Tigger transposable element-derived protein 1

Overview
NameTigger transposable element-derived protein 1
Smed IDSMED30009023
Length (bp)1467
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Tigger transposable element-derived protein 1 (SMED30009023) t-SNE clustered cells

Violin plots show distribution of expression levels for Tigger transposable element-derived protein 1 (SMED30009023) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Tigger transposable element-derived protein 1 (SMED30009023) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Tigger transposable element-derived protein 1 (SMED30009023) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30009023

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parenchymal cellSMED30009023SMESG000070289.1 SMESG000066561.1 SMESG000037674.1 dd_Smed_v4_6949_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Human
Match: TIGD1 (tigger transposable element derived 1 [Source:HGNC Symbol;Acc:HGNC:14523])

HSP 1 Score: 109.383 bits (272), Expect = 2.384e-45
Identity = 58/121 (47.93%), Postives = 80/121 (66.12%), Query Frame = 1
Query:    1 ETGLFWKKMPRRTYITAEEDAMPGHKPMKDRLSLLFCANASSDLKVKLLLVYHSETPRAFKKCKVQKNRLNVMWRSNKKAWVTRDLFTDWLNNVFGPSVKNYXXXXXXXXXXXXXMDNAPN 363
            ET  +WKKMP RT+I  EE ++PG K  KDRL+LL  ANA+ D K+K +L+YHSE PRA K     K+ L V+++ N KA +T  LFT W    F P+V+ Y   + +P  +LL++DNAP+
Sbjct:  188 ETAFYWKKMPSRTFIAREEKSVPGFKASKDRLTLLLGANAAGDFKLKPMLIYHSENPRALK--NYTKSTLPVLYKWNSKARMTAHLFTAWFTEYFKPTVETYCSEKKIPFKILLLIDNAPS 306          

HSP 2 Score: 93.9745 bits (232), Expect = 2.384e-45
Identity = 63/166 (37.95%), Postives = 91/166 (54.82%), Query Frame = 2
Query:  365 NAPAHSPGLQDDFVEEFKFIKIQFMPPNTTALLQPMDQQVISNFKKLYTKALFEHCF-----EMTEKTNLT-LREFWKDHFHIVACLKIIETAWEAVTKRTLISAWKKLWPDGDGECNFEGVETLPVESVVNEIVSLATTMGLEVNVNDIHELVKEPSQELTTEEL 844
            NAP+H   L + + E    I + FMP NTT++LQPMDQ VIS FK  Y +  F         ++++ +  + L+ FWK  F I+  +K I  +WE V   TL   WKKL P      ++EG +T  VE V  ++V +A  + LEV   D+ EL++   + LT EEL
Sbjct:  303 NAPSHPRALMEIYEE----INVIFMPANTTSILQPMDQGVISTFKSYYLRNTFHKALAAMDSDVSDGSGQSKLKTFWKG-FTILDAIKNIRDSWEEVKLSTLTGVWKKLIPTLID--DYEGFKT-SVEEVSADVVEIAKELELEVEPEDVTELLQSHDKTLTDEEL 460          
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Human
Match: JRKL (JRK like [Source:HGNC Symbol;Acc:HGNC:6200])

HSP 1 Score: 84.7297 bits (208), Expect = 2.214e-26
Identity = 44/120 (36.67%), Postives = 72/120 (60.00%), Query Frame = 1
Query:    1 ETGLFWKKMPRRTYITAEEDAMPGHKPMKDRLSLLFCANASSDLKVKLLLVYHSETPRAFKKCKVQKNRLNVMWRSNKKAWVTRDLFTDWLNNVFGPSVKNYXXXXXXXXXXXXXMDNAP 360
            ETGLFWK +P R  +   +  +PGHK +++R++++ CANA+   K+KL +V  ++ PR+FK        L V + S K AW+   +F  W + +F P V+ YL  + L    +L++DN+P
Sbjct:  178 ETGLFWKCLPSRISVIKGKCTVPGHKSIEERVTIMCCANATGLHKLKLCVVGKAKKPRSFKSTDTLN--LPVSYFSQKGAWMDLSIFRQWFDKIFVPQVREYLRSKGLQEKAVLLLDNSP 295          

HSP 2 Score: 55.0694 bits (131), Expect = 2.214e-26
Identity = 37/110 (33.64%), Postives = 54/110 (49.09%), Query Frame = 2
Query:  359 LINAPAHSPG---LQDDFVEEFKFIKIQFMPPNTTALLQPMDQQVISNFKKLYTKALFEHCFEMTEKTNLTLREFWKDHFHIVACLKIIETAWEAVTKRTLISAWKKLWP 679
            L N+P H P    L+ D  + F     +++PPN  +L+QP DQ VI+  K+ Y   L ++  E        L+ FWK    ++  L  I  AW  V   T+  AWKK+ P
Sbjct:  291 LDNSPTH-PNENVLRSDDGQIF----AKYLPPNVASLIQPSDQGVIATMKRNYRAGLLQNNLEEGN----DLKSFWK-KLTLLDALYEIAMAWNLVKPVTISRAWKKILP 390          
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Human
Match: TIGD2 (tigger transposable element derived 2 [Source:HGNC Symbol;Acc:HGNC:18333])

HSP 1 Score: 70.4774 bits (171), Expect = 6.530e-23
Identity = 34/102 (33.33%), Postives = 57/102 (55.88%), Query Frame = 1
Query:    1 ETGLFWKKMPRRTYITAEEDAMPGHKPMKDRLSLLFCANASSDLKVKLLLVYHSETPRAFKKCKVQKNRLNVMWRSNKKAWVTRDLFTDWLNNVFGPSVKNY 306
            +TGLFWK +P RT     + +  G +  ++R+ ++ CANA+   K+ L +V  ++ PRAFK   +  + L V + S K AW+ + +F  W    F P V+ +
Sbjct:  178 QTGLFWKCLPSRTLTLETDQSTSGCRSSRERIIIMCCANATGLHKLNLCVVGKAKKPRAFKGTDL--SNLPVTYYSQKGAWIEQSVFRQWFEKYFVPQVQKH 277          

HSP 2 Score: 57.3806 bits (137), Expect = 6.530e-23
Identity = 27/86 (31.40%), Postives = 46/86 (53.49%), Query Frame = 2
Query:  422 IKIQFMPPNTTALLQPMDQQVISNFKKLYTKALFEHCFEMTEKTNLTLREFWKDHFHIVACLKIIETAWEAVTKRTLISAWKKLWP 679
            I ++++PPN T+L+QPM Q V++  K+ Y   L +   +      +    FWK +  ++  +  +  AW  V   T+  AWKKL+P
Sbjct:  310 IIVKYLPPNVTSLIQPMSQGVLATVKRYYRAGLLQKYMDEGNDPKI----FWK-NLTVLDAIYEVSRAWNMVKSSTITKAWKKLFP 390          
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Human
Match: TIGD2 (tigger transposable element derived 2 [Source:HGNC Symbol;Acc:HGNC:18333])

HSP 1 Score: 70.4774 bits (171), Expect = 6.530e-23
Identity = 34/102 (33.33%), Postives = 57/102 (55.88%), Query Frame = 1
Query:    1 ETGLFWKKMPRRTYITAEEDAMPGHKPMKDRLSLLFCANASSDLKVKLLLVYHSETPRAFKKCKVQKNRLNVMWRSNKKAWVTRDLFTDWLNNVFGPSVKNY 306
            +TGLFWK +P RT     + +  G +  ++R+ ++ CANA+   K+ L +V  ++ PRAFK   +  + L V + S K AW+ + +F  W    F P V+ +
Sbjct:  178 QTGLFWKCLPSRTLTLETDQSTSGCRSSRERIIIMCCANATGLHKLNLCVVGKAKKPRAFKGTDL--SNLPVTYYSQKGAWIEQSVFRQWFEKYFVPQVQKH 277          

HSP 2 Score: 57.3806 bits (137), Expect = 6.530e-23
Identity = 27/86 (31.40%), Postives = 46/86 (53.49%), Query Frame = 2
Query:  422 IKIQFMPPNTTALLQPMDQQVISNFKKLYTKALFEHCFEMTEKTNLTLREFWKDHFHIVACLKIIETAWEAVTKRTLISAWKKLWP 679
            I ++++PPN T+L+QPM Q V++  K+ Y   L +   +      +    FWK +  ++  +  +  AW  V   T+  AWKKL+P
Sbjct:  310 IIVKYLPPNVTSLIQPMSQGVLATVKRYYRAGLLQKYMDEGNDPKI----FWK-NLTVLDAIYEVSRAWNMVKSSTITKAWKKLFP 390          
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Human
Match: TIGD7 (tigger transposable element derived 7 [Source:HGNC Symbol;Acc:HGNC:18331])

HSP 1 Score: 75.0998 bits (183), Expect = 1.764e-22
Identity = 36/102 (35.29%), Postives = 61/102 (59.80%), Query Frame = 1
Query:    1 ETGLFWKKMPRRTYITAEEDAMPGHKPMKDRLSLLFCANASSDLKVKLLLVYHSETPRAFKKCKVQKNRLNVMWRSNKKAWVTRDLFTDWLNNVFGPSVKNY 306
            ET LFWK MP  +  + ++  +PG K  K+RLS   CANA    K+K +++  S+ P++ K+     + L V+++ +K  W TR+LF++W    F P V+++
Sbjct:  179 ETDLFWKSMPENSQASRKDICLPGKKINKERLSAFLCANADGTHKLKSIIIGKSKLPKSVKE---DTSTLPVIYKPSKDVWFTRELFSEWFFQNFVPEVRHF 277          

HSP 2 Score: 51.6026 bits (122), Expect = 1.764e-22
Identity = 39/144 (27.08%), Postives = 69/144 (47.92%), Query Frame = 2
Query:  359 LINAPAHSPGLQDDFVEEFKFIKIQFMPPNTTALLQPMDQQVISNFKKLY-------TKALFEHCFEMTEKTNLTLREFWKDHFHIVACLKIIETAWEAVTKRTLISAWKKLWPDGDGECNFEGVETLPVESVVNEIVSLATTM 769
            L + PAH     +    E   IK  F P NT+ L+QPM+Q VI + K+LY       +  +FE   +  EK +  + +     ++I + +     +WE V + T+ +AW+ L    + E +F+G+E      ++ +   L T +
Sbjct:  295 LDSCPAHPSS--ESLTSEDGRIKCMFFPHNTSTLIQPMNQGVILSCKRLYRWKQLEESLVIFEESDDEQEKGDKGVSKI--KIYNIKSAIFNWAKSWEEVKQITIANAWENLLYKKEPEYDFQGLEHGDYREILEKCGELETKL 434          
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Xenopus
Match: kif6 (kinesin family member 6 [Source:Xenbase;Acc:XB-GENE-1014042])

HSP 1 Score: 76.6406 bits (187), Expect = 3.095e-14
Identity = 36/101 (35.64%), Postives = 60/101 (59.41%), Query Frame = 1
Query:    4 TGLFWKKMPRRTYITAEEDAMPGHKPMKDRLSLLFCANASSDLKVKLLLVYHSETPRAFKKCKVQKNRLNVMWRSNKKAWVTRDLFTDWLNNVFGPSVKNY 306
              LFW+ +P++   TA++    G +  K+RL++L C+NA+   K +LL++  S  PRAFK  +V      V + +NK+A +TR++F DW  N F P  + +
Sbjct:  356 ASLFWRHLPQKLVATAQKPPSSGLEDPKERLTVLACSNAAGTHKARLLVIGKSRNPRAFKGVRV----FPVTYTANKQAGITREIFQDWFENHFVPEARAH 452          
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Mouse
Match: Jrkl (Jrk-like [Source:MGI Symbol;Acc:MGI:1924782])

HSP 1 Score: 80.8777 bits (198), Expect = 3.460e-24
Identity = 43/120 (35.83%), Postives = 69/120 (57.50%), Query Frame = 1
Query:    1 ETGLFWKKMPRRTYITAEEDAMPGHKPMKDRLSLLFCANASSDLKVKLLLVYHSETPRAFKKCKVQKNRLNVMWRSNKKAWVTRDLFTDWLNNVFGPSVKNYXXXXXXXXXXXXXMDNAP 360
            ETGLFWK +P RT +   +  +PGH   ++R++++ C NA+   K+KL +V  +  PR+FK        L V + S K AW+   +F  W + +F P V+ YL  + L    +L++DN+P
Sbjct:  178 ETGLFWKCLPSRTTVIKGKCTVPGHNLGEERITVMCCTNATGLHKLKLCVVGKARKPRSFKSTDTLN--LPVSYFSQKGAWMDLSIFRQWFDKIFVPQVREYLRSKGLQEKAVLLLDNSP 295          

HSP 2 Score: 50.8322 bits (120), Expect = 3.460e-24
Identity = 27/83 (32.53%), Postives = 42/83 (50.60%), Query Frame = 2
Query:  431 QFMPPNTTALLQPMDQQVISNFKKLYTKALFEHCFEMTEKTNLTLREFWKDHFHIVACLKIIETAWEAVTKRTLISAWKKLWP 679
            +++PPN  +L+QP+ Q VI+  K+ Y   L  +  E        L+ FWK    ++  L  I  AW  V   T+  AWK++ P
Sbjct:  313 KYLPPNVASLIQPLGQGVIAAMKRNYRAGLLHNNLEEGN----DLKSFWK-KLTLLDALYEIAMAWNLVKPVTISRAWKQILP 390          
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Mouse
Match: Tigd2 (tigger transposable element derived 2 [Source:MGI Symbol;Acc:MGI:1915390])

HSP 1 Score: 64.6994 bits (156), Expect = 6.128e-21
Identity = 32/102 (31.37%), Postives = 55/102 (53.92%), Query Frame = 1
Query:    1 ETGLFWKKMPRRTYITAEEDAMPGHKPMKDRLSLLFCANASSDLKVKLLLVYHSETPRAFKKCKVQKNRLNVMWRSNKKAWVTRDLFTDWLNNVFGPSVKNY 306
            +TGLFWK +P RT     + +   ++  ++R+ ++ CANA+   K+ L +V  ++ PRAFK   +  + L V + S K AW+   +   W    F P V+ +
Sbjct:  178 QTGLFWKCLPTRTLAFDTDQSTCEYRTSRERIIIMCCANATGSHKLNLCVVGKAKRPRAFKGTDL--SNLPVTYFSQKSAWIEPSVLKQWFEKCFVPQVQKH 277          

HSP 2 Score: 56.225 bits (134), Expect = 6.128e-21
Identity = 30/107 (28.04%), Postives = 55/107 (51.40%), Query Frame = 2
Query:  359 LINAPAHSPGLQDDFVEEFKFIKIQFMPPNTTALLQPMDQQVISNFKKLYTKALFEHCFEMTEKTNLTLREFWKDHFHIVACLKIIETAWEAVTKRTLISAWKKLWP 679
            L++ PA  P  +    ++ + I ++++PPN T+L+QPM Q V++  K+ Y   L +   +         + FWK+   ++  +     AW  +   T+  AWKKL+P
Sbjct:  290 LLDFPAAHPAEELLSSDDGRII-VKYLPPNVTSLIQPMSQGVLTTVKRYYRAGLIQKYMDEGNDP----KTFWKN-LTVLDAIYEASRAWNQIRSNTITRAWKKLFP 390          
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Mouse
Match: Jrk (jerky [Source:MGI Symbol;Acc:MGI:106214])

HSP 1 Score: 73.9442 bits (180), Expect = 1.566e-13
Identity = 34/102 (33.33%), Postives = 60/102 (58.82%), Query Frame = 1
Query:    1 ETGLFWKKMPRRTYITAEEDAMPGHKPMKDRLSLLFCANASSDLKVKLLLVYHSETPRAFKKCKVQKNRLNVMWRSNKKAWVTRDLFTDWLNNVFGPSVKNY 306
            ETGL W+ +P       ++  +P  K  KDRL++L CANA+   ++K L +     PRAF+  +     L + +++   AWV +++F+DW +++F PSV+ +
Sbjct:  188 ETGLVWRCLPNSA---PDDGTVPHFKQGKDRLTVLMCANATGSHRIKPLAIGKGGGPRAFRGIQ----HLPIAYKAQGNAWVDKEIFSDWFHHIFVPSVREH 282          
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Mouse
Match: Tigd4 (tigger transposable element derived 4 [Source:MGI Symbol;Acc:MGI:2685264])

HSP 1 Score: 53.5286 bits (127), Expect = 4.205e-7
Identity = 30/94 (31.91%), Postives = 47/94 (50.00%), Query Frame = 1
Query:    1 ETGLFWKKMPRRTYITAEEDAMPGHKPMKDRLSLLFCANASSDLKVKLLLVYHSETPRAFKKCKVQKNRLNVMWRSNKKAWVTRDLFTDWLNNV 282
            ETGL ++ +P  T+    E    G K  KDR++L    N     K+ LL++  +  PR FK  K     L V + +N+ AW+T  +F  W+  +
Sbjct:  184 ETGLLYRMLPTNTFAFKGETCSVG-KLCKDRITLALGTNMDGSEKLPLLIIGKNRAPRCFKGIK----SLPVYYEANRTAWMTAAIFEQWMQKL 272          
BLAST of Tigger transposable element-derived protein 1 vs. UniProt/SwissProt
Match: sp|Q96MW7|TIGD1_HUMAN (Tigger transposable element-derived protein 1 OS=Homo sapiens OX=9606 GN=TIGD1 PE=1 SV=1)

HSP 1 Score: 109.383 bits (272), Expect = 1.039e-44
Identity = 58/121 (47.93%), Postives = 80/121 (66.12%), Query Frame = 1
Query:    1 ETGLFWKKMPRRTYITAEEDAMPGHKPMKDRLSLLFCANASSDLKVKLLLVYHSETPRAFKKCKVQKNRLNVMWRSNKKAWVTRDLFTDWLNNVFGPSVKNYXXXXXXXXXXXXXMDNAPN 363
            ET  +WKKMP RT+I  EE ++PG K  KDRL+LL  ANA+ D K+K +L+YHSE PRA K     K+ L V+++ N KA +T  LFT W    F P+V+ Y   + +P  +LL++DNAP+
Sbjct:  188 ETAFYWKKMPSRTFIAREEKSVPGFKASKDRLTLLLGANAAGDFKLKPMLIYHSENPRALK--NYTKSTLPVLYKWNSKARMTAHLFTAWFTEYFKPTVETYCSEKKIPFKILLLIDNAPS 306          

HSP 2 Score: 93.9745 bits (232), Expect = 1.039e-44
Identity = 63/166 (37.95%), Postives = 91/166 (54.82%), Query Frame = 2
Query:  365 NAPAHSPGLQDDFVEEFKFIKIQFMPPNTTALLQPMDQQVISNFKKLYTKALFEHCF-----EMTEKTNLT-LREFWKDHFHIVACLKIIETAWEAVTKRTLISAWKKLWPDGDGECNFEGVETLPVESVVNEIVSLATTMGLEVNVNDIHELVKEPSQELTTEEL 844
            NAP+H   L + + E    I + FMP NTT++LQPMDQ VIS FK  Y +  F         ++++ +  + L+ FWK  F I+  +K I  +WE V   TL   WKKL P      ++EG +T  VE V  ++V +A  + LEV   D+ EL++   + LT EEL
Sbjct:  303 NAPSHPRALMEIYEE----INVIFMPANTTSILQPMDQGVISTFKSYYLRNTFHKALAAMDSDVSDGSGQSKLKTFWKG-FTILDAIKNIRDSWEEVKLSTLTGVWKKLIPTLID--DYEGFKT-SVEEVSADVVEIAKELELEVEPEDVTELLQSHDKTLTDEEL 460          
BLAST of Tigger transposable element-derived protein 1 vs. UniProt/SwissProt
Match: sp|Q9Y4A0|JERKL_HUMAN (Jerky protein homolog-like OS=Homo sapiens OX=9606 GN=JRKL PE=2 SV=2)

HSP 1 Score: 84.7297 bits (208), Expect = 9.651e-26
Identity = 44/120 (36.67%), Postives = 72/120 (60.00%), Query Frame = 1
Query:    1 ETGLFWKKMPRRTYITAEEDAMPGHKPMKDRLSLLFCANASSDLKVKLLLVYHSETPRAFKKCKVQKNRLNVMWRSNKKAWVTRDLFTDWLNNVFGPSVKNYXXXXXXXXXXXXXMDNAP 360
            ETGLFWK +P R  +   +  +PGHK +++R++++ CANA+   K+KL +V  ++ PR+FK        L V + S K AW+   +F  W + +F P V+ YL  + L    +L++DN+P
Sbjct:  178 ETGLFWKCLPSRISVIKGKCTVPGHKSIEERVTIMCCANATGLHKLKLCVVGKAKKPRSFKSTDTLN--LPVSYFSQKGAWMDLSIFRQWFDKIFVPQVREYLRSKGLQEKAVLLLDNSP 295          

HSP 2 Score: 55.0694 bits (131), Expect = 9.651e-26
Identity = 37/110 (33.64%), Postives = 54/110 (49.09%), Query Frame = 2
Query:  359 LINAPAHSPG---LQDDFVEEFKFIKIQFMPPNTTALLQPMDQQVISNFKKLYTKALFEHCFEMTEKTNLTLREFWKDHFHIVACLKIIETAWEAVTKRTLISAWKKLWP 679
            L N+P H P    L+ D  + F     +++PPN  +L+QP DQ VI+  K+ Y   L ++  E        L+ FWK    ++  L  I  AW  V   T+  AWKK+ P
Sbjct:  291 LDNSPTH-PNENVLRSDDGQIF----AKYLPPNVASLIQPSDQGVIATMKRNYRAGLLQNNLEEGN----DLKSFWK-KLTLLDALYEIAMAWNLVKPVTISRAWKKILP 390          
BLAST of Tigger transposable element-derived protein 1 vs. UniProt/SwissProt
Match: sp|B2RRL2|JERKL_MOUSE (Jerky protein homolog-like OS=Mus musculus OX=10090 GN=Jrkl PE=2 SV=1)

HSP 1 Score: 80.8777 bits (198), Expect = 2.083e-23
Identity = 43/120 (35.83%), Postives = 69/120 (57.50%), Query Frame = 1
Query:    1 ETGLFWKKMPRRTYITAEEDAMPGHKPMKDRLSLLFCANASSDLKVKLLLVYHSETPRAFKKCKVQKNRLNVMWRSNKKAWVTRDLFTDWLNNVFGPSVKNYXXXXXXXXXXXXXMDNAP 360
            ETGLFWK +P RT +   +  +PGH   ++R++++ C NA+   K+KL +V  +  PR+FK        L V + S K AW+   +F  W + +F P V+ YL  + L    +L++DN+P
Sbjct:  178 ETGLFWKCLPSRTTVIKGKCTVPGHNLGEERITVMCCTNATGLHKLKLCVVGKARKPRSFKSTDTLN--LPVSYFSQKGAWMDLSIFRQWFDKIFVPQVREYLRSKGLQEKAVLLLDNSP 295          

HSP 2 Score: 50.8322 bits (120), Expect = 2.083e-23
Identity = 27/83 (32.53%), Postives = 42/83 (50.60%), Query Frame = 2
Query:  431 QFMPPNTTALLQPMDQQVISNFKKLYTKALFEHCFEMTEKTNLTLREFWKDHFHIVACLKIIETAWEAVTKRTLISAWKKLWP 679
            +++PPN  +L+QP+ Q VI+  K+ Y   L  +  E        L+ FWK    ++  L  I  AW  V   T+  AWK++ P
Sbjct:  313 KYLPPNVASLIQPLGQGVIAAMKRNYRAGLLHNNLEEGN----DLKSFWK-KLTLLDALYEIAMAWNLVKPVTISRAWKQILP 390          
BLAST of Tigger transposable element-derived protein 1 vs. UniProt/SwissProt
Match: sp|Q4W5G0|TIGD2_HUMAN (Tigger transposable element-derived protein 2 OS=Homo sapiens OX=9606 GN=TIGD2 PE=3 SV=1)

HSP 1 Score: 70.4774 bits (171), Expect = 2.847e-22
Identity = 34/102 (33.33%), Postives = 57/102 (55.88%), Query Frame = 1
Query:    1 ETGLFWKKMPRRTYITAEEDAMPGHKPMKDRLSLLFCANASSDLKVKLLLVYHSETPRAFKKCKVQKNRLNVMWRSNKKAWVTRDLFTDWLNNVFGPSVKNY 306
            +TGLFWK +P RT     + +  G +  ++R+ ++ CANA+   K+ L +V  ++ PRAFK   +  + L V + S K AW+ + +F  W    F P V+ +
Sbjct:  178 QTGLFWKCLPSRTLTLETDQSTSGCRSSRERIIIMCCANATGLHKLNLCVVGKAKKPRAFKGTDL--SNLPVTYYSQKGAWIEQSVFRQWFEKYFVPQVQKH 277          

HSP 2 Score: 57.3806 bits (137), Expect = 2.847e-22
Identity = 27/86 (31.40%), Postives = 46/86 (53.49%), Query Frame = 2
Query:  422 IKIQFMPPNTTALLQPMDQQVISNFKKLYTKALFEHCFEMTEKTNLTLREFWKDHFHIVACLKIIETAWEAVTKRTLISAWKKLWP 679
            I ++++PPN T+L+QPM Q V++  K+ Y   L +   +      +    FWK +  ++  +  +  AW  V   T+  AWKKL+P
Sbjct:  310 IIVKYLPPNVTSLIQPMSQGVLATVKRYYRAGLLQKYMDEGNDPKI----FWK-NLTVLDAIYEVSRAWNMVKSSTITKAWKKLFP 390          
BLAST of Tigger transposable element-derived protein 1 vs. UniProt/SwissProt
Match: sp|Q6NT04|TIGD7_HUMAN (Tigger transposable element-derived protein 7 OS=Homo sapiens OX=9606 GN=TIGD7 PE=1 SV=1)

HSP 1 Score: 75.0998 bits (183), Expect = 7.692e-22
Identity = 36/102 (35.29%), Postives = 61/102 (59.80%), Query Frame = 1
Query:    1 ETGLFWKKMPRRTYITAEEDAMPGHKPMKDRLSLLFCANASSDLKVKLLLVYHSETPRAFKKCKVQKNRLNVMWRSNKKAWVTRDLFTDWLNNVFGPSVKNY 306
            ET LFWK MP  +  + ++  +PG K  K+RLS   CANA    K+K +++  S+ P++ K+     + L V+++ +K  W TR+LF++W    F P V+++
Sbjct:  179 ETDLFWKSMPENSQASRKDICLPGKKINKERLSAFLCANADGTHKLKSIIIGKSKLPKSVKE---DTSTLPVIYKPSKDVWFTRELFSEWFFQNFVPEVRHF 277          

HSP 2 Score: 51.6026 bits (122), Expect = 7.692e-22
Identity = 39/144 (27.08%), Postives = 69/144 (47.92%), Query Frame = 2
Query:  359 LINAPAHSPGLQDDFVEEFKFIKIQFMPPNTTALLQPMDQQVISNFKKLY-------TKALFEHCFEMTEKTNLTLREFWKDHFHIVACLKIIETAWEAVTKRTLISAWKKLWPDGDGECNFEGVETLPVESVVNEIVSLATTM 769
            L + PAH     +    E   IK  F P NT+ L+QPM+Q VI + K+LY       +  +FE   +  EK +  + +     ++I + +     +WE V + T+ +AW+ L    + E +F+G+E      ++ +   L T +
Sbjct:  295 LDSCPAHPSS--ESLTSEDGRIKCMFFPHNTSTLIQPMNQGVILSCKRLYRWKQLEESLVIFEESDDEQEKGDKGVSKI--KIYNIKSAIFNWAKSWEEVKQITIANAWENLLYKKEPEYDFQGLEHGDYREILEKCGELETKL 434          
BLAST of Tigger transposable element-derived protein 1 vs. TrEMBL
Match: A0A3B3R9B8 (HTH CENPB-type domain-containing protein OS=Paramormyrops kingsleyae OX=1676925 PE=4 SV=1)

HSP 1 Score: 310.457 bits (794), Expect = 2.753e-131
Identity = 164/251 (65.34%), Postives = 198/251 (78.88%), Query Frame = 2
Query:  365 NAPAHSPGLQDDFVEEFKFIKIQFMPPNTTALLQPMDQQVISNFKKLYTKALFEHCFEMTEKTNLTLREFWKDHFHIVACLKIIETAWEAVTKRTLISAWKKLWPDGDGECNFEGVETLPVESVVNEIVSLATTMGLEVNVNDIHELVKEPSQELTTEELMELHYXXXXXXXXXXXXXXXXGTIKQQ-SSGAIREMLKSWETAASYIEKYHPDKAVAMRATNLFNDNAVLPFYQILKRRQKQPSLDSFLIK 1114
            NAPAHSPGL+DD +EEF+FIK++F+PPNTT+LLQPMDQQVISNFKKLYTKALF+ CFE+TE TNLTLREFWK+HFHIV CLKII+ AW+ VTKRTL SAW+KLW D      FEG        VV+EIVSL  T+GLEVN  DI ELV+E  QELTT+EL++L    Q+EV+EEI SE+ E   ++  +S  IREM K WE   +++EK+HP+KAVA+RA NLFNDNA+  F++ILKRRQKQ SLD  LIK
Sbjct:  308 NAPAHSPGLEDDLLEEFEFIKVKFLPPNTTSLLQPMDQQVISNFKKLYTKALFQRCFEVTEGTNLTLREFWKNHFHIVNCLKIIDKAWDGVTKRTLNSAWRKLWSDCVLGHGFEGFAHELEPPVVDEIVSLGKTLGLEVNEEDIQELVEEHGQELTTDELIDLRREQQQEVMEEISSEEVEKNTEESLTSNEIREMCKMWERVQNFVEKHHPNKAVAVRAMNLFNDNAMSHFHEILKRRQKQHSLDRSLIK 558          

HSP 2 Score: 189.889 bits (481), Expect = 2.753e-131
Identity = 97/120 (80.83%), Postives = 108/120 (90.00%), Query Frame = 1
Query:    1 ETGLFWKKMPRRTYITAEEDAMPGHKPMKDRLSLLFCANASSDLKVKLLLVYHSETPRAFKKCKVQKNRLNVMWRSNKKAWVTRDLFTDWLNNVFGPSVKNYXXXXXXXXXXXXXMDNAP 360
            E GLFWKKMP+RTYITAEE+AMPGHKPMKDRL+LL CANAS D KVK LLVYHSE PRAFKKC+VQK++LNVMWRSN+KAWVTR LF +W+N VFGP+VK YLL +NLPL VLLVMDNAP
Sbjct:  191 EMGLFWKKMPKRTYITAEENAMPGHKPMKDRLTLLLCANASGDFKVKPLLVYHSENPRAFKKCRVQKSQLNVMWRSNRKAWVTRILFVEWINEVFGPAVKKYLLEKNLPLKVLLVMDNAP 310          
BLAST of Tigger transposable element-derived protein 1 vs. TrEMBL
Match: A0A3Q3IBC0 (HTH CENPB-type domain-containing protein OS=Monopterus albus OX=43700 PE=4 SV=1)

HSP 1 Score: 304.679 bits (779), Expect = 1.605e-130
Identity = 162/250 (64.80%), Postives = 196/250 (78.40%), Query Frame = 2
Query:  365 NAPAHSPGLQDDFVEEFKFIKIQFMPPNTTALLQPMDQQVISNFKKLYTKALFEHCFEMTEKTNLTLREFWKDHFHIVACLKIIETAWEAVTKRTLISAWKKLWPDGDGECNFEGVETLPVESVVNEIVSLATTMGLEVNVNDIHELVKEPSQELTTEELMELHYXXXXXXXXXXXXXXXXGTIKQQ-SSGAIREMLKSWETAASYIEKYHPDKAVAMRATNLFNDNAVLPFYQILKRRQKQPSLDSFLI 1111
            NAPAH PGL+DD +EEF+FIK++F+PPNTT LLQPMDQQV SNFKKLYTKALF+ CFE+TE TNLTLREFWK+HFHIV CLK+I+ AW  VTKRTL SAW+KLW D     + EG        VV+EI+SL  TMGLEVN +DI ELV+E  QELTT EL++LH   Q+EV+EEI SE+E+   ++  +S  IR+M K WET  +++EK+HP+KAVA+RATNLFNDNAV  F QILKRRQ Q SLD FL+
Sbjct:  312 NAPAHPPGLEDDLLEEFEFIKVKFLPPNTTPLLQPMDQQVTSNFKKLYTKALFQLCFEVTEGTNLTLREFWKNHFHIVNCLKLIDKAWNWVTKRTLNSAWRKLWSDCALGHDVEGFAQEQQPPVVDEIMSLGKTMGLEVNEDDIQELVEEHGQELTTNELIDLHREQQQEVMEEISSEEEDKKPEESLTSNEIRDMCKMWETVQNFVEKHHPNKAVAVRATNLFNDNAVSHFCQILKRRQNQVSLDRFLV 561          

HSP 2 Score: 192.971 bits (489), Expect = 1.605e-130
Identity = 99/120 (82.50%), Postives = 109/120 (90.83%), Query Frame = 1
Query:    1 ETGLFWKKMPRRTYITAEEDAMPGHKPMKDRLSLLFCANASSDLKVKLLLVYHSETPRAFKKCKVQKNRLNVMWRSNKKAWVTRDLFTDWLNNVFGPSVKNYXXXXXXXXXXXXXMDNAP 360
            ETGLFWKKMP+RTYITAEE+AMPGHKPMKDRL+LL CANAS DLK+K LLVYHSE PRAFKKCKVQK++LNVMWRSN KAWVTR LF +W+N VFGP+VK YLL +NLPL VLLVMDNAP
Sbjct:  195 ETGLFWKKMPKRTYITAEENAMPGHKPMKDRLTLLLCANASGDLKIKPLLVYHSENPRAFKKCKVQKSQLNVMWRSNSKAWVTRILFVEWINEVFGPTVKKYLLEKNLPLKVLLVMDNAP 314          
BLAST of Tigger transposable element-derived protein 1 vs. TrEMBL
Match: A0A4Y2CVZ5 (Tigger transposable element-derived protein 1 OS=Araneus ventricosus OX=182803 GN=TIGD1_64 PE=4 SV=1)

HSP 1 Score: 300.056 bits (767), Expect = 9.161e-128
Identity = 171/242 (70.66%), Postives = 200/242 (82.64%), Query Frame = 2
Query:  365 NAPAHSPGLQDDFVEEFKFIKIQFMPPNTTALLQPMDQQVISNFKKLYTKALFEHCFEMTEKTNLTLREFWKDHFHIVACLKIIETAWEAVTKRTLISAWKKLWPDGDGECNFEGVETLPVESVVNEIVSLATTMGLEVNVNDIHELVKEPSQELTTEELMELHYXXXXXXXXXXXXXXXXGTI--KQQSSGAIREMLKSWETAASYIEKYHPDKAVAMRATNLFNDNAVLPFYQILKRRQK 1084
            N+PAH P LQD  +EEFKFIKI F+PPNTT LLQPM+QQV+S+FKKLYTKALFE CFE+TE TN+TLREFWK HFHIVACLK+IE AWE VTKRTL SAWKKLWP+   EC FE  ET+PV+ VV EIVSLA  +GLEV+ NDI +LV+E +QELTTEEL+ELH VSQ+EV E  +SE+E+  I  KQQSS  IREMLK+WET ASYIEK+HP+KA AMRATNLF+++AV  F QIL  +QK
Sbjct:  304 NSPAHPPDLQDHLLEEFKFIKILFLPPNTTQLLQPMNQQVLSSFKKLYTKALFERCFEVTEVTNITLREFWKCHFHIVACLKMIENAWEGVTKRTLTSAWKKLWPESVVECEFEEPETVPVDPVVYEIVSLAKIVGLEVDSNDIEQLVEEHNQELTTEELLELHRVSQQEVEEGSLSEEEDEAITEKQQSSTEIREMLKAWETVASYIEKHHPNKAEAMRATNLFDEHAVSHFRQILNCQQK 545          

HSP 2 Score: 188.348 bits (477), Expect = 9.161e-128
Identity = 96/120 (80.00%), Postives = 108/120 (90.00%), Query Frame = 1
Query:    1 ETGLFWKKMPRRTYITAEEDAMPGHKPMKDRLSLLFCANASSDLKVKLLLVYHSETPRAFKKCKVQKNRLNVMWRSNKKAWVTRDLFTDWLNNVFGPSVKNYXXXXXXXXXXXXXMDNAP 360
            ETGLFWKKMP+RTYIT EE+A+PGHKPMKDRL+LLFCANAS DLK+K LLVYHSETP+ FKKCK+QK+RLNVMWRSN  A VTRD+FTDW+N VF PSVK YLL  NLPLHVLL+MDN+P
Sbjct:  187 ETGLFWKKMPKRTYITQEENALPGHKPMKDRLTLLFCANASGDLKIKPLLVYHSETPQDFKKCKIQKSRLNVMWRSNNTACVTRDIFTDWINEVFAPSVKKYLLEMNLPLHVLLIMDNSP 306          
BLAST of Tigger transposable element-derived protein 1 vs. TrEMBL
Match: A0A2J7RCR5 (DDE-1 domain-containing protein OS=Cryptotermes secundus OX=105785 GN=B7P43_G02310 PE=4 SV=1)

HSP 1 Score: 375.17 bits (962), Expect = 2.809e-125
Identity = 194/253 (76.68%), Postives = 215/253 (84.98%), Query Frame = 2
Query:  365 NAPAHSPGLQDDFVEEFKFIKIQFMPPNTTALLQPMDQQVISNFKKLYTKALFEHCFEMTEKTNLTLREFWKDHFHIVACLKIIETAWEAVTKRTLISAWKKLWPDGDGECNFEGVETLPVESVVNEIVSLATTMGLEVNVNDIHELVKEPSQELTTEELMELH-YXXXXXXXXXXXXXXXXGTIKQQSSGAIREMLKSWETAASYIEKYHPDKAVAMRATNLFNDNAVLPFYQILKRRQKQPSLDSFLIKKN 1120
            NAPAHSP LQDD +EEFKFIKIQF+PPNTT LLQPMDQQVISNFKKLYTKALFE CFE+TE TNLTLREFWK HFHI ACLK+IE AWE VTKRTL SAWKKLWP+   EC+FEG E + VE VVNEIV+LA TMGLEV+ NDI ELV+E SQELTTE+LMELH    QE + E +  E++E T KQQSSGAIREMLK+WET ASYIEK+HP+KAVAM ATNLFND AV  F+QILKRRQKQ S+DSFL+KKN
Sbjct:   13 NAPAHSPDLQDDLLEEFKFIKIQFLPPNTTPLLQPMDQQVISNFKKLYTKALFERCFEVTEGTNLTLREFWKYHFHIAACLKMIEKAWEGVTKRTLTSAWKKLWPESVVECDFEGFEIVLVEPVVNEIVALAKTMGLEVDNNDIDELVEEHSQELTTEDLMELHCVSQQEVLEESLSEEEKEVTAKQQSSGAIREMLKAWETFASYIEKHHPNKAVAMLATNLFNDKAVSNFHQILKRRQKQMSVDSFLVKKN 265          
BLAST of Tigger transposable element-derived protein 1 vs. TrEMBL
Match: A0A2J7R126 (DDE-1 domain-containing protein OS=Cryptotermes secundus OX=105785 GN=B7P43_G10746 PE=4 SV=1)

HSP 1 Score: 355.525 bits (911), Expect = 1.363e-117
Identity = 188/253 (74.31%), Postives = 208/253 (82.21%), Query Frame = 2
Query:  365 NAPAHSPGLQDDFVEEFKFIKIQFMPPNTTALLQPMDQQVISNFKKLYTKALFEHCFEMTEKTNLTLREFWKDHFHIVACLKIIETAWEAVTKRTLISAWKKLWPDGDGECNFEGVETLPVESVVNEIVSLATTMGLEVNVNDIHELVKEPSQELTTEELMELHYXXXX--XXXXXXXXXXXXGTIKQQSSGAIREMLKSWETAASYIEKYHPDKAVAMRATNLFNDNAVLPFYQILKRRQKQPSLDSFLIKK 1117
            NAPAH P LQDD +EEFKFIKIQF+PPNTT LLQP+D+QVIS FKKLYTKALFE CFE+TE TNLTL+EF K HFHIVACLK+IE AWE VTKRTL SAWKKLWP+   E +FEG E  PVE VVN+IVSLA  MGLEV+ NDI ELV+E SQELTTEELMELH VSQ+          E+EE T KQQSSGAIREMLK+WET ASYIEK+HP+KAV M ATNLFNDNAV  F+QILK RQKQ SLDS+L+KK
Sbjct:   13 NAPAHPPDLQDDLLEEFKFIKIQFLPPNTTLLLQPLDKQVISKFKKLYTKALFERCFEVTEATNLTLKEFRKYHFHIVACLKMIEKAWEGVTKRTLTSAWKKLWPESIVEHDFEGYEIAPVEPVVNKIVSLAKIMGLEVDNNDIDELVEEQSQELTTEELMELHCVSQQEVVEESLSEEEEEEVTAKQQSSGAIREMLKAWETVASYIEKHHPNKAVDMCATNLFNDNAVSHFHQILKHRQKQMSLDSYLVKK 265          
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005656.1 (pep scaffold:Pmarinus_7.0:GL476578:539135:542172:1 gene:ENSPMAG00000005132.1 transcript:ENSPMAT00000005656.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 124.79 bits (312), Expect = 3.860e-31
Identity = 65/121 (53.72%), Postives = 83/121 (68.60%), Query Frame = 1
Query:    1 ETGLFWKKMPRRTYITAEEDAMPGHKPMKDRLSLLFCANASSDLKVKLLLVYHSETPRAFKKCKVQKNRLNVMWRSNKKAWVTRDLFTDWLNNVFGPSVKNYXXXXXXXXXXXXXMDNAPN 363
            ETGLFWK+MP  T+++ EE   PG K  KDRL+LL  ANA+ D K+K LLVYHS+TPRA K C   K  L V+WRSNKK W+T  +F DWL N F P+++ Y   +NL    LL+++NAP 
Sbjct:  189 ETGLFWKRMPASTFLSREEKTAPGFKASKDRLALLVGANAAGDCKLKPLLVYHSKTPRALKGC--IKADLPVIWRSNKKGWITASVFLDWLKNHFCPAIEKYCKKKNLDHKALLLLNNAPG 307          
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003106.1 (pep scaffold:Pmarinus_7.0:GL476998:37517:41189:1 gene:ENSPMAG00000002845.1 transcript:ENSPMAT00000003106.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 96.6709 bits (239), Expect = 5.223e-29
Identity = 87/258 (33.72%), Postives = 127/258 (49.22%), Query Frame = 2
Query:  359 LINAPAHSPGLQDDFVEEFK-FIKIQFMPPNTTALLQPMDQQVISNFKKLYTKALFEHCFEMTEK-TNLTLREFWKDHFHIVACLKIIETAWEAVTKRTLISAWKKLWPDGDGECNFEGVETLPVESVVNEIVSLATTMGLEVNVNDIHELVKEPSQELTTEELMELHYXXXXXXXXXXXXXXXXGTIKQQSSGAIREMLKSWETAASYIEKYHPDKAVAMRATNLFNDNAVLPFYQILKRRQK----QPSLDSFLIK 1114
            L NAP H        VE F   IK+ F+ PNTTALLQPMDQ V+S+FK  Y +  F      T+K    TL EFWK  F I+  +K I  +W+ + +  L   W+KL P  +   NF+G  T  VE V   +V +A  + LEV   D+ EL+   + EL+ E+L++L     EE  +   +     + K      + E  + +ET  + +EK  P+   + +A+ +         Y+ + R QK    Q SLD F  K
Sbjct:  241 LDNAPCHPVS-----VEGFDPNIKVVFLTPNTTALLQPMDQGVMSSFKAYYLRQTFAQAISATDKEGGPTLTEFWKG-FSILDAVKNIAASWKEMKQSNLNGVWRKLCP--EFVSNFQGF-TDTVEEVTENVVEMAGQLQLEVAPEDVGELLASHAHELSNEDLLQLEQQRLEEETQTQETPHPSLSTK-----VLSEAFQHFETGMALLEKNDPNFERSSKASEIIRSGYTC--YREIYREQKKAAVQTSLDLFFKK 482          

HSP 2 Score: 48.9062 bits (115), Expect = 5.223e-29
Identity = 31/67 (46.27%), Postives = 39/67 (58.21%), Query Frame = 1
Query:  160 SETPRAFKKCKVQKNRLNVMWRSNKKAWVTRDLFTDWLNNVFGPSVKNYXXXXXXXXXXXXXMDNAP 360
            +E PRA K     KN L V+W+SN KA VT  +F +W    F P+VK Y    NL    +LV+DNAP
Sbjct:  181 TENPRALKG--YTKNTLPVIWKSNPKARVTGAIFEEWFRVYFVPAVKEYCRTNNLAFKAILVLDNAP 245          
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010132.1 (pep scaffold:Pmarinus_7.0:GL477949:48477:51271:1 gene:ENSPMAG00000009170.1 transcript:ENSPMAT00000010132.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 107.071 bits (266), Expect = 1.528e-25
Identity = 60/121 (49.59%), Postives = 79/121 (65.29%), Query Frame = 1
Query:    1 ETGLFWKKMPRRTYITAEEDAMPGHKPMKDRLSLLFCANASSDLKVKLLLVYHSETPRAFKKCKVQKNRLNVMWRSNKKAWVTRDLFTDWLNNVFGPSVKNYXXXXXXXXXXXXXMDNAPN 363
            ET LFWK+MP  T+++ E+   PG K  KDRL+LL  AN + D ++K LLVYHS+TPR  K C   K  L + WRSNKK W+T  +F DWL N F P+++ Y   +NL L  LL+ +NAP 
Sbjct:  186 ETRLFWKRMPASTFLSREKKTAPGFKASKDRLALLVGANGAGDCRLKPLLVYHSKTPRYLKGC--IKADLPI-WRSNKKGWITASVFLDWLKNHFCPAIEKYCKKKNLDLKALLLRNNAPG 303          
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001313.1 (pep scaffold:Pmarinus_7.0:GL487606:277:3092:-1 gene:ENSPMAG00000001181.1 transcript:ENSPMAT00000001313.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 107.071 bits (266), Expect = 1.530e-25
Identity = 60/121 (49.59%), Postives = 79/121 (65.29%), Query Frame = 1
Query:    1 ETGLFWKKMPRRTYITAEEDAMPGHKPMKDRLSLLFCANASSDLKVKLLLVYHSETPRAFKKCKVQKNRLNVMWRSNKKAWVTRDLFTDWLNNVFGPSVKNYXXXXXXXXXXXXXMDNAPN 363
            ET LFWK+MP  T+++ E+   PG K  KDRL+LL  AN + D ++K LLVYHS+TPR  K C   K  L + WRSNKK W+T  +F DWL N F P+++ Y   +NL L  LL+ +NAP 
Sbjct:  187 ETRLFWKRMPASTFLSREKKTAPGFKASKDRLALLVGANGAGDCRLKPLLVYHSKTPRYLKGC--IKADLPI-WRSNKKGWITASVFLDWLKNHFCPAIEKYCKKKNLDLKALLLRNNAPG 304          
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004972.1 (pep scaffold:Pmarinus_7.0:GL476545:74372:75575:-1 gene:ENSPMAG00000004517.1 transcript:ENSPMAT00000004972.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 72.7886 bits (177), Expect = 3.831e-23
Identity = 43/100 (43.00%), Postives = 58/100 (58.00%), Query Frame = 1
Query:   64 MPGHKPMKDRLSLLFCANASSDLKVKLLLVYHSETPRAFKKCKVQKNRLNVMWRSNKKAWVTRDLFTDWLNNVFGPSVKNYXXXXXXXXXXXXXMDNAPN 363
            M G K  KDRL+LL   N +   K+K  ++YHS   RA    ++ KN L V +R NKKAW+T  LF DW  N F P VK +     +P  ++L++DNAP 
Sbjct:  178 MAGFKAFKDRLTLLLGGNVAV-YKLKPFMIYHSTNARAL--ARISKNMLPVHYRHNKKAWMTAVLFEDWFVNCFIPEVKEHCRKNGIPFKIMLILDNAPG 274          

HSP 2 Score: 52.7582 bits (125), Expect = 3.831e-23
Identity = 34/105 (32.38%), Postives = 55/105 (52.38%), Query Frame = 2
Query:  359 LINAPAHSPGLQDDFVEEFKFIKIQFMPPNTTALLQPMDQQVISNFKKLYTKALFEHCFEMTEKTNLTLREFWKDHFHIVACLKIIETAWEAVTKRTLISAWKKL 673
            L NAP H   + D+         + F+PPNTT+++QPMDQ  ++  + L ++   +H  E  E     LR  WK+  +++  ++ I  AW+ VTK  +   WK L
Sbjct:  269 LDNAPGHLQYIGDNDPNV-----VVFLPPNTTSIIQPMDQGAVATSQGLLSE---KHATEEKE-----LRMIWKES-NVLNAIRNIGRAWKEVTKECMNGIWKNL 359          
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Nematostella
Match: EDO44738 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RUQ6])

HSP 1 Score: 52.373 bits (124), Expect = 1.944e-7
Identity = 27/94 (28.72%), Postives = 49/94 (52.13%), Query Frame = 1
Query:    1 ETGLFWKKMPRRTYITAEEDAMPGHKPMKDRLSLLFCANASSDLKVKLLLVYHSETPRAFKKCKVQKNRLNVMWRSNKKAWVTRDLFTDWLNNV 282
            ETGL+++ +P +  +   E          +RL++  C N   + + K L++  +  P  F   K+    L V+WR+N++AW+T  +F DWL  +
Sbjct:  168 ETGLYYRALPDKNLVPETESTS------TERLTVTLCCNMDGEFE-KPLVIGPTANPPCF--AKLDSECLPVIWRANRRAWITTSIFADWLRTL 252          
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Medaka
Match: ENSORLT00000036785.1 (pep primary_assembly:ASM223467v1:22:11796267:11802170:-1 gene:ENSORLG00000024024.1 transcript:ENSORLT00000036785.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 97.8265 bits (242), Expect = 3.264e-33
Identity = 52/163 (31.90%), Postives = 91/163 (55.83%), Query Frame = 2
Query:  377 HSPGLQDDFVEEFKFIKIQFMPPNTTALLQPMDQQVISNFKKLYTKALFEHCFE-MTEKTNLTLREFWKDHFHIVACLKIIETAWEAVTKRTLISAWKKLWPDG---DGECNFEGVETLPVESVVNEIVSLATTMGLEVNVNDIHELVKEPSQELTTEELMEL 853
            ++ G  DD   +   ++I+F+PPNT++L+QPMDQ +I  FK LYT+   +H  + M    N + +++W++ + I +CL+ I+ A + +   TL   W+KLWP+      E   + +    VE+ V+    L      E+  +D++ L+   SQ LT E+L E+
Sbjct:  269 NAGGFADDLSHDG--VQIEFLPPNTSSLIQPMDQGIIRTFKALYTRNTLQHLVDAMDSDQNFSFKDYWRE-YTIASCLQHIQRAHQEMKSETLNGCWEKLWPEAVHNPTESRLDEIHRSVVETAVSLAKRLRGDGFDEITSDDVNSLIDAHSQPLTDEDLAEM 428          

HSP 2 Score: 63.929 bits (154), Expect = 3.264e-33
Identity = 44/119 (36.97%), Postives = 64/119 (53.78%), Query Frame = 1
Query:    1 ETGLFWKKMPRRTYITAEEDAMPGHKPMKDRLSLLFCANASSDLKVKLLLVYHSETPRAFKKCKVQKNRLNVMWRSNKKAWVTRDLFTDWLNNVFGPSVKNYXXXXXXXXXXXXXMDNA 357
            ETGLFWK++P +   +       G +  KDR++L+ C NA+    +K  L+   + PRA K   +  + L V W  N  AW+T+ L  +W    F P VK YL  + L   VLL++DNA
Sbjct:  162 ETGLFWKQIPSQAKAS-------GFRGQKDRVTLVMCGNAAG-FMIKPGLISRLKNPRALKNKNM--SALPVYWMHNTMAWMTKALNLNWFKGCFIPEVKGYLTEKGLDFKVLLLIDNA 270          
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Medaka
Match: ENSORLT00000031980.1 (pep primary_assembly:ASM223467v1:3:6881985:6888319:-1 gene:ENSORLG00000025652.1 transcript:ENSORLT00000031980.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 102.064 bits (253), Expect = 2.195e-23
Identity = 69/177 (38.98%), Postives = 90/177 (50.85%), Query Frame = 1
Query:    1 ETGLFWKKMPRRTYITAEEDAMPGHKPMKDRLSLLFCANASSDLKVKLLLVYHSETPRAFKKCKVQKNRLNVMWRSNKKAWVTRDLFTDWLNNVFGPSVKNYXXXXXXXXXXXXXMDNAPNKXXXXXXXXXXXXXXXIQIHQDPIHASQYHCLTPAYGPAGYFEL*EALHQGTLRAL 531
            ETGLFWK+MP RT+I  EE   PG K  KDRL+L+ C NA+    +K  L+Y S+ PRA K     K+ L+V W  N KAW+T+ L  DW  N F P VK YL  + L   VLL++DNA                     H D +    Y C+   + P     L + + QG +RA 
Sbjct:  116 ETGLFWKRMPSRTFIMQEEAKAPGFKAQKDRLTLVKCGNAAG-FMIKPGLIYRSKNPRALK--NKNKDDLHVCWMYNAKAWMTKALNLDWFKNCFIPQVKCYLRGKGLDFKVLLLVDNAGG-------------------HADDL---AYDCVQIKFLPPNTTSLIQPMDQGIIRAF 267          

HSP 2 Score: 84.3445 bits (207), Expect = 2.127e-17
Identity = 42/108 (38.89%), Postives = 66/108 (61.11%), Query Frame = 2
Query:  365 NAPAHSPGLQDDFVEEFKFIKIQFMPPNTTALLQPMDQQVISNFKKLYTKALFEHCFE-MTEKTNLTLREFWKDHFHIVACLKIIETAWEAVTKRTLISAWKKLWPDG 685
            NA  H+  L  D V+      I+F+PPNTT+L+QPMDQ +I  FK LYT+   +H  + M    + +L+++W+  + I +CL+ I+ A + +   TL + WKKLWP+ 
Sbjct:  230 NAGGHADDLAYDCVQ------IKFLPPNTTSLIQPMDQGIIRAFKALYTRNTLQHLVDAMDSDQDSSLKDYWRG-YTIASCLQNIQRAIQEMKTETLNACWKKLWPEA 330          
BLAST of Tigger transposable element-derived protein 1 vs. Planmine SMEST
Match: SMESG000037674.1 (SMESG000037674.1)

HSP 1 Score: 219.935 bits (559), Expect = 7.107e-70
Identity = 128/143 (89.51%), Postives = 132/143 (92.31%), Query Frame = 2
Query:  608 KIIETAWEAVTKRTLISAWKKLWPDGDGECNFEGVETLPVESVVNEIVSLATTMGLEVNVNDIHELVKEPSQELTTEELMELHYXXXXXXXXXXXXXXXXGTIKQQSSGAIREMLKSWETAASYIEKYHPDKAVAMRATNLFN 1036
            KIIET WEAVTKRT+IS  KKLWP GDGECNFEGVETLPVES+VN+IVSLATTMGLEVNVNDIHELVKEP QELTTEE MELHYVSQEEVVEEIMSEKEEGTI QQSSGAIREMLKSWETAASYIEKYHPDKAVA +   LFN
Sbjct:   14 KIIETVWEAVTKRTIISERKKLWPYGDGECNFEGVETLPVESLVNKIVSLATTMGLEVNVNDIHELVKEPIQELTTEEQMELHYVSQEEVVEEIMSEKEEGTINQQSSGAIREMLKSWETAASYIEKYHPDKAVARQ---LFN 153          
BLAST of Tigger transposable element-derived protein 1 vs. Planmine SMEST
Match: SMESG000057528.1 (SMESG000057528.1)

HSP 1 Score: 75.485 bits (184), Expect = 4.482e-15
Identity = 47/135 (34.81%), Postives = 72/135 (53.33%), Query Frame = 2
Query:  428 IQFMPPNTTALLQPMDQQVISNFKKLYTKALFEHCFEMTEKTNLTLREFWKDHFHIVACLKIIETAWEAVTKRTLISAWKKLWPD---GDGECNFEGVETLPVESVVNEIVSLATTMGLE----VNVNDIHELVK 811
            I F+PPN T+L+QP+DQ +I+ FKK Y K+ +E   ++  +T L L + WK  F I+ C+  +  A   +   TL   WK +WP+   G+G           +  + +EI++LA   G E     N NDI EL +
Sbjct:   45 ILFIPPNMTSLIQPLDQGIIAPFKKYYIKSTYESILKIENET-LPLSKIWK-KFTILDCINHVANAINQIRPMTLNLCWKAIWPECVTGNG----------TIAEISDEIIALAHLFGGEGFETFNQNDIEELAR 167          
BLAST of Tigger transposable element-derived protein 1 vs. Planmine SMEST
Match: SMESG000057528.1 (SMESG000057528.1)

HSP 1 Score: 76.2554 bits (186), Expect = 6.272e-15
Identity = 47/136 (34.56%), Postives = 73/136 (53.68%), Query Frame = 2
Query:  425 KIQFMPPNTTALLQPMDQQVISNFKKLYTKALFEHCFEMTEKTNLTLREFWKDHFHIVACLKIIETAWEAVTKRTLISAWKKLWPD---GDGECNFEGVETLPVESVVNEIVSLATTMGLE----VNVNDIHELVK 811
            +I F+PPN T+L+QP+DQ +I+ FKK Y K+ +E   ++  +T L L + WK  F I+ C+  +  A   +   TL   WK +WP+   G+G           +  + +EI++LA   G E     N NDI EL +
Sbjct:  105 QILFIPPNMTSLIQPLDQGIIAPFKKYYIKSTYESILKIENET-LPLSKIWK-KFTILDCINHVANAINQIRPMTLNLCWKAIWPECVTGNG----------TIAEISDEIIALAHLFGGEGFETFNQNDIEELAR 228          
BLAST of Tigger transposable element-derived protein 1 vs. Planmine SMEST
Match: SMESG000057528.1 (SMESG000057528.1)

HSP 1 Score: 76.2554 bits (186), Expect = 6.581e-15
Identity = 47/136 (34.56%), Postives = 73/136 (53.68%), Query Frame = 2
Query:  425 KIQFMPPNTTALLQPMDQQVISNFKKLYTKALFEHCFEMTEKTNLTLREFWKDHFHIVACLKIIETAWEAVTKRTLISAWKKLWPD---GDGECNFEGVETLPVESVVNEIVSLATTMGLE----VNVNDIHELVK 811
            +I F+PPN T+L+QP+DQ +I+ FKK Y K+ +E   ++  +T L L + WK  F I+ C+  +  A   +   TL   WK +WP+   G+G           +  + +EI++LA   G E     N NDI EL +
Sbjct:  113 QILFIPPNMTSLIQPLDQGIIAPFKKYYIKSTYESILKIENET-LPLSKIWK-KFTILDCINHVANAINQIRPMTLNLCWKAIWPECVTGNG----------TIAEISDEIIALAHLFGGEGFETFNQNDIEELAR 236          
BLAST of Tigger transposable element-derived protein 1 vs. Planmine SMEST
Match: SMESG000027161.1 (SMESG000027161.1)

HSP 1 Score: 64.3142 bits (155), Expect = 1.406e-10
Identity = 35/103 (33.98%), Postives = 55/103 (53.40%), Query Frame = 1
Query:    1 ETGLFWKKMPRRTYITAEED-AMPGHKPMKDRLSLLFCANASSDLKVKLLLVYHSETPRAFKKCKVQKNRLNVMWRSNKKAWVTRDLFTDWLNNVFGPSVKNY 306
            ET L +K +P RT+ T  ++    G K  KDRL+LLFC N S   K++ L++  S+ PR F +  ++      +  +N  AW+    F DW +  F P V+ +
Sbjct:  372 ETDLCYKILPNRTFTTKTDNHKREGFKKRKDRLTLLFCVNKSGSHKLRPLMIGKSKAPRCFYRVNMKSPPFQYINSNN--AWMNTTAFYDWFHKTFVPDVRAH 472          
The following BLAST results are available for this feature:
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TIGD12.384e-4547.93tigger transposable element derived 1 [Source:HGNC... [more]
JRKL2.214e-2636.67JRK like [Source:HGNC Symbol;Acc:HGNC:6200][more]
TIGD26.530e-2333.33tigger transposable element derived 2 [Source:HGNC... [more]
TIGD26.530e-2333.33tigger transposable element derived 2 [Source:HGNC... [more]
TIGD71.764e-2235.29tigger transposable element derived 7 [Source:HGNC... [more]
back to top
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
kif63.095e-1435.64kinesin family member 6 [Source:Xenbase;Acc:XB-GEN... [more]
back to top
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Jrkl3.460e-2435.83Jrk-like [Source:MGI Symbol;Acc:MGI:1924782][more]
Tigd26.128e-2131.37tigger transposable element derived 2 [Source:MGI ... [more]
Jrk1.566e-1333.33jerky [Source:MGI Symbol;Acc:MGI:106214][more]
Tigd44.205e-731.91tigger transposable element derived 4 [Source:MGI ... [more]
back to top
BLAST of Tigger transposable element-derived protein 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q96MW7|TIGD1_HUMAN1.039e-4447.93Tigger transposable element-derived protein 1 OS=H... [more]
sp|Q9Y4A0|JERKL_HUMAN9.651e-2636.67Jerky protein homolog-like OS=Homo sapiens OX=9606... [more]
sp|B2RRL2|JERKL_MOUSE2.083e-2335.83Jerky protein homolog-like OS=Mus musculus OX=1009... [more]
sp|Q4W5G0|TIGD2_HUMAN2.847e-2233.33Tigger transposable element-derived protein 2 OS=H... [more]
sp|Q6NT04|TIGD7_HUMAN7.692e-2235.29Tigger transposable element-derived protein 7 OS=H... [more]
back to top
BLAST of Tigger transposable element-derived protein 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3B3R9B82.753e-13165.34HTH CENPB-type domain-containing protein OS=Paramo... [more]
A0A3Q3IBC01.605e-13064.80HTH CENPB-type domain-containing protein OS=Monopt... [more]
A0A4Y2CVZ59.161e-12870.66Tigger transposable element-derived protein 1 OS=A... [more]
A0A2J7RCR52.809e-12576.68DDE-1 domain-containing protein OS=Cryptotermes se... [more]
A0A2J7R1261.363e-11774.31DDE-1 domain-containing protein OS=Cryptotermes se... [more]
back to top
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000005656.13.860e-3153.72pep scaffold:Pmarinus_7.0:GL476578:539135:542172:1... [more]
ENSPMAT00000003106.15.223e-2933.72pep scaffold:Pmarinus_7.0:GL476998:37517:41189:1 g... [more]
ENSPMAT00000010132.11.528e-2549.59pep scaffold:Pmarinus_7.0:GL477949:48477:51271:1 g... [more]
ENSPMAT00000001313.11.530e-2549.59pep scaffold:Pmarinus_7.0:GL487606:277:3092:-1 gen... [more]
ENSPMAT00000004972.13.831e-2343.00pep scaffold:Pmarinus_7.0:GL476545:74372:75575:-1 ... [more]
back to top
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO447381.944e-728.72Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSORLT00000036785.13.264e-3331.90pep primary_assembly:ASM223467v1:22:11796267:11802... [more]
ENSORLT00000031980.12.195e-2338.98pep primary_assembly:ASM223467v1:3:6881985:6888319... [more]
back to top
BLAST of Tigger transposable element-derived protein 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000037674.17.107e-7089.51SMESG000037674.1[more]
SMESG000057528.14.482e-1534.81SMESG000057528.1[more]
SMESG000057528.16.272e-1534.56SMESG000057528.1[more]
SMESG000057528.16.581e-1534.56SMESG000057528.1[more]
SMESG000027161.11.406e-1033.98SMESG000027161.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30009023 ID=SMED30009023|Name=Tigger transposable element-derived protein 1|organism=Schmidtea mediterranea sexual|type=transcript|length=1467bp
GAGACGGGTCTTTTCTGGAAAAAGATGCCTAGGCGAACTTATATTACTGC
AGAGGAGGATGCAATGCCCGGGCACAAGCCAATGAAAGACCGCCTCTCGC
TACTTTTTTGTGCTAATGCAAGCAGCGATTTGAAAGTTAAACTGCTGCTT
GTTTATCATTCTGAAACCCCACGAGCATTCAAGAAGTGTAAAGTCCAAAA
AAACAGGCTAAATGTGATGTGGAGGTCAAACAAAAAGGCGTGGGTGACAC
GTGACCTTTTTACTGATTGGCTCAATAATGTGTTTGGTCCGTCTGTGAAA
AATTATTTACTTCATGAGAATCTGCCGTTACATGTCTTGCTTGTTATGGA
TAACGCACCTAATAAACGCACCTGCTCATTCTCCAGGCCTACAAGATGAT
TTCGTTGAAGAATTCAAATTCATCAAGATCCAATTCATGCCTCCCAATAC
CACTGCCTTACTCCAGCCTATGGACCAGCAGGTTATTTCGAACTTTAAGA
AGCTCTACACCAAGGCACTCTTCGAGCACTGTTTTGAAATGACTGAAAAG
ACCAATCTCACTCTCAGAGAGTTTTGGAAAGATCACTTCCACATCGTTGC
CTGCCTCAAGATTATCGAAACGGCATGGGAGGCAGTTACCAAGAGAACTC
TCATTTCTGCGTGGAAGAAACTTTGGCCAGATGGTGATGGCGAATGTAAC
TTTGAGGGGGTTGAAACATTACCCGTAGAGTCTGTAGTTAACGAGATCGT
GTCTTTGGCTACGACCATGGGACTAGAGGTAAATGTAAATGATATCCACG
AGCTTGTGAAAGAGCCTAGCCAAGAGCTGACCACTGAAGAGCTAATGGAG
TTACATTACGTTTCTCAAGAAGAAGTTGTGGAGGAGATTATGTCAGAGAA
GGAGGAGGGAACAATAAAGCAGCAATCTTCTGGCGCAATAAGAGAAATGT
TGAAATCATGGGAAACTGCTGCGTCGTACATTGAGAAATATCACCCCGAT
AAAGCAGTAGCTATGCGCGCTACAAATTTATTTAATGATAATGCCGTATT
GCCTTTTTACCAAATTTTGAAGCGTCGCCAAAAACAACCGTCACTAGACA
GCTTTTTAATAAAAAAAAATTAGTTATATATCATTACAACAAATTTATTA
TTCGAATACTTTTTAATTTTTGTAAAATGAATTCGCATTACAGGTTGGTT
TATTCCGTTACAAAAAGAAAGACCAAGATGGTCTACAATCCTTAACAACA
TGATCATGTATATAATTTTCATTTAATAAAAGTATGTCATAAAATTTTTT
GTGTATTTTTTTCGGCACGGAACGAATTATCGTATTTTATCTTAATTTAT
ATGGGAAGCGTTGTTTCGCTTAACGAGTGTTTCGCTTTACGAGGAACGTT
TTGGAACGAATTATGCTCGTTATGCGAGGTTCCACTGTATATCAAAAAAC
ATGTGTTTAAGTGGCAC
back to top

protein sequence of SMED30009023-orf-1

>SMED30009023-orf-1 ID=SMED30009023-orf-1|Name=SMED30009023-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=133bp
ETGLFWKKMPRRTYITAEEDAMPGHKPMKDRLSLLFCANASSDLKVKLLL
VYHSETPRAFKKCKVQKNRLNVMWRSNKKAWVTRDLFTDWLNNVFGPSVK
NYLLHENLPLHVLLVMDNAPNKRTCSFSRPTR*
back to top

protein sequence of SMED30009023-orf-2

>SMED30009023-orf-2 ID=SMED30009023-orf-2|Name=SMED30009023-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=270bp
MRICRYMSCLLWITHLINAPAHSPGLQDDFVEEFKFIKIQFMPPNTTALL
QPMDQQVISNFKKLYTKALFEHCFEMTEKTNLTLREFWKDHFHIVACLKI
IETAWEAVTKRTLISAWKKLWPDGDGECNFEGVETLPVESVVNEIVSLAT
TMGLEVNVNDIHELVKEPSQELTTEELMELHYVSQEEVVEEIMSEKEEGT
IKQQSSGAIREMLKSWETAASYIEKYHPDKAVAMRATNLFNDNAVLPFYQ
ILKRRQKQPSLDSFLIKKN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0003677DNA binding
GO:0003676nucleic acid binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR004875DDE_SF_endonuclease_dom