDLSLSVVKDLVNMMRRTKMEVPEFLSTSA 1521
            T +QK    I+ +   DL+  A+TGSGKT A+L P+L+ I    P E + + K ++          QYP+ LVLAPTREL +QI  EA+K    + +R   V GGAD G QI  + +GCH LVATPGRL D ++RG + L YCN LV+DEADRMLDMGFEPQIR I+    MPP   R T +FSATFP  +  L R  L+  +  + +G+   +S     E+I QK +   +    S   D      ++ + T+VF   K   +    F   +    +S+HGD +Q  RE   + F++    ILVAT++A+RGLD+++V+ VIN  LP ++EEY+HR+GR GR+G  G A +F    D + ++ KDL++++   K EVP +L + A
Sbjct:  232 TPVQKHAIPII-KSKRDLMACAQTGSGKTAAFLLPVLSQIYTDGPGEALQAAKNSAQENGKYGRRKQYPISLVLAPTRELALQIYDEARKFSYRSHVRPCVVYGGADIGQQIRDLERGCHLLVATPGRLVDMMERGKIGLDYCNYLVLDEADRMLDMGFEPQIRRIVEQDTMPPKGLRQTMMFSATFPKEIQILARDFLE-DYIFLAVGRVGSTS-----ENITQKVVWVEENDKRSFLLDLLNATGKDSL-TLVFVETKKGADALEDFLYREGYACTSIHGDRSQRDREEALHQFRSGRCPILVATAVAARGLDISNVKHVINFDLPSDIEEYVHRIGRTGRVGNLGLATSFF--NDKNGNITKDLLDILVEAKQEVPSWLESLA 607          
BLAST of ATP-dependent RNA helicase DDX3X vs. Ensembl Zebrafish
Match: ddx3xa (DEAD-box helicase 3 X-linked a [Source:ZFIN;Acc:ZDB-GENE-030131-1565])

HSP 1 Score: 279.641 bits (714), Expect = 9.352e-85
Identity = 159/387 (41.09%), Postives = 228/387 (58.91%), Query Frame = 1
Query:  394 TQIQKSTFDILNRQLLDLLGSAETGSGKTVAYLTPLLNSILKSYPEEMMASLK-----ENSSTV---QYPLILVLAPTRELVIQISKEAKKLLTFTQLRTVSVIGGADPGGQIGSIFKGCHALVATPGRLKDFIQRGLLSLKYCNKLVIDEADRMLDMGFEPQIREIMFDFDMPPVKERHTSLFSATFPNSVMSLTRTLLKPKHGKVMIGKNAGSSEACVPESINQKFILTNQG---SMFRDCFKFIKENPVKTIVFCNRKIEVETFCRFATNQCLRVSSLHGDYNQSRRESEFNFFKNNDSKILVATSIASRGLDVTDVECVINIGLPMEVEEYMHRVGRCGRMGRPGTAVTFVQETDLSLSVVKDLVNMMRRTKMEVPEFLSTSA 1521
            T +QK    I+  +  DL+  A+TGSGKT A+L P+L+ I    P E + + K     EN   V   QYP+ LVLAPTREL +QI  EA+K    +++R   V GGAD G QI  + +GCH LVATPGRL D ++RG + L YC  LV+DEADRMLDMGFEPQIR I+    MPP   R T +FSATFP  +  L R  L+ ++  + +G+   +S     E+I QK +   +    S   D      ++ + T+VF   K   +    F   +    +S+HGD +Q  RE   + F++    I+VAT++A+RGLD+++V+ VIN  LP ++EEY+HR+GR GR+G  G A +F    D + ++ KDL++++   K EVP +L   A
Sbjct:  247 TPVQKYAIPIIKTKR-DLMACAQTGSGKTAAFLLPVLSQIYSEGPGEALQATKASTQQENGKYVRRKQYPISLVLAPTRELALQIYDEARKFAYRSRVRPCVVYGGADIGQQIRDLERGCHLLVATPGRLVDMMERGKIGLDYCKYLVLDEADRMLDMGFEPQIRRIVEQDTMPPKGSRQTMMFSATFPKEIQILARDFLE-EYIFLAVGRVGSTS-----ENITQKVVWVEENDKRSFLLDLLNATGKDSL-TLVFVETKKGADALEDFLYREGYACTSIHGDRSQRDREEALHQFRSGRCPIMVATAVAARGLDISNVKHVINFDLPSDIEEYVHRIGRTGRVGNLGLATSFY--NDKNSNITKDLLDILVEAKQEVPSWLENLA 623          
BLAST of ATP-dependent RNA helicase DDX3X vs. Ensembl Zebrafish
Match: ddx4 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 4 [Source:ZFIN;Acc:ZDB-GENE-990415-272])

HSP 1 Score: 241.891 bits (616), Expect = 1.097e-70
Identity = 146/391 (37.34%), Postives = 221/391 (56.52%), Query Frame = 1
Query:  355 LSEVLIKSGHDQMTQIQKSTFDILNRQLLDLLGSAETGSGKTVAYLTPLLNSILKSYPEEMMASLKENSSTVQYPLILVLAPTRELVIQISKEAKKLLTFTQLRTVSVIGGADPGGQIGSIFKGCHALVATPGRLKDFIQRGLLSLKYCNKLVIDEADRMLDMGFEPQIREIMFDFDMPPVKERHTSLFSATFPNSVMSLTRTLLKPKHGKVMIGKNAGSSEACVPESINQKFILTNQGSMFRDCFKFIKENP-VKTIVFCNRKIEVETFCRFATNQCLRVSSLHGDYNQSRRESEFNFFKNNDSKILVATSIASRGLDVTDVECVINIGLPMEVEEYMHRVGRCGRMGRPGTAVTFVQ-ETDLSLSVVKDLVNMMRRTKMEVPEFLSTSA 1521
            LS+ + KSG+ + T +QK    I++    DL+  A+TGSGKT A+L P    IL+ +  + +A+ K   S +Q P  +++APTREL+ QI  EA+K    T +R V V GG + G  I  + KGC+ L ATPGRL D I RG + L     LV+DEADRMLDMGFEP++R+++    MP  +ER T +FSAT+P  +  +    LK  +  + +G   G   AC    + Q  +  +Q S      + ++     +T+VF   K   +    F   + +  +S+HGD  Q  RE   + F+     +LVATS+A+RGLD+  V+ V+N  +P  ++EY+HR+GR GR G  G AV+F   E+D  L+  + LV ++   +  VP++L   A
Sbjct:  271 LSKNVSKSGYVKPTPVQKHGIPIISAGR-DLMACAQTGSGKTAAFLLP----ILQRFMTDGVAASK--FSEIQEPEAIIVAPTRELINQIYLEARKFAYGTCVRPVVVYGGINTGYTIREVLKGCNVLCATPGRLHDLIGRGKIGLSKVRYLVLDEADRMLDMGFEPEMRKLVASPGMPSKEERQTLMFSATYPEDIQRMAADFLKVDYIFLAVGVVGG---AC--SDVEQTIVQVDQYSKRDQLLELLRATGNERTMVFVETKRSADFIATFLCQEKISTTSIHGDREQREREKALSDFRLGQCPVLVATSVAARGLDIEQVQHVVNFDMPSSIDEYVHRIGRTGRCGNTGRAVSFFNPESDTPLA--RSLVKVLSGAQQVVPKWLEEVA 647          
BLAST of ATP-dependent RNA helicase DDX3X vs. Ensembl Zebrafish
Match: ddx4 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 4 [Source:ZFIN;Acc:ZDB-GENE-990415-272])

HSP 1 Score: 241.891 bits (616), Expect = 1.117e-70
Identity = 146/391 (37.34%), Postives = 221/391 (56.52%), Query Frame = 1
Query:  355 LSEVLIKSGHDQMTQIQKSTFDILNRQLLDLLGSAETGSGKTVAYLTPLLNSILKSYPEEMMASLKENSSTVQYPLILVLAPTRELVIQISKEAKKLLTFTQLRTVSVIGGADPGGQIGSIFKGCHALVATPGRLKDFIQRGLLSLKYCNKLVIDEADRMLDMGFEPQIREIMFDFDMPPVKERHTSLFSATFPNSVMSLTRTLLKPKHGKVMIGKNAGSSEACVPESINQKFILTNQGSMFRDCFKFIKENP-VKTIVFCNRKIEVETFCRFATNQCLRVSSLHGDYNQSRRESEFNFFKNNDSKILVATSIASRGLDVTDVECVINIGLPMEVEEYMHRVGRCGRMGRPGTAVTFVQ-ETDLSLSVVKDLVNMMRRTKMEVPEFLSTSA 1521
            LS+ + KSG+ + T +QK    I++    DL+  A+TGSGKT A+L P    IL+ +  + +A+ K   S +Q P  +++APTREL+ QI  EA+K    T +R V V GG + G  I  + KGC+ L ATPGRL D I RG + L     LV+DEADRMLDMGFEP++R+++    MP  +ER T +FSAT+P  +  +    LK  +  + +G   G   AC    + Q  +  +Q S      + ++     +T+VF   K   +    F   + +  +S+HGD  Q  RE   + F+     +LVATS+A+RGLD+  V+ V+N  +P  ++EY+HR+GR GR G  G AV+F   E+D  L+  + LV ++   +  VP++L   A
Sbjct:  272 LSKNVSKSGYVKPTPVQKHGIPIISAGR-DLMACAQTGSGKTAAFLLP----ILQRFMTDGVAASK--FSEIQEPEAIIVAPTRELINQIYLEARKFAYGTCVRPVVVYGGINTGYTIREVLKGCNVLCATPGRLHDLIGRGKIGLSKVRYLVLDEADRMLDMGFEPEMRKLVASPGMPSKEERQTLMFSATYPEDIQRMAADFLKVDYIFLAVGVVGG---AC--SDVEQTIVQVDQYSKRDQLLELLRATGNERTMVFVETKRSADFIATFLCQEKISTTSIHGDREQREREKALSDFRLGQCPVLVATSVAARGLDIEQVQHVVNFDMPSSIDEYVHRIGRTGRCGNTGRAVSFFNPESDTPLA--RSLVKVLSGAQQVVPKWLEEVA 648          
BLAST of ATP-dependent RNA helicase DDX3X vs. Ensembl Zebrafish
Match: ddx4 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 4 [Source:ZFIN;Acc:ZDB-GENE-990415-272])

HSP 1 Score: 241.506 bits (615), Expect = 1.199e-70
Identity = 146/391 (37.34%), Postives = 221/391 (56.52%), Query Frame = 1
Query:  355 LSEVLIKSGHDQMTQIQKSTFDILNRQLLDLLGSAETGSGKTVAYLTPLLNSILKSYPEEMMASLKENSSTVQYPLILVLAPTRELVIQISKEAKKLLTFTQLRTVSVIGGADPGGQIGSIFKGCHALVATPGRLKDFIQRGLLSLKYCNKLVIDEADRMLDMGFEPQIREIMFDFDMPPVKERHTSLFSATFPNSVMSLTRTLLKPKHGKVMIGKNAGSSEACVPESINQKFILTNQGSMFRDCFKFIKENP-VKTIVFCNRKIEVETFCRFATNQCLRVSSLHGDYNQSRRESEFNFFKNNDSKILVATSIASRGLDVTDVECVINIGLPMEVEEYMHRVGRCGRMGRPGTAVTFVQ-ETDLSLSVVKDLVNMMRRTKMEVPEFLSTSA 1521
            LS+ + KSG+ + T +QK    I++    DL+  A+TGSGKT A+L P    IL+ +  + +A+ K   S +Q P  +++APTREL+ QI  EA+K    T +R V V GG + G  I  + KGC+ L ATPGRL D I RG + L     LV+DEADRMLDMGFEP++R+++    MP  +ER T +FSAT+P  +  +    LK  +  + +G   G   AC    + Q  +  +Q S      + ++     +T+VF   K   +    F   + +  +S+HGD  Q  RE   + F+     +LVATS+A+RGLD+  V+ V+N  +P  ++EY+HR+GR GR G  G AV+F   E+D  L+  + LV ++   +  VP++L   A
Sbjct:  259 LSKNVSKSGYVKPTPVQKHGIPIISAGR-DLMACAQTGSGKTAAFLLP----ILQRFMTDGVAASK--FSEIQEPEAIIVAPTRELINQIYLEARKFAYGTCVRPVVVYGGINTGYTIREVLKGCNVLCATPGRLHDLIGRGKIGLSKVRYLVLDEADRMLDMGFEPEMRKLVASPGMPSKEERQTLMFSATYPEDIQRMAADFLKVDYIFLAVGVVGG---AC--SDVEQTIVQVDQYSKRDQLLELLRATGNERTMVFVETKRSADFIATFLCQEKISTTSIHGDREQREREKALSDFRLGQCPVLVATSVAARGLDIEQVQHVVNFDMPSSIDEYVHRIGRTGRCGNTGRAVSFFNPESDTPLA--RSLVKVLSGAQQVVPKWLEEVA 635          
BLAST of ATP-dependent RNA helicase DDX3X vs. Ensembl Xenopus
Match: ddx3x (DEAD-box helicase 3 X-linked [Source:NCBI gene;Acc:394804])

HSP 1 Score: 289.271 bits (739), Expect = 2.040e-89
Identity = 161/382 (42.15%), Postives = 232/382 (60.73%), Query Frame = 1
Query:  394 TQIQKSTFDILNRQLLDLLGSAETGSGKTVAYLTPLLNSILKSYPEEMMASLKENSST---VQYPLILVLAPTRELVIQISKEAKKLLTFTQLRTVSVIGGADPGGQIGSIFKGCHALVATPGRLKDFIQRGLLSLKYCNKLVIDEADRMLDMGFEPQIREIMFDFDMPPVKERHTSLFSATFPNSVMSLTRTLLKPKHGKVMIGKNAGSSEACVPESINQKFILT---NQGSMFRDCFKFIKENPVKTIVFCNRKIEVETFCRFATNQCLRVSSLHGDYNQSRRESEFNFFKNNDSKILVATSIASRGLDVTDVECVINIGLPMEVEEYMHRVGRCGRMGRPGTAVTFVQETDLSLSVVKDLVNMMRRTKMEVPEFLSTSA 1521
            T +QK    I+  +  DL+  A+TGSGKT A+L P+L+ I    P + M  LKEN       Q+PL LVLAPTREL +QI +EA+K    +++R   V GGAD G QI  + +GCH LVATPGRL D ++RG + L +CN LV+DEADRMLDMGFEPQIR I+    MPP   R T +FSATFP  +  L R  L  ++  + +G+   +S     E+I QK +     ++ S   D      ++ + T+VF   K   +    F  ++    +S+HGD +Q  RE   + F++  S ILVAT++A+RGLD+++V+ VIN  LP ++EEY+HR+GR GR+G  G A +F  E +  +++ KDL++++   K EVP +L   A
Sbjct:  164 TPVQKHAIPIIIEKR-DLMACAQTGSGKTAAFLLPILSQIYADGPGDAMKHLKENGRYGRRKQFPLSLVLAPTRELAVQIYEEARKFAYRSRVRPCVVYGGADIGQQIRDLERGCHLLVATPGRLVDMMERGKIGLDFCNYLVLDEADRMLDMGFEPQIRRIVEQDTMPPKGVRQTMMFSATFPKEIQILARDFLD-EYIFLAVGRVGSTS-----ENITQKVVWVEEMDKRSFLLDLLNATGKDSL-TLVFVETKKGADALEDFLYHEGYACTSIHGDRSQRDREEALHQFRSGKSPILVATAVAARGLDISNVKHVINFDLPSDIEEYVHRIGRTGRVGNLGLATSFFNEKN--INITKDLLDLLVEAKQEVPSWLENMA 535          
BLAST of ATP-dependent RNA helicase DDX3X vs. Ensembl Xenopus
Match: ddx3x (DEAD-box helicase 3 X-linked [Source:NCBI gene;Acc:394804])

HSP 1 Score: 289.271 bits (739), Expect = 2.529e-89
Identity = 161/382 (42.15%), Postives = 232/382 (60.73%), Query Frame = 1
Query:  394 TQIQKSTFDILNRQLLDLLGSAETGSGKTVAYLTPLLNSILKSYPEEMMASLKENSS---TVQYPLILVLAPTRELVIQISKEAKKLLTFTQLRTVSVIGGADPGGQIGSIFKGCHALVATPGRLKDFIQRGLLSLKYCNKLVIDEADRMLDMGFEPQIREIMFDFDMPPVKERHTSLFSATFPNSVMSLTRTLLKPKHGKVMIGKNAGSSEACVPESINQKFILT---NQGSMFRDCFKFIKENPVKTIVFCNRKIEVETFCRFATNQCLRVSSLHGDYNQSRRESEFNFFKNNDSKILVATSIASRGLDVTDVECVINIGLPMEVEEYMHRVGRCGRMGRPGTAVTFVQETDLSLSVVKDLVNMMRRTKMEVPEFLSTSA 1521
            T +QK    I+  +  DL+  A+TGSGKT A+L P+L+ I    P + M  LKEN       Q+PL LVLAPTREL +QI +EA+K    +++R   V GGAD G QI  + +GCH LVATPGRL D ++RG + L +CN LV+DEADRMLDMGFEPQIR I+    MPP   R T +FSATFP  +  L R  L  ++  + +G+   +S     E+I QK +     ++ S   D      ++ + T+VF   K   +    F  ++    +S+HGD +Q  RE   + F++  S ILVAT++A+RGLD+++V+ VIN  LP ++EEY+HR+GR GR+G  G A +F  E +  +++ KDL++++   K EVP +L   A
Sbjct:  172 TPVQKHAIPIIIEKR-DLMACAQTGSGKTAAFLLPILSQIYADGPGDAMKHLKENGRYGRRKQFPLSLVLAPTRELAVQIYEEARKFAYRSRVRPCVVYGGADIGQQIRDLERGCHLLVATPGRLVDMMERGKIGLDFCNYLVLDEADRMLDMGFEPQIRRIVEQDTMPPKGVRQTMMFSATFPKEIQILARDFLD-EYIFLAVGRVGSTS-----ENITQKVVWVEEMDKRSFLLDLLNATGKDSL-TLVFVETKKGADALEDFLYHEGYACTSIHGDRSQRDREEALHQFRSGKSPILVATAVAARGLDISNVKHVINFDLPSDIEEYVHRIGRTGRVGNLGLATSFFNEKN--INITKDLLDLLVEAKQEVPSWLENMA 543          
BLAST of ATP-dependent RNA helicase DDX3X vs. Ensembl Xenopus
Match: ddx3x (DEAD-box helicase 3 X-linked [Source:NCBI gene;Acc:394804])

HSP 1 Score: 289.656 bits (740), Expect = 3.151e-89
Identity = 161/382 (42.15%), Postives = 232/382 (60.73%), Query Frame = 1
Query:  394 TQIQKSTFDILNRQLLDLLGSAETGSGKTVAYLTPLLNSILKSYPEEMMASLKENSS---TVQYPLILVLAPTRELVIQISKEAKKLLTFTQLRTVSVIGGADPGGQIGSIFKGCHALVATPGRLKDFIQRGLLSLKYCNKLVIDEADRMLDMGFEPQIREIMFDFDMPPVKERHTSLFSATFPNSVMSLTRTLLKPKHGKVMIGKNAGSSEACVPESINQKFILT---NQGSMFRDCFKFIKENPVKTIVFCNRKIEVETFCRFATNQCLRVSSLHGDYNQSRRESEFNFFKNNDSKILVATSIASRGLDVTDVECVINIGLPMEVEEYMHRVGRCGRMGRPGTAVTFVQETDLSLSVVKDLVNMMRRTKMEVPEFLSTSA 1521
            T +QK    I+  +  DL+  A+TGSGKT A+L P+L+ I    P + M  LKEN       Q+PL LVLAPTREL +QI +EA+K    +++R   V GGAD G QI  + +GCH LVATPGRL D ++RG + L +CN LV+DEADRMLDMGFEPQIR I+    MPP   R T +FSATFP  +  L R  L  ++  + +G+   +S     E+I QK +     ++ S   D      ++ + T+VF   K   +    F  ++    +S+HGD +Q  RE   + F++  S ILVAT++A+RGLD+++V+ VIN  LP ++EEY+HR+GR GR+G  G A +F  E +  +++ KDL++++   K EVP +L   A
Sbjct:  199 TPVQKHAIPIIIEKR-DLMACAQTGSGKTAAFLLPILSQIYADGPGDAMKHLKENGRYGRRKQFPLSLVLAPTRELAVQIYEEARKFAYRSRVRPCVVYGGADIGQQIRDLERGCHLLVATPGRLVDMMERGKIGLDFCNYLVLDEADRMLDMGFEPQIRRIVEQDTMPPKGVRQTMMFSATFPKEIQILARDFLD-EYIFLAVGRVGSTS-----ENITQKVVWVEEMDKRSFLLDLLNATGKDSL-TLVFVETKKGADALEDFLYHEGYACTSIHGDRSQRDREEALHQFRSGKSPILVATAVAARGLDISNVKHVINFDLPSDIEEYVHRIGRTGRVGNLGLATSFFNEKN--INITKDLLDLLVEAKQEVPSWLENMA 570          
BLAST of ATP-dependent RNA helicase DDX3X vs. Ensembl Xenopus
Match: ddx3x (DEAD-box helicase 3 X-linked [Source:NCBI gene;Acc:394804])

HSP 1 Score: 289.656 bits (740), Expect = 4.024e-89
Identity = 161/382 (42.15%), Postives = 232/382 (60.73%), Query Frame = 1
Query:  394 TQIQKSTFDILNRQLLDLLGSAETGSGKTVAYLTPLLNSILKSYPEEMMASLKENSS---TVQYPLILVLAPTRELVIQISKEAKKLLTFTQLRTVSVIGGADPGGQIGSIFKGCHALVATPGRLKDFIQRGLLSLKYCNKLVIDEADRMLDMGFEPQIREIMFDFDMPPVKERHTSLFSATFPNSVMSLTRTLLKPKHGKVMIGKNAGSSEACVPESINQKFILT---NQGSMFRDCFKFIKENPVKTIVFCNRKIEVETFCRFATNQCLRVSSLHGDYNQSRRESEFNFFKNNDSKILVATSIASRGLDVTDVECVINIGLPMEVEEYMHRVGRCGRMGRPGTAVTFVQETDLSLSVVKDLVNMMRRTKMEVPEFLSTSA 1521
            T +QK    I+  +  DL+  A+TGSGKT A+L P+L+ I    P + M  LKEN       Q+PL LVLAPTREL +QI +EA+K    +++R   V GGAD G QI  + +GCH LVATPGRL D ++RG + L +CN LV+DEADRMLDMGFEPQIR I+    MPP   R T +FSATFP  +  L R  L  ++  + +G+   +S     E+I QK +     ++ S   D      ++ + T+VF   K   +    F  ++    +S+HGD +Q  RE   + F++  S ILVAT++A+RGLD+++V+ VIN  LP ++EEY+HR+GR GR+G  G A +F  E +  +++ KDL++++   K EVP +L   A
Sbjct:  201 TPVQKHAIPIIIEKR-DLMACAQTGSGKTAAFLLPILSQIYADGPGDAMKHLKENGRYGRRKQFPLSLVLAPTRELAVQIYEEARKFAYRSRVRPCVVYGGADIGQQIRDLERGCHLLVATPGRLVDMMERGKIGLDFCNYLVLDEADRMLDMGFEPQIRRIVEQDTMPPKGVRQTMMFSATFPKEIQILARDFLD-EYIFLAVGRVGSTS-----ENITQKVVWVEEMDKRSFLLDLLNATGKDSL-TLVFVETKKGADALEDFLYHEGYACTSIHGDRSQRDREEALHQFRSGKSPILVATAVAARGLDISNVKHVINFDLPSDIEEYVHRIGRTGRVGNLGLATSFFNEKN--INITKDLLDLLVEAKQEVPSWLENMA 572          
BLAST of ATP-dependent RNA helicase DDX3X vs. Ensembl Xenopus
Match: ddx3x (DEAD-box helicase 3 X-linked [Source:NCBI gene;Acc:394804])

HSP 1 Score: 289.271 bits (739), Expect = 8.705e-89
Identity = 161/382 (42.15%), Postives = 232/382 (60.73%), Query Frame = 1
Query:  394 TQIQKSTFDILNRQLLDLLGSAETGSGKTVAYLTPLLNSILKSYPEEMMASLKENSS---TVQYPLILVLAPTRELVIQISKEAKKLLTFTQLRTVSVIGGADPGGQIGSIFKGCHALVATPGRLKDFIQRGLLSLKYCNKLVIDEADRMLDMGFEPQIREIMFDFDMPPVKERHTSLFSATFPNSVMSLTRTLLKPKHGKVMIGKNAGSSEACVPESINQKFILT---NQGSMFRDCFKFIKENPVKTIVFCNRKIEVETFCRFATNQCLRVSSLHGDYNQSRRESEFNFFKNNDSKILVATSIASRGLDVTDVECVINIGLPMEVEEYMHRVGRCGRMGRPGTAVTFVQETDLSLSVVKDLVNMMRRTKMEVPEFLSTSA 1521
            T +QK    I+  +  DL+  A+TGSGKT A+L P+L+ I    P + M  LKEN       Q+PL LVLAPTREL +QI +EA+K    +++R   V GGAD G QI  + +GCH LVATPGRL D ++RG + L +CN LV+DEADRMLDMGFEPQIR I+    MPP   R T +FSATFP  +  L R  L  ++  + +G+   +S     E+I QK +     ++ S   D      ++ + T+VF   K   +    F  ++    +S+HGD +Q  RE   + F++  S ILVAT++A+RGLD+++V+ VIN  LP ++EEY+HR+GR GR+G  G A +F  E +  +++ KDL++++   K EVP +L   A
Sbjct:  242 TPVQKHAIPIIIEKR-DLMACAQTGSGKTAAFLLPILSQIYADGPGDAMKHLKENGRYGRRKQFPLSLVLAPTRELAVQIYEEARKFAYRSRVRPCVVYGGADIGQQIRDLERGCHLLVATPGRLVDMMERGKIGLDFCNYLVLDEADRMLDMGFEPQIRRIVEQDTMPPKGVRQTMMFSATFPKEIQILARDFLD-EYIFLAVGRVGSTS-----ENITQKVVWVEEMDKRSFLLDLLNATGKDSL-TLVFVETKKGADALEDFLYHEGYACTSIHGDRSQRDREEALHQFRSGKSPILVATAVAARGLDISNVKHVINFDLPSDIEEYVHRIGRTGRVGNLGLATSFFNEKN--INITKDLLDLLVEAKQEVPSWLENMA 613          
BLAST of ATP-dependent RNA helicase DDX3X vs. Ensembl Mouse
Match: D1Pas1 (DNA segment, Chr 1, Pasteur Institute 1 [Source:MGI Symbol;Acc:MGI:91842])

HSP 1 Score: 291.197 bits (744), Expect = 1.359e-89
Identity = 159/382 (41.62%), Postives = 233/382 (60.99%), Query Frame = 1
Query:  394 TQIQKSTFDILNRQLLDLLGSAETGSGKTVAYLTPLLNSILKSYPEEMMASLKENSST---VQYPLILVLAPTRELVIQISKEAKKLLTFTQLRTVSVIGGADPGGQIGSIFKGCHALVATPGRLKDFIQRGLLSLKYCNKLVIDEADRMLDMGFEPQIREIMFDFDMPPVKERHTSLFSATFPNSVMSLTRTLLKPKHGKVMIGKNAGSSEACVPESINQKFILTNQG---SMFRDCFKFIKENPVKTIVFCNRKIEVETFCRFATNQCLRVSSLHGDYNQSRRESEFNFFKNNDSKILVATSIASRGLDVTDVECVINIGLPMEVEEYMHRVGRCGRMGRPGTAVTFVQETDLSLSVVKDLVNMMRRTKMEVPEFLSTSA 1521
            T +QK    I+ ++  DL+  A+TGSGKT A+L P+L+ I    P E + ++KEN       QYP+ LVLAPTREL +QI +EA+K    +++R   V GGAD G QI  + +GCH LVATPGRL D ++RG + L +C  LV+DEADRMLDMGFEPQIR I+    MPP   RHT +FSATFP  +  L R  L  ++  + +G+   +S     E+I QK +   +    S   D      ++ +  +VF   K   ++   F  ++    +S+HGD +Q  RE   + F++  S ILVAT++A+RGLD+++V+ VIN  LP ++EEY+HR+GR GR+G  G A +F  E +  +++ KDL++++   K EVP +L   A
Sbjct:  203 TPVQKHAIPII-KEKRDLMACAQTGSGKTAAFLLPILSQIYTDGPGEALRAMKENGKYGRRKQYPISLVLAPTRELAVQIYEEARKFSYRSRVRPCVVYGGADIGQQIRDLERGCHLLVATPGRLVDMMERGKIGLDFCKYLVLDEADRMLDMGFEPQIRRIVEQDTMPPKGVRHTMMFSATFPKEIQMLARDFLD-EYIFLAVGRVGSTS-----ENITQKVVWVEEADKRSFLLDLLNATGKDSL-ILVFVETKKGADSLEDFLYHEGYACTSIHGDRSQRDREEALHQFRSGKSPILVATAVAARGLDISNVKHVINFDLPSDIEEYVHRIGRTGRVGNLGLATSFFNERN--INITKDLLDLLVEAKQEVPSWLENMA 574          
BLAST of ATP-dependent RNA helicase DDX3X vs. Ensembl Mouse
Match: Ddx3x (DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 3, X-linked [Source:MGI Symbol;Acc:MGI:103064])

HSP 1 Score: 290.041 bits (741), Expect = 4.301e-89
Identity = 159/382 (41.62%), Postives = 235/382 (61.52%), Query Frame = 1
Query:  394 TQIQKSTFDILNRQLLDLLGSAETGSGKTVAYLTPLLNSILKSYPEEMMASLKENSST---VQYPLILVLAPTRELVIQISKEAKKLLTFTQLRTVSVIGGADPGGQIGSIFKGCHALVATPGRLKDFIQRGLLSLKYCNKLVIDEADRMLDMGFEPQIREIMFDFDMPPVKERHTSLFSATFPNSVMSLTRTLLKPKHGKVMIGKNAGSSEACVPESINQKFILT---NQGSMFRDCFKFIKENPVKTIVFCNRKIEVETFCRFATNQCLRVSSLHGDYNQSRRESEFNFFKNNDSKILVATSIASRGLDVTDVECVINIGLPMEVEEYMHRVGRCGRMGRPGTAVTFVQETDLSLSVVKDLVNMMRRTKMEVPEFLSTSA 1521
            T +QK    I+ ++  DL+  A+TGSGKT A+L P+L+ I    P E + ++KEN       QYP+ LVLAPTREL +QI +EA+K    +++R   V GGA+ G QI  + +GCH LVATPGRL D ++RG + L +C  LV+DEADRMLDMGFEPQIR I+    MPP   RHT +FSATFP  +  L R  L  ++  + +G+   +S     E+I QK +     ++ S   D      ++ + T+VF   K   ++   F  ++    +S+HGD +Q  RE   + F++  S ILVAT++A+RGLD+++V+ VIN  LP ++EEY+HR+GR GR+G  G A +F  E +  +++ KDL++++   K EVP +L   A
Sbjct:  204 TPVQKHAIPII-KEKRDLMACAQTGSGKTAAFLLPILSQIYADGPGEALRAMKENGRYGRRKQYPISLVLAPTRELAVQIYEEARKFSYRSRVRPCVVYGGAEIGQQIRDLERGCHLLVATPGRLVDMMERGKIGLDFCKYLVLDEADRMLDMGFEPQIRRIVEQDTMPPKGVRHTMMFSATFPKEIQMLARDFLD-EYIFLAVGRVGSTS-----ENITQKVVWVEEIDKRSFLLDLLNATGKDSL-TLVFVETKKGADSLEDFLYHEGYACTSIHGDRSQRDREEALHQFRSGKSPILVATAVAARGLDISNVKHVINFDLPSDIEEYVHRIGRTGRVGNLGLATSFFNERN--INITKDLLDLLVEAKQEVPSWLENMA 575          
BLAST of ATP-dependent RNA helicase DDX3X vs. Ensembl Mouse
Match: Ddx3y (DEAD (Asp-Glu-Ala-Asp) box polypeptide 3, Y-linked [Source:MGI Symbol;Acc:MGI:1349406])

HSP 1 Score: 287.345 bits (734), Expect = 4.139e-88
Identity = 159/382 (41.62%), Postives = 233/382 (60.99%), Query Frame = 1
Query:  394 TQIQKSTFDILNRQLLDLLGSAETGSGKTVAYLTPLLNSILKSYPEEMMASLKENSS---TVQYPLILVLAPTRELVIQISKEAKKLLTFTQLRTVSVIGGADPGGQIGSIFKGCHALVATPGRLKDFIQRGLLSLKYCNKLVIDEADRMLDMGFEPQIREIMFDFDMPPVKERHTSLFSATFPNSVMSLTRTLLKPKHGKVMIGKNAGSSEACVPESINQKFILT---NQGSMFRDCFKFIKENPVKTIVFCNRKIEVETFCRFATNQCLRVSSLHGDYNQSRRESEFNFFKNNDSKILVATSIASRGLDVTDVECVINIGLPMEVEEYMHRVGRCGRMGRPGTAVTFVQETDLSLSVVKDLVNMMRRTKMEVPEFLSTSA 1521
            T +QK    I+ ++  DL+  A+TGSGKT A+L P+L+ I    P E + ++KEN       QYP+ LVLAPTREL +QI +EA+K    +++R   V GGAD   QI  + +GCH LVATPGRL D ++RG + L +C  LV+DEADRMLDMGFEPQIR I+    MPP   RHT +FSATFP  +  L R  L  ++  + +G+   +S     E+I QK +     ++ S   D      ++ + T+VF   K   ++   F   +    +S+HGD +Q  RE   + F++    ILVAT++A+RGLD+++V+ VIN  LP ++EEY+HR+GR GR+G  G A +F  E +  L++ KDL++++   K EVP +L + A
Sbjct:  203 TPVQKHAIPII-KEKRDLMACAQTGSGKTAAFLLPILSQIYTDGPGEALKAMKENGRYGRRKQYPISLVLAPTRELAVQIYEEARKFSYRSRVRPCVVYGGADTVQQIRDLERGCHLLVATPGRLVDMMERGKIGLDFCKYLVLDEADRMLDMGFEPQIRRIVEQDTMPPKGVRHTMMFSATFPKEIQMLARDFLD-EYIFLAVGRVGSTS-----ENITQKVVWVEELDKRSFLLDLLNATGKDSL-TLVFVETKKGADSLENFLFQERYACTSIHGDRSQKDREEALHQFRSGRKPILVATAVAARGLDISNVKHVINFDLPSDIEEYVHRIGRTGRVGNLGLATSFFNERN--LNITKDLLDLLVEAKQEVPSWLESMA 574          
BLAST of ATP-dependent RNA helicase DDX3X vs. Ensembl Mouse
Match: Ddx4 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 4 [Source:MGI Symbol;Acc:MGI:102670])

HSP 1 Score: 237.654 bits (605), Expect = 5.134e-69
Identity = 143/392 (36.48%), Postives = 222/392 (56.63%), Query Frame = 1
Query:  340 DLDQRLSEVLIKSGHDQMTQIQKSTFDILNRQLLDLLGSAETGSGKTVAYLTPLLNSILKSYPEEMMAS-LKENSSTVQYPLILVLAPTRELVIQISKEAKKLLTFTQLRTVSVIGGADPGGQIGSIFKGCHALVATPGRLKDFIQRGLLSLKYCNKLVIDEADRMLDMGFEPQIREIMFDFDMPPVKERHTSLFSATFPNSVMSLTRTLLKPKHGKVMIGKNAGSSEACVPESINQKFILTNQGSMFRDCFKFIKE-NPVKTIVFCNRKIEVETFCRFATNQCLRVSSLHGDYNQSRRESEFNFFKNNDSKILVATSIASRGLDVTDVECVINIGLPMEVEEYMHRVGRCGRMGRPGTAVTFVQETDLSLSVVKDLVNMMRRTKMEVPEFL 1509
            +L Q L+  + K+G+ ++T +QK +  I+     DL+  A+TGSGKT A+L P+L  +++   + + AS  KE    +Q P  +++APTREL+ QI  EA+K    T +R V + GG   G  +  I +GC+ L ATPGRL D I +  + LK    LV+DEADRMLDMGF P++++++    MP  ++R T LFSATFP  +  L    LK  +  V +G+  G   AC    + Q  +   Q S      + ++     +T+VF   K + +    F   + +  +S+HGD  Q  RE     F+     +LVATS+A+RGLD+ +V+ VIN  LP  ++EY+HR+GR GR G  G A++F  +TD    + + LV ++   + +VP +L
Sbjct:  267 NLCQTLNNNIAKAGYTKLTPVQKYSIPIV-LAGRDLMACAQTGSGKTAAFLLPILAHMMR---DGITASRFKE----LQEPECIIVAPTRELINQIYLEARKFSFGTCVRAVVIYGGTQFGHSVRQIVQGCNILCATPGRLMDIIGKEKIGLKQVKYLVLDEADRMLDMGFGPEMKKLISCPGMPSKEQRQTLLFSATFPEEIQRLAGDFLKSSYLFVAVGQVGG---AC--RDVQQTILQVGQYSKREKLVEILRNIGDERTMVFVETKKKADFIATFLCQEKISTTSIHGDREQREREQALGDFRCGKCPVLVATSVAARGLDIENVQHVINFDLPSTIDEYVHRIGRTGRCGNTGRAISFF-DTDSDNHLAQPLVKVLSDAQQDVPAWL 644          
BLAST of ATP-dependent RNA helicase DDX3X vs. Ensembl Mouse
Match: Ddx4 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 4 [Source:MGI Symbol;Acc:MGI:102670])

HSP 1 Score: 237.654 bits (605), Expect = 8.262e-69
Identity = 143/392 (36.48%), Postives = 222/392 (56.63%), Query Frame = 1
Query:  340 DLDQRLSEVLIKSGHDQMTQIQKSTFDILNRQLLDLLGSAETGSGKTVAYLTPLLNSILKSYPEEMMAS-LKENSSTVQYPLILVLAPTRELVIQISKEAKKLLTFTQLRTVSVIGGADPGGQIGSIFKGCHALVATPGRLKDFIQRGLLSLKYCNKLVIDEADRMLDMGFEPQIREIMFDFDMPPVKERHTSLFSATFPNSVMSLTRTLLKPKHGKVMIGKNAGSSEACVPESINQKFILTNQGSMFRDCFKFIKE-NPVKTIVFCNRKIEVETFCRFATNQCLRVSSLHGDYNQSRRESEFNFFKNNDSKILVATSIASRGLDVTDVECVINIGLPMEVEEYMHRVGRCGRMGRPGTAVTFVQETDLSLSVVKDLVNMMRRTKMEVPEFL 1509
            +L Q L+  + K+G+ ++T +QK +  I+     DL+  A+TGSGKT A+L P+L  +++   + + AS  KE    +Q P  +++APTREL+ QI  EA+K    T +R V + GG   G  +  I +GC+ L ATPGRL D I +  + LK    LV+DEADRMLDMGF P++++++    MP  ++R T LFSATFP  +  L    LK  +  V +G+  G   AC    + Q  +   Q S      + ++     +T+VF   K + +    F   + +  +S+HGD  Q  RE     F+     +LVATS+A+RGLD+ +V+ VIN  LP  ++EY+HR+GR GR G  G A++F  +TD    + + LV ++   + +VP +L
Sbjct:  293 NLCQTLNNNIAKAGYTKLTPVQKYSIPIV-LAGRDLMACAQTGSGKTAAFLLPILAHMMR---DGITASRFKE----LQEPECIIVAPTRELINQIYLEARKFSFGTCVRAVVIYGGTQFGHSVRQIVQGCNILCATPGRLMDIIGKEKIGLKQVKYLVLDEADRMLDMGFGPEMKKLISCPGMPSKEQRQTLLFSATFPEEIQRLAGDFLKSSYLFVAVGQVGG---AC--RDVQQTILQVGQYSKREKLVEILRNIGDERTMVFVETKKKADFIATFLCQEKISTTSIHGDREQREREQALGDFRCGKCPVLVATSVAARGLDIENVQHVINFDLPSTIDEYVHRIGRTGRCGNTGRAISFF-DTDSDNHLAQPLVKVLSDAQQDVPAWL 670          
BLAST of ATP-dependent RNA helicase DDX3X vs. UniProt/SwissProt
Match: sp|O00571|DDX3X_HUMAN (ATP-dependent RNA helicase DDX3X OS=Homo sapiens OX=9606 GN=DDX3X PE=1 SV=3)

HSP 1 Score: 293.123 bits (749), Expect = 1.947e-89
Identity = 161/385 (41.82%), Postives = 233/385 (60.52%), Query Frame = 1
Query:  394 TQIQKSTFDILNRQLLDLLGSAETGSGKTVAYLTPLLNSILKSYPEEMMASLKENSST---VQYPLILVLAPTRELVIQISKEAKKLLTFTQLRTVSVIGGADPGGQIGSIFKGCHALVATPGRLKDFIQRGLLSLKYCNKLVIDEADRMLDMGFEPQIREIMFDFDMPPVKERHTSLFSATFPNSVMSLTRTLLKPKHGKVMIGKNAGSSE------ACVPESINQKFILTNQGSMFRDCFKFIKENPVKTIVFCNRKIEVETFCRFATNQCLRVSSLHGDYNQSRRESEFNFFKNNDSKILVATSIASRGLDVTDVECVINIGLPMEVEEYMHRVGRCGRMGRPGTAVTFVQETDLSLSVVKDLVNMMRRTKMEVPEFLSTSA 1521
            T +QK    I+ ++  DL+  A+TGSGKT A+L P+L+ I    P E + ++KEN       QYP+ LVLAPTREL +QI +EA+K    +++R   V GGAD G QI  + +GCH LVATPGRL D ++RG + L +C  LV+DEADRMLDMGFEPQIR I+    MPP   RHT +FSATFP  +  L R  L  ++  + +G+   +SE        V ES  + F+L    +  +D           T+VF   K   ++   F  ++    +S+HGD +Q  RE   + F++  S ILVAT++A+RGLD+++V+ VIN  LP ++EEY+HR+GR GR+G  G A +F  E +  +++ KDL++++   K EVP +L   A
Sbjct:  204 TPVQKHAIPII-KEKRDLMACAQTGSGKTAAFLLPILSQIYSDGPGEALRAMKENGRYGRRKQYPISLVLAPTRELAVQIYEEARKFSYRSRVRPCVVYGGADIGQQIRDLERGCHLLVATPGRLVDMMERGKIGLDFCKYLVLDEADRMLDMGFEPQIRRIVEQDTMPPKGVRHTMMFSATFPKEIQMLARDFLD-EYIFLAVGRVGSTSENITQKVVWVEESDKRSFLLDLLNATGKDSL---------TLVFVETKKGADSLEDFLYHEGYACTSIHGDRSQRDREEALHQFRSGKSPILVATAVAARGLDISNVKHVINFDLPSDIEEYVHRIGRTGRVGNLGLATSFFNERN--INITKDLLDLLVEAKQEVPSWLENMA 575          
BLAST of ATP-dependent RNA helicase DDX3X vs. UniProt/SwissProt
Match: sp|Q5RF43|DDX3Y_PONAB (ATP-dependent RNA helicase DDX3Y OS=Pongo abelii OX=9601 GN=DDX3Y PE=2 SV=1)

HSP 1 Score: 291.967 bits (746), Expect = 6.407e-89
Identity = 161/385 (41.82%), Postives = 231/385 (60.00%), Query Frame = 1
Query:  394 TQIQKSTFDILNRQLLDLLGSAETGSGKTVAYLTPLLNSILKSYPEEMMASLKENSST---VQYPLILVLAPTRELVIQISKEAKKLLTFTQLRTVSVIGGADPGGQIGSIFKGCHALVATPGRLKDFIQRGLLSLKYCNKLVIDEADRMLDMGFEPQIREIMFDFDMPPVKERHTSLFSATFPNSVMSLTRTLLKPKHGKVMIGKNAGSSE------ACVPESINQKFILTNQGSMFRDCFKFIKENPVKTIVFCNRKIEVETFCRFATNQCLRVSSLHGDYNQSRRESEFNFFKNNDSKILVATSIASRGLDVTDVECVINIGLPMEVEEYMHRVGRCGRMGRPGTAVTFVQETDLSLSVVKDLVNMMRRTKMEVPEFLSTSA 1521
            T +QK    I+  +  DL+  A+TGSGKT A+L P+L+ I    P E + ++KEN       QYP+ LVLAPTREL +QI +EA+K    +++R   V GGAD G QI  + +GCH LVATPGRL D ++RG + L +C  LV+DEADRMLDMGFEPQIR I+    MPP   RHT +FSATFP  +  L R  L  ++  + +G+   +SE        V +   + F+L   G+  RD           T+VF   K   ++   F  ++    +S+HGD +Q  RE   + F++  S ILVAT++A+RGLD+++V  VIN  LP ++EEY+HR+GR GR+G  G A +F  E +  +++ KDL++++   K EVP +L   A
Sbjct:  202 TPVQKHAIPIIKGKR-DLMACAQTGSGKTAAFLLPILSQIYTDGPGEALKAVKENGRYGRRKQYPISLVLAPTRELAVQIYEEARKFSYRSRVRPCVVYGGADIGQQIRDLERGCHLLVATPGRLVDMMERGKIGLDFCKYLVLDEADRMLDMGFEPQIRRIVEQDTMPPKGVRHTMMFSATFPKEIQMLARDFLD-EYIFLAVGRVGSTSENITQKVVWVEDLDKRSFLLDLLGATGRDSL---------TLVFVETKKGADSLEDFLYHEGYACTSIHGDRSQRDREEALHQFRSGKSPILVATAVAARGLDISNVRHVINFDLPSDIEEYVHRIGRTGRVGNLGLATSFFNEKN--MNITKDLLDLLVEAKQEVPSWLENMA 573          
BLAST of ATP-dependent RNA helicase DDX3X vs. UniProt/SwissProt
Match: sp|P16381|DDX3L_MOUSE (Putative ATP-dependent RNA helicase Pl10 OS=Mus musculus OX=10090 GN=D1Pas1 PE=1 SV=1)

HSP 1 Score: 291.197 bits (744), Expect = 9.506e-89
Identity = 159/382 (41.62%), Postives = 233/382 (60.99%), Query Frame = 1
Query:  394 TQIQKSTFDILNRQLLDLLGSAETGSGKTVAYLTPLLNSILKSYPEEMMASLKENSST---VQYPLILVLAPTRELVIQISKEAKKLLTFTQLRTVSVIGGADPGGQIGSIFKGCHALVATPGRLKDFIQRGLLSLKYCNKLVIDEADRMLDMGFEPQIREIMFDFDMPPVKERHTSLFSATFPNSVMSLTRTLLKPKHGKVMIGKNAGSSEACVPESINQKFILTNQG---SMFRDCFKFIKENPVKTIVFCNRKIEVETFCRFATNQCLRVSSLHGDYNQSRRESEFNFFKNNDSKILVATSIASRGLDVTDVECVINIGLPMEVEEYMHRVGRCGRMGRPGTAVTFVQETDLSLSVVKDLVNMMRRTKMEVPEFLSTSA 1521
            T +QK    I+ ++  DL+  A+TGSGKT A+L P+L+ I    P E + ++KEN       QYP+ LVLAPTREL +QI +EA+K    +++R   V GGAD G QI  + +GCH LVATPGRL D ++RG + L +C  LV+DEADRMLDMGFEPQIR I+    MPP   RHT +FSATFP  +  L R  L  ++  + +G+   +S     E+I QK +   +    S   D      ++ +  +VF   K   ++   F  ++    +S+HGD +Q  RE   + F++  S ILVAT++A+RGLD+++V+ VIN  LP ++EEY+HR+GR GR+G  G A +F  E +  +++ KDL++++   K EVP +L   A
Sbjct:  203 TPVQKHAIPII-KEKRDLMACAQTGSGKTAAFLLPILSQIYTDGPGEALRAMKENGKYGRRKQYPISLVLAPTRELAVQIYEEARKFSYRSRVRPCVVYGGADIGQQIRDLERGCHLLVATPGRLVDMMERGKIGLDFCKYLVLDEADRMLDMGFEPQIRRIVEQDTMPPKGVRHTMMFSATFPKEIQMLARDFLD-EYIFLAVGRVGSTS-----ENITQKVVWVEEADKRSFLLDLLNATGKDSL-ILVFVETKKGADSLEDFLYHEGYACTSIHGDRSQRDREEALHQFRSGKSPILVATAVAARGLDISNVKHVINFDLPSDIEEYVHRIGRTGRVGNLGLATSFFNERN--INITKDLLDLLVEAKQEVPSWLENMA 574          
BLAST of ATP-dependent RNA helicase DDX3X vs. UniProt/SwissProt
Match: sp|Q62167|DDX3X_MOUSE (ATP-dependent RNA helicase DDX3X OS=Mus musculus OX=10090 GN=Ddx3x PE=1 SV=3)

HSP 1 Score: 290.041 bits (741), Expect = 3.009e-88
Identity = 159/382 (41.62%), Postives = 235/382 (61.52%), Query Frame = 1
Query:  394 TQIQKSTFDILNRQLLDLLGSAETGSGKTVAYLTPLLNSILKSYPEEMMASLKENSST---VQYPLILVLAPTRELVIQISKEAKKLLTFTQLRTVSVIGGADPGGQIGSIFKGCHALVATPGRLKDFIQRGLLSLKYCNKLVIDEADRMLDMGFEPQIREIMFDFDMPPVKERHTSLFSATFPNSVMSLTRTLLKPKHGKVMIGKNAGSSEACVPESINQKFILT---NQGSMFRDCFKFIKENPVKTIVFCNRKIEVETFCRFATNQCLRVSSLHGDYNQSRRESEFNFFKNNDSKILVATSIASRGLDVTDVECVINIGLPMEVEEYMHRVGRCGRMGRPGTAVTFVQETDLSLSVVKDLVNMMRRTKMEVPEFLSTSA 1521
            T +QK    I+ ++  DL+  A+TGSGKT A+L P+L+ I    P E + ++KEN       QYP+ LVLAPTREL +QI +EA+K    +++R   V GGA+ G QI  + +GCH LVATPGRL D ++RG + L +C  LV+DEADRMLDMGFEPQIR I+    MPP   RHT +FSATFP  +  L R  L  ++  + +G+   +S     E+I QK +     ++ S   D      ++ + T+VF   K   ++   F  ++    +S+HGD +Q  RE   + F++  S ILVAT++A+RGLD+++V+ VIN  LP ++EEY+HR+GR GR+G  G A +F  E +  +++ KDL++++   K EVP +L   A
Sbjct:  204 TPVQKHAIPII-KEKRDLMACAQTGSGKTAAFLLPILSQIYADGPGEALRAMKENGRYGRRKQYPISLVLAPTRELAVQIYEEARKFSYRSRVRPCVVYGGAEIGQQIRDLERGCHLLVATPGRLVDMMERGKIGLDFCKYLVLDEADRMLDMGFEPQIRRIVEQDTMPPKGVRHTMMFSATFPKEIQMLARDFLD-EYIFLAVGRVGSTS-----ENITQKVVWVEEIDKRSFLLDLLNATGKDSL-TLVFVETKKGADSLEDFLYHEGYACTSIHGDRSQRDREEALHQFRSGKSPILVATAVAARGLDISNVKHVINFDLPSDIEEYVHRIGRTGRVGNLGLATSFFNERN--INITKDLLDLLVEAKQEVPSWLENMA 575          
BLAST of ATP-dependent RNA helicase DDX3X vs. UniProt/SwissProt
Match: sp|O15523|DDX3Y_HUMAN (ATP-dependent RNA helicase DDX3Y OS=Homo sapiens OX=9606 GN=DDX3Y PE=1 SV=2)

HSP 1 Score: 290.041 bits (741), Expect = 3.399e-88
Identity = 160/382 (41.88%), Postives = 232/382 (60.73%), Query Frame = 1
Query:  394 TQIQKSTFDILNRQLLDLLGSAETGSGKTVAYLTPLLNSILKSYPEEMMASLKENSST---VQYPLILVLAPTRELVIQISKEAKKLLTFTQLRTVSVIGGADPGGQIGSIFKGCHALVATPGRLKDFIQRGLLSLKYCNKLVIDEADRMLDMGFEPQIREIMFDFDMPPVKERHTSLFSATFPNSVMSLTRTLLKPKHGKVMIGKNAGSSEACVPESINQKFILT---NQGSMFRDCFKFIKENPVKTIVFCNRKIEVETFCRFATNQCLRVSSLHGDYNQSRRESEFNFFKNNDSKILVATSIASRGLDVTDVECVINIGLPMEVEEYMHRVGRCGRMGRPGTAVTFVQETDLSLSVVKDLVNMMRRTKMEVPEFLSTSA 1521
            T +QK    I+  +  DL+  A+TGSGKT A+L P+L+ I    P E + ++KEN       QYP+ LVLAPTREL +QI +EA+K    +++R   V GGAD G QI  + +GCH LVATPGRL D ++RG + L +C  LV+DEADRMLDMGFEPQIR I+    MPP   RHT +FSATFP  +  L R  L  ++  + +G+   +S     E+I QK +     ++ S   D       + + T+VF   K   ++   F  ++    +S+HGD +Q  RE   + F++  S ILVAT++A+RGLD+++V  VIN  LP ++EEY+HR+GR GR+G  G A +F  E +  +++ KDL++++   K EVP +L   A
Sbjct:  202 TPVQKHAIPIIKGKR-DLMACAQTGSGKTAAFLLPILSQIYTDGPGEALKAVKENGRYGRRKQYPISLVLAPTRELAVQIYEEARKFSYRSRVRPCVVYGGADIGQQIRDLERGCHLLVATPGRLVDMMERGKIGLDFCKYLVLDEADRMLDMGFEPQIRRIVEQDTMPPKGVRHTMMFSATFPKEIQMLARDFLD-EYIFLAVGRVGSTS-----ENITQKVVWVEDLDKRSFLLDILGATGSDSL-TLVFVETKKGADSLEDFLYHEGYACTSIHGDRSQRDREEALHQFRSGKSPILVATAVAARGLDISNVRHVINFDLPSDIEEYVHRIGRTGRVGNLGLATSFFNEKN--MNITKDLLDLLVEAKQEVPSWLENMA 573          
BLAST of ATP-dependent RNA helicase DDX3X vs. TrEMBL
Match: A4V6K8 (Putative RNA helicase protein OS=Dugesia japonica OX=6161 PE=2 SV=1)

HSP 1 Score: 547.74 bits (1410), Expect = 0.000e+0
Identity = 276/517 (53.38%), Postives = 373/517 (72.15%), Query Frame = 1
Query:   28 MITRKFFLTRLSVTISVSRNY-NYRDNYPASRQSYGNNNQKESNDLYRTNRYNRKSHWKKNIRTIMELN*NLKAGK*----L*IFC--FKGATC*CPMW-RFAI*YLG*KINDLDQRLSEVLIKSGHDQMTQIQKSTFDILNRQLLDLLGSAETGSGKTVAYLTPLLNSILKSYPEEMMASLKENSSTVQYPLILVLAPTRELVIQISKEAKKLLTFTQLRTVSVIGGADPGGQIGSIFKGCHALVATPGRLKDFIQRGLLSLKYCNKLVIDEADRMLDMGFEPQIREIMFDFDMPPVKERHTSLFSATFPNSVMSLTRTLLKPKHGKVMIGKNAGSSEACVPESINQKFILTNQGSMFRDCFKFIKENPVKTIVFCNRKIEVETFCRFATNQCLRVSSLHGDYNQSRRESEFNFFKNNDSKILVATSIASRGLDVTDVECVINIGLPMEVEEYMHRVGRCGRMGRPGTAVTFVQETDLSLSVVKDLVNMMRRTKMEVPEFLSTSAKNVKSDNSRVD 1554
            M+ R  F ++L    S +R Y N+R+N    RQ+Y   ++  +N   +++ Y  +S W +  + ++    N+   +     + I C   K  T     W +F+      +I+D+D RLSE+L+K+GHD MTQIQK TFDILNRQL+D+LGSAETGSGKT+AYL PLLN+I+K YPEEMM  LK+N   +QYPL+LVLAPTRELV QI+  AK LL  T LR+VSVIGG D   QI    +GCHAL+ATPGRLKD   RG+ SLKYCNKLVIDEADRMLDMGFEPQIREI+   ++P V +RHTS+FSATFP SVMSL   L+KP  G++ +GKN+G++EAC+P+SI Q+FILT   S+FR+CF F++ N  KTIVFCN+K++V+ F RF+T + + ++ LHGD  Q +R+ EF+ FKNN ++ILVATS+A+RG+DV+D+ECVIN+GLP+ +++Y+HRVGRCGRMGRPG ++TFV + + S+S + D+  M+ +T  +VPEF+    KN   D S VD
Sbjct:    1 MLKRSVFQSQLLFACSATRFYQNFRNN--TYRQNYDRYSENSTN-FQKSSGYLTESKWFERTKVVINDQSNIVCNQLREHPINIVCRDIKYNT-----WDKFS------EIDDIDSRLSEILMKNGHDGMTQIQKHTFDILNRQLIDILGSAETGSGKTIAYLAPLLNNIMKHYPEEMMNELKQNDEELQYPLLLVLAPTRELVNQITSVAKTLLKLTHLRSVSVIGGVDARSQINDASRGCHALIATPGRLKDLTDRGIFSLKYCNKLVIDEADRMLDMGFEPQIREII--NNLPSVSKRHTSMFSATFPKSVMSLASKLMKPNFGEITVGKNSGTNEACIPDSIEQEFILTESDSIFRNCFDFLQNNNKKTIVFCNKKMDVDIFYRFSTKKNITIAKLHGDLTQRQRDYEFDLFKNNRTQILVATSVAARGIDVSDIECVINLGLPVNLDDYIHRVGRCGRMGRPGKSITFVDQFNPSISTLNDVRRMLEKTGKKVPEFMVEMNKN---DRSSVD 498          
BLAST of ATP-dependent RNA helicase DDX3X vs. TrEMBL
Match: T1L075 (Uncharacterized protein OS=Tetranychus urticae OX=32264 GN=107368975 PE=3 SV=1)

HSP 1 Score: 300.056 bits (767), Expect = 1.065e-89
Identity = 173/439 (39.41%), Postives = 248/439 (56.49%), Query Frame = 1
Query:  376 SGHDQMTQIQKSTFDILNRQLLDLLGSAETGSGKTVAYLTPLLNSILKSYPEEMMASLKENSSTVQYPLILVLAPTRELVIQISKEAKKLLTFTQLRTVSVIGGADPGGQIGSIFKGCHALVATPGRLKDFIQRGLLSLKYCNKLVIDEADRMLDMGFEPQIREIMFDFDMPPVKERHTSLFSATFPNSVMSLTRTLLKPKHGKVMIGKNAGSSEACVPESINQKFILTNQGSMFRDCFKFIKENPVK---------TIVFCNRKIEVETFCRFATNQCLRVSSLHGDYNQSRRESEFNFFKNNDSKILVATSIASRGLDVTDVECVINIGLPMEVEEYMHRVGRCGRMGRPGTAVTFVQETDLSLSVVKDLVNMMRRTKMEVPEFLSTSAKNVKSDNSRVDYNRFDSNNRRTIIRPFG-------DRGGFNRNMSRKN 1644
            +G+ + T +QK    ++ ++  DL+  A+TGSGKT A+L P+LN I  + P + M +++  +   QYPL LVLAPTREL +QI  EA K    + +R   V GGADP  Q+  + KGC  LVATPGRL D  +RG + L     LV+DEADRMLDMGFEPQIR I+    MPPV +R T +FSATFP  V  L R  L   +  + +G+   +S     E+I QKF    +          +    +K         T+VF   K   ++   F   +   V+S+HGD +Q  RE     FK   + ILVAT++A+RGLD+ +V+ VIN  LP ++EEY+HR+GR GR+G  GTA +F  E + +++   DLV+++   K E+PE+L+T  K+V+S+    +  ++    RR     FG       DRGG   N   +N
Sbjct:  170 AGYSRPTPVQKYAIPVILKKR-DLMACAQTGSGKTAAFLAPILNMIFVNGPPKDMPTIRSGAKIKQYPLALVLAPTRELAVQIYDEACKFAYRSCVRPCVVYGGADPVAQMRDLDKGCQVLVATPGRLVDMTERGKVGLDMVRYLVLDEADRMLDMGFEPQIRRIVLQDSMPPVGQRQTLMFSATFPKKVQELARQFLD-NYIFLAVGRVGSTS-----ENITQKFYWVAELEKRSVLLDILAAEGLKAVDSASESLTLVFVETKKGADSLETFLDREGFPVTSIHGDRSQREREDALMSFKTGRTPILVATAVAARGLDIPNVKHVINFDLPTDIEEYVHRIGRTGRVGNLGTATSFFNEKNKNMAA--DLVDLLTEAKQEIPEWLTTLGKDVQSEQRNSNQRKY--GQRRYGAGGFGSRDYRQFDRGGARSNGPSRN 597          
BLAST of ATP-dependent RNA helicase DDX3X vs. TrEMBL
Match: A0A485NYS7 (Atp-dependent rna helicase ddx3x isoform 2 OS=Lynx pardinus OX=191816 GN=LYPA_23C019600 PE=3 SV=1)

HSP 1 Score: 293.893 bits (751), Expect = 2.742e-89
Identity = 161/385 (41.82%), Postives = 234/385 (60.78%), Query Frame = 1
Query:  394 TQIQKSTFDILNRQLLDLLGSAETGSGKTVAYLTPLLNSILKSYPEEMMASLKENSST---VQYPLILVLAPTRELVIQISKEAKKLLTFTQLRTVSVIGGADPGGQIGSIFKGCHALVATPGRLKDFIQRGLLSLKYCNKLVIDEADRMLDMGFEPQIREIMFDFDMPPVKERHTSLFSATFPNSVMSLTRTLLKPKHGKVMIGKNAGSSE------ACVPESINQKFILTNQGSMFRDCFKFIKENPVKTIVFCNRKIEVETFCRFATNQCLRVSSLHGDYNQSRRESEFNFFKNNDSKILVATSIASRGLDVTDVECVINIGLPMEVEEYMHRVGRCGRMGRPGTAVTFVQETDLSLSVVKDLVNMMRRTKMEVPEFLSTSA 1521
            T +QK    I+ ++  DL+  A+TGSGKT A+L P+L+ I    P E + ++KEN       QYP+ LVLAPTREL +QI +EA+K    +++R   V GGAD G QI  + +GCH LVATPGRL D ++RG + L +C  LV+DEADRMLDMGFEPQIR I+    MPP   RHT +FSATFP  +  L R  L  ++  + +G+   +SE        V ES  + F+L    +  +D           T+VF   K   ++   F  ++    +S+HGD +Q  RE   + F++  S ILVAT++A+RGLD+++V+ VIN  LP ++EEY+HR+GR GR+G  G A +F  E +++++  KDL++++   K EVP +L   A
Sbjct:   18 TPVQKHAIPII-KEKRDLMACAQTGSGKTAAFLLPILSQIYSDGPGEALRAMKENGRYGRRKQYPISLVLAPTRELAVQIYEEARKFSYRSRVRPCVVYGGADIGQQIRDLERGCHLLVATPGRLVDMMERGKIGLDFCKYLVLDEADRMLDMGFEPQIRRIVEQDTMPPKGVRHTMMFSATFPKEIQMLARDFLD-EYIFLAVGRVGSTSENITQKVVWVEESDKRSFLLDLLNATGKDSL---------TLVFVETKKGADSLEDFLYHEGYACTSIHGDRSQRDREEALHQFRSGKSPILVATAVAARGLDISNVKHVINFDLPSDIEEYVHRIGRTGRVGNLGLATSFFNERNINIT--KDLLDLLVEAKQEVPSWLENMA 389          
BLAST of ATP-dependent RNA helicase DDX3X vs. TrEMBL
Match: A0A2R8YDT5 (ATP-dependent RNA helicase DDX3X OS=Homo sapiens OX=9606 GN=DDX3X PE=1 SV=1)

HSP 1 Score: 293.893 bits (751), Expect = 2.742e-89
Identity = 161/385 (41.82%), Postives = 234/385 (60.78%), Query Frame = 1
Query:  394 TQIQKSTFDILNRQLLDLLGSAETGSGKTVAYLTPLLNSILKSYPEEMMASLKENSST---VQYPLILVLAPTRELVIQISKEAKKLLTFTQLRTVSVIGGADPGGQIGSIFKGCHALVATPGRLKDFIQRGLLSLKYCNKLVIDEADRMLDMGFEPQIREIMFDFDMPPVKERHTSLFSATFPNSVMSLTRTLLKPKHGKVMIGKNAGSSE------ACVPESINQKFILTNQGSMFRDCFKFIKENPVKTIVFCNRKIEVETFCRFATNQCLRVSSLHGDYNQSRRESEFNFFKNNDSKILVATSIASRGLDVTDVECVINIGLPMEVEEYMHRVGRCGRMGRPGTAVTFVQETDLSLSVVKDLVNMMRRTKMEVPEFLSTSA 1521
            T +QK    I+ ++  DL+  A+TGSGKT A+L P+L+ I    P E + ++KEN       QYP+ LVLAPTREL +QI +EA+K    +++R   V GGAD G QI  + +GCH LVATPGRL D ++RG + L +C  LV+DEADRMLDMGFEPQIR I+    MPP   RHT +FSATFP  +  L R  L  ++  + +G+   +SE        V ES  + F+L    +  +D           T+VF   K   ++   F  ++    +S+HGD +Q  RE   + F++  S ILVAT++A+RGLD+++V+ VIN  LP ++EEY+HR+GR GR+G  G A +F  E +++++  KDL++++   K EVP +L   A
Sbjct:   18 TPVQKHAIPII-KEKRDLMACAQTGSGKTAAFLLPILSQIYSDGPGEALRAMKENGRYGRRKQYPISLVLAPTRELAVQIYEEARKFSYRSRVRPCVVYGGADIGQQIRDLERGCHLLVATPGRLVDMMERGKIGLDFCKYLVLDEADRMLDMGFEPQIRRIVEQDTMPPKGVRHTMMFSATFPKEIQMLARDFLD-EYIFLAVGRVGSTSENITQKVVWVEESDKRSFLLDLLNATGKDSL---------TLVFVETKKGADSLEDFLYHEGYACTSIHGDRSQRDREEALHQFRSGKSPILVATAVAARGLDISNVKHVINFDLPSDIEEYVHRIGRTGRVGNLGLATSFFNERNINIT--KDLLDLLVEAKQEVPSWLENMA 389          
BLAST of ATP-dependent RNA helicase DDX3X vs. TrEMBL
Match: A0A485NWC5 (Atp-dependent rna helicase ddx3x isoform 1 OS=Lynx pardinus OX=191816 GN=LYPA_23C019600 PE=3 SV=1)

HSP 1 Score: 293.508 bits (750), Expect = 3.382e-89
Identity = 161/385 (41.82%), Postives = 234/385 (60.78%), Query Frame = 1
Query:  394 TQIQKSTFDILNRQLLDLLGSAETGSGKTVAYLTPLLNSILKSYPEEMMASLKENSST---VQYPLILVLAPTRELVIQISKEAKKLLTFTQLRTVSVIGGADPGGQIGSIFKGCHALVATPGRLKDFIQRGLLSLKYCNKLVIDEADRMLDMGFEPQIREIMFDFDMPPVKERHTSLFSATFPNSVMSLTRTLLKPKHGKVMIGKNAGSSE------ACVPESINQKFILTNQGSMFRDCFKFIKENPVKTIVFCNRKIEVETFCRFATNQCLRVSSLHGDYNQSRRESEFNFFKNNDSKILVATSIASRGLDVTDVECVINIGLPMEVEEYMHRVGRCGRMGRPGTAVTFVQETDLSLSVVKDLVNMMRRTKMEVPEFLSTSA 1521
            T +QK    I+ ++  DL+  A+TGSGKT A+L P+L+ I    P E + ++KEN       QYP+ LVLAPTREL +QI +EA+K    +++R   V GGAD G QI  + +GCH LVATPGRL D ++RG + L +C  LV+DEADRMLDMGFEPQIR I+    MPP   RHT +FSATFP  +  L R  L  ++  + +G+   +SE        V ES  + F+L    +  +D           T+VF   K   ++   F  ++    +S+HGD +Q  RE   + F++  S ILVAT++A+RGLD+++V+ VIN  LP ++EEY+HR+GR GR+G  G A +F  E +++++  KDL++++   K EVP +L   A
Sbjct:   18 TPVQKHAIPII-KEKRDLMACAQTGSGKTAAFLLPILSQIYSDGPGEALRAMKENGRYGRRKQYPISLVLAPTRELAVQIYEEARKFSYRSRVRPCVVYGGADIGQQIRDLERGCHLLVATPGRLVDMMERGKIGLDFCKYLVLDEADRMLDMGFEPQIRRIVEQDTMPPKGVRHTMMFSATFPKEIQMLARDFLD-EYIFLAVGRVGSTSENITQKVVWVEESDKRSFLLDLLNATGKDSL---------TLVFVETKKGADSLEDFLYHEGYACTSIHGDRSQRDREEALHQFRSGKSPILVATAVAARGLDISNVKHVINFDLPSDIEEYVHRIGRTGRVGNLGLATSFFNERNINIT--KDLLDLLVEAKQEVPSWLENMA 389          
BLAST of ATP-dependent RNA helicase DDX3X vs. Ensembl Cavefish
Match: ddx3xb (DEAD-box helicase 3 X-linked b [Source:ZFIN;Acc:ZDB-GENE-980526-150])

HSP 1 Score: 283.493 bits (724), Expect = 3.908e-87
Identity = 161/383 (42.04%), Postives = 224/383 (58.49%), Query Frame = 1
Query:  394 TQIQKSTFDILNRQLLDLLGSAETGSGKTVAYLTPLLNSILKSYP-EEMMASLKENSSTVQYPLILVLAPTRELVIQISKEAKKLLTFTQLRTVSVIGGADPGGQIGSIFKGCHALVATPGRLKDFIQRGLLSLKYCNKLVIDEADRMLDMGFEPQIREIMFDFDMPPVKERHTSLFSATFPNSVMSLTRTLLKPKHGKVMIGKNAGSSE------ACVPESINQKFILTNQGSMFRDCFKFIKENPVKTIVFCNRKIEVETFCRFATNQCLRVSSLHGDYNQSRRESEFNFFKNNDSKILVATSIASRGLDVTDVECVINIGLPMEVEEYMHRVGRCGRMGRPGTAVTFVQETDLSLSVVKDLVNMMRRTKMEVPEFLSTSA 1521
            T +QK    I+  +  DL+  A+TGSGKT A+L P+L+ I    P E + A         QYPL LVLAPTREL +QI  EA+K    +++R   V GGAD G QI  + +GCH LVATPGRL D ++RG + L YCN LV+DEADRMLDMGFEPQIR I+    MPP   R T +FSATFP  +  L R  L+  +  + +G+   +SE        V ES  + F+L    +  +D           T+VF   K   +    F   +    +S+HGD +Q  RE   N F++    ILVAT++A+RGLD+++V+ VIN  LP ++EEY+HR+GR GR+G  G A +F    D + ++ KDL++++   K EVP +L + A
Sbjct:  162 TPVQKHAIPIIKTKR-DLMACAQTGSGKTAAFLLPVLSQIYTDGPGEALQAENGRYGRRKQYPLSLVLAPTRELALQIYDEARKFAYRSRVRPCVVYGGADIGQQIRDLERGCHLLVATPGRLVDMMERGKIGLDYCNYLVLDEADRMLDMGFEPQIRRIVEQDTMPPKGLRQTMMFSATFPKEIQILARDFLE-DYIFLAVGRVGSTSENITQKVVWVEESDKRSFLLDLLNATGKDSL---------TLVFVETKKGADALEDFLYREGYACTSIHGDRSQRDREEALNQFRSGRCPILVATAVAARGLDISNVKHVINFDLPSDIEEYVHRIGRTGRVGNLGLATSFF--NDKNSNITKDLLDILVEAKQEVPSWLESLA 531          
BLAST of ATP-dependent RNA helicase DDX3X vs. Ensembl Cavefish
Match: ddx3xa (DEAD-box helicase 3 X-linked [Source:NCBI gene;Acc:103040126])

HSP 1 Score: 282.722 bits (722), Expect = 1.742e-85
Identity = 171/431 (39.68%), Postives = 244/431 (56.61%), Query Frame = 1
Query:  394 TQIQKSTFDILNRQLLDLLGSAETGSGKTVAYLTPLLNSILKSYPEEMM----ASLKENSST---VQYPLILVLAPTRELVIQISKEAKKLLTFTQLRTVSVIGGADPGGQIGSIFKGCHALVATPGRLKDFIQRGLLSLKYCNKLVIDEADRMLDMGFEPQIREIMFDFDMPPVKERHTSLFSATFPNSVMSLTRTLLKPKHGKVMIGKNAGSSE------ACVPESINQKFILTNQGSMFRDCFKFIKENPVKTIVFCNRKIEVETFCRFATNQCLRVSSLHGDYNQSRRESEFNFFKNNDSKILVATSIASRGLDVTDVECVINIGLPMEVEEYMHRVGRCGRMGRPGTAVTFVQETDLSLSVVKDLVNMMRRTKMEVPEFLSTSA-----KNVKSDNSRVDYNRFDSNNRRTII---RPFGDRGGFN 1623
            T +QK    I+ +   DL+  A+TGSGKT A+L P+L+ I    P E +    AS +EN       QYP+ LVLAPTREL +QI  EA+K    +++R   V GGAD G QI  + +GCH LVATPGRL D ++RG + L YCN LV+DEADRMLDMGFEPQIR I+    MPP   R T +FSATFP  +  L R  L+ ++  + +G+   +SE        V ES  + F+L    +  +D           T+VF   K   +    F   +    +S+HGD +Q  RE   + F++    I+VAT++A+RGLD+++V+ VIN  LP ++EEY+HR+GR GR+G  G A +F    D + ++ KDL++++   K EVP +L + A     KN     S+     F + + R +      FG+RG  N
Sbjct:  292 TPVQKHAIPII-KAKRDLMACAQTGSGKTAAFLLPVLSQIYTDGPGEALQASKASGQENGKYGRRKQYPISLVLAPTRELALQIYDEARKFAYRSRVRPCVVYGGADIGQQIRDLERGCHLLVATPGRLVDMMERGKIGLDYCNYLVLDEADRMLDMGFEPQIRRIVEQDTMPPKGARQTMMFSATFPKEIQILARDFLE-EYIFLAVGRVGSTSENITQKVVWVEESDKRSFLLDLLNATGKDSL---------TLVFVETKKGADALEDFLYREGYACTSIHGDRSQRDREEALHQFRSGRCPIMVATAVAARGLDISNVKHVINFDLPSDIEEYVHRIGRTGRVGNLGLATSFY--NDKNSNITKDLLDILVEAKQEVPSWLESLAFEHQHKNSNRGRSKRFSGGFGARDYRQMSGGGNAFGNRGARN 709          
BLAST of ATP-dependent RNA helicase DDX3X vs. Ensembl Cavefish
Match: ddx3xa (DEAD-box helicase 3 X-linked [Source:NCBI gene;Acc:103040126])

HSP 1 Score: 282.337 bits (721), Expect = 3.174e-85
Identity = 171/431 (39.68%), Postives = 244/431 (56.61%), Query Frame = 1
Query:  394 TQIQKSTFDILNRQLLDLLGSAETGSGKTVAYLTPLLNSILKSYPEEMM----ASLKENSST---VQYPLILVLAPTRELVIQISKEAKKLLTFTQLRTVSVIGGADPGGQIGSIFKGCHALVATPGRLKDFIQRGLLSLKYCNKLVIDEADRMLDMGFEPQIREIMFDFDMPPVKERHTSLFSATFPNSVMSLTRTLLKPKHGKVMIGKNAGSSE------ACVPESINQKFILTNQGSMFRDCFKFIKENPVKTIVFCNRKIEVETFCRFATNQCLRVSSLHGDYNQSRRESEFNFFKNNDSKILVATSIASRGLDVTDVECVINIGLPMEVEEYMHRVGRCGRMGRPGTAVTFVQETDLSLSVVKDLVNMMRRTKMEVPEFLSTSA-----KNVKSDNSRVDYNRFDSNNRRTII---RPFGDRGGFN 1623
            T +QK    I+ +   DL+  A+TGSGKT A+L P+L+ I    P E +    AS +EN       QYP+ LVLAPTREL +QI  EA+K    +++R   V GGAD G QI  + +GCH LVATPGRL D ++RG + L YCN LV+DEADRMLDMGFEPQIR I+    MPP   R T +FSATFP  +  L R  L+ ++  + +G+   +SE        V ES  + F+L    +  +D           T+VF   K   +    F   +    +S+HGD +Q  RE   + F++    I+VAT++A+RGLD+++V+ VIN  LP ++EEY+HR+GR GR+G  G A +F    D + ++ KDL++++   K EVP +L + A     KN     S+     F + + R +      FG+RG  N
Sbjct:  321 TPVQKHAIPII-KAKRDLMACAQTGSGKTAAFLLPVLSQIYTDGPGEALQASKASGQENGKYGRRKQYPISLVLAPTRELALQIYDEARKFAYRSRVRPCVVYGGADIGQQIRDLERGCHLLVATPGRLVDMMERGKIGLDYCNYLVLDEADRMLDMGFEPQIRRIVEQDTMPPKGARQTMMFSATFPKEIQILARDFLE-EYIFLAVGRVGSTSENITQKVVWVEESDKRSFLLDLLNATGKDSL---------TLVFVETKKGADALEDFLYREGYACTSIHGDRSQRDREEALHQFRSGRCPIMVATAVAARGLDISNVKHVINFDLPSDIEEYVHRIGRTGRVGNLGLATSFY--NDKNSNITKDLLDILVEAKQEVPSWLESLAFEHQHKNSNRGRSKRFSGGFGARDYRQMSGGGNAFGNRGARN 738          
BLAST of ATP-dependent RNA helicase DDX3X vs. Ensembl Cavefish
Match: ddx3xa (DEAD-box helicase 3 X-linked [Source:NCBI gene;Acc:103040126])

HSP 1 Score: 281.182 bits (718), Expect = 3.858e-85
Identity = 175/439 (39.86%), Postives = 248/439 (56.49%), Query Frame = 1
Query:  394 TQIQKSTFDILNRQLLDLLGSAETGSGKTVAYLTPLLNSILKSYPEEMM----ASLKENSST---VQYPLILVLAPTRELVIQISKEAKKLLTFTQLRTVSVIGGADPGGQIGSIFKGCHALVATPGRLKDFIQRGLLSLKYCNKLVIDEADRMLDMGFEPQIREIMFDFDMPPVKERHTSLFSATFPNSVMSLTRTLLKPKHGKVMIGKNAGSSE------ACVPESINQKFIL-----TNQGSMFRDCFKFIKENPVK---TIVFCNRKIEVETFCRFATNQCLRVSSLHGDYNQSRRESEFNFFKNNDSKILVATSIASRGLDVTDVECVINIGLPMEVEEYMHRVGRCGRMGRPGTAVTFVQETDLSLSVVKDLVNMMRRTKMEVPEFLSTSA-----KNVKSDNSRVDYNRFDSNNRRTII---RPFGDRGGFN 1623
            T +QK    I+ +   DL+  A+TGSGKT A+L P+L+ I    P E +    AS +EN       QYP+ LVLAPTREL +QI  EA+K    +++R   V GGAD G QI  + +GCH LVATPGRL D ++RG + L YCN LV+DEADRMLDMGFEPQIR I+    MPP   R T +FSATFP  +  L R  L+ ++  + +G+   +SE        V ES  + F+L     T   S  ++      E P K   T+VF   K   +    F   +    +S+HGD +Q  RE   + F++    I+VAT++A+RGLD+++V+ VIN  LP ++EEY+HR+GR GR+G  G A +F    D + ++ KDL++++   K EVP +L + A     KN     S+     F + + R +      FG+RG  N
Sbjct:  248 TPVQKHAIPII-KAKRDLMACAQTGSGKTAAFLLPVLSQIYTDGPGEALQASKASGQENGKYGRRKQYPISLVLAPTRELALQIYDEARKFAYRSRVRPCVVYGGADIGQQIRDLERGCHLLVATPGRLVDMMERGKIGLDYCNYLVLDEADRMLDMGFEPQIRRIVEQDTMPPKGARQTMMFSATFPKEIQILARDFLE-EYIFLAVGRVGSTSENITQKVVWVEESDKRSFLLDLLNATVIPSEVQENATETPERPGKDSLTLVFVETKKGADALEDFLYREGYACTSIHGDRSQRDREEALHQFRSGRCPIMVATAVAARGLDISNVKHVINFDLPSDIEEYVHRIGRTGRVGNLGLATSFY--NDKNSNITKDLLDILVEAKQEVPSWLESLAFEHQHKNSNRGRSKRFSGGFGARDYRQMSGGGNAFGNRGARN 682          
BLAST of ATP-dependent RNA helicase DDX3X vs. Ensembl Cavefish
Match: ddx3xa (DEAD-box helicase 3 X-linked [Source:NCBI gene;Acc:103040126])

HSP 1 Score: 281.182 bits (718), Expect = 5.016e-85
Identity = 175/439 (39.86%), Postives = 248/439 (56.49%), Query Frame = 1
Query:  394 TQIQKSTFDILNRQLLDLLGSAETGSGKTVAYLTPLLNSILKSYPEEMM----ASLKENSST---VQYPLILVLAPTRELVIQISKEAKKLLTFTQLRTVSVIGGADPGGQIGSIFKGCHALVATPGRLKDFIQRGLLSLKYCNKLVIDEADRMLDMGFEPQIREIMFDFDMPPVKERHTSLFSATFPNSVMSLTRTLLKPKHGKVMIGKNAGSSE------ACVPESINQKFIL-----TNQGSMFRDCFKFIKENPVK---TIVFCNRKIEVETFCRFATNQCLRVSSLHGDYNQSRRESEFNFFKNNDSKILVATSIASRGLDVTDVECVINIGLPMEVEEYMHRVGRCGRMGRPGTAVTFVQETDLSLSVVKDLVNMMRRTKMEVPEFLSTSA-----KNVKSDNSRVDYNRFDSNNRRTII---RPFGDRGGFN 1623
            T +QK    I+ +   DL+  A+TGSGKT A+L P+L+ I    P E +    AS +EN       QYP+ LVLAPTREL +QI  EA+K    +++R   V GGAD G QI  + +GCH LVATPGRL D ++RG + L YCN LV+DEADRMLDMGFEPQIR I+    MPP   R T +FSATFP  +  L R  L+ ++  + +G+   +SE        V ES  + F+L     T   S  ++      E P K   T+VF   K   +    F   +    +S+HGD +Q  RE   + F++    I+VAT++A+RGLD+++V+ VIN  LP ++EEY+HR+GR GR+G  G A +F    D + ++ KDL++++   K EVP +L + A     KN     S+     F + + R +      FG+RG  N
Sbjct:  268 TPVQKHAIPII-KAKRDLMACAQTGSGKTAAFLLPVLSQIYTDGPGEALQASKASGQENGKYGRRKQYPISLVLAPTRELALQIYDEARKFAYRSRVRPCVVYGGADIGQQIRDLERGCHLLVATPGRLVDMMERGKIGLDYCNYLVLDEADRMLDMGFEPQIRRIVEQDTMPPKGARQTMMFSATFPKEIQILARDFLE-EYIFLAVGRVGSTSENITQKVVWVEESDKRSFLLDLLNATVIPSEVQENATETPERPGKDSLTLVFVETKKGADALEDFLYREGYACTSIHGDRSQRDREEALHQFRSGRCPIMVATAVAARGLDISNVKHVINFDLPSDIEEYVHRIGRTGRVGNLGLATSFY--NDKNSNITKDLLDILVEAKQEVPSWLESLAFEHQHKNSNRGRSKRFSGGFGARDYRQMSGGGNAFGNRGARN 702          
BLAST of ATP-dependent RNA helicase DDX3X vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003898.1 (pep scaffold:Pmarinus_7.0:GL481305:13824:21767:-1 gene:ENSPMAG00000003524.1 transcript:ENSPMAT00000003898.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 277.715 bits (709), Expect = 1.789e-86
Identity = 161/417 (38.61%), Postives = 241/417 (57.79%), Query Frame = 1
Query:  355 LSEVLIKS----GHDQMTQIQKSTFDILNRQLLDLLGSAETGSGKTVAYLTPLLNSILKSYPEEMMASLKENSSTV------QYPLILVLAPTRELVIQISKEAKKLLTFTQLRTVSVIGGADPGGQIGSIFKGCHALVATPGRLKDFIQRGLLSLKYCNKLVIDEADRMLDMGFEPQIREIMFDFDMPPVKERHTSLFSATFPNSVMSLTRTLLKPKHGKVMIGKNAGSSEACVPESINQKFILT---NQGSMFRDCFKFIKENPVKTIVFCNRKIEVETFCRFATNQCLRVSSLHGDYNQSRRESEFNFFKNNDSKILVATSIASRGLDVTDVECVINIGLPMEVEEYMHRVGRCGRMGRPGTAVTFVQETDLSLSVVKDLVNMMRRTKMEVPEFLSTSAKNVKSDNSRVDYNRF 1566
            L E+++ S     +++ T +QK    I+  +  DL+  A+TGSGKT A+L P+L+ I    P +++   K    TV      QYP+ LVLAPTREL +QI  EA+K    + +R   V GGAD G Q+  + KGCH LVATPGRL D ++RG + L +C  LV+DEADRMLDMGFEPQIR I+    MP   +R T +FSATFP  +  L R  L+  +  + +G+   +S     E+I QK +     ++ S   D       + + T+VF   K   +    F  ++    +S+HGD +Q  RE   + F+     ILVAT++A+RGLD+ +V+ VIN  LP ++EEY+HR+GR GR+G  G A +F  E + +++  ++L++++     EVP +L T A+  +S  +R    RF
Sbjct:   66 LGEIIMSSVTLCRYERPTPVQKYAIPIIKAKR-DLMACAQTGSGKTAAFLLPILSQIYSGGPGKVVEDTKNQQETVKYGQRKQYPMSLVLAPTRELALQIYDEARKFAYRSCVRPCVVYGGADIGNQVRELQKGCHLLVATPGRLVDMMERGKVGLDHCRYLVLDEADRMLDMGFEPQIRRIVEQDVMPTKGDRQTLMFSATFPKEIQILARDFLE-DYIFLAVGRVGSAS-----ENITQKVVWVEEMDKRSFLLDLLNATGRDSL-TLVFVETKKGADALQGFLCSEGYSCTSIHGDRSQRDREEALSLFRTGRRPILVATAVAARGLDIPNVKHVINFDLPSDIEEYVHRIGRTGRVGNLGQATSFYNEKNENMT--RELLHLLVEAHQEVPSWLETMAQEHRSKPARGRPKRF 472          
BLAST of ATP-dependent RNA helicase DDX3X vs. Ensembl Sea Lamprey
Match: ddx23 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 23 [Source:ZFIN;Acc:ZDB-GENE-030131-6215])

HSP 1 Score: 201.83 bits (512), Expect = 1.711e-56
Identity = 136/403 (33.75%), Postives = 197/403 (48.88%), Query Frame = 1
Query:  343 LDQRLSEVLIKSGHDQMTQIQKSTFDILNRQLLDLLGSAETGSGKTVAYLTPLLNSILKSYPEEMMASLKENSSTVQYPLILVLAPTRELVIQISKEAKKLLTFTQLRTVSVIGGADPGGQIGSIFKGCHALVATPGRLKDFIQRGLLSLKYCNKLVIDEADRMLDMGFEPQIREIM----------------------FDFDMPPVKERHTSLFSATFPNSVMSLTRTLLKPKHGKVMIGKNAGSSEACVPESINQKFILTNQGSMFRDCFKFIK---ENPVKTIVFCNRKIEVETFCRFATNQCLRVSSLHGDYNQSRRESEFNFFKNNDSKILVATSIASRGLDVTDVECVINIGLPMEVEEYMHRVGRCGRMGRPGTAVTFVQETDLSLSVVKDLVNMM 1476
            L   + EV+ K G+   T IQ+    I   Q  D++G AETGSGKT A+L PLL  I        +  +     T Q P  ++LAPTREL  QI +E  K      +RTV+VIGG     Q   +  GC  ++ATPGRL D ++   L L  C  +V+DEADRM+DMGFEP ++ I+                       +F+    K R T +F+AT P +V  L R+ L+ +   V IG     S     E + Q+  +  +    +   + +    E P+  I+F N+K   +   +          +LHG   Q +RE   +  K     ILVAT +A RG+D+ DV  V+N  +   +E+Y HR+GR GR G+ G +VTF+ + D   +V  DL   M
Sbjct:  327 LPSHIREVIEKCGYKDPTPIQRQAIPI-GLQNRDIIGIAETGSGKTAAFLIPLLVWIT------TLPKIDRIEDTDQGPYAVILAPTRELAQQIEEETIKFGKPLGIRTVAVIGGISREDQGFRLRMGCKIVIATPGRLIDVLENRYLVLSRCTYVVLDEADRMIDMGFEPDVQRILEHMPVSNQKPDTDDAEDPDKMTANFESGRHKYRQTVMFTATMPAAVERLARSYLR-RPAVVYIG-----SVGKPIERVEQRVFIMGESEKRKKLLELLSRGFEPPI--IIFVNQKKGCDVLAKSLEKMGFNACTLHGGKGQEQREFALSNLKAGAKDILVATDVAGRGIDIHDVSMVLNYDMAKNIEDYTHRIGRTGRAGKSGVSVTFLTKED--AAVFYDLKQAM 712          
BLAST of ATP-dependent RNA helicase DDX3X vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000216.1 (pep scaffold:Pmarinus_7.0:GL476721:117971:126978:-1 gene:ENSPMAG00000000186.1 transcript:ENSPMAT00000000216.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 185.652 bits (470), Expect = 5.010e-53
Identity = 129/371 (34.77%), Postives = 193/371 (52.02%), Query Frame = 1
Query:  355 LSEVLIKSGHDQMTQIQKSTFDILNRQLLDLLGSAETGSGKTVAYLTPLLNSILKSYPEEMMASLKENSSTVQYPLILVLAPTRELVIQISKEAKKLLTFTQLRTVSVIGGADPGGQIGSIFKGCHALVATPGRLKDFIQR----GLLSLKYCNKLVIDEADRMLDMGFEPQIREIMFDFDMPPVKERHTSLFSATFPNSVMSLTRTLLKPKHGKVMIGKNAGSSEACVPESINQKFILTNQGSMFRDCFKFIKENPVKT---IVFCNRKIEVETFCRFATNQCLRVSSLHGDYNQSRRESEFNFFKNNDSKILVATSIASRGLDVTDVECVINIGLPMEVEEYMHRVGRCGRMGRPGTAVTFVQETDLSL 1446
            L E   + G  Q T+IQ     +   Q  D++G AETGSGKT A+  P+L ++L + P+ + A              LVL PTREL  QIS++ + L +   +++  V+GG D   Q  ++ K  H ++ATPGRL D ++      + +LKY   LV+DEADR+L+M FE ++ +I+    + P KER T LFSAT    V  L R  LK         K + S++    E + Q ++     + F+D +     N +     I+FC+     +       N       LHG  +Q++R    N FK     IL+AT +ASRGLD+  V+ VIN  +P   ++Y+HRVGR  R GR G ++TFV + D+ L
Sbjct:    6 LCEACEQLGWKQPTKIQVEAIPV-ALQGKDIIGLAETGSGKTGAFALPILQALLDA-PQRLFA--------------LVLTPTRELAFQISEQFEALGSSIGIKSAVVVGGIDMMSQSLALAKKPHVIIATPGRLVDHLENTKGFNIRALKY---LVMDEADRILNMDFETEVDKIL---KVIP-KERKTYLFSATMTKKVQKLQRAALKEPV------KCSVSTKYQTVEKLQQYYVFIP--AKFKDSYLVYILNELAGNSFIIFCSTCNNTQRIALLLRNLGFTAIPLHGQMSQNKRLGSLNKFKGKARSILLATDVASRGLDIPHVDVVINFDIPTHSKDYIHRVGRTARAGRSGKSITFVSQYDVEL 345          
BLAST of ATP-dependent RNA helicase DDX3X vs. Ensembl Sea Lamprey
Match: ddx46 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 46 [Source:NCBI gene;Acc:321948])

HSP 1 Score: 194.126 bits (492), Expect = 5.276e-53
Identity = 120/336 (35.71%), Postives = 183/336 (54.46%), Query Frame = 1
Query:  442 DLLGSAETGSGKTVAYLTPLLNSILKSYPEEMMASLKENSSTVQYPLILVLAPTRELVIQISKEAKKLLTFTQLRTVSVIGGADPGGQIGSIFKGCHALVATPGRLKDFIQRG---LLSLKYCNKLVIDEADRMLDMGFEPQIREIMFDFDMPPVKERHTSLFSATFPNSVMSLTRTLLKPKHGKVMIGKNAGSSEACVPESINQKFILTNQGSMFRDCFKFIK--ENPVKTIVFCNRKIEVETFCR---FATNQCLRVSSLHGDYNQSRRESEFNFFKNNDSKILVATSIASRGLDVTDVECVINIGLPMEVEEYMHRVGRCGRMGRPGTAVTFV 1425
            DL+G A+TGSGKT+ +L P+   ++   P      L+E       P+ +++ PTREL +QI+KE +K      LR V V GG     QI  + +G   +V TPGR+ D +      + + +    +V+DEADRM DMGFEPQ+  I+ +   P   +R T +FSATFP ++ +L R +L  K  +V +G   G S  C    + Q  I+  + + F    + +   +     IVF +++   +T  +    A+  CL   SLHG  +Q  R+S  N FK+   +++VATS+A+RGLDV  +  V+N   P   E+Y+HRVGR GR G  G + TF+
Sbjct:  408 DLIGIAKTGSGKTIGFLLPMFRHVMDQRP------LEEGEG----PIGVIMTPTRELALQIAKECRKFTKQLALRVVCVYGGTGISEQIAELKRGAEIIVCTPGRMIDMLAANSGRVTNFRRATYMVLDEADRMFDMGFEPQVMRII-ETSRP---DRQTVMFSATFPRAMEALARRILN-KPVEVQVG---GRSVVC--SDVEQHVIVIEEDTKFYKLLELLGLYQEKGAVIVFVDKQEHADTLLKDLMKASYPCL---SLHGGIDQYDRDSIINDFKSGVCRLMVATSVAARGLDVKHLIMVVNYDCPNHYEDYVHRVGRTGRAGNKGYSYTFI 720          
BLAST of ATP-dependent RNA helicase DDX3X vs. Ensembl Sea Lamprey
Match: ddx42 (DEAD (Asp-Glu-Ala-Asp) box helicase 42 [Source:ZFIN;Acc:ZDB-GENE-050706-53])

HSP 1 Score: 172.555 bits (436), Expect = 3.681e-46
Identity = 126/388 (32.47%), Postives = 191/388 (49.23%), Query Frame = 1
Query:  343 LDQRLSEVLIKSGHDQMTQIQKSTFDILNRQLLDLLGSAETGSGKTVAYLTPLLNSILKSYPEEMMASLKENSSTVQYPLILVLAPTRELVIQISKEAKKLLTFTQLRTVSVIGGADPGGQIGSIFKGCHALVATPGRLKDFIQRGLLSLKYCNKLVIDEADRMLDMGFEPQIREIMFDFDMPPVKERHTSLFSATFPNSVMSLTRTLL-KPKHGKVMIGKNAGSSEACVPESINQKFILTNQGSMFRDCFKFIKE--NPVKTIVFCNRKIEVETFCRFATNQCLRVSSLHGDYNQSRRESEFNFFKNNDSKILVATSIASRGLDVTDVECVINIGLPMEVEEYMHRVGRCGRMGRPGTAVTFVQETDLSLSVVKDLVNMMRRTKMEV 1497
             D++L  ++ KS   Q T IQ     I      D++G A+TGSGKT +++ P+L  I+          LK        P+ L+  PTREL  QI+ E K+      L +V+V GG     Q  ++ +G   +V TPGRL D +++   +L+    LV DEADRM DMGFE Q+R I          +R T L+SATF   V  L R +L  P   +V+ G + G +   V + +    I +N  + +      + E  +    ++F  RK   E        +  +V  LHGD +QS R    + FK     I+VAT +A+RGLD+  ++ V+N  +  +++ + HRVGR GR G  GTA T +   D++ +   DLV  +      V
Sbjct:  256 FDEQLLNLIRKSEFTQPTPIQCQGIPIA-LSGRDIIGIAKTGSGKTASFIWPMLVHIM------AQKELKPGDG----PIGLICVPTRELCQQINVECKRFGKAYNLHSVAVYGGGSMWEQAKALQEGAEIVVCTPGRLIDHVKKKATNLQRVTYLVFDEADRMFDMGFEYQVRSIANHV----RPDRQTMLYSATFRMRVEKLARDILIDPI--RVVQG-DIGEANEDVTQRVE---IFSNGAAKWNWLCSHLVEFTSSGSVLIFVTRKDNSEELSNDLEQEGFQVGLLHGDMDQSERNKVISDFKKKVIPIMVATDVAARGLDIPSIKTVVNYDVARDIDTHTHRVGRTGRAGEKGTAFTLMTHKDMNFA--GDLVRNLEGANQHV 620          
BLAST of ATP-dependent RNA helicase DDX3X vs. Ensembl Yeast
Match: DBP1 (Putative ATP-dependent RNA helicase of the DEAD-box protein family; mutants show reduced stability of the 40S ribosomal subunit scanning through 5' untranslated regions of mRNAs; protein abundance increases in response to DNA replication stress; DBP1 has a paralog, DED1, that arose from the whole genome duplication [Source:SGD;Acc:S000006040])

HSP 1 Score: 266.544 bits (680), Expect = 1.536e-81
Identity = 168/459 (36.60%), Postives = 246/459 (53.59%), Query Frame = 1
Query:  343 LDQRLSEVLIKSGHDQMTQIQKSTFDILNRQLLDLLGSAETGSGKTVAYLTPLLNSILKSYPEEMMASLKENSSTVQYPLILVLAPTRELVIQISKEAKKLLTFTQLRTVSVIGGADPGGQIGSIFKGCHALVATPGRLKDFIQRGLLSLKYCNKLVIDEADRMLDMGFEPQIREIMFDFDMPPVKERHTSLFSATFPNSVMSLTRTLLKPKHGKVMIGKNAGSSEACVPESINQKFILT---NQGSMFRDCFKFIKENPVKTIVFCNRKIEVETFCRFATNQCLRVSSLHGDYNQSRRESEFNFFKNNDSKILVATSIASRGLDVTDVECVINIGLPMEVEEYMHRVGRCGRMGRPGTAVTFVQETDLSLSVVKDLVNMMRRTKMEVPEFLSTSAK---------------NVKSDNSRVDYNRFDSNNRRTIIRP-------FGDRGGFNRNMSRKN 1644
            LD+ L E +  +   + T +QK +  I+ +   DL+  A+TGSGKT  +L PL   + +S P  +    +   S   YP  LVLAPTREL  QI +EA+K    + +R   V GGA  G Q+  + +GC  LVATPGRL D ++RG +SL     LV+DEADRMLDMGFEPQIR I+ + DMP V+ R T +FSATFP  +  L R  L   +  + +G+   +S     E+I Q+ +     ++ S   D      E+   T++F   K   +    F   Q  + +++HGD  Q+ RE   + FK N + ILVAT++A+RGLD+ +V  VIN  LP ++++Y+HR+GR GR G  G A +F    +   ++VK L+ ++     EVP FLS  ++               N +++ SR DY +   N      RP       +G  GG  RN + KN
Sbjct:  161 LDELLMENIKLASFTKPTPVQKYSIPIVTKGR-DLMACAQTGSGKTGGFLFPLFTELFRSGPSPVPEKAQSFYSRKGYPSALVLAPTRELATQIFEEARKFTYRSWVRPCVVYGGAPIGNQMREVDRGCDLLVATPGRLNDLLERGKVSLANIKYLVLDEADRMLDMGFEPQIRHIVEECDMPSVENRQTLMFSATFPVDIQHLARDFLD-NYIFLSVGRVGSTS-----ENITQRILYVDDMDKKSALLDLLS--AEHKGLTLIFVETKRMADQLTDFLIMQNFKATAIHGDRTQAERERALSAFKANVADILVATAVAARGLDIPNVTHVINYDLPSDIDDYVHRIGRTGRAGNTGVATSFFNSNN--QNIVKGLMEILNEANQEVPTFLSDLSRQNSRGGRTRGGGGFFNSRNNGSR-DYRKHGGNGSFGSTRPRNTGTSNWGSIGGGFRNDNEKN 607          
BLAST of ATP-dependent RNA helicase DDX3X vs. Ensembl Yeast
Match: DED1 (ATP-dependent DEAD (Asp-Glu-Ala-Asp)-box RNA helicase; required for translation initiation of all yeast mRNAs; binds to mRNA cap-associated factors, and binding stimulates Ded1p RNA-dependent ATPase activity; mutation in human homolog DBY is associated with male infertility; human homolog DDX3X complements ded1 null mutation; DED1 has a paralog, DBP1, that arose from the whole genome duplication [Source:SGD;Acc:S000005730])

HSP 1 Score: 255.758 bits (652), Expect = 1.051e-77
Identity = 163/435 (37.47%), Postives = 231/435 (53.10%), Query Frame = 1
Query:  343 LDQRLSEVLIKSGHDQMTQIQKSTFDILNRQLLDLLGSAETGSGKTVAYLTPLLNSILKSYPEEMMASLKENSSTVQYPLILVLAPTRELVIQISKEAKKLLTFTQLRTVSVIGGADPGGQIGSIFKGCHALVATPGRLKDFIQRGLLSLKYCNKLVIDEADRMLDMGFEPQIREIMFDFDMPPVKERHTSLFSATFPNSVMSLTRTLLKPKHGKVMIGKNAGSSEACVPESINQKFILT---NQGSMFRDCFKFIKENPVKTIVFCNRKIEVETFCRFATNQCLRVSSLHGDYNQSRRESEFNFFKNNDSKILVATSIASRGLDVTDVECVINIGLPMEVEEYMHRVGRCGRMGRPGTAVTFVQETDLSLSVVKDLVNMMRRTKMEVPEFLSTSAKNVKSDNSRVDYNRFDSNNRRTIIRPFGDRGGFNRNMSR 1638
            LD  L E +  +   + T +QK +  I+     DL+  A+TGSGKT  +L P+L+   K+ P     S         YP  +++APTREL  QI  EAKK    + ++   V GG+  G Q+  I +GC  LVATPGRL D ++RG +SL     LV+DEADRMLDMGFEPQIR I+ D DM PV ER T +FSATFP  +  L R  L   +  + +G+   +S     E+I QK +     ++ S   D      +    T++F   K   +    F   Q  R +++HGD  QS RE     F++  + +LVAT++A+RGLD+ +V  VIN  LP +V++Y+HR+GR GR G  G A  F    +   ++VK L  ++     EVP FL  +   + +  SR       SN+R         RGGF RN +R
Sbjct:  149 LDGLLLENIKLARFTKPTPVQKYSVPIVANGR-DLMACAQTGSGKTGGFLFPVLSESFKTGPSPQPESQGSFYQRKAYPTAVIMAPTRELATQIFDEAKKFTYRSWVKACVVYGGSPIGNQLREIERGCDLLVATPGRLNDLLERGKISLANVKYLVLDEADRMLDMGFEPQIRHIVEDCDMTPVGERQTLMFSATFPADIQHLARDFLS-DYIFLSVGRVGSTS-----ENITQKVLYVENQDKKSALLDLLSASTDG--LTLIFVETKRMADQLTDFLIMQNFRATAIHGDRTQSERERALAAFRSGAATLLVATAVAARGLDIPNVTHVINYDLPSDVDDYVHRIGRTGRAGNTGLATAFFNSEN--SNIVKGLHEILTEANQEVPSFLKDAM--MSAPGSR-------SNSR---------RGGFGRNNNR 554          
BLAST of ATP-dependent RNA helicase DDX3X vs. Ensembl Yeast
Match: DBP2 (ATP-dependent RNA helicase of the DEAD-box protein family; has strong preference for dsRNA; interacts with YRA1; required for assembly of Yra1p, Nab2p and Mex67p onto mRNA and formation of nuclear mRNP; involved in mRNA decay and rRNA processing; may be involved in suppression of transcription from cryptic initiation sites [Source:SGD;Acc:S000005056])

HSP 1 Score: 207.223 bits (526), Expect = 5.252e-60
Identity = 127/360 (35.28%), Postives = 190/360 (52.78%), Query Frame = 1
Query:  442 DLLGSAETGSGKTVAYLTPLLNSILKSYPEEMMASLKENSSTVQYPLILVLAPTRELVIQISKEAKKLLTFTQLRTVSVIGGADPGGQIGSIFKGCHALVATPGRLKDFIQRGLLSLKYCNKLVIDEADRMLDMGFEPQIREIMFDFDMPPVKERHTSLFSATFPNSVMSLTRTLLKPKHGKVMIGKNAGSSEACVPESINQKFILTNQGSMFRDCFKFI----KENPVKTIVFCNRKIEVETFCRFATNQCLRVSSLHGDYNQSRRESEFNFFKNNDSKILVATSIASRGLDVTDVECVINIGLPMEVEEYMHRVGRCGRMGRPGTAVTFVQETDLSLSVVKDLVNMMRRTKMEVPEFL 1509
            D++G A TGSGKT++Y  P    I+    + ++A           P++LVLAPTREL +QI  E  K    +++R   V GG     QI  + +G   ++ATPGRL D ++ G  +LK    LV+DEADRMLDMGFEPQIR+I+ D   P   +R T ++SAT+P  V  L    L        I    GS E     +I Q   + +         K++    ++N  KT++F + K   +   ++         ++HGD +Q  R+     F+N  S I+VAT +A+RG+DV  +  VIN  +P  +E+Y+HR+GR GR G  GTA++F  E +  L     L+++MR     +P  L
Sbjct:  152 DMVGIAATGSGKTLSYCLP---GIVHINAQPLLAPGDG-------PIVLVLAPTRELAVQIQTECSKFGHSSRIRNTCVYGGVPKSQQIRDLSRGSEIVIATPGRLIDMLEIGKTNLKRVTYLVLDEADRMLDMGFEPQIRKIV-DQIRP---DRQTLMWSATWPKEVKQLAADYLNDP-----IQVQVGSLELSASHNITQIVEVVSDFEKRDRLNKYLETASQDNEYKTLIFASTKRMCDDITKYLREDGWPALAIHGDKDQRERDWVLQEFRNGRSPIMVATDVAARGIDVKGINYVINYDMPGNIEDYVHRIGRTGRAGATGTAISFFTEQNKGLGA--KLISIMREANQNIPPEL 490          
BLAST of ATP-dependent RNA helicase DDX3X vs. Ensembl Yeast
Match: PRP28 (RNA binding protein; involved in RNA isomerization at the 5' splice site and for exchange of U6 for U1 snRNA at the 5' splice site; similar to the RNA helicases of the DEAD-box family [Source:SGD;Acc:S000002651])

HSP 1 Score: 194.126 bits (492), Expect = 7.196e-55
Identity = 130/392 (33.16%), Postives = 206/392 (52.55%), Query Frame = 1
Query:  394 TQIQKSTF-DILN-RQLLDLLGSAETGSGKTVAYLTPLLNSILKSYPEEMMASLKENSSTVQYPLILVLAPTRELVIQISKEAKKLLTFTQ------LRTVSVIGGADPGGQIGSIFKGCHALVATPGRLKDFIQRGLLSLKYCNKLVIDEADRMLDMGFEPQIREIM--FDFDMPPVKERHTSLFSATFPNSVMSLTRTLL-KPKHGKVMIGKNAGSSEACVPESINQKFI--LTNQGSMFRDCFKFIKENPVKTIVFCNRKIEVETFC-RFATNQCLRVSSLHGDYNQSRRESEFNFFKNNDSKILVATSIASRGLDVTDVECVINIGLPMEVEEYMHRVGRCGRMGRPGTAVTFVQETDLSLSVVKDLVNMMRRTKMEVPEFLSTSAKN 1527
            T IQ+ T  ++ N +Q  D LG A TGSGKT+A++ P+L  + +S P     SLK     +  P  L+LAPTRELV QI KE +K+            + +S++GG        S+ +GC  LVATPGRL D ++  LL +K    LV+DEAD+M+D+GFE Q+  I+   D +      R T +F+AT    +  +    + KP +    IG   GS      E + Q+ +    N    F+     + +     I+F N K   +    +F     ++V+ LHG  +Q +RE     F+ N  +I++AT++A+RGLD+ +V  V+N  +  ++++Y+HR+GR GR    GTAV+FV   +   S++++L   +R+         S + KN
Sbjct:  198 TPIQRITIPNVCNMKQYRDFLGVASTGSGKTLAFVIPILIKMSRSPPRP--PSLK----IIDGPKALILAPTRELVQQIQKETQKVTKIWSKESNYDCKVISIVGGHSLEEISFSLSEGCDILVATPGRLIDSLENHLLVMKQVETLVLDEADKMIDLGFEDQVTNILTKVDINADSAVNRQTLMFTATMTPVIEKIAAGYMQKPVYA--TIGVETGS------EPLIQQVVEYADNDEDKFKKLKPIVAKYDPPIIIFINYKQTADWLAEKFQKETNMKVTILHGSKSQEQREHSLQLFRTNKVQIMIATNVAARGLDIPNVSLVVNFQISKKMDDYIHRIGRTGRAANEGTAVSFVSAAE-DESLIRELYKYVRKHDPLNSNIFSEAVKN 574          
BLAST of ATP-dependent RNA helicase DDX3X vs. Ensembl Yeast
Match: DBP3 (RNA-Dependent ATPase, member of DExD/H-box family; involved in cleavage of site A3 within the ITS1 spacer during rRNA processing; not essential for growth, but deletion causes severe slow-growth phenotype [Source:SGD;Acc:S000003046])

HSP 1 Score: 182.185 bits (461), Expect = 4.221e-51
Identity = 123/362 (33.98%), Postives = 184/362 (50.83%), Query Frame = 1
Query:  442 DLLGSAETGSGKTVAYLTPLLNSILKSYPEEMMASLKENSSTVQYPLILVLAPTRELVIQISKEAKKLLTFTQLRTVSVIGGADPGGQIGSIFKGCHALVATPGRLKDFIQRGLLSLKYCNKLVIDEADRMLDMGFEPQIREIMFDFDMPPVKERHTSLFSATFPNSVMSLTRTLLKPKHGKVMIGKNAGSSEACVPESINQKFILTNQGSMFRDCFKFIKE------NPVKTIVFCNRKIEVETFCRFATNQCLRVSSLHGDYNQSRRESEFNFFKNNDSKILVATSIASRGLDVTDVECVINIGLPMEVEEYMHRVGRCGRMGRPGTAVTFVQETDLSLSVVKDLVNMMRRTKMEVPEFL 1509
            D++G AETGSGKT A+  P ++ ++            +    +Q   +LV++PTREL  QI      L     ++   V GG  P  +     K    +VATPGRL D +Q G + L   N LV+DEADRML+ GFE  I+ I+ + D     +R T +F+AT+P  V  L  T +     KV IG    + +    + I Q   + +     R   + +K+         K ++F   K E     R        V+++HGD +Q +R    N FK+  S +L+AT +A+RGLD+ +V+ VIN+  P+ VE+Y+HR+GR GR G+ GTA T   E +  L+    LVN++      VPE L
Sbjct:  151 DVVGVAETGSGKTFAFGVPAISHLMND----------QKKRGIQ---VLVISPTRELASQIYDNLIVLTDKVGMQCCCVYGGV-PKDEQRIQLKKSQVVVATPGRLLDLLQEGSVDLSQVNYLVLDEADRMLEKGFEEDIKNIIRETD---ASKRQTLMFTATWPKEVRELASTFMN-NPIKVSIG---NTDQLTANKRITQIVEVVDPRGKERKLLELLKKYHSGPKKNEKVLIFALYKKEAARVERNLKYNGYNVAAIHGDLSQQQRTQALNEFKSGKSNLLLATDVAARGLDIPNVKTVINLTFPLTVEDYVHRIGRTGRAGQTGTAHTLFTEQEKHLA--GGLVNVLNGANQPVPEDL 489          
BLAST of ATP-dependent RNA helicase DDX3X vs. Ensembl Nematostella
Match: PL10 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SM49])

HSP 1 Score: 262.692 bits (670), Expect = 3.147e-79
Identity = 155/403 (38.46%), Postives = 224/403 (55.58%), Query Frame = 1
Query:  346 DQRLSEVLIK----SGHDQMTQIQKSTFDILNRQLLDLLGSAETGSGKTVAYLTPLLNSILKSYPEEMMASLKENSSTVQYPLILVLAPTRELVIQISKEAKKLLTFTQLRTVSVIGGADPGGQIGSIFKGCHALVATPGRLKDFIQRGLLSLKYCNKLVIDEADRMLDMGFEPQIREIMFDFDMPPVKERHTSLFSATFPNSVMSLTRTLLKPKHGKVMIGKNAGSSEACVPESINQKFILTNQGSMFRDCFKFIKENPVK--TIVFCNRKIEVETFCRFATNQCLRVSSLHGDYNQSRRESEFNFFKNNDSKILVATSIASRGLDVTDVECVINIGLPMEVEEYMHRVGRCGRMGRPGTAVTFVQETDLSLSVVKDLVNMMRRTKMEVPEFLSTSAKNVKS 1536
            D  L E+L+     +G+ + T +QK    I+  +  DL+  A+TGSGKT A+L P+L+ I    P      +K      QYP+ LVLAPTREL +QI  EA+K    +  R   V GGAD G Q+  + + CH LVATPGRL D + RG + L     LV+DEADRMLDMGFEPQIR I+    MP    R T +FSATFP  +  L R  L+  +  + +GK   +S     E+I QK +  ++          +  +  +  T+VF   K   +    F        +S+HGD +Q  RE     F+  D+ ILVAT++A+RGLD+ +V+ VIN  LP ++EEY+HR+GR GR+G  G A +F    +   +V K+L++++  +K E+P +L + A    S
Sbjct:  196 DVDLGEILLHNVGLAGYKKPTPVQKYAIPIVKGKR-DLMACAQTGSGKTAAFLIPILSRIYMEGPP-APPDIKHAGRRRQYPICLVLAPTRELAVQIFDEARKFSYRSLCRPCVVYGGADIGSQLRELDRNCHLLVATPGRLVDMMDRGRVGLDSIRFLVLDEADRMLDMGFEPQIRRIVDQDSMPKTGIRQTLMFSATFPKEIQMLARDFLE-NYIFLAVGKVGSTS-----ENITQKVVWVDEFDKRSFLLDLLNASGPQQLTLVFVETKKGADALEMFLAKDGYYCTSIHGDRSQREREEALRTFRCGDTPILVATAVAARGLDIPNVKHVINFDLPTDIEEYVHRIGRTGRVGHTGLATSFFNHKN--KNVAKELMDILEESKQEIPSWLESMAYEASS 588          
BLAST of ATP-dependent RNA helicase DDX3X vs. Ensembl Nematostella
Match: VAS1 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJG3])

HSP 1 Score: 224.557 bits (571), Expect = 4.689e-68
Identity = 132/361 (36.57%), Postives = 197/361 (54.57%), Query Frame = 1
Query:  448 LGSAETGSGKTVAYLTPLLNSILKSYPEEMMASLKENSSTVQYPLILVLAPTRELVIQISKEAKKLLTFTQLRTVSVIGGADPGGQIGSIFKGCHALVATPGRLKDFIQRGLLSLKYCNKLVIDEADRMLDMGFEPQIREIMFDFDMPPVKERHTSLFSATFPNSVMSLTRTLLKPKHGKVMIGKNAGSSEACVPESINQKFILTNQGSMFRDCFKFI--KENPVKTIVFCNRKIEVETFCRFATNQCLRVSSLHGDYNQSRRESEFNFFKNNDSKILVATSIASRGLDVTDVECVINIGLPMEVEEYMHRVGRCGRMGRPGTAVTFVQETDLSLSVVKDLVNMMRRTKMEVPEFLSTSAK 1524
            +  A+TGSGKT AY+ P+L S++K          +  ++  + PL L +APTREL  QI  EA+K    T ++     GG     Q   + +GCH LV TPGRL+DF+ R  + L     L++DEADRMLD+GF P I +++ + +M   + R T +FSATFP+ +  L  + LKP +  + +G+  G++       I Q  I  N GS  RD    I       +T+VF   K   +    + +      +S+  D  QS RE+    F++  + ILVATS+A+RGLD+ +V+ VIN  LP ++EEY+HRVGR GR+G  G A  F  E      + + LV ++     EVP +L  +A+
Sbjct:    1 MACAQTGSGKTAAYMLPVLTSLIK----------QGLNAPPRSPLALCVAPTRELAKQIYIEARKFSDHTPIKVCVCYGGVSVPYQASQLERGCHFLVGTPGRLQDFVSREKIYLGSIQHLILDEADRMLDLGFGPDIHKLIEESNMTAKESRQTLMFSATFPDEIQHLAGSFLKPDYLFLAVGRVGGTN-----LDITQHVITVN-GSEKRDKLHEILSATGTDRTLVFVELKRVADFLAAWLSQNNFPTTSISSDRCQSEREAALRDFRDGRANILVATSVAARGLDIPNVKHVINYDLPQDIEEYVHRVGRTGRIGNEGKATAFY-EVGRDDRLARSLVKVLSEALQEVPAWLDEAAE 344          
BLAST of ATP-dependent RNA helicase DDX3X vs. Ensembl Nematostella
Match: EDO43602 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RYA5])

HSP 1 Score: 209.149 bits (531), Expect = 1.065e-58
Identity = 133/382 (34.82%), Postives = 196/382 (51.31%), Query Frame = 1
Query:  361 EVLIKSGHDQMTQIQKSTFDILNRQLLDLLGSAETGSGKTVAYLTPLLNSILKSYPEEMMASLKENSSTVQYPLILVLAPTRELVIQISKEAKKLLTFTQLRTVSVIGGADPGGQIGSIFKGCHALVATPGRLKDFIQRGLLSLKYCNKLVIDEADRMLDMGFEPQIREIMFDFDMPPVKE--------------------RHTSLFSATFPNSVMSLTRTLLKPKHGKVMIGKNAGSSEACVPESINQKFILTNQGSMFRDCFKFIK---ENPVKTIVFCNRKIEVETFCRFATNQCLRVSSLHGDYNQSRRESEFNFFKNNDSKILVATSIASRGLDVTDVECVINIGLPMEVEEYMHRVGRCGRMGRPGTAVTFVQETD 1437
            E++ K G+   T IQ+    I   Q  D++G AETGSGKT A+  PLL  I+       +  ++ ++   Q P  L+LAPTREL  QI +E  K      +RTVSVIGG     Q   +  G   ++ATPGRL D ++   L L  C+ +V+DEADRM+DMGFEP++++I+    +  VK                     R T +F+AT P  V  L +  L+ +   V IG     S     E + Q+  L N+    +   + +    E P+  I+F N+K   +   +       R ++LHG  NQ +RE   +  K     ILVAT +A RG+D+ DV  VIN  +   +E+Y HR+GR GR G+ G AV+F+ ++D
Sbjct:  363 EIVDKLGYKDPTPIQRQAIPI-GLQNRDIIGVAETGSGKTAAFAIPLLVWIMG------LPKIERDNDADQGPYALILAPTRELAQQIEEEILKFGRPLGIRTVSVIGGLSREDQGFQLRLGVEIVIATPGRLIDVLENRYLVLNRCSYIVMDEADRMIDMGFEPEVQKILEHLPVSNVKPDSEDSEDPEHLLTHMGKDKYRQTVMFTATMPPQVERLAKNYLR-RPAVVYIG-----SVGKPVERVEQRVYLVNEQQKRKKLLELLNKDLEPPI--IIFVNQKKGADVLAKSLEKMGFRATTLHGGRNQEQREFALSSLKGGSKDILVATDVAGRGIDIKDVSHVINYDMAKTIEDYTHRIGRTGRAGKTGIAVSFLTQSD 729          
BLAST of ATP-dependent RNA helicase DDX3X vs. Ensembl Nematostella
Match: EDO42894 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S034])

HSP 1 Score: 199.904 bits (507), Expect = 2.037e-55
Identity = 130/389 (33.42%), Postives = 201/389 (51.67%), Query Frame = 1
Query:  352 RLSEVLIKSGHDQMTQIQKSTFDILNRQLLDLLGSAETGSGKTVAYLTPLLNSILKSYPEEMMASLKENSSTVQYPLILVLAPTRELVIQISKEAKKLLTFTQLRTVSVIGGADPGGQIGSIFKGCHALVATPGRLKDFIQRG---LLSLKYCNKLVIDEADRMLDMGFEPQIREIMFDFDMPPVKERHTSLFSATFPNSVMSLTRTLLKPKHGKVMIGKNAGSSEACVPESINQKFILTNQGSMFRDCFKFIK--ENPVKTIVFCNRKIEVETFCRFATNQCLRVSSLHGDYNQSRRESEFNFFKNNDSKILVATSIASRGLDVTDVECVINIGLPMEVEEYMHRVGRCGRMGRPGTAVTFVQETDLSLSVVKDLVNMMRRTKMEVPE 1503
            ++ +VL K+ +++ T IQ     ++     D++G A+TGSGKT+A+L P+   I    P E              P+ +V+ PTREL IQI +E KK      LR V V GG     QI  + +G   +V TPGR+ D +      + + + C  LV+DEADRM DMGFEPQ+  I+ D   P   +R T +FSATFP  + +L R +L  K  ++ +G   G S  C    + Q  ++  +   F    + +   +     +VF  ++   ++  +    +     SLHG  +Q  R+S    FKN  +K+++ATS+A+RGLDV  +  V+N   P   E+Y+HRVGR GR G  GTA TF+       ++  D++  +   +  VPE
Sbjct:  147 KILDVLKKNSYEKPTPIQAQAIPVIMSGR-DMIGIAKTGSGKTLAFLIPMFRHIKDQPPLEREEG----------PIAIVMTPTRELAIQIHRECKKFCKPNNLRCVCVYGGTGISEQIAELKRGAEIIVCTPGRMIDMLTANNGRVTNCQRCTYLVLDEADRMFDMGFEPQVMRII-DCIRP---DRQTVMFSATFPRQMEALARKILD-KPIEIQVG---GRSVVC--SDVEQNVVVIEEDDKFLKLLELLGLYQEQGSVLVFVEKQDSADSLFKDLLKRSYPCLSLHGGMDQFDRDSTIADFKNGVTKLMIATSVAARGLDVKHLNLVVNYDCPNHYEDYVHRVGRTGRAGNKGTAYTFLTPEQGRFAI--DVIKALEMAENPVPE 512          
BLAST of ATP-dependent RNA helicase DDX3X vs. Ensembl Nematostella
Match: EDO49247 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGX3])

HSP 1 Score: 190.66 bits (483), Expect = 4.513e-54
Identity = 121/374 (32.35%), Postives = 198/374 (52.94%), Query Frame = 1
Query:  442 DLLGSAETGSGKTVAYLTPLLNSILKSYPEEMMASLKENSSTVQYPLILVLAPTREL------VIQISKEAKKLLTFTQLRTVSVIGGADPGGQIGSIFKGCHALVATPGRLKDFIQRGLLSLKYCNKLVIDEADRMLDMGFEPQIREIMFDFDMPPVKERHTSLFSATFPNSVMSLTRT-LLKPKHGKVMIGKNAGSSEACVPESINQKFILTNQGSMFRDCFKFIKENPVKTIVFCNRKIEVETFCRFATNQCLRVSSLHGDYNQSRRESEFNFFKNNDSKILVATSIASRGLDVTDVECVINIGLPMEVEEYMHRVGRCGRMGRPGTAVTFVQETDLSLSVVKDLVNMMRRTKMEVPEFLSTSAKNVKSDN 1542
            D++G A TGSGKT+ +  P+   I+ S  +E     + N      P  +++ P+REL      VI     A +   F  LRT   IGG+    Q  ++ +G H +VATPGRL D + + +++L  C  LV+DEADRM+DMGFE  +R I   F      +R T LFSAT P  + +  ++ L+KP      +  N G + A   + I Q+     Q +      + +++ P   ++F  +K +V+    +   + +   ++HGD +Q  R      F   +  +LVAT +AS+GLD  D++ VIN  +P ++E Y+HR+GR GR G+ G A TF+ ++    SV+ DL +++   K ++     T A++++ DN
Sbjct:   86 DMIGIAFTGSGKTLVFTLPI---IMFSLEQEKAMPFQRNEG----PYGMIVVPSRELARQTFEVITHFSRALEAHGFPSLRTNLCIGGSSIKEQSDAMKRGVHMVVATPGRLMDLLDKRIITLDVCRYLVLDEADRMIDMGFEEDVRTIFSYFK----SQRQTLLFSATMPKKIQNFAKSALVKP------VTVNVGRAGAASLDVI-QEVEYVKQEAKVVYLLECLQKTPPPVLIFAEKKSDVDDIHEYLLLKGVEAVAIHGDKSQEERVHAIREFHQGNKDVLVATDVASKGLDFPDIQHVINFDMPEDIENYVHRIGRTGRCGKTGVATTFINKS-CEESVLLDLKHLLMEAKQKI-----TRARSLQVDN 435          
BLAST of ATP-dependent RNA helicase DDX3X vs. Ensembl Medaka
Match: ddx3xa (DEAD-box helicase 3 X-linked [Source:NCBI gene;Acc:101158982])

HSP 1 Score: 284.648 bits (727), Expect = 4.874e-87
Identity = 163/405 (40.25%), Postives = 236/405 (58.27%), Query Frame = 1
Query:  382 HDQMTQIQKSTFDILNRQLLDLLGSAETGSGKTVAYLTPLLNSILKSYPEEMMASLKENSST-------VQYPLILVLAPTRELVIQISKEAKKLLTFTQLRTVSVIGGADPGGQIGSIFKGCHALVATPGRLKDFIQRGLLSLKYCNKLVIDEADRMLDMGFEPQIREIMFDFDMPPVKERHTSLFSATFPNSVMSLTRTLLKPKHGKVMIGKNAGSSEACVPESINQKFIL---TNQGSMFRDCFKFIKENPVKTIVFCNRKIEVETFCRFATNQCLRVSSLHGDYNQSRRESEFNFFKNNDSKILVATSIASRGLDVTDVECVINIGLPMEVEEYMHRVGRCGRMGRPGTAVTFVQETDLSLSVVKDLVNMMRRTKMEVPEFLSTSAKNVKSDNSRVDYNRF 1566
            +D+ T +QK    I+  +  DL+  A+TGSGKT A+L P+L+ I    P + + + K N           QYPL LVLAPTREL +QI  EA+K    +++R   V GGAD G QI  + +GCH LVATPGRL D ++RG + L YCN LV+DEADRMLDMGFEPQIR I+    MPP   R T +FSATFP  +  L R  L+  +  + +G+   +S     E+I QK +     ++ S   D      ++ + T+VF   K   +    F   +    +S+HGD +Q  RE   + F++    ILVAT++A+RGLD+++V+ VIN  LP ++EEY+HR+GR GR+G  G A +F    D + ++ KDL++++   K EVP +L + A   +  +S     RF
Sbjct:  217 YDRPTPVQKYAIPIIKTKR-DLMACAQTGSGKTAAFLLPVLSQIYSDGPGDALQAAKNNGQDNGRYGRRKQYPLSLVLAPTRELALQIYDEARKFAYRSRVRPCVVYGGADIGQQIRELERGCHLLVATPGRLVDMMERGKIGLDYCNYLVLDEADRMLDMGFEPQIRRIVEQDTMPPKGIRQTMMFSATFPKEIQILARDFLE-DYIFLAVGRVGSTS-----ENITQKVVWVEDNDKRSFLLDLLNATGKDSL-TLVFVETKKGADALEDFLYREGYACTSIHGDRSQRDREEALHQFRSGHCPILVATAVAARGLDISNVKHVINFDLPSDIEEYVHRIGRTGRVGNLGLATSFF--NDKNSNITKDLLDILVEAKQEVPSWLESLAYEHQHKSSTRGRKRF 611          
BLAST of ATP-dependent RNA helicase DDX3X vs. Ensembl Medaka
Match: ddx3xa (DEAD-box helicase 3 X-linked [Source:NCBI gene;Acc:101158982])

HSP 1 Score: 281.952 bits (720), Expect = 1.456e-86
Identity = 162/399 (40.60%), Postives = 234/399 (58.65%), Query Frame = 1
Query:  382 HDQMTQIQKSTFDILNRQLLDLLGSAETGSGKTVAYLTPLLNSILKSYP-EEMMASLKENSSTVQYPLILVLAPTRELVIQISKEAKKLLTFTQLRTVSVIGGADPGGQIGSIFKGCHALVATPGRLKDFIQRGLLSLKYCNKLVIDEADRMLDMGFEPQIREIMFDFDMPPVKERHTSLFSATFPNSVMSLTRTLLKPKHGKVMIGKNAGSSEACVPESINQKFILT---NQGSMFRDCFKFIKENPVKTIVFCNRKIEVETFCRFATNQCLRVSSLHGDYNQSRRESEFNFFKNNDSKILVATSIASRGLDVTDVECVINIGLPMEVEEYMHRVGRCGRMGRPGTAVTFVQETDLSLSVVKDLVNMMRRTKMEVPEFLSTSAKNVKSDNSRVDYNRF 1566
            +D+ T +QK    I+  +  DL+  A+TGSGKT A+L P+L+ I    P + + A         QYPL LVLAPTREL +QI  EA+K    +++R   V GGAD G QI  + +GCH LVATPGRL D ++RG + L YCN LV+DEADRMLDMGFEPQIR I+    MPP   R T +FSATFP  +  L R  L+  +  + +G+   +S     E+I QK +     ++ S   D      ++ + T+VF   K   +    F   +    +S+HGD +Q  RE   + F++    ILVAT++A+RGLD+++V+ VIN  LP ++EEY+HR+GR GR+G  G A +F    D + ++ KDL++++   K EVP +L + A   +  +S     RF
Sbjct:  169 YDRPTPVQKYAIPIIKTKR-DLMACAQTGSGKTAAFLLPVLSQIYSDGPGDALQADNGRYGRRKQYPLSLVLAPTRELALQIYDEARKFAYRSRVRPCVVYGGADIGQQIRELERGCHLLVATPGRLVDMMERGKIGLDYCNYLVLDEADRMLDMGFEPQIRRIVEQDTMPPKGIRQTMMFSATFPKEIQILARDFLE-DYIFLAVGRVGSTS-----ENITQKVVWVEDNDKRSFLLDLLNATGKDSL-TLVFVETKKGADALEDFLYREGYACTSIHGDRSQRDREEALHQFRSGHCPILVATAVAARGLDISNVKHVINFDLPSDIEEYVHRIGRTGRVGNLGLATSFF--NDKNSNITKDLLDILVEAKQEVPSWLESLAYEHQHKSSTRGRKRF 557          
BLAST of ATP-dependent RNA helicase DDX3X vs. Ensembl Medaka
Match: ddx3xa (DEAD-box helicase 3 X-linked [Source:NCBI gene;Acc:101158982])

HSP 1 Score: 284.263 bits (726), Expect = 1.469e-86
Identity = 163/405 (40.25%), Postives = 236/405 (58.27%), Query Frame = 1
Query:  382 HDQMTQIQKSTFDILNRQLLDLLGSAETGSGKTVAYLTPLLNSILKSYPEEMMASLKENSST-------VQYPLILVLAPTRELVIQISKEAKKLLTFTQLRTVSVIGGADPGGQIGSIFKGCHALVATPGRLKDFIQRGLLSLKYCNKLVIDEADRMLDMGFEPQIREIMFDFDMPPVKERHTSLFSATFPNSVMSLTRTLLKPKHGKVMIGKNAGSSEACVPESINQKFIL---TNQGSMFRDCFKFIKENPVKTIVFCNRKIEVETFCRFATNQCLRVSSLHGDYNQSRRESEFNFFKNNDSKILVATSIASRGLDVTDVECVINIGLPMEVEEYMHRVGRCGRMGRPGTAVTFVQETDLSLSVVKDLVNMMRRTKMEVPEFLSTSAKNVKSDNSRVDYNRF 1566
            +D+ T +QK    I+  +  DL+  A+TGSGKT A+L P+L+ I    P + + + K N           QYPL LVLAPTREL +QI  EA+K    +++R   V GGAD G QI  + +GCH LVATPGRL D ++RG + L YCN LV+DEADRMLDMGFEPQIR I+    MPP   R T +FSATFP  +  L R  L+  +  + +G+   +S     E+I QK +     ++ S   D      ++ + T+VF   K   +    F   +    +S+HGD +Q  RE   + F++    ILVAT++A+RGLD+++V+ VIN  LP ++EEY+HR+GR GR+G  G A +F    D + ++ KDL++++   K EVP +L + A   +  +S     RF
Sbjct:  253 YDRPTPVQKYAIPIIKTKR-DLMACAQTGSGKTAAFLLPVLSQIYSDGPGDALQAAKNNGQDNGRYGRRKQYPLSLVLAPTRELALQIYDEARKFAYRSRVRPCVVYGGADIGQQIRELERGCHLLVATPGRLVDMMERGKIGLDYCNYLVLDEADRMLDMGFEPQIRRIVEQDTMPPKGIRQTMMFSATFPKEIQILARDFLE-DYIFLAVGRVGSTS-----ENITQKVVWVEDNDKRSFLLDLLNATGKDSL-TLVFVETKKGADALEDFLYREGYACTSIHGDRSQRDREEALHQFRSGHCPILVATAVAARGLDISNVKHVINFDLPSDIEEYVHRIGRTGRVGNLGLATSFF--NDKNSNITKDLLDILVEAKQEVPSWLESLAYEHQHKSSTRGRKRF 647          
BLAST of ATP-dependent RNA helicase DDX3X vs. Ensembl Medaka
Match: ddx3xa (DEAD-box helicase 3 X-linked [Source:NCBI gene;Acc:101158982])

HSP 1 Score: 281.182 bits (718), Expect = 7.540e-86
Identity = 165/416 (39.66%), Postives = 239/416 (57.45%), Query Frame = 1
Query:  382 HDQMTQIQKSTFDILNRQLLDLLGSAETGSGKTVAYLTPLLNSILKSYPEEMMASLKENSST-------VQYPLILVLAPTRELVIQISKEAKKLLTFTQLRTVSVIGGADPGGQIGSIFKGCHALVATPGRLKDFIQRGLLSLKYCNKLVIDEADRMLDMGFEPQIREIMFDFDMPPVKERHTSLFSATFPNSVMSLTRTLLKPKHGKVMIGKNAGSSE------ACVPESINQKFILT--NQGSMFRDCFKFIKENPVK------TIVFCNRKIEVETFCRFATNQCLRVSSLHGDYNQSRRESEFNFFKNNDSKILVATSIASRGLDVTDVECVINIGLPMEVEEYMHRVGRCGRMGRPGTAVTFVQETDLSLSVVKDLVNMMRRTKMEVPEFLSTSAKNVKSDNSRVDYNRF 1566
            +D+ T +QK    I+  +  DL+  A+TGSGKT A+L P+L+ I    P + + + K N           QYPL LVLAPTREL +QI  EA+K    +++R   V GGAD G QI  + +GCH LVATPGRL D ++RG + L YCN LV+DEADRMLDMGFEPQIR I+    MPP   R T +FSATFP  +  L R  L+  +  + +G+   +SE        V ++  + F+L   N   +  +  + I E+  K      T+VF   K   +    F   +    +S+HGD +Q  RE   + F++    ILVAT++A+RGLD+++V+ VIN  LP ++EEY+HR+GR GR+G  G A +F    D + ++ KDL++++   K EVP +L + A   +  +S     RF
Sbjct:  180 YDRPTPVQKYAIPIIKTKR-DLMACAQTGSGKTAAFLLPVLSQIYSDGPGDALQAAKNNGQDNGRYGRRKQYPLSLVLAPTRELALQIYDEARKFAYRSRVRPCVVYGGADIGQQIRELERGCHLLVATPGRLVDMMERGKIGLDYCNYLVLDEADRMLDMGFEPQIRRIVEQDTMPPKGIRQTMMFSATFPKEIQILARDFLE-DYIFLAVGRVGSTSENITQKVVWVEDNDKRSFLLDLLNATVIPSEVQESITESTEKIGKDSLTLVFVETKKGADALEDFLYREGYACTSIHGDRSQRDREEALHQFRSGHCPILVATAVAARGLDISNVKHVINFDLPSDIEEYVHRIGRTGRVGNLGLATSFF--NDKNSNITKDLLDILVEAKQEVPSWLESLAYEHQHKSSTRGRKRF 591          
BLAST of ATP-dependent RNA helicase DDX3X vs. Ensembl Medaka
Match: ddx3xa (DEAD-box helicase 3 X-linked [Source:NCBI gene;Acc:101158982])

HSP 1 Score: 281.182 bits (718), Expect = 1.098e-85
Identity = 165/416 (39.66%), Postives = 239/416 (57.45%), Query Frame = 1
Query:  382 HDQMTQIQKSTFDILNRQLLDLLGSAETGSGKTVAYLTPLLNSILKSYPEEMMASLKENSST-------VQYPLILVLAPTRELVIQISKEAKKLLTFTQLRTVSVIGGADPGGQIGSIFKGCHALVATPGRLKDFIQRGLLSLKYCNKLVIDEADRMLDMGFEPQIREIMFDFDMPPVKERHTSLFSATFPNSVMSLTRTLLKPKHGKVMIGKNAGSSE------ACVPESINQKFILT--NQGSMFRDCFKFIKENPVK------TIVFCNRKIEVETFCRFATNQCLRVSSLHGDYNQSRRESEFNFFKNNDSKILVATSIASRGLDVTDVECVINIGLPMEVEEYMHRVGRCGRMGRPGTAVTFVQETDLSLSVVKDLVNMMRRTKMEVPEFLSTSAKNVKSDNSRVDYNRF 1566
            +D+ T +QK    I+  +  DL+  A+TGSGKT A+L P+L+ I    P + + + K N           QYPL LVLAPTREL +QI  EA+K    +++R   V GGAD G QI  + +GCH LVATPGRL D ++RG + L YCN LV+DEADRMLDMGFEPQIR I+    MPP   R T +FSATFP  +  L R  L+  +  + +G+   +SE        V ++  + F+L   N   +  +  + I E+  K      T+VF   K   +    F   +    +S+HGD +Q  RE   + F++    ILVAT++A+RGLD+++V+ VIN  LP ++EEY+HR+GR GR+G  G A +F    D + ++ KDL++++   K EVP +L + A   +  +S     RF
Sbjct:  200 YDRPTPVQKYAIPIIKTKR-DLMACAQTGSGKTAAFLLPVLSQIYSDGPGDALQAAKNNGQDNGRYGRRKQYPLSLVLAPTRELALQIYDEARKFAYRSRVRPCVVYGGADIGQQIRELERGCHLLVATPGRLVDMMERGKIGLDYCNYLVLDEADRMLDMGFEPQIRRIVEQDTMPPKGIRQTMMFSATFPKEIQILARDFLE-DYIFLAVGRVGSTSENITQKVVWVEDNDKRSFLLDLLNATVIPSEVQESITESTEKIGKDSLTLVFVETKKGADALEDFLYREGYACTSIHGDRSQRDREEALHQFRSGHCPILVATAVAARGLDISNVKHVINFDLPSDIEEYVHRIGRTGRVGNLGLATSFF--NDKNSNITKDLLDILVEAKQEVPSWLESLAYEHQHKSSTRGRKRF 611          
BLAST of ATP-dependent RNA helicase DDX3X vs. Planmine SMEST
Match: SMESG000046974.1 (SMESG000046974.1)

HSP 1 Score: 963.37 bits (2489), Expect = 0.000e+0
Identity = 489/591 (82.74%), Postives = 506/591 (85.62%), Query Frame = 1
Query:   28 MITRKFFLTRLSVTISVSRNYNYRDNYPASRQSYGNNNQKESNDLYRTNRYNR---------------------------KSHWKKNIR-----------TIMELN*NLKAGK*L*IFCFKGATC*CPMW-RFAI*YLG*KINDLDQRLSEVLIKSGHDQMTQIQKSTFDILNRQLLDLLGSAETGSGKTVAYLTPLLNSILKSYPEEMMASLKENSSTVQYPLILVLAPTRELVIQISKEAKKLLTFTQLRTVSVIGGADPGGQIGSIFKGCHALVATPGRLKDFIQRGLLSLKYCNKLVIDEADRMLDMGFEPQIREIMFDFDMPPVKERHTSLFSATFPNSVMSLTRTLLKPKHGKVMIGKNAGSSEACVPESINQKFILTNQGSMFRDCFKFIKENPVKTIVFCNRKIEVETFCRFATNQCLRVSSLHGDYNQSRRESEFNFFKNNDSKILVATSIASRGLDVTDVECVINIGLPMEVEEYMHRVGRCGRMGRPGTAVTFVQETDLSLSVVKDLVNMMRRTKMEVPEFLSTSAKNVKSDNSRVDYNRFDSNNRRTIIRPFGDRGGFNRNMSRKNFKDEQDDFDRFMR 1683
            M+ RK  L+RL +  SV  NY++R+NY  +RQ  G NN++ SND YRTN YNR                           +S W + I            TI E   N++ G       +K       +W +F+       INDLDQRLSEVLIKSGHDQMTQIQKSTFDILNRQLLDLLGSAETGSGKTVAYLTPLLNSILKSYPEEMMASLKENSSTVQYPLILVLAPTRELVIQISKEAKKLLTFTQLRTVSVIGGADPGGQIGSIFKGCHALVATPGRLKDFIQRGLLSLKYCNKLVIDEADRMLDMGFEPQIREIMFDFDMPPVKERHTSLFSATFPNSVMSLTRTLLKPKHGKVMIGKNAGSSEACVPESINQKFILTNQGSMFRDCFKFIKENPVKTIVFCNRKIEVETFCRFATNQCLRVSSLHGDYNQSRRESEFNFFKNNDSKILVATSIASRGLDVTDVECVINIGLPMEVEEYMHRVGRCGRMGRPGTAVTFVQETDLSLSVVKDLVNMMRRTKMEVPEFLSTSAKNVKSDNSRVDYNRFDSNNRRTIIRPFGDRGGFNRNMSRKNFKDEQDDFDRFMR
Sbjct:    1 MLARKILLSRLPLNFSVICNYSFRENYADTRQFNGYNNRRNSNDRYRTNNYNRNQKPFESNNSDRYKIEQRSGGSGGYLTQSQWSERIDSNFIINKSESFTIKEQPINIECGN----LEYK-------IWDKFS------DINDLDQRLSEVLIKSGHDQMTQIQKSTFDILNRQLLDLLGSAETGSGKTVAYLTPLLNSILKSYPEEMMASLKENSSTVQYPLILVLAPTRELVIQISKEAKKLLTFTQLRTVSVIGGADPGGQIGSIFKGCHALVATPGRLKDFIQRGLLSLKYCNKLVIDEADRMLDMGFEPQIREIMFDFDMPPVKERHTSLFSATFPNSVMSLTRTLLKPKHGKVMIGKNAGSSEACVPESINQKFILTNQGSMFRDCFKFIKENPVKTIVFCNRKIEVETFCRFATNQCLRVSSLHGDYNQSRRESEFNFFKNNDSKILVATSIASRGLDVTDVECVINIGLPMEVEEYMHRVGRCGRMGRPGTAVTFVQETDLSLSVVKDLVNMMRRTKMEVPEFLSTSAKNVKSDNSRVDYNRFDSNNRRTIIRPFGDRGGFNRNMSRKNFKDEQDDFDRFMR 574          
BLAST of ATP-dependent RNA helicase DDX3X vs. Planmine SMEST
Match: SMESG000046953.1 (SMESG000046953.1)

HSP 1 Score: 482.641 bits (1241), Expect = 1.443e-169
Identity = 236/267 (88.39%), Postives = 247/267 (92.51%), Query Frame = 1
Query:  841 MGFEPQIREIMFDFDMPPVKERHTSLFSATFPNSVMSLTRTLLKPKHGKVMIGKNAGSSEACVPESINQKFILTNQGSMFRDCFKFIKENPVKTIVFCNRKIEVETFCRFATNQCLRVSSLHGDYNQSRRESEFNFFKNNDSKILVATSIASRGLDVTDVECVINIGLPMEVEEYMHRVGRCGRMGRPGTAVTFVQETDLSLSVVKDLVNMMRRTKMEVPEFLSTSAKNVKSDNSRVDYNRFDSNNRRTIIRPFGDRGGFNRNMSRK 1641
            MGFEPQIREIMFDFDMPPVKERHTSLFSATFPNSVMSL RTLLKPKHGK+M+GKNAGSSEACVPESINQKFILTNQGSMFRDCFKFIKE+PVKTIVFCNRK EVETFCRFAT Q LRVSSLHGDYN SR ESEFN FKNNDS ILV TSIASRGLDVTDVECVINIGLP EVEEYMHRVGRCGR+GRPGTAVTFV+ETDLSLSVVKDLVNMMRRTKMEVPEFLSTSAKN+KSDNS     RFD+N+ +TIIRPFG + GF RN +RK
Sbjct:    1 MGFEPQIREIMFDFDMPPVKERHTSLFSATFPNSVMSLARTLLKPKHGKIMVGKNAGSSEACVPESINQKFILTNQGSMFRDCFKFIKEDPVKTIVFCNRKYEVETFCRFATKQSLRVSSLHGDYNHSRIESEFNLFKNNDSMILV-TSIASRGLDVTDVECVINIGLPKEVEEYMHRVGRCGRIGRPGTAVTFVKETDLSLSVVKDLVNMMRRTKMEVPEFLSTSAKNIKSDNS-----RFDTNDHKTIIRPFGGQRGFKRNSNRK 261          
BLAST of ATP-dependent RNA helicase DDX3X vs. Planmine SMEST
Match: SMESG000013025.1 (SMESG000013025.1)

HSP 1 Score: 276.944 bits (707), Expect = 4.096e-83
Identity = 161/420 (38.33%), Postives = 243/420 (57.86%), Query Frame = 1
Query:  367 LIKSGHDQMTQIQKSTFDILNRQLLDLLGSAETGSGKTVAYLTPLLNSILKS--YPEEMMASLKENSSTVQYPLILVLAPTRELVIQISKEAKKLLTFTQLRTVSVIGGADPGGQIGSIFKGCHALVATPGRLKDFIQRGLLSLKYCNKLVIDEADRMLDMGFEPQIREIMFDFDMPPVKERHTSLFSATFPNSVMSLTRTLLKPKHGKVMIGKNAGSSEACVPESINQKFIL---TNQGSMFRDCFKFIKENPVKTIVFCNRKIEVETFCRFATNQCLRVSSLHGDYNQSRRESEFNFFKNNDSKILVATSIASRGLDVTDVECVINIGLPMEVEEYMHRVGRCGRMGRPGTAVTFVQETDLSLSVVKDLVNMMRRTKMEVPEFLSTSAKNVKSDNSRVDYNRFDSNNRRTIIRPFGDR 1611
            ++ + + + T IQK+    +  +  D++  A+TGSGKT A+L P++N ++     P+          +   YP  L+LAPTREL IQI  E++K    TQ+R+  V GGAD   QI  +  GCH LVATPGRL DFI++  +SL+ C  +V+DEADRMLDMGFEPQIR+I+ + +MP    R T +FSATFP  +  L    L   +  + +G+   +S     +SI Q+ I      + +  ++ F     N +  ++F   K   ++  RF  ++   VSS+HGD NQ  RE   N F+N    ILVAT++A+RGLD+ +V+ VIN  LP ++EEY+HR+GR GR+G  G A +F  + + ++++  DLV++++     VP++LS  A  +K  NS +  N    N RR     FG R
Sbjct:  200 ILLASYQRPTPIQKNAIPAI-LEHRDIMACAQTGSGKTAAFLIPIINHLISQDLSPQRY--------TKTAYPKCLILAPTRELAIQILSESQKFSLNTQMRSCVVYGGADTHSQIREVQIGCHLLVATPGRLVDFIEKNKISLEMCKYIVLDEADRMLDMGFEPQIRKIIEESNMPSGINRQTLMFSATFPKEIQKLAADFLY-NYIFMTVGRVGSTS-----DSIKQEIIYMTDVEKLNYLKNIFNTTAPNTL-ILIFVETKKGADSLARFLLSKGYPVSSIHGDRNQGEREHALNMFRNGQCPILVATAVAARGLDIPNVKHVINYDLPSDIEEYVHRIGRTGRLGNHGRATSFYVDKNNNIAI--DLVDLLKEANQIVPQWLSALADELKR-NSVIGSNNKRHNQRRFKNGNFGGR 600          
BLAST of ATP-dependent RNA helicase DDX3X vs. Planmine SMEST
Match: SMESG000064743.1 (SMESG000064743.1)

HSP 1 Score: 265.774 bits (678), Expect = 3.263e-81
Identity = 156/380 (41.05%), Postives = 224/380 (58.95%), Query Frame = 1
Query:  394 TQIQKSTFDILNRQLLDLLGSAETGSGKTVAYLTPLLNSILKSYPEEMMASLKENSSTVQYPLILVLAPTRELVIQISKEAKKLLTFTQLRTVSVIGGADPGGQIGSIFKGCHALVATPGRLKDFIQRGLLSLKYCNKLVIDEADRMLDMGFEPQIREIMFDFDMPPVKERHTSLFSATFPNSVMSLTRTLLKPKHGKVMIGKNAGSSEACVPESINQKFILTNQGSMFRDCFKFIKENPVKTIVFCNRKIEVETFCRFATNQCLRVSSLHGDYNQSRRESEFNFFKNNDSKILVATSIASRGLDVTDVECVINIGLPMEVEEYMHRVGRCGRMGRPGTAVTFVQETDLSLSVVKDLVNMMRRTKMEVPEFLSTSAKNVK 1533
            T +QK    I+  Q  DL+  A+TGSGKT A+L P+LN I   Y E    S    +   QYP+ L+LAPTREL  QI +E +K    +Q+R+  V GGAD   QI ++ +GC+ LVATPGRL D ++R  + L++   LV+DEADRMLDMGFEPQ+R+I+ D DMP V +R T +FSATFP  +  L    L   +  + +G   GSS   + + I        +  + +   K   E+ V  ++F   K        F   +   V+S+HGD  Q  RE+    FKN    ILVAT++A+RGLD+ +V+ VIN  LP ++EEY+HR+GR GR+G  G +V+F    D +++VVK L+N++   + EVP +L    K++K
Sbjct:  136 TPVQKFAIPII-LQRRDLMACAQTGSGKTAAFLIPILNMI---YVEGPGDSQIPGNYEKQYPVALILAPTRELACQIYEEIRKFSYRSQVRSCVVYGGADISKQINNLSRGCNLLVATPGRLIDMLKRDKIGLQFIRYLVLDEADRMLDMGFEPQLRQIVEDSDMPYVGDRQTLMFSATFPKEIQHLAADFLN-YYIFLAVGI-VGSSSHNITQHIFYIEEFRKRNHLLQILNKLEPEDLV--LIFVETKKGARQLENFLMQRDFPVTSIHGDRKQVERETALKCFKNGSLPILVATAVAARGLDIPNVKLVINFDLPSDIEEYVHRIGRTGRVGHLGESVSFF--NDNNVNVVKGLINVLEEAQQEVPVWLYEKLKDMK 505          
BLAST of ATP-dependent RNA helicase DDX3X vs. Planmine SMEST
Match: SMESG000019837.1 (SMESG000019837.1)

HSP 1 Score: 258.07 bits (658), Expect = 7.125e-77
Identity = 146/374 (39.04%), Postives = 220/374 (58.82%), Query Frame = 1
Query:  394 TQIQKSTFDILNRQLLDLLGSAETGSGKTVAYLTPLLNSILKSYPEEMMASLKENSSTVQYPLILVLAPTRELVIQISKEAKKLLTFTQLRTVSVIGGADPGGQIGSIFKGCHALVATPGRLKDFIQRGLLSLKYCNKLVIDEADRMLDMGFEPQIREIMFDFDMPPVKERHTSLFSATFPNSVMSLTRTLLKPKHGKVMIGKNAGSSEACVPESINQKFILTNQGSMFRDCFKFIKENPVKT--IVFCNRKIEVETFCRFATNQCLRVSSLHGDYNQSRRESEFNFFKNNDSKILVATSIASRGLDVTDVECVINIGLPMEVEEYMHRVGRCGRMGRPGTAVTFVQETDLSLSVVKDLVNMMRRTKMEVPEFL 1509
            T +Q+    I+  Q  DL+  A+TGSGKT A+L PLLN +    P     SL       +YP+ L+LAPTREL +QI +EA+K    + +R   V GGAD   Q+  + +GC+ LVATPGRL D ++R  + L     LV+DEADRMLDMGFEPQIR+I+   +MPP   R T +FSATFP  +  L    L+  +  + +GK   +S     ++I Q+ +  ++          + +   ++  +VF   K   +    F   +  RV+S+HGD +QS RE     F++  + ILVAT++A+RGLD+ +V+ VIN  LP ++EEY+HR+GR GR+G  G A++F   TD + +V ++LV+++      VP++L
Sbjct:  233 TPVQRYAVPII-VQRRDLMACAQTGSGKTAAFLIPLLNMMYNDGPGN---SLSRTGYKKEYPVALILAPTRELALQIYEEARKFSYRSLVRPCVVYGGADIRNQLHDLSQGCNMLVATPGRLSDMLERCRIGLDCIRYLVLDEADRMLDMGFEPQIRKIVEQTNMPPPGNRQTLMFSATFPKEIQMLASDFLQ-DYLFLRVGKVGSTS-----QNITQRIVYVDENEKRDHLLDILADIDSESLILVFVETKRGADALEGFLHGEGFRVASIHGDRSQSDRELALQCFRDGRTPILVATAVAARGLDIPNVKFVINYDLPTDIEEYVHRIGRTGRVGNLGEAISFY--TDKNNNVARELVDILLEANQTVPDWL 594          
The following BLAST results are available for this feature:
BLAST of ATP-dependent RNA helicase DDX3X vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DDX3X1.926e-9241.82DEAD-box helicase 3 X-linked [Source:HGNC Symbol;A... [more]
DDX3X2.376e-9241.82DEAD-box helicase 3 X-linked [Source:HGNC Symbol;A... [more]
DDX3X2.376e-9241.82DEAD-box helicase 3 X-linked [Source:HGNC Symbol;A... [more]
DDX3X2.376e-9241.82DEAD-box helicase 3 X-linked [Source:HGNC Symbol;A... [more]
DDX3X1.215e-9041.82DEAD-box helicase 3 X-linked [Source:HGNC Symbol;A... [more]
back to top
BLAST of ATP-dependent RNA helicase DDX3X vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
laf-15.420e-7937.56ATP-dependent RNA helicase laf-1 [Source:UniProtK... [more]
vbh-12.191e-7839.09Vasa-and Belle-like Helicase [Source:UniProtKB/Tr... [more]
vbh-12.191e-7839.09Vasa-and Belle-like Helicase [Source:UniProtKB/Tr... [more]
vbh-12.197e-7839.09Vasa-and Belle-like Helicase [Source:UniProtKB/Tr... [more]
vbh-12.197e-7839.09Vasa-and Belle-like Helicase [Source:UniProtKB/Tr... [more]
back to top
BLAST of ATP-dependent RNA helicase DDX3X vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
bel5.875e-8040.05gene:FBgn0263231 transcript:FBtr0081888[more]
bel8.608e-8040.05gene:FBgn0263231 transcript:FBtr0334319[more]
vas5.599e-6835.48gene:FBgn0283442 transcript:FBtr0445187[more]
vas5.599e-6835.48gene:FBgn0283442 transcript:FBtr0445185[more]
vas5.599e-6835.48gene:FBgn0283442 transcript:FBtr0445186[more]
back to top
BLAST of ATP-dependent RNA helicase DDX3X vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ddx3xb3.645e-8540.93DEAD-box helicase 3 X-linked b [Source:ZFIN;Acc:ZD... [more]
ddx3xa9.352e-8541.09DEAD-box helicase 3 X-linked a [Source:ZFIN;Acc:ZD... [more]
ddx41.097e-7037.34DEAD (Asp-Glu-Ala-Asp) box polypeptide 4 [Source:Z... [more]
ddx41.117e-7037.34DEAD (Asp-Glu-Ala-Asp) box polypeptide 4 [Source:Z... [more]
ddx41.199e-7037.34DEAD (Asp-Glu-Ala-Asp) box polypeptide 4 [Source:Z... [more]
back to top
BLAST of ATP-dependent RNA helicase DDX3X vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ddx3x2.040e-8942.15DEAD-box helicase 3 X-linked [Source:NCBI gene;Acc... [more]
ddx3x2.529e-8942.15DEAD-box helicase 3 X-linked [Source:NCBI gene;Acc... [more]
ddx3x3.151e-8942.15DEAD-box helicase 3 X-linked [Source:NCBI gene;Acc... [more]
ddx3x4.024e-8942.15DEAD-box helicase 3 X-linked [Source:NCBI gene;Acc... [more]
ddx3x8.705e-8942.15DEAD-box helicase 3 X-linked [Source:NCBI gene;Acc... [more]
back to top
BLAST of ATP-dependent RNA helicase DDX3X vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
D1Pas11.359e-8941.62DNA segment, Chr 1, Pasteur Institute 1 [Source:MG... [more]
Ddx3x4.301e-8941.62DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 3, X-... [more]
Ddx3y4.139e-8841.62DEAD (Asp-Glu-Ala-Asp) box polypeptide 3, Y-linked... [more]
Ddx45.134e-6936.48DEAD (Asp-Glu-Ala-Asp) box polypeptide 4 [Source:M... [more]
Ddx48.262e-6936.48DEAD (Asp-Glu-Ala-Asp) box polypeptide 4 [Source:M... [more]
back to top
BLAST of ATP-dependent RNA helicase DDX3X vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O00571|DDX3X_HUMAN1.947e-8941.82ATP-dependent RNA helicase DDX3X OS=Homo sapiens O... [more]
sp|Q5RF43|DDX3Y_PONAB6.407e-8941.82ATP-dependent RNA helicase DDX3Y OS=Pongo abelii O... [more]
sp|P16381|DDX3L_MOUSE9.506e-8941.62Putative ATP-dependent RNA helicase Pl10 OS=Mus mu... [more]
sp|Q62167|DDX3X_MOUSE3.009e-8841.62ATP-dependent RNA helicase DDX3X OS=Mus musculus O... [more]
sp|O15523|DDX3Y_HUMAN3.399e-8841.88ATP-dependent RNA helicase DDX3Y OS=Homo sapiens O... [more]
back to top
BLAST of ATP-dependent RNA helicase DDX3X vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A4V6K80.000e+053.38Putative RNA helicase protein OS=Dugesia japonica ... [more]
T1L0751.065e-8939.41Uncharacterized protein OS=Tetranychus urticae OX=... [more]
A0A485NYS72.742e-8941.82Atp-dependent rna helicase ddx3x isoform 2 OS=Lynx... [more]
A0A2R8YDT52.742e-8941.82ATP-dependent RNA helicase DDX3X OS=Homo sapiens O... [more]
A0A485NWC53.382e-8941.82Atp-dependent rna helicase ddx3x isoform 1 OS=Lynx... [more]
back to top
BLAST of ATP-dependent RNA helicase DDX3X vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ddx3xb3.908e-8742.04DEAD-box helicase 3 X-linked b [Source:ZFIN;Acc:ZD... [more]
ddx3xa1.742e-8539.68DEAD-box helicase 3 X-linked [Source:NCBI gene;Acc... [more]
ddx3xa3.174e-8539.68DEAD-box helicase 3 X-linked [Source:NCBI gene;Acc... [more]
ddx3xa3.858e-8539.86DEAD-box helicase 3 X-linked [Source:NCBI gene;Acc... [more]
ddx3xa5.016e-8539.86DEAD-box helicase 3 X-linked [Source:NCBI gene;Acc... [more]
back to top
BLAST of ATP-dependent RNA helicase DDX3X vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000003898.11.789e-8638.61pep scaffold:Pmarinus_7.0:GL481305:13824:21767:-1 ... [more]
ddx231.711e-5633.75DEAD (Asp-Glu-Ala-Asp) box polypeptide 23 [Source:... [more]
ENSPMAT00000000216.15.010e-5334.77pep scaffold:Pmarinus_7.0:GL476721:117971:126978:-... [more]
ddx465.276e-5335.71DEAD (Asp-Glu-Ala-Asp) box polypeptide 46 [Source:... [more]
ddx423.681e-4632.47DEAD (Asp-Glu-Ala-Asp) box helicase 42 [Source:ZFI... [more]
back to top
BLAST of ATP-dependent RNA helicase DDX3X vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
DBP11.536e-8136.60Putative ATP-dependent RNA helicase of the DEAD-bo... [more]
DED11.051e-7737.47ATP-dependent DEAD (Asp-Glu-Ala-Asp)-box RNA helic... [more]
DBP25.252e-6035.28ATP-dependent RNA helicase of the DEAD-box protein... [more]
PRP287.196e-5533.16RNA binding protein; involved in RNA isomerization... [more]
DBP34.221e-5133.98RNA-Dependent ATPase, member of DExD/H-box family;... [more]
back to top
BLAST of ATP-dependent RNA helicase DDX3X vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
PL103.147e-7938.46Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
VAS14.689e-6836.57Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO436021.065e-5834.82Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO428942.037e-5533.42Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO492474.513e-5432.35Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of ATP-dependent RNA helicase DDX3X vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ddx3xa4.874e-8740.25DEAD-box helicase 3 X-linked [Source:NCBI gene;Acc... [more]
ddx3xa1.456e-8640.60DEAD-box helicase 3 X-linked [Source:NCBI gene;Acc... [more]
ddx3xa1.469e-8640.25DEAD-box helicase 3 X-linked [Source:NCBI gene;Acc... [more]
ddx3xa7.540e-8639.66DEAD-box helicase 3 X-linked [Source:NCBI gene;Acc... [more]
ddx3xa1.098e-8539.66DEAD-box helicase 3 X-linked [Source:NCBI gene;Acc... [more]
back to top
BLAST of ATP-dependent RNA helicase DDX3X vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000046974.10.000e+082.74SMESG000046974.1[more]
SMESG000046953.11.443e-16988.39SMESG000046953.1[more]
SMESG000013025.14.096e-8338.33SMESG000013025.1[more]
SMESG000064743.13.263e-8141.05SMESG000064743.1[more]
SMESG000019837.17.125e-7739.04SMESG000019837.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30009026 ID=SMED30009026|Name=ATP-dependent RNA helicase DDX3X|organism=Schmidtea mediterranea sexual|type=transcript|length=1766bp
ATTTTTTTTAATAATAATAAGCCTAAAATGATAACTAGGAAATTTTTTCT
TACACGTTTGTCTGTTACAATTTCAGTTTCTCGAAATTATAATTATCGTG
ATAATTATCCTGCTTCAAGACAATCTTATGGAAATAATAACCAAAAGGAA
TCAAATGATCTATATAGAACTAATCGTTATAATAGAAAAAGCCATTGGAA
AAAAAATATACGGACCATTATGGAATTAAATTGAAATCTAAAGGCGGGTA
AATGACTCTGAATATTTTGCTTTAAAGGAGCAACCTGCTAATGTCCAATG
TGGCGATTTGCAATATAATACTTGGGATAAAAAATTAACGATTTAGATCA
AAGACTATCCGAAGTTTTAATAAAAAGCGGTCATGATCAAATGACACAAA
TTCAAAAATCAACATTTGATATTCTAAATCGCCAGTTATTAGATTTACTA
GGGTCGGCAGAAACTGGTTCTGGTAAAACAGTAGCGTATCTTACTCCATT
GCTGAATAGTATTTTAAAATCGTATCCAGAAGAAATGATGGCAAGCTTGA
AGGAGAATAGTTCAACTGTACAATATCCCCTTATTCTGGTTTTAGCTCCA
ACTAGAGAATTAGTAATTCAAATATCAAAAGAAGCGAAAAAATTGTTGAC
ATTTACTCAATTAAGGACTGTCAGTGTAATCGGTGGAGCTGATCCTGGTG
GTCAAATAGGTAGTATTTTTAAAGGTTGTCATGCATTAGTAGCAACACCG
GGTCGATTGAAAGATTTTATTCAACGCGGTCTTCTTTCTTTGAAATATTG
CAATAAGCTTGTAATAGATGAGGCTGACAGAATGTTGGATATGGGATTTG
AGCCACAAATTCGTGAAATAATGTTTGATTTTGATATGCCACCTGTCAAA
GAACGGCACACGTCATTGTTTAGCGCAACATTCCCCAATTCTGTTATGTC
ATTGACTAGAACGCTATTGAAACCTAAACACGGAAAGGTTATGATTGGTA
AAAATGCTGGTTCGAGTGAAGCTTGTGTTCCAGAATCGATTAATCAAAAA
TTTATTTTGACTAATCAAGGATCGATGTTTAGAGATTGTTTTAAATTCAT
TAAAGAAAATCCCGTTAAGACTATTGTTTTCTGTAACAGGAAAATCGAGG
TGGAAACCTTTTGTCGTTTCGCTACAAATCAATGCTTGAGAGTCTCAAGT
TTGCATGGGGATTACAATCAAAGTCGTAGAGAGTCGGAATTTAATTTTTT
TAAAAACAATGATAGTAAGATTTTGGTGGCCACTTCTATCGCTTCAAGGG
GATTGGATGTAACTGATGTGGAATGCGTTATCAATATCGGGTTACCAATG
GAAGTTGAGGAATATATGCACCGAGTTGGTCGATGTGGTAGAATGGGAAG
GCCTGGAACCGCGGTAACCTTTGTTCAAGAAACCGATCTGTCGTTGTCGG
TTGTGAAAGATTTAGTGAATATGATGCGTCGAACTAAAATGGAGGTTCCA
GAGTTTCTCAGCACAAGCGCTAAAAACGTTAAATCAGATAATTCTCGAGT
TGACTATAATCGATTTGACTCGAATAATCGCAGAACAATCATTCGACCAT
TTGGTGACCGAGGCGGCTTTAATCGAAATATGAGCAGAAAAAACTTCAAA
GATGAGCAAGATGATTTTGATCGTTTTATGCGATAATTTATTTTGCATTT
AAGGTTTCAGAGTGTAATTTGCATTTTGTTAATAATAAAATTAAATTATC
TTTTATTAAAAAAAAA
back to top

protein sequence of SMED30009026-orf-1

>SMED30009026-orf-1 ID=SMED30009026-orf-1|Name=SMED30009026-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=432bp
MTQIQKSTFDILNRQLLDLLGSAETGSGKTVAYLTPLLNSILKSYPEEMM
ASLKENSSTVQYPLILVLAPTRELVIQISKEAKKLLTFTQLRTVSVIGGA
DPGGQIGSIFKGCHALVATPGRLKDFIQRGLLSLKYCNKLVIDEADRMLD
MGFEPQIREIMFDFDMPPVKERHTSLFSATFPNSVMSLTRTLLKPKHGKV
MIGKNAGSSEACVPESINQKFILTNQGSMFRDCFKFIKENPVKTIVFCNR
KIEVETFCRFATNQCLRVSSLHGDYNQSRRESEFNFFKNNDSKILVATSI
ASRGLDVTDVECVINIGLPMEVEEYMHRVGRCGRMGRPGTAVTFVQETDL
SLSVVKDLVNMMRRTKMEVPEFLSTSAKNVKSDNSRVDYNRFDSNNRRTI
IRPFGDRGGFNRNMSRKNFKDEQDDFDRFMR*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000103central nervous system
PLANA:0000204ovary
PLANA:0000208testis
PLANA:0000429neoblast
Vocabulary: INTERPRO
TermDefinition
IPR014001Helicase_ATP-bd
IPR001650Helicase_C
IPR027417P-loop_NTPase
IPR011545DEAD/DEAH_box_helicase_dom
IPR000629RNA-helicase_DEAD-box_CS
Vocabulary: molecular function
TermDefinition
GO:0003676nucleic acid binding
GO:0005524ATP binding
GO:0048027mRNA 5'-UTR binding
GO:0000166nucleotide binding
GO:0003677DNA binding
GO:0003723RNA binding
GO:0003924GTPase activity
GO:0004003ATP-dependent DNA helicase activity
GO:0004004ATP-dependent RNA helicase activity
GO:0004386helicase activity
GO:0005515protein binding
GO:0008134transcription factor binding
GO:0008143poly(A) binding
GO:0008190eukaryotic initiation factor 4E binding
GO:0016787hydrolase activity
GO:0016887ATPase activity
GO:0017111nucleoside-triphosphatase activity
GO:0031369translation initiation factor binding
GO:0035613RNA stem-loop binding
GO:0043024ribosomal small subunit binding
GO:0043273CTPase activity
GO:0045296cadherin binding
Vocabulary: biological process
TermDefinition
GO:0045944positive regulation of transcription from RNA polymerase II promoter
GO:0045948positive regulation of translational initiation
GO:0071243cellular response to arsenic-containing substance
GO:0071470cellular response to osmotic stress
GO:0071651positive regulation of chemokine (C-C motif) ligand 5 production
GO:0097193intrinsic apoptotic signaling pathway
GO:1900087positive regulation of G1/S transition of mitotic cell cycle
GO:1903608protein localization to cytoplasmic stress granule
GO:2001243negative regulation of intrinsic apoptotic signaling pathway
GO:0002376immune system process
GO:0006351transcription, DNA-templated
GO:0006355regulation of transcription, DNA-templated
GO:0006417regulation of translation
GO:0006915apoptotic process
GO:0007059chromosome segregation
GO:0008625extrinsic apoptotic signaling pathway via death domain receptors
GO:0009615response to virus
GO:0010501RNA secondary structure unwinding
GO:0010628positive regulation of gene expression
GO:0016032viral process
GO:0016055Wnt signaling pathway
GO:0017148negative regulation of translation
GO:0030307positive regulation of cell growth
GO:0030308negative regulation of cell growth
GO:0031333negative regulation of protein complex assembly
GO:0032508DNA duplex unwinding
GO:0032728positive regulation of interferon-beta production
GO:0034063stress granule assembly
GO:0035556intracellular signal transduction
GO:0042254ribosome biogenesis
GO:0042256mature ribosome assembly
GO:0043065positive regulation of apoptotic process
GO:0043066negative regulation of apoptotic process
GO:0043154negative regulation of cysteine-type endopeptidase activity involved in apoptotic process
GO:0043280positive regulation of cysteine-type endopeptidase activity involved in apoptotic process
GO:0043312neutrophil degranulation
GO:0045070positive regulation of viral genome replication
GO:0045087innate immune response
GO:0045727positive regulation of translation
Vocabulary: cellular component
TermDefinition
GO:0070062extracellular exosome
GO:1904813ficolin-1-rich granule lumen
GO:0005576extracellular region
GO:0005634nucleus
GO:0005737cytoplasm
GO:0005739mitochondrion
GO:0005741mitochondrial outer membrane
GO:0005829cytosol
GO:0010494cytoplasmic stress granule
GO:0016020membrane
GO:0016607nuclear speck
GO:0034774secretory granule lumen
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001650Helicase, C-terminalSMARTSM00490helicmild6coord: 255..336
e-value: 1.6E-22
score: 90.8
IPR001650Helicase, C-terminalPFAMPF00271Helicase_Ccoord: 235..336
e-value: 6.3E-25
score: 87.7
IPR001650Helicase, C-terminalPROSITEPS51194HELICASE_CTERcoord: 229..377
score: 19.347
IPR014001Helicase superfamily 1/2, ATP-binding domainSMARTSM00487ultradead3coord: 1..220
e-value: 1.3E-39
score: 147.5
IPR014001Helicase superfamily 1/2, ATP-binding domainPROSITEPS51192HELICASE_ATP_BIND_1coord: 10..199
score: 25.945
IPR011545DEAD/DEAH box helicase domainPFAMPF00270DEADcoord: 2..186
e-value: 8.4E-39
score: 133.1
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 1..203
e-value: 2.0E-57
score: 196.0
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 204..381
e-value: 1.9E-43
score: 149.8
NoneNo IPR availablePANTHERPTHR24031RNA HELICASEcoord: 2..405
NoneNo IPR availablePANTHERPTHR24031:SF683coord: 2..405
NoneNo IPR availableCDDcd17967DEADc_DDX3_DDX4coord: 2..194
e-value: 3.83905E-78
score: 239.696
NoneNo IPR availableCDDcd18787SF2_C_DEADcoord: 217..345
e-value: 2.05932E-44
score: 149.195
IPR000629ATP-dependent RNA helicase DEAD-box, conserved sitePROSITEPS00039DEAD_ATP_HELICASEcoord: 141..149
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 64..350