Alpha/beta hydrolase

Overview
NameAlpha/beta hydrolase
Smed IDSMED30009014
Length (bp)1187
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Alpha/beta hydrolase (SMED30009014) t-SNE clustered cells

Violin plots show distribution of expression levels for Alpha/beta hydrolase (SMED30009014) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Alpha/beta hydrolase (SMED30009014) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Alpha/beta hydrolase (SMED30009014) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30009014

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30009014SMESG000022359.1 dd_Smed_v4_10155_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30009014SMESG000022359.1 dd_Smed_v4_10155_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Category 4 cellSMED30009014SMESG000022359.1 dd_Smed_v4_10155_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30009014SMESG000022359.1 dd_Smed_v4_10155_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30009014SMESG000022359.1 dd_Smed_v4_10155_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Alpha/beta hydrolase vs. Ensembl Human
Match: MGLL (monoglyceride lipase [Source:HGNC Symbol;Acc:HGNC:17038])

HSP 1 Score: 140.584 bits (353), Expect = 4.586e-38
Identity = 83/272 (30.51%), Postives = 141/272 (51.84%), Query Frame = 2
Query:  128 YFINPDGVKLFKQLWRPNAQNIRAFVFIIHGLSENSSFYYEDLVAKPLNEIGCLVAAHDQVGHGKSEGNRRLLEKIDNLSRDVVAHIELIRKTENLSSDIPTFLYGHSMGGLVATVTAHNYPEIINGMVLESPPLTLDGKIGPWMKYFAL-AMSYVIPYYKVGKQDLENLTHNTEVIQVALNDPYRHNEPMTLTTAVQIGEAIHYLQSVFKEMTTPFLIAHGEHDVIVSIAGSQKLYKESKTKDKSLLVFKNAYHIIRVDSQEFRENIVEWI 940
            + +N DG  LF + W+P     +A +F+ HG  E+S  Y E  +A+ L  +  LV AHD VGHG+SEG R ++       RDV+ H++ ++K       +P FL GHSMGG +A +TA   P    GMVL SP +  + +     K  A   ++ V+P   +G  D   L+ N   + +  +DP      + +   +Q+  A+  ++    ++T PFL+  G  D +    G+  L + +K++DK+L +++ AYH++  +  E   ++   I
Sbjct:   21 HLVNADGQYLFCRYWKPTGTP-KALIFVSHGAGEHSGRYEE--LARMLMGLDLLVFAHDHVGHGQSEGERMVVSDFHVFVRDVLQHVDSMQKD---YPGLPVFLLGHSMGGAIAILTAAERPGHFAGMVLISPLVLANPESATTFKVLAAKVLNLVLPNLSLGPIDSSVLSRNKTEVDIYNSDPLICRAGLKVCFGIQLLNAVSRVERALPKLTVPFLLLQGSADRLCDSKGAYLLMELAKSQDKTLKIYEGAYHVLHKELPEVTNSVFHEI 286          
BLAST of Alpha/beta hydrolase vs. Ensembl Human
Match: MGLL (monoglyceride lipase [Source:HGNC Symbol;Acc:HGNC:17038])

HSP 1 Score: 140.584 bits (353), Expect = 4.586e-38
Identity = 83/272 (30.51%), Postives = 141/272 (51.84%), Query Frame = 2
Query:  128 YFINPDGVKLFKQLWRPNAQNIRAFVFIIHGLSENSSFYYEDLVAKPLNEIGCLVAAHDQVGHGKSEGNRRLLEKIDNLSRDVVAHIELIRKTENLSSDIPTFLYGHSMGGLVATVTAHNYPEIINGMVLESPPLTLDGKIGPWMKYFAL-AMSYVIPYYKVGKQDLENLTHNTEVIQVALNDPYRHNEPMTLTTAVQIGEAIHYLQSVFKEMTTPFLIAHGEHDVIVSIAGSQKLYKESKTKDKSLLVFKNAYHIIRVDSQEFRENIVEWI 940
            + +N DG  LF + W+P     +A +F+ HG  E+S  Y E  +A+ L  +  LV AHD VGHG+SEG R ++       RDV+ H++ ++K       +P FL GHSMGG +A +TA   P    GMVL SP +  + +     K  A   ++ V+P   +G  D   L+ N   + +  +DP      + +   +Q+  A+  ++    ++T PFL+  G  D +    G+  L + +K++DK+L +++ AYH++  +  E   ++   I
Sbjct:   21 HLVNADGQYLFCRYWKPTGTP-KALIFVSHGAGEHSGRYEE--LARMLMGLDLLVFAHDHVGHGQSEGERMVVSDFHVFVRDVLQHVDSMQKD---YPGLPVFLLGHSMGGAIAILTAAERPGHFAGMVLISPLVLANPESATTFKVLAAKVLNLVLPNLSLGPIDSSVLSRNKTEVDIYNSDPLICRAGLKVCFGIQLLNAVSRVERALPKLTVPFLLLQGSADRLCDSKGAYLLMELAKSQDKTLKIYEGAYHVLHKELPEVTNSVFHEI 286          
BLAST of Alpha/beta hydrolase vs. Ensembl Human
Match: MGLL (monoglyceride lipase [Source:HGNC Symbol;Acc:HGNC:17038])

HSP 1 Score: 140.584 bits (353), Expect = 6.352e-38
Identity = 83/272 (30.51%), Postives = 141/272 (51.84%), Query Frame = 2
Query:  128 YFINPDGVKLFKQLWRPNAQNIRAFVFIIHGLSENSSFYYEDLVAKPLNEIGCLVAAHDQVGHGKSEGNRRLLEKIDNLSRDVVAHIELIRKTENLSSDIPTFLYGHSMGGLVATVTAHNYPEIINGMVLESPPLTLDGKIGPWMKYFAL-AMSYVIPYYKVGKQDLENLTHNTEVIQVALNDPYRHNEPMTLTTAVQIGEAIHYLQSVFKEMTTPFLIAHGEHDVIVSIAGSQKLYKESKTKDKSLLVFKNAYHIIRVDSQEFRENIVEWI 940
            + +N DG  LF + W+P     +A +F+ HG  E+S  Y E  +A+ L  +  LV AHD VGHG+SEG R ++       RDV+ H++ ++K       +P FL GHSMGG +A +TA   P    GMVL SP +  + +     K  A   ++ V+P   +G  D   L+ N   + +  +DP      + +   +Q+  A+  ++    ++T PFL+  G  D +    G+  L + +K++DK+L +++ AYH++  +  E   ++   I
Sbjct:   31 HLVNADGQYLFCRYWKPTG-TPKALIFVSHGAGEHSGRYEE--LARMLMGLDLLVFAHDHVGHGQSEGERMVVSDFHVFVRDVLQHVDSMQKD---YPGLPVFLLGHSMGGAIAILTAAERPGHFAGMVLISPLVLANPESATTFKVLAAKVLNLVLPNLSLGPIDSSVLSRNKTEVDIYNSDPLICRAGLKVCFGIQLLNAVSRVERALPKLTVPFLLLQGSADRLCDSKGAYLLMELAKSQDKTLKIYEGAYHVLHKELPEVTNSVFHEI 296          
BLAST of Alpha/beta hydrolase vs. Ensembl Human
Match: MGLL (monoglyceride lipase [Source:HGNC Symbol;Acc:HGNC:17038])

HSP 1 Score: 130.183 bits (326), Expect = 1.482e-34
Identity = 78/247 (31.58%), Postives = 128/247 (51.82%), Query Frame = 2
Query:  128 YFINPDGVKLFKQLWRPNAQNIRAFVFIIHGLSENSSFYYEDLVAKPLNEIGCLVAAHDQVGHGKSEGNRRLLEKIDNLSRDVVAHIELIRKTENLSSDIPTFLYGHSMGGLVATVTAHNYPEIINGMVLESPPLTLDGKIGPWMKYFAL-AMSYVIPYYKVGKQDLENLTHNTEVIQVALNDPYRHNEPMTLTTAVQIGEAIHYLQSVFKEMTTPFLIAHGEHDVIVSIAGSQKLYKESKTKDKSL 865
            + +N DG  LF + W+P     +A +F+ HG  E+S  Y E  +A+ L  +  LV AHD VGHG+SEG R ++       RDV+ H++ ++K       +P FL GHSMGG +A +TA   P    GMVL SP +  + +     K  A   ++ V+P   +G  D   L+ N   + +  +DP      + +   +Q+  A+  ++    ++T PFL+  G  D +    G+  L + +K++DK+L
Sbjct:   21 HLVNADGQYLFCRYWKPTGTP-KALIFVSHGAGEHSGRYEE--LARMLMGLDLLVFAHDHVGHGQSEGERMVVSDFHVFVRDVLQHVDSMQKD---YPGLPVFLLGHSMGGAIAILTAAERPGHFAGMVLISPLVLANPESATTFKVLAAKVLNLVLPNLSLGPIDSSVLSRNKTEVDIYNSDPLICRAGLKVCFGIQLLNAVSRVERALPKLTVPFLLLQGSADRLCDSKGAYLLMELAKSQDKTL 261          
BLAST of Alpha/beta hydrolase vs. Ensembl Human
Match: MGLL (monoglyceride lipase [Source:HGNC Symbol;Acc:HGNC:17038])

HSP 1 Score: 122.865 bits (307), Expect = 1.162e-31
Identity = 81/271 (29.89%), Postives = 131/271 (48.34%), Query Frame = 2
Query:  128 YFINPDGVKLFKQLWRPNAQNIRAFVFIIHGLSENSSFYYEDLVAKPLNEIGCLVAAHDQVGHGKSEGNRRLLEKIDNLSRDVVAHIELIRKTENLSSDIPTFLYGHSMGGLVATVTAHNYPEIINGMVLESPPLTLDGKIGPWMKYFALAMSYVIPYYKVGKQDLENLTHNTEVIQVALNDPYRHNEPMTLTTAVQIGEAIHYLQSVFKEMTTPFLIAHGEHDVIVSIAGSQKLYKESKTKDKSLLVFKNAYHIIRVDSQEFRENIVEWI 940
            + +N DG  LF + W+P     +A +F+ HG  E+S  Y E  +A+ L  +  LV AHD VGHG+SEG R ++       RDV+ H++ ++K       +P FL GHSMGG +A +TA   P    GMVL SP                LA       +KV   D+ N            +DP      + +   +Q+  A+  ++    ++T PFL+  G  D +    G+  L + +K++DK+L +++ AYH++  +  E   ++   I
Sbjct:   31 HLVNADGQYLFCRYWKPTG-TPKALIFVSHGAGEHSGRYEE--LARMLMGLDLLVFAHDHVGHGQSEGERMVVSDFHVFVRDVLQHVDSMQKD---YPGLPVFLLGHSMGGAIAILTAAERPGHFAGMVLISP--------------LVLANPESATTFKV---DIYN------------SDPLICRAGLKVCFGIQLLNAVSRVERALPKLTVPFLLLQGSADRLCDSKGAYLLMELAKSQDKTLKIYEGAYHVLHKELPEVTNSVFHEI 266          
BLAST of Alpha/beta hydrolase vs. Ensembl Zebrafish
Match: mgll (monoglyceride lipase [Source:ZFIN;Acc:ZDB-GENE-031006-9])

HSP 1 Score: 139.043 bits (349), Expect = 1.119e-37
Identity = 81/276 (29.35%), Postives = 147/276 (53.26%), Query Frame = 2
Query:  128 YFINPDGVKLFKQLWRPNAQNIRAFVFIIHGLSENSSFYYEDLVAKPLNEIGCLVAAHDQVGHGKSEGNRRLLEKIDNLSRDVVAHIELIRKTENLSSDIPTFLYGHSMGGLVATVTAHNYPEIINGMVLESPPLTLDGKIG-PWMKYFALAMSYVIPYYKVGKQDLENLTHNTEVIQVALNDPYRHNEPMTLTTAVQIGEAIHYLQSVFKEMTTPFLIAHGEHDVIVSIAGSQKLYKESKTKDKSLLVFKNAYHIIRVDSQEFRENIVE----WI 940
            + +N DG+ LF + W P+    +A V++ HG  E+   Y +  +A  L + G LV AHD VGHG+SEG R  L+      RD + HI++++        +  F+ GHSMGG ++ +TA   P+   G+VL  P + +  +   P+  + A  ++ + P   +G  D + ++ + + ++    D   ++  + ++  +Q+ +A   ++    ++  PF I HG+ D +  I GS+ LY E+K+ DK L V++ AYH +  D  E  E++++    WI
Sbjct:   21 HIVNADGLHLFCRYWEPDGPP-KALVYVAHGAGEHCGGYAD--IAHSLTQHGILVFAHDHVGHGQSEGERMELKNFQIYVRDSLQHIDIMKAR---YPKLAVFIVGHSMGGAISILTACERPQDFTGVVLIGPMVQMSAESATPFKVFMAKVLNRLAPKLTLGPIDPKFVSRDPKQVEAYEKDELNYHGGLRVSFGMQMLDATSRIERELPDIRWPFYILHGDADKLCDIRGSRLLYNEAKSTDKKLKVYEEAYHALHHDLPETIESVLKEVSTWI 290          
BLAST of Alpha/beta hydrolase vs. Ensembl Zebrafish
Match: mgll (monoglyceride lipase [Source:ZFIN;Acc:ZDB-GENE-031006-9])

HSP 1 Score: 95.5153 bits (236), Expect = 4.983e-22
Identity = 57/206 (27.67%), Postives = 107/206 (51.94%), Query Frame = 2
Query:  116 SKKEYFINPDGVKLFKQLWRPNAQNIRAFVFIIHGLSENSSFYYEDLVAKPLNEIGCLVAAHDQVGHGKSEGNRRLLEKIDNLSRDVVAHIELIRKTENLSSDIPTFLYGHSMGGLVATVTAHNYPEIINGMVLESPPLTLDGKIG-PWMKYFALAMSYVIPYYKVGKQDLENLTHNTEVIQVALNDPYRHNEPMTLTTAVQIGEA 730
            S   + +N DG+ LF + W P+    +A V++ HG  E+   Y +  +A  L + G LV AHD VGHG+SEG R  L+      RD + HI++++        +  F+ GHSMGG ++ +TA   P+   G+VL  P + +  +   P+  + A  ++ + P   +G  D + ++ + + ++    D   ++  + ++  +Q+ +A
Sbjct:   60 SDLPHIVNADGLHLFCRYWEPDGPP-KALVYVAHGAGEHCGGYAD--IAHSLTQHGILVFAHDHVGHGQSEGERMELKNFQIYVRDSLQHIDIMKAR---YPKLAVFIVGHSMGGAISILTACERPQDFTGVVLIGPMVQMSAESATPFKVFMAKVLNRLAPKLTLGPIDPKFVSRDPKQVEAYEKDELNYHGGLRVSFGMQMLDA 259          
BLAST of Alpha/beta hydrolase vs. Ensembl Xenopus
Match: slc35d1 (solute carrier family 35 member D1 [Source:Xenbase;Acc:XB-GENE-992383])

HSP 1 Score: 149.443 bits (376), Expect = 3.189e-41
Identity = 84/273 (30.77%), Postives = 148/273 (54.21%), Query Frame = 2
Query:  128 YFINPDGVKLFKQLWRPNAQNIRAFVFIIHGLSENSSFYYEDLVAKPLNEIGCLVAAHDQVGHGKSEGNRRLLEKIDNLSRDVVAHIELIRKTENLSSDIPTFLYGHSMGGLVATVTAHNYPEIINGMVLESPPLTLDGKIGPWMKYFALAM-SYVIPYYKVGKQDLENLTHNTEVIQVALNDPYRHNEPMTLTTAVQIGEAIHYLQSVFKEMTTPFLIAHGEHDVIVSIAGSQKLYKESKTKDKSLLVFKNAYHIIRVDSQEFRENIVEWIE 943
            ++IN DG  +F + W+P+  + RA +FI+HG  E+   Y  D +A+ L  +  +V +HD VGHG+SEG R  +       RDV+ H++L++K       +P F+ GHSMGG +A +TA   P+  +G++L SP +  + +     K FA  M +YV+P   +G  D   ++ N + ++   +DP  ++  M ++  VQ+  A   ++        P L+ HG  D +  I GS  +    ++++K+L V++ A+H +  +  E   N+ + IE
Sbjct:   43 HYINADGQHIFSRYWKPSG-SPRALMFIVHGAGEHCCRY--DDLAQILTALNFVVFSHDHVGHGQSEGERMTVPDFHIFVRDVIQHLDLMKKQ---YPGLPLFMCGHSMGGAIAILTADERPDDFSGLILISPLVLPNPQSATSFKVFAAKMLNYVLPNLSLGSIDPNFVSRNKKEVEAYTSDPLVYHGGMKVSFGVQLLNATSRVEKALPHFKVPLLLFHGTLDKLCDIRGSHVMMDTIQSEEKTLKVYEGAFHALHKELPEVTSNVFQEIE 309          
BLAST of Alpha/beta hydrolase vs. Ensembl Mouse
Match: Mgll (monoglyceride lipase [Source:MGI Symbol;Acc:MGI:1346042])

HSP 1 Score: 147.132 bits (370), Expect = 9.333e-41
Identity = 83/280 (29.64%), Postives = 146/280 (52.14%), Query Frame = 2
Query:  128 YFINPDGVKLFKQLWRPNAQNIRAFVFIIHGLSENSSFYYEDLVAKPLNEIGCLVAAHDQVGHGKSEGNRRLLEKIDNLSRDVVAHIELIRKTENLSSDIPTFLYGHSMGGLVATVTAHNYPEIINGMVLESPPLTLDGKIGPWMKYFALAM-SYVIPYYKVGKQDLENLTHNTEVIQVALNDPYRHNEPMTLTTAVQIGEAIHYLQSVFKEMTTPFLIAHGEHDVIVSIAGSQKLYKESKTKDKSLLVFKNAYHIIRVDSQEFRENIV----EWIEKHI 952
            + +N DG  LF + W+P+    +A +F+ HG  E+   Y  D +A  L  +  LV AHD VGHG+SEG R ++       RDV+ H++ I+K      D+P FL GHSMGG ++ + A   P   +GMVL SP +  + +    +K  A  + ++V+P   +G+ D   L+ N   + +  +DP      + +   +Q+  A+  ++     +T PFL+  G  D +    G+  L + S+++DK+L +++ AYH++  +  E   +++     W+   I
Sbjct:   21 HLVNADGQYLFCRYWKPSGTP-KALIFVSHGAGEHCGRY--DELAHMLKGLDMLVFAHDHVGHGQSEGERMVVSDFQVFVRDVLQHVDTIQKDY---PDVPIFLLGHSMGGAISILVAAERPTYFSGMVLISPLVLANPESASTLKVLAAKLLNFVLPNMTLGRIDSSVLSRNKSEVDLYNSDPLVCRAGLKVCFGIQLLNAVARVERAMPRLTLPFLLLQGSADRLCDSKGAYLLMESSRSQDKTLKMYEGAYHVLHRELPEVTNSVLHEVNSWVSHRI 294          
BLAST of Alpha/beta hydrolase vs. Ensembl Mouse
Match: Mgll (monoglyceride lipase [Source:MGI Symbol;Acc:MGI:1346042])

HSP 1 Score: 147.132 bits (370), Expect = 9.333e-41
Identity = 83/280 (29.64%), Postives = 146/280 (52.14%), Query Frame = 2
Query:  128 YFINPDGVKLFKQLWRPNAQNIRAFVFIIHGLSENSSFYYEDLVAKPLNEIGCLVAAHDQVGHGKSEGNRRLLEKIDNLSRDVVAHIELIRKTENLSSDIPTFLYGHSMGGLVATVTAHNYPEIINGMVLESPPLTLDGKIGPWMKYFALAM-SYVIPYYKVGKQDLENLTHNTEVIQVALNDPYRHNEPMTLTTAVQIGEAIHYLQSVFKEMTTPFLIAHGEHDVIVSIAGSQKLYKESKTKDKSLLVFKNAYHIIRVDSQEFRENIV----EWIEKHI 952
            + +N DG  LF + W+P+    +A +F+ HG  E+   Y  D +A  L  +  LV AHD VGHG+SEG R ++       RDV+ H++ I+K      D+P FL GHSMGG ++ + A   P   +GMVL SP +  + +    +K  A  + ++V+P   +G+ D   L+ N   + +  +DP      + +   +Q+  A+  ++     +T PFL+  G  D +    G+  L + S+++DK+L +++ AYH++  +  E   +++     W+   I
Sbjct:   21 HLVNADGQYLFCRYWKPSGTP-KALIFVSHGAGEHCGRY--DELAHMLKGLDMLVFAHDHVGHGQSEGERMVVSDFQVFVRDVLQHVDTIQKDY---PDVPIFLLGHSMGGAISILVAAERPTYFSGMVLISPLVLANPESASTLKVLAAKLLNFVLPNMTLGRIDSSVLSRNKSEVDLYNSDPLVCRAGLKVCFGIQLLNAVARVERAMPRLTLPFLLLQGSADRLCDSKGAYLLMESSRSQDKTLKMYEGAYHVLHRELPEVTNSVLHEVNSWVSHRI 294          
BLAST of Alpha/beta hydrolase vs. Ensembl Mouse
Match: Mgll (monoglyceride lipase [Source:MGI Symbol;Acc:MGI:1346042])

HSP 1 Score: 146.747 bits (369), Expect = 1.930e-40
Identity = 83/280 (29.64%), Postives = 146/280 (52.14%), Query Frame = 2
Query:  128 YFINPDGVKLFKQLWRPNAQNIRAFVFIIHGLSENSSFYYEDLVAKPLNEIGCLVAAHDQVGHGKSEGNRRLLEKIDNLSRDVVAHIELIRKTENLSSDIPTFLYGHSMGGLVATVTAHNYPEIINGMVLESPPLTLDGKIGPWMKYFALAM-SYVIPYYKVGKQDLENLTHNTEVIQVALNDPYRHNEPMTLTTAVQIGEAIHYLQSVFKEMTTPFLIAHGEHDVIVSIAGSQKLYKESKTKDKSLLVFKNAYHIIRVDSQEFRENIV----EWIEKHI 952
            + +N DG  LF + W+P+    +A +F+ HG  E+   Y  D +A  L  +  LV AHD VGHG+SEG R ++       RDV+ H++ I+K      D+P FL GHSMGG ++ + A   P   +GMVL SP +  + +    +K  A  + ++V+P   +G+ D   L+ N   + +  +DP      + +   +Q+  A+  ++     +T PFL+  G  D +    G+  L + S+++DK+L +++ AYH++  +  E   +++     W+   I
Sbjct:   37 HLVNADGQYLFCRYWKPSG-TPKALIFVSHGAGEHCGRY--DELAHMLKGLDMLVFAHDHVGHGQSEGERMVVSDFQVFVRDVLQHVDTIQKD---YPDVPIFLLGHSMGGAISILVAAERPTYFSGMVLISPLVLANPESASTLKVLAAKLLNFVLPNMTLGRIDSSVLSRNKSEVDLYNSDPLVCRAGLKVCFGIQLLNAVARVERAMPRLTLPFLLLQGSADRLCDSKGAYLLMESSRSQDKTLKMYEGAYHVLHRELPEVTNSVLHEVNSWVSHRI 310          
BLAST of Alpha/beta hydrolase vs. Ensembl Mouse
Match: Mgll (monoglyceride lipase [Source:MGI Symbol;Acc:MGI:1346042])

HSP 1 Score: 137.502 bits (345), Expect = 7.279e-37
Identity = 88/308 (28.57%), Postives = 151/308 (49.03%), Query Frame = 2
Query:  128 YFINPDGVKLFKQLWRPNAQNIRAFVFIIHGLSENSSFYYEDLVAKPLNEIGCLVAAHDQVGHGKSEGNRRLLEKIDNLSRDVVAHIELIRKTENLSSDIPTFLYGHSMGGLVATVTAHNYPEIINGMVLESPPL--------TLDGKIG--------------PWMKY----FALA---MSYVIPYYKVGKQDLENLTHNTEVIQVALNDPYRHNEPMTLTTAVQIGEAIHYLQSVFKEMTTPFLIAHGEHDVIVSIAGSQKLYKESKTKDKSLLVFKNAYHIIRVDSQEFRENIV----EWIEKHI 952
            + +N DG  LF + W+P+    +A +F+ HG  E+   Y  D +A  L  +  LV AHD VGHG+SEG R ++       RDV+ H++ I+K      D+P FL GHSMGG ++ + A   P   +GMVL SP +        TL  K+                W+ Y    + LA   +++V+P   +G+ D   L+ N   + +  +DP      + +   +Q+  A+  ++     +T PFL+  G  D +    G+  L + S+++DK+L +++ AYH++  +  E   +++     W+   I
Sbjct:   21 HLVNADGQYLFCRYWKPSGTP-KALIFVSHGAGEHCGRY--DELAHMLKGLDMLVFAHDHVGHGQSEGERMVVSDFQVFVRDVLQHVDTIQKDY---PDVPIFLLGHSMGGAISILVAAERPTYFSGMVLISPLVLANPESASTLKDKLHITKTSLEKAAEVSVTWIPYAFHLWVLAAKLLNFVLPNMTLGRIDSSVLSRNKSEVDLYNSDPLVCRAGLKVCFGIQLLNAVARVERAMPRLTLPFLLLQGSADRLCDSKGAYLLMESSRSQDKTLKMYEGAYHVLHRELPEVTNSVLHEVNSWVSHRI 322          
BLAST of Alpha/beta hydrolase vs. Ensembl Mouse
Match: Mgll (monoglyceride lipase [Source:MGI Symbol;Acc:MGI:1346042])

HSP 1 Score: 111.694 bits (278), Expect = 6.875e-28
Identity = 75/280 (26.79%), Postives = 127/280 (45.36%), Query Frame = 2
Query:  128 YFINPDGVKLFKQLWRPNAQNIRAFVFIIHGLSENSSFYYEDLVAKPLNEIGCLVAAHDQVGHGKSEGNRRLLEKIDNLSRDVVAHIELIRKTENLSSDIPTFLYGHSMGGLVATVTAHNYPEIINGMVLESPPLTLDGKIGPWMKYFALA-MSYVIPYYKVGKQDLENLTHNTEVIQVALNDPYRHNEPMTLTTAVQIGEAIHYLQSVFKEMTTPFLIAHGEHDVIVSIAGSQKLYKESKTKDKSLLVFKNAYHIIRVDSQEFRENIV----EWIEKHI 952
            + +N DG  LF + W+P+    +A +F+ HG  E+   Y  D +A  L  +  LV AHD VGHG+SEG R ++       RDV+ H++ I+K      D+P FL GHSMGG ++ + A   P   +GMVL SP +  + +    +K  A   +++V+P   +G+ D   L+ N                                              + G  D +    G+  L + S+++DK+L +++ AYH++  +  E   +++     W+   I
Sbjct:   21 HLVNADGQYLFCRYWKPSG-TPKALIFVSHGAGEHCGRY--DELAHMLKGLDMLVFAHDHVGHGQSEGERMVVSDFQVFVRDVLQHVDTIQKD---YPDVPIFLLGHSMGGAISILVAAERPTYFSGMVLISPLVLANPESASTLKVLAAKLLNFVLPNMTLGRIDSSVLSRNK---------------------------------------------SEGSADRLCDSKGAYLLMESSRSQDKTLKMYEGAYHVLHRELPEVTNSVLHEVNSWVSHRI 249          
BLAST of Alpha/beta hydrolase vs. UniProt/SwissProt
Match: sp|O35678|MGLL_MOUSE (Monoglyceride lipase OS=Mus musculus OX=10090 GN=Mgll PE=1 SV=1)

HSP 1 Score: 147.132 bits (370), Expect = 6.529e-40
Identity = 83/280 (29.64%), Postives = 146/280 (52.14%), Query Frame = 2
Query:  128 YFINPDGVKLFKQLWRPNAQNIRAFVFIIHGLSENSSFYYEDLVAKPLNEIGCLVAAHDQVGHGKSEGNRRLLEKIDNLSRDVVAHIELIRKTENLSSDIPTFLYGHSMGGLVATVTAHNYPEIINGMVLESPPLTLDGKIGPWMKYFALAM-SYVIPYYKVGKQDLENLTHNTEVIQVALNDPYRHNEPMTLTTAVQIGEAIHYLQSVFKEMTTPFLIAHGEHDVIVSIAGSQKLYKESKTKDKSLLVFKNAYHIIRVDSQEFRENIV----EWIEKHI 952
            + +N DG  LF + W+P+    +A +F+ HG  E+   Y  D +A  L  +  LV AHD VGHG+SEG R ++       RDV+ H++ I+K      D+P FL GHSMGG ++ + A   P   +GMVL SP +  + +    +K  A  + ++V+P   +G+ D   L+ N   + +  +DP      + +   +Q+  A+  ++     +T PFL+  G  D +    G+  L + S+++DK+L +++ AYH++  +  E   +++     W+   I
Sbjct:   21 HLVNADGQYLFCRYWKPSGTP-KALIFVSHGAGEHCGRY--DELAHMLKGLDMLVFAHDHVGHGQSEGERMVVSDFQVFVRDVLQHVDTIQKDY---PDVPIFLLGHSMGGAISILVAAERPTYFSGMVLISPLVLANPESASTLKVLAAKLLNFVLPNMTLGRIDSSVLSRNKSEVDLYNSDPLVCRAGLKVCFGIQLLNAVARVERAMPRLTLPFLLLQGSADRLCDSKGAYLLMESSRSQDKTLKMYEGAYHVLHRELPEVTNSVLHEVNSWVSHRI 294          
BLAST of Alpha/beta hydrolase vs. UniProt/SwissProt
Match: sp|Q8R431|MGLL_RAT (Monoglyceride lipase OS=Rattus norvegicus OX=10116 GN=Mgll PE=1 SV=1)

HSP 1 Score: 141.739 bits (356), Expect = 8.720e-38
Identity = 79/280 (28.21%), Postives = 146/280 (52.14%), Query Frame = 2
Query:  128 YFINPDGVKLFKQLWRPNAQNIRAFVFIIHGLSENSSFYYEDLVAKPLNEIGCLVAAHDQVGHGKSEGNRRLLEKIDNLSRDVVAHIELIRKTENLSSDIPTFLYGHSMGGLVATVTAHNYPEIINGMVLESPPLTLDGKIGPWMKYFALAM-SYVIPYYKVGKQDLENLTHNTEVIQVALNDPYRHNEPMTLTTAVQIGEAIHYLQSVFKEMTTPFLIAHGEHDVIVSIAGSQKLYKESKTKDKSLLVFKNAYHIIRVDSQEFRENIVE----WIEKHI 952
            + +N DG  LF + W+P+    +A +F+ HG  E+   Y  D +A+ L  +  LV AHD VGHG+SEG R ++       RD++ H+  ++K      ++P FL GHSMGG ++ + A   P   +GM+L SP +  + +    +K  A  + ++V+P   +G+ D   L+ N   + +  +DP   +  + +   +Q+  A+  ++     +T PFL+  G  D +    G+  L + S ++DK+L +++ AYH++  +  E   +++     W+   I
Sbjct:   21 HLVNADGQYLFCRYWKPSGTP-KALIFVSHGAGEHCGRY--DELAQMLKRLDMLVFAHDHVGHGQSEGERMVVSDFQVFVRDLLQHVNTVQKDY---PEVPVFLLGHSMGGAISILAAAERPTHFSGMILISPLILANPESASTLKVLAAKLLNFVLPNISLGRIDSSVLSRNKSEVDLYNSDPLICHAGVKVCFGIQLLNAVSRVERAMPRLTLPFLLLQGSADRLCDSKGAYLLMESSPSQDKTLKMYEGAYHVLHKELPEVTNSVLHEINTWVSHRI 294          
BLAST of Alpha/beta hydrolase vs. UniProt/SwissProt
Match: sp|Q99685|MGLL_HUMAN (Monoglyceride lipase OS=Homo sapiens OX=9606 GN=MGLL PE=1 SV=2)

HSP 1 Score: 140.584 bits (353), Expect = 2.202e-37
Identity = 83/272 (30.51%), Postives = 141/272 (51.84%), Query Frame = 2
Query:  128 YFINPDGVKLFKQLWRPNAQNIRAFVFIIHGLSENSSFYYEDLVAKPLNEIGCLVAAHDQVGHGKSEGNRRLLEKIDNLSRDVVAHIELIRKTENLSSDIPTFLYGHSMGGLVATVTAHNYPEIINGMVLESPPLTLDGKIGPWMKYFAL-AMSYVIPYYKVGKQDLENLTHNTEVIQVALNDPYRHNEPMTLTTAVQIGEAIHYLQSVFKEMTTPFLIAHGEHDVIVSIAGSQKLYKESKTKDKSLLVFKNAYHIIRVDSQEFRENIVEWI 940
            + +N DG  LF + W+P     +A +F+ HG  E+S  Y E  +A+ L  +  LV AHD VGHG+SEG R ++       RDV+ H++ ++K       +P FL GHSMGG +A +TA   P    GMVL SP +  + +     K  A   ++ V+P   +G  D   L+ N   + +  +DP      + +   +Q+  A+  ++    ++T PFL+  G  D +    G+  L + +K++DK+L +++ AYH++  +  E   ++   I
Sbjct:   21 HLVNADGQYLFCRYWKPTGTP-KALIFVSHGAGEHSGRYEE--LARMLMGLDLLVFAHDHVGHGQSEGERMVVSDFHVFVRDVLQHVDSMQKD---YPGLPVFLLGHSMGGAIAILTAAERPGHFAGMVLISPLVLANPESATTFKVLAAKVLNLVLPNLSLGPIDSSVLSRNKTEVDIYNSDPLICRAGLKVCFGIQLLNAVSRVERALPKLTVPFLLLQGSADRLCDSKGAYLLMELAKSQDKTLKIYEGAYHVLHKELPEVTNSVFHEI 286          
BLAST of Alpha/beta hydrolase vs. UniProt/SwissProt
Match: sp|Q9C942|CSE_ARATH (Caffeoylshikimate esterase OS=Arabidopsis thaliana OX=3702 GN=CSE PE=1 SV=1)

HSP 1 Score: 112.464 bits (280), Expect = 9.620e-27
Identity = 79/293 (26.96%), Postives = 148/293 (50.51%), Query Frame = 2
Query:  122 KEYFINPDGVKLFKQLWRPNAQNIRAFVFIIHGLSENSSFYYEDLVAKPLNEIGCLVAAHDQVGHGKSEGNRRLLEKIDNLSRDVVAHIELIRKTENLSSDIPTFLYGHSMGGLVATVTA-HNYPEIINGMVLESPPLTLDGKIGPWMKY-------FALAMSYV-IPYYK-VGKQDLENLTHNTEVIQVALNDPYRHNEPMTLTTAVQIGEAIHYLQSVFKEMTTPFLIAHGEHDVIVSIAGSQKLYKESKTKDKSLLVFKNAYH-IIRVDSQEFRE----NIVEWIEKHIK 955
            K YF  P+G KLF Q + P    I+  V++ HG   ++S+ ++ +     +  G  V A D +GHG+S+G R  +  ++ ++   +A  + +R ++    D+P FL+G SMGGLV  +    + PE   G++  +P   +   + P   +       F LA ++  +P  K VGK        + E +++  ++P R+     + T  ++     Y+Q  F ++T P   AHG  D +     S+ LY+++ + DK+L +++  YH +I+ +  E  E    ++ EWI++ +K
Sbjct:   41 KSYFETPNG-KLFTQSFLPLDGEIKGTVYMSHGYGSDTSWMFQKICMS-FSSWGYAVFAADLLGHGRSDGIRCYMGDMEKVAATSLAFFKHVRCSDPYK-DLPAFLFGESMGGLVTLLMYFQSEPETWTGLMFSAPLFVIPEDMKPSKAHLFAYGLLFGLADTWAAMPDNKMVGKA-----IKDPEKLKIIASNPQRYTGKPRVGTMRELLRKTQYVQENFGKVTIPVFTAHGTADGVTCPTSSKLLYEKASSADKTLKIYEGMYHSLIQGEPDENAEIVLKDMREWIDEKVK 325          
BLAST of Alpha/beta hydrolase vs. UniProt/SwissProt
Match: sp|A0QNZ7|MGLL_MYCS2 (Monoacylglycerol lipase OS=Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) OX=246196 GN=MSMEG_0220 PE=1 SV=1)

HSP 1 Score: 105.916 bits (263), Expect = 9.963e-25
Identity = 70/276 (25.36%), Postives = 120/276 (43.48%), Query Frame = 2
Query:  131 FINPDGVKLFKQLWRPNAQNIRAFVFIIHGLSENSSFYYEDLVAKPLNEIGCLVAAHDQVGHGKSEGNRRLLEKIDNLSRDVVAHIELIRKTENLSSDIPTFLYGHSMGGLVATVTAHNYPEIINGMVLESPPLTLDGKIGPWMKYFALAMSYVIPYYKVGKQDLENLTHNTEVIQVALNDPYRHNEPMTLTTAVQIGEAIHYLQSVFKEMTTPFLIAHGEHDVIVSIAGSQKLYKESKTKDKSLLVFKNAYHIIRVDSQE--FRENIVEWIEKHI 952
            F    GV++   +W P+  + R  V + HG +E++  Y+   VA+     G LV A D  GHG+S G R  L  +     D      L+    N    +P  + GHSMGG +       YP   + MVL  P +     + P +   A  +  + P   V   D + ++ + EV+     DP  H+  +    A  +      +      +T P L+ HG+ D ++ +AGS+ L     ++D  L V+   YH +  + ++    +++  WI  H+
Sbjct:   11 FAGVGGVRIVYDVWTPD-TDPRGVVVLAHGYAEHAGRYHH--VAQRFGAAGLLVYALDHRGHGRSGGKRVHLRDLSEFVEDFRT---LVGIAANDHPTLPRIVLGHSMGGGIVFAYGARYPGEYSAMVLSGPAVNAHDGVSPVLVAVAKVLGKLAPGIPVENLDADAVSRDPEVVAAYKADPMVHHGKLPAGIARALIGLGQSMPQRAAALTAPLLVVHGDKDRLIPVAGSRLLVDRVASEDVHLKVYPGLYHEVFNEPEQKLVLDDVTSWIVSHL 280          
BLAST of Alpha/beta hydrolase vs. TrEMBL
Match: A0A023G7K1 (Putative lysophospholipase OS=Amblyomma triste OX=251400 PE=2 SV=1)

HSP 1 Score: 182.185 bits (461), Expect = 1.006e-50
Identity = 97/274 (35.40%), Postives = 151/274 (55.11%), Query Frame = 2
Query:  131 FINPDGVKLFKQLWRPNAQNIRAFVFIIHGLSENSSFYYEDLVAKPLNEIGCLVAAHDQVGHGKSEGNRRLLEKIDNLSRDVVAHIELIRKTENLSSDIPTFLYGHSMGGLVATVTAHNYPEIINGMVLESPPLTLDGKIGPWMKY-FALAMSYVIPYYKVGKQDLENLTHNTEVIQVALNDPYRHNEPMTLTTAVQIGEAIHYLQSVFKEMTTPFLIAHGEHDVIVSIAGSQKLYKESKTKDKSLLVFKNAYHIIRVD----SQEFRENIVEW 937
            F N DG K+    W P  Q  RA VF+ HG +E+      D +A+ L E+GC V AHD VGHGKSEG R  ++  D    D++ H++L+R+        P FL+GHSMGGL+  + A   P+ I G+++ +P L +D + G W+K   A  +  V+P   +G  DL  ++ + E +    NDP R++  + +  A  I  A+  LQ+    +  PFLI HG  D +  + GS+  YK++ +KDKS+ V+K  YH +  +     Q+  ++I +W
Sbjct:   29 FRNRDGYKIACTTWSPEVQP-RALVFLAHGYAEHCHVPCYDSLARTLVELGCYVFAHDHVGHGKSEGPRGTVKSADIYVDDILTHVDLVRQK---FPGRPVFLFGHSMGGLLVAMAAERRPKDIAGLIMMAPLLAVDKEQGTWLKMTLARILGRVVPNLPIGDLDLSLVSRDPETVAWMTNDPLRYHGSVRMGWAAAILNALEDLQAKIDLVDIPFLIQHGSGDKLCDLGGSEDFYKKAPSKDKSMKVYKECYHSLLTEPGEMGQQVLKDIADW 298          
BLAST of Alpha/beta hydrolase vs. TrEMBL
Match: G3MI93 (Hydrolase_4 domain-containing protein (Fragment) OS=Amblyomma maculatum OX=34609 PE=2 SV=1)

HSP 1 Score: 180.259 bits (456), Expect = 3.266e-50
Identity = 96/274 (35.04%), Postives = 150/274 (54.74%), Query Frame = 2
Query:  131 FINPDGVKLFKQLWRPNAQNIRAFVFIIHGLSENSSFYYEDLVAKPLNEIGCLVAAHDQVGHGKSEGNRRLLEKIDNLSRDVVAHIELIRKTENLSSDIPTFLYGHSMGGLVATVTAHNYPEIINGMVLESPPLTLDGKIGPWMKY-FALAMSYVIPYYKVGKQDLENLTHNTEVIQVALNDPYRHNEPMTLTTAVQIGEAIHYLQSVFKEMTTPFLIAHGEHDVIVSIAGSQKLYKESKTKDKSLLVFKNAYHIIRVD----SQEFRENIVEW 937
            F N DG K+    W P  Q  R  VF+ HG +E+      D +A+ L E+GC V AHD VGHGKSEG R  ++  D    D++ H++L+R+        P FL+GHSMGGL+  + A   P+ I G+++ +P L +D + G W+K   A  +  V+P   +G  DL  ++ + E +    NDP R++  + +  A  I  A+  LQ+    +  PFLI HG  D +  + GS+  YK++ +KDKS+ V+K  YH +  +     Q+  ++I +W
Sbjct:   12 FRNRDGYKIACTTWSPEVQP-RVLVFLAHGYAEHCHVPCYDSLARTLVELGCYVFAHDHVGHGKSEGPRGTVKSADIYVDDILTHVDLVRQK---FPGRPVFLFGHSMGGLLVAMAAERRPKDIAGLIMMAPLLAVDKEQGTWLKMTLARILGRVVPNLPIGDLDLSLVSRDPETVAWMTNDPLRYHGSVRMGWAAAILNALEDLQAKIDLVDIPFLIQHGSGDKLCDLGGSEDFYKKAPSKDKSMKVYKECYHSLLTEPGEMGQQVLKDIADW 281          
BLAST of Alpha/beta hydrolase vs. TrEMBL
Match: A0A224Z3S0 (Lysophospholipase OS=Rhipicephalus zambeziensis OX=60191 PE=4 SV=1)

HSP 1 Score: 180.259 bits (456), Expect = 5.400e-50
Identity = 95/279 (34.05%), Postives = 153/279 (54.84%), Query Frame = 2
Query:  131 FINPDGVKLFKQLWRPNAQNIRAFVFIIHGLSENSSFYYEDLVAKPLNEIGCLVAAHDQVGHGKSEGNRRLLEKIDNLSRDVVAHIELIRKTENLSSDIPTFLYGHSMGGLVATVTAHNYPEIINGMVLESPPLTLDGKIGPWMKY-FALAMSYVIPYYKVGKQDLENLTHNTEVIQVALNDPYRHNEPMTLTTAVQIGEAIHYLQSVFKEMTTPFLIAHGEHDVIVSIAGSQKLYKESKTKDKSLLVFKNAYHIIRVD----SQEFRENIVEWIEKHI 952
            F N DG K+    W P  +  RA VF+ HG +E+      D++A+ L E+GC V +HD VGHGKSEG R L++  D    D++ H++L+++        P FL+GHSMGGL+  + A   P+ I G+V+ +P L +D +   W+K   A  +  ++P   +G  DL  ++ + E++     DP R++  + +  A  +  A+  LQ+    + TPF I HG  D +  I GS+  YK++ TKDKS  V+K+ YH +  +    +Q+  ++I  W    I
Sbjct:   29 FRNRDGHKISCLTWSPEVEP-RALVFLAHGYAEHCHGPCYDMLARKLVEMGCYVFSHDHVGHGKSEGPRALVKSADIYVDDILTHVDLVKQK---YPSRPVFLFGHSMGGLLVALAAERRPQDIAGIVMMAPMLAVDKEQATWLKMTLARILGRIVPTLPIGNLDLSLVSKDPEIVDRMTKDPLRYHGRVRVGWAAAMLNALEDLQAKVDSIDTPFFIQHGSADKLCDIGGSEDFYKKAPTKDKSFKVYKDCYHSLLTEPEDMAQQVLQDIANWYSARI 303          
BLAST of Alpha/beta hydrolase vs. TrEMBL
Match: A0A1E1X7Q5 (Putative lysophospholipase (Fragment) OS=Amblyomma aureolatum OX=187763 PE=2 SV=1)

HSP 1 Score: 177.948 bits (450), Expect = 2.315e-49
Identity = 94/274 (34.31%), Postives = 154/274 (56.20%), Query Frame = 2
Query:  131 FINPDGVKLFKQLWRPNAQNIRAFVFIIHGLSENSSFYYEDLVAKPLNEIGCLVAAHDQVGHGKSEGNRRLLEKIDNLSRDVVAHIELIRKTENLSSDIPTFLYGHSMGGLVATVTAHNYPEIINGMVLESPPLTLDGKIGPWMKY-FALAMSYVIPYYKVGKQDLENLTHNTEVIQVALNDPYRHNEPMTLTTAVQIGEAIHYLQSVFKEMTTPFLIAHGEHDVIVSIAGSQKLYKESKTKDKSLLVFKNAYHIIRVD----SQEFRENIVEW 937
            F N DG K+    W P AQ  RA VF+ HG +E+      D +A+ L E+GC V AHD VGHGKSEG R  ++  D    D++ H++L+R+        P FL+GHSMGGL+  + A   P+ I G+++ +P L +  + G W+K   A  +  V+P   +G  DL  ++ + + +    +DP R++  + +  A  +  A+  LQ+  + +  PFLI HG  D +  +AGS+  YK++ +KDKS+ V+++ YH +  +     Q+  ++I +W
Sbjct:   12 FRNRDGYKIACTTWSPEAQP-RALVFLAHGYAEHCHVPCYDSLARTLVELGCYVFAHDHVGHGKSEGPRGTVKSADIYVDDILTHVDLVRQK---FPGRPVFLFGHSMGGLLVAMAAERRPKDIAGLIMMAPLLAIAKEQGSWLKVTLARILGRVVPNLPIGDLDLSLVSKDPDTVAWMASDPLRYHGSVRMGWAAAMLNALEDLQAKIELVDIPFLIQHGSADKLCDLAGSEDFYKKAPSKDKSMKVYEDCYHSLLTEPGEMGQQVLKDITDW 281          
BLAST of Alpha/beta hydrolase vs. TrEMBL
Match: A0A023FID4 (Putative lysophospholipase (Fragment) OS=Amblyomma cajennense OX=34607 PE=2 SV=1)

HSP 1 Score: 174.866 bits (442), Expect = 4.070e-48
Identity = 91/254 (35.83%), Postives = 144/254 (56.69%), Query Frame = 2
Query:  131 FINPDGVKLFKQLWRPNAQNIRAFVFIIHGLSENSSFYYEDLVAKPLNEIGCLVAAHDQVGHGKSEGNRRLLEKIDNLSRDVVAHIELIRKTENLSSDIPTFLYGHSMGGLVATVTAHNYPEIINGMVLESPPLTLDGKIGPWMKY-FALAMSYVIPYYKVGKQDLENLTHNTEVIQVALNDPYRHNEPMTLTTAVQIGEAIHYLQSVFKEMTTPFLIAHGEHDVIVSIAGSQKLYKESKTKDKSLLVFKNAYH 889
            F N DG K+    W P  Q  RA VF+ HG +E+      D +A+ L E+GC V AHD VGHGKSEG R  ++  D    D++ H++L+R+        P +L+GHSMGGL+  + A   P+ I G+++ +P L +D + G W+K   A  +  V+P   +G  DL  ++ + + +    NDP R++  + +  A  +  A+  LQ+  + +  PFLI HG  D +  +AGS++ YK++ +K KS+ V+K  YH
Sbjct:   29 FRNRDGYKIACTTWSPEVQP-RALVFLAHGYAEHCHVPCYDSLARTLVELGCYVFAHDHVGHGKSEGPRGTVKSADIYVDDILTHVDLVRQK---FPGRPVYLFGHSMGGLLVAMAAERRPKDIAGLIMMAPLLAVDKEQGTWLKMTLARILGRVVPNLPIGDLDLSLVSRDPDTVAWMANDPLRYHGSVRMGWAAAMLNALEDLQAKIELVDIPFLIQHGSADKLCDLAGSEEFYKKAPSKAKSMKVYKECYH 278          
BLAST of Alpha/beta hydrolase vs. Ensembl Cavefish
Match: mgll (monoglyceride lipase [Source:NCBI gene;Acc:103026761])

HSP 1 Score: 149.828 bits (377), Expect = 6.507e-42
Identity = 86/276 (31.16%), Postives = 149/276 (53.99%), Query Frame = 2
Query:  128 YFINPDGVKLFKQLWRPNAQNIRAFVFIIHGLSENSSFYYEDLVAKPLNEIGCLVAAHDQVGHGKSEGNRRLLEKIDNLSRDVVAHIELIRKTENLSSDIPTFLYGHSMGGLVATVTAHNYPEIINGMVLESPPLTLDGKIG-PWMKYFALAMSYVIPYYKVGKQDLENLTHNTEVIQVALNDPYRHNEPMTLTTAVQIGEAIHYLQSVFKEMTTPFLIAHGEHDVIVSIAGSQKLYKESKTKDKSLLVFKNAYHIIRVDSQEFRENIVEWIEKHI 952
            + ++ DG+ LF + W P A   RA VFI HG  E+   Y +  VA  L + G  V AHD VGHG+SEG R  ++      RD + HI+LIR        +P F+ GHSMGG ++ + A   P+   G+VL  P + ++ +   P+  + A  +S++IP   +G  D ++++ + + ++    D   ++  M ++  +Q+  A + ++     +T PF I HG+ D +  I GS  ++ ++K+ DK L V++ AYH +  D  E  E++++ +   I
Sbjct:   23 HIVSADGLHLFCRYWEPEAPP-RALVFIAHGAGEHCGMYTD--VAHTLVQKGLYVFAHDHVGHGQSEGERMNIKNFQIYIRDALQHIDLIRARH---PSLPVFILGHSMGGAISILAACERPQDFVGVVLIGPLIQMNPESATPFKVFLAKVLSHMIPSLTLGAIDPKSVSRDPKQVEAYEADELNYHGGMRVSFGMQLMTAANRIERELPNITWPFYILHGDADKLCDIGGSHLMFNQAKSTDKKLKVYEGAYHALHHDLPETAESVLQEVSSWI 292          
BLAST of Alpha/beta hydrolase vs. Ensembl Sea Lamprey
Match: mgll (monoglyceride lipase [Source:ZFIN;Acc:ZDB-GENE-031006-9])

HSP 1 Score: 142.124 bits (357), Expect = 3.975e-40
Identity = 82/254 (32.28%), Postives = 134/254 (52.76%), Query Frame = 2
Query:  194 RAFVFIIHGLSENSSFYYEDLVAKPLNEIGCLVAAHDQVGHGKSEGNRRLLEKIDNLSRDVVAHIELIRKTENLSSDIPTFLYGHSMGGLVATVTAHNYPEIINGMVLESPPLTLDGKI-GPWMKYFALAMSYVIPYYKVGKQDLENLTHNTEVIQVALNDPYRHNEPMTLTTAVQIGEAIHYLQSVFKEMTTPFLIAHGEHDVIVSIAGSQKLYKESKTKDKSLLVFKNAYHIIRVDSQEFRENIVEWIEKHI 952
            RA VF+ HGL E+   Y  D VA+ L + G LV AHD VGHG+SEG R    ++    RD + H  L R       ++P FL GHSMGG VA   A   P+   G++L SP +TL   +  P + Y A  M+Y+ P   VG  +   L+ ++  +Q    DP  H+  +++   + + E    ++ +      PFL+  G  D++    G++  Y  + ++DK+L  +++AYH++  +  E +E +++ IE  +
Sbjct:    1 RALVFVSHGLGEHCGRY--DEVARMLVQHGVLVFAHDHVGHGRSEGERVSEARLGVYVRDCLQHARLARTRH---PELPCFLLGHSMGGAVAVAVASECPDDFAGVILISPLVTLSPSVTSPTLMYMARIMNYMWPRCPVGSVNTAWLSRDSNEVQAYEYDPLVHHGRLSVAMGLGLSETSARVRWLVPSARWPFLLLQGGADLLCDPEGARLFYDLAPSQDKTLRWYQDAYHVLHKELPEVKEAVLKEIESWV 249          
BLAST of Alpha/beta hydrolase vs. Ensembl Sea Lamprey
Match: mgll (monoglyceride lipase [Source:ZFIN;Acc:ZDB-GENE-031006-9])

HSP 1 Score: 127.872 bits (320), Expect = 2.138e-34
Identity = 73/253 (28.85%), Postives = 132/253 (52.17%), Query Frame = 2
Query:  197 AFVFIIHGLSENSSFYYEDLVAKPLNEIGCLVAAHDQVGHGKSEGNRRLLEKIDNLSRDVVAHIELIRKTENLSSDIPTFLYGHSMGGLVATVTAHNYPEIINGMVLESPPLTLDGKI-GPWMKYFALAMSYVIPYYKVGKQDLENLTHNTEVIQVALNDPYRHNEPMTLTTAVQIGEAIHYLQSVFKEMTTPFLIAHGEHDVIVSIAGSQKLYKESKTKDKSLLVFKNAYHIIRVDSQEFRENIVEWIEKHI 952
              V +IHG  E+   Y  D VA  L+ +G    AHD VGHG+SEG R  +       RD + H +LI K      D+P FL GHSMGG ++ + A    + + G+VL  P +  +  I  P+  +      Y++P   +       +T N   +++  +DP  H+  ++++    + +A+  ++++  ++T PFL+ HG+ D +  + GS+  ++ +++ DK+L +++ AYH +  +  E    ++E IE  I
Sbjct:   42 GLVHVIHGAGEHCRRY--DEVASRLSALGYFAFAHDHVGHGQSEGPRMQVSDFQVFVRDTLQHFDLICKR---YPDLPIFLLGHSMGGAISILAASERSDKVAGVVLIGPLIEGNPDIVSPFKIFLMKIFKYLLPSLTLASIGPTLVTRNKAEVELFESDPLVHHAGLSVSFLSTLMDAVARIEALLPDVTWPFLLLHGDEDQLCFVGGSKAFHERARSADKTLHIYEGAYHALHKEIPECAGTVLEEIEAWI 289          
BLAST of Alpha/beta hydrolase vs. Ensembl Sea Lamprey
Match: mgll (monoglyceride lipase [Source:ZFIN;Acc:ZDB-GENE-031006-9])

HSP 1 Score: 84.3445 bits (207), Expect = 7.646e-19
Identity = 69/263 (26.24%), Postives = 119/263 (45.25%), Query Frame = 2
Query:  194 RAFVFIIHGLSENSSFYYEDLVAKPLNEIGCLVAAHDQVGHGKSEGNRRLLEKIDNLSRDVVAHIELIRKTENLSSDIPTFLYGHSMGGLVATVTAHNY-----PEIINGMVLESPPLTLDGKIGPWMKYFALAMSYVIPYYKVGKQDLENL-THNTEVIQVA--LNDPYRHNEPMTLTTAVQIGEAIHYLQSVFKEMTTPFLIAHGEHDVIVSIAGSQKLYKESKT--KDKSLLVFKNAYHIIRVDSQEFRENIVEWIEKHI 952
            R  V ++HG  E+   Y  D +AK L     LV  HD VGHG+S   R     +D   RD + H+  +R T      +P FL GHS+G + +            PE I+     S       K G  ++     +   +P + +G  D   L  H+ E  +V    +DP  ++  + +  AV++   +  L  +   ++ PFL+ HG  D +   AGSQ L +  +   +D    +++ AYH++  +  + +E ++  I++ I
Sbjct:    1 RGLVCVMHGAGEHCGRY--DELAKTLTRHSLLVFGHDHVGHGRSTRVRLADIHVDMHVRDCLQHVRRVRGTH---PRLPCFLLGHSLGHVDSKCAEGERGEPEDPETIHLFSPLSRRSISSAKSG--LRAHGEVLQLHLPPFTLGSLDPSLLWPHSREGSEVRDYASDPLVYHGRVRVAFAVRLLHTVSLLARLMPSVSWPFLLLHGSRDQLCDPAGSQMLVRPGRQHGQDHQGEMYEGAYHVLHRELPDVKEAVLREIQQWI 256          
BLAST of Alpha/beta hydrolase vs. Ensembl Yeast
Match: YJU3 (Monoglyceride lipase (MGL); functional ortholog of mammalian MGL, localizes to lipid particles and membranes, also member of the eukaryotic serine hydrolase family [Source:SGD;Acc:S000001577])

HSP 1 Score: 57.7658 bits (138), Expect = 7.865e-10
Identity = 70/296 (23.65%), Postives = 122/296 (41.22%), Query Frame = 2
Query:  137 NPDGVKLFKQLW--RPNAQNIRAFVFIIHGLSENSSFYYEDLVAKPLNEIGCLVAAHDQVGHG-KSEGNRRLLEKIDNLSRDVVAHIELIRKTENLSSDIPTFLYGHSMGGLVAT--VTAHNYPEIINGMVLESP-----PLTLDGKIGPWMKYFALAMSYVIPYYKVGKQ-DLENLTHN--------TEVIQVALNDPYRHNEPMTLTTAVQIGEAIHYLQSVFKEMTTPFLIAHGEHDVIVSIAGSQKLYKESKTKDKSLLVFKNAYHII------RVDSQEFRENIVEWIEKH 949
            N DG K     W  +     +R  V +IHG  E +   +  +    LN  G      DQ G G  S G  + +    ++  D+   +E    +E  +  IP F++GHSMGG +         +   I+G +   P     P T+  K     +  A  ++  +P  ++    DL+ +T +        ++ + V L   +R         A       +Y+Q  F +   P +I HG+ D I    GS+K  ++  + DK L ++  A H I      +V +  F + + +W++KH
Sbjct:   19 NFDGAKFGYMFWPVQNGTNEVRGRVLLIHGFGEYTKIQFRLMDHLSLN--GYESFTFDQRGAGVTSPGRSKGVTDEYHVFNDLEHFVEK-NLSECKAKGIPLFMWGHSMGGGICLNYACQGKHKNEISGYIGSGPLIILHPHTMYNKP---TQIIAPLLAKFLPRVRIDTGLDLKGITSDKAYRAFLGSDPMSVPLYGSFRQIHDFMQRGAKLYKNENNYIQKNFAK-DKPVIIMHGQDDTINDPKGSEKFIQDCPSADKELKLYPGARHSIFSLETDKVFNTVFND-MKQWLDKH 306          
BLAST of Alpha/beta hydrolase vs. Ensembl Nematostella
Match: EDO29435 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T3M9])

HSP 1 Score: 151.369 bits (381), Expect = 6.789e-43
Identity = 85/283 (30.04%), Postives = 150/283 (53.00%), Query Frame = 2
Query:  113 MSKKEYFINPDGVKLFKQLWRPNAQNIRAFVFIIHGLSENSSFYYEDLVAKPLNEIGCLVAAHDQVGHGKSEGNRRLLEKIDNLSRDVVAHI-ELIRKTENLSSDIPTFLYGHSMGGLVATVTAHNYPEIINGMVLESPPLTLDG-KIGPWMKYFALAMSYVIPYYK-VGKQDLENLTHNTEVIQVALNDPYRHNEPMTLTTAVQIGEAIHYLQSVFKEMTTPFLIAHGEHDVIVSIAGSQKLYKESKTKDKSLLVFKNAYHII----RVDSQEFRENIVEWI 940
            M  +  F N DG+ +  + W   ++  +A +FI HG  ++S   Y   +A+ L + G  V +HD VGHGKSEG R  ++ +    RD+  HI ++I K E L    P +L+GHSMGGL+A + A   P    G+VL +P L +D  K    M++    +S+V P  + +   D  +++ + E ++    DP   +  + +   + I  A+  +Q+  + +  PFL+ HG  D +  + GS++L + + +KDK++  +   YH +    + DS    ++I+EW+
Sbjct:   17 MENEGSFKNKDGLSISTRTWTSQSEQPKALIFICHGYGDHSK-RYSKFLAQALVDEGFFVLSHDHVGHGKSEGERAQIDSLQKYVRDIFDHIDQIIPKYEGL----PIYLFGHSMGGLIAVLAAQRRPTFFKGVVLSAPALIVDPHKDNKCMRFLGKMVSWVAPSLQLLPAMDPNSMSRDPEQVKAYAEDPLVWHGGVKVGIGLAIAHAVDEVQASMESIKWPFLVLHGTADTLCLMEGSKQLERRAGSKDKTIKTYDGYYHDLLKEPKDDSTVILKDIIEWL 294          
BLAST of Alpha/beta hydrolase vs. Ensembl Medaka
Match: mgll (monoglyceride lipase [Source:NCBI gene;Acc:101169855])

HSP 1 Score: 153.295 bits (386), Expect = 4.472e-43
Identity = 86/284 (30.28%), Postives = 159/284 (55.99%), Query Frame = 2
Query:  116 SKKEYFINPDGVKLFKQLWRPNAQNIRAFVFIIHGLSENSSFYYEDLVAKPLNEIGCLVAAHDQVGHGKSEGNRRLLEKIDNLSRDVVAHIELIRKTENLSSDIPTFLYGHSMGGLVATVTAHNYPEIINGMVLESPPLTLDGKIG-PWMKYFALAMSYVIPYYKVGKQDLENLTHNTEVIQVALNDPYRHNEPMTLTTAVQIGEAIHYLQSVFKEMTTPFLIAHGEHDVIVSIAGSQKLYKESKTKDKSLLVFKNAYHIIRVDSQEFRENIVE----WIEKHI 952
            S+  + +N DG+ LF + W P A   RA VF++HG  E+S  Y  D +A+ L E+  LV AHD VGHG+SEG R  ++      RD + HI+L++       D+P F+ GHSMGG ++ +TA   P  I+G+VL  P + ++ +   P+  + A  +++++P   +G  +   ++ +   ++   ND   ++  + ++  +Q+  A   ++     ++ PFLI HG+ D +  I GS+ +++++ + DK L +++ AYH +  D  E  E++++    WI + +
Sbjct:   26 SELPHIVNADGLHLFCRYWEPAAPP-RALVFVVHGAGEHSGPY--DEIAQRLKELSLLVFAHDHVGHGQSEGERMNIKDFQIYVRDSLQHIDLMKSRH---PDLPVFIVGHSMGGAISILTACERPSEISGVVLIGPMVQMNPESATPFKVFVAKLLNHMMPSLTLGSIESRWVSRDKTQVEAYDNDELNYHGRLRVSFGIQLMGAAERIEREIPSISWPFLILHGDDDKLCDIRGSKMMHEKAASSDKKLKIYEGAYHALHHDLPEVAESVLKDVTSWITERL 303          
BLAST of Alpha/beta hydrolase vs. Ensembl Medaka
Match: mgll (monoglyceride lipase [Source:NCBI gene;Acc:101169855])

HSP 1 Score: 153.295 bits (386), Expect = 4.811e-43
Identity = 86/284 (30.28%), Postives = 159/284 (55.99%), Query Frame = 2
Query:  116 SKKEYFINPDGVKLFKQLWRPNAQNIRAFVFIIHGLSENSSFYYEDLVAKPLNEIGCLVAAHDQVGHGKSEGNRRLLEKIDNLSRDVVAHIELIRKTENLSSDIPTFLYGHSMGGLVATVTAHNYPEIINGMVLESPPLTLDGKIG-PWMKYFALAMSYVIPYYKVGKQDLENLTHNTEVIQVALNDPYRHNEPMTLTTAVQIGEAIHYLQSVFKEMTTPFLIAHGEHDVIVSIAGSQKLYKESKTKDKSLLVFKNAYHIIRVDSQEFRENIVE----WIEKHI 952
            S+  + +N DG+ LF + W P A   RA VF++HG  E+S  Y  D +A+ L E+  LV AHD VGHG+SEG R  ++      RD + HI+L++       D+P F+ GHSMGG ++ +TA   P  I+G+VL  P + ++ +   P+  + A  +++++P   +G  +   ++ +   ++   ND   ++  + ++  +Q+  A   ++     ++ PFLI HG+ D +  I GS+ +++++ + DK L +++ AYH +  D  E  E++++    WI + +
Sbjct:   29 SELPHIVNADGLHLFCRYWEPAAPP-RALVFVVHGAGEHSGPY--DEIAQRLKELSLLVFAHDHVGHGQSEGERMNIKDFQIYVRDSLQHIDLMKSRH---PDLPVFIVGHSMGGAISILTACERPSEISGVVLIGPMVQMNPESATPFKVFVAKLLNHMMPSLTLGSIESRWVSRDKTQVEAYDNDELNYHGRLRVSFGIQLMGAAERIEREIPSISWPFLILHGDDDKLCDIRGSKMMHEKAASSDKKLKIYEGAYHALHHDLPEVAESVLKDVTSWITERL 306          
BLAST of Alpha/beta hydrolase vs. Ensembl Medaka
Match: mgll (monoglyceride lipase [Source:NCBI gene;Acc:101169855])

HSP 1 Score: 153.68 bits (387), Expect = 6.939e-43
Identity = 86/284 (30.28%), Postives = 159/284 (55.99%), Query Frame = 2
Query:  116 SKKEYFINPDGVKLFKQLWRPNAQNIRAFVFIIHGLSENSSFYYEDLVAKPLNEIGCLVAAHDQVGHGKSEGNRRLLEKIDNLSRDVVAHIELIRKTENLSSDIPTFLYGHSMGGLVATVTAHNYPEIINGMVLESPPLTLDGKIG-PWMKYFALAMSYVIPYYKVGKQDLENLTHNTEVIQVALNDPYRHNEPMTLTTAVQIGEAIHYLQSVFKEMTTPFLIAHGEHDVIVSIAGSQKLYKESKTKDKSLLVFKNAYHIIRVDSQEFRENIVE----WIEKHI 952
            S+  + +N DG+ LF + W P A   RA VF++HG  E+S  Y  D +A+ L E+  LV AHD VGHG+SEG R  ++      RD + HI+L++       D+P F+ GHSMGG ++ +TA   P  I+G+VL  P + ++ +   P+  + A  +++++P   +G  +   ++ +   ++   ND   ++  + ++  +Q+  A   ++     ++ PFLI HG+ D +  I GS+ +++++ + DK L +++ AYH +  D  E  E++++    WI + +
Sbjct:   56 SELPHIVNADGLHLFCRYWEPAAPP-RALVFVVHGAGEHSGPY--DEIAQRLKELSLLVFAHDHVGHGQSEGERMNIKDFQIYVRDSLQHIDLMKSRH---PDLPVFIVGHSMGGAISILTACERPSEISGVVLIGPMVQMNPESATPFKVFVAKLLNHMMPSLTLGSIESRWVSRDKTQVEAYDNDELNYHGRLRVSFGIQLMGAAERIEREIPSISWPFLILHGDDDKLCDIRGSKMMHEKAASSDKKLKIYEGAYHALHHDLPEVAESVLKDVTSWITERL 333          
BLAST of Alpha/beta hydrolase vs. Planmine SMEST
Match: SMESG000022359.1 (SMESG000022359.1)

HSP 1 Score: 578.17 bits (1489), Expect = 0.000e+0
Identity = 279/281 (99.29%), Postives = 280/281 (99.64%), Query Frame = 2
Query:  113 MSKKEYFINPDGVKLFKQLWRPNAQNIRAFVFIIHGLSENSSFYYEDLVAKPLNEIGCLVAAHDQVGHGKSEGNRRLLEKIDNLSRDVVAHIELIRKTENLSSDIPTFLYGHSMGGLVATVTAHNYPEIINGMVLESPPLTLDGKIGPWMKYFALAMSYVIPYYKVGKQDLENLTHNTEVIQVALNDPYRHNEPMTLTTAVQIGEAIHYLQSVFKEMTTPFLIAHGEHDVIVSIAGSQKLYKESKTKDKSLLVFKNAYHIIRVDSQEFRENIVEWIEKHIK 955
            MSKKEYFINPDGVKLFKQLWRPNAQNIRAFVFIIHGLSENSSFYYEDLVAKPLNEIGCLVAAHDQVGHGKSEGNRRLLEKIDNLSRDVVAHIELIRKTENLSSDIPTFLYGHSMGGLVATVTAHNYPEIINGMVLESPPLTLDGKIGPWMKYFALAMSYVIPYYKVGKQ LENLTHNTEVIQVALNDPYRHNEPMTLTTAVQIGEAIHYLQSVFKEMTTPFLIAHGEHDVIVSIAGSQKLY+ESKTKDKSLLVFKNAYHIIRVDSQEFRENIVEWIEKHIK
Sbjct:    1 MSKKEYFINPDGVKLFKQLWRPNAQNIRAFVFIIHGLSENSSFYYEDLVAKPLNEIGCLVAAHDQVGHGKSEGNRRLLEKIDNLSRDVVAHIELIRKTENLSSDIPTFLYGHSMGGLVATVTAHNYPEIINGMVLESPPLTLDGKIGPWMKYFALAMSYVIPYYKVGKQYLENLTHNTEVIQVALNDPYRHNEPMTLTTAVQIGEAIHYLQSVFKEMTTPFLIAHGEHDVIVSIAGSQKLYEESKTKDKSLLVFKNAYHIIRVDSQEFRENIVEWIEKHIK 281          
BLAST of Alpha/beta hydrolase vs. Planmine SMEST
Match: SMESG000004815.1 (SMESG000004815.1)

HSP 1 Score: 298.13 bits (762), Expect = 1.536e-99
Identity = 144/286 (50.35%), Postives = 202/286 (70.63%), Query Frame = 2
Query:  113 MSKKEYFINPDGVKLFKQLWRPNAQNIRAFVFIIHGLSENSSFYYEDLVAKPLNEIGCLVAAHDQVGHGKSEGNRRLLEKIDNLSRDVVAHIELIRKTENLSSDIPTFLYGHSMGGLVATVTAHNYPEIINGMVLESPPLTLDGK--IGPWMKYFALAMSYVIPYYKVGKQDLENLTHNTEVIQVALNDPYRHNEPMTLTTAVQIGEAIHYLQSVFKEMTTPFLIAHGEHDVIVSIAGSQKLYKESKTKDKSLLVFKNAYHIIRVDSQEFREN----IVEWIEKHI 952
            +  + YFIN DG+KLF+Q+W P +  IRAF+FIIHGLSE+SSFYY + + KPL +IGCLVA+HD VGHGKS+GNR ++EKID L+ DV+ HIE I+    LS +IP F YGHS+GGL+A + + + P+I+ GMVLE+P LTL+G+   G W  +    +S+++P + + K   ENLT N EVIQ AL D +R+   +T+ TAV IG AI  +QS  K++ TPFL+AHG+ DV+VS  GS+ L   ++ +DK  + ++ AYH++RVDS E  E+    +VEWI + I
Sbjct:    8 IENENYFINKDGLKLFEQIWFPESGEIRAFIFIIHGLSEHSSFYYFNPIVKPLLDIGCLVASHDHVGHGKSDGNREVVEKIDKLTNDVILHIEDIKSRFKLSDNIPIFAYGHSLGGLIACLLSLDKPQILKGMVLEAPALTLNGRDDTGSWYMFIVYMLSFLMPSFVIKKPTFENLTRNNEVIQNALTDTFRNKGGLTMGTAVNIGYAIQGVQSRLKDIKTPFLVAHGKKDVVVSSTGSKILCDVAEVEDKLYIEYEEAYHLLRVDSGEICEDFTCKLVEWINQRI 293          
BLAST of Alpha/beta hydrolase vs. Planmine SMEST
Match: SMESG000038748.1 (SMESG000038748.1)

HSP 1 Score: 200.29 bits (508), Expect = 1.981e-61
Identity = 99/277 (35.74%), Postives = 156/277 (56.32%), Query Frame = 2
Query:  122 KEYFINPDGVKLFKQLWRPNAQNIRAFVFIIHGLSENSSFYYEDLVAKPLNEIGCLVAAHDQVGHGKSEGNRRLLEKIDNLSRDVVAHIELIRKTENLSSDIPTFLYGHSMGGLVATVTAHNYPEIINGMVLESPPLTLDGKIGPWMKYFALAMSYVIPYYKVGKQDLENLTHNTEVIQVALNDPYRHNEPMTLTTAVQIGEAIHYLQSVFKEMTTPFLIAHGEHDVIVSIAGSQKLYKESKTKDKSLLVFKNAYHIIRVDSQ----EFRENIVEWI 940
            K++F+NPDG+KLF+ ++ P  +  RA VFI HGL E+    Y   V +PL   GC+V  HD  GHG SEG+R ++   D+L RDV+  I+     EN+   +P FLYG+S+GGL+    +        G+ LE+P L    K G     F   +S   P ++  K D +++  N + +     D  R +  +   TA++I  A  YL+   KE++TPF++ HG+ D I  I GS+ L + +  +DK+ ++F+ A H +R++ +    EF +NI+EWI
Sbjct:    8 KDFFVNPDGIKLFRLVYPPTVRPYRAVVFICHGLFEHCQASYFKPVIRPLVNSGCMVITHDHRGHGLSEGDRGMINSFDSLVRDVLLDIDETLVRENIPQQVPLFLYGYSLGGLICIYASLRRDRFFKGLCLEAPLLVFPSKFGIITPSFGKLISRYFPTFEFNKLDYDDICRNKDYVHTLYGDHLRIHSGVPAKTAMEIYRAADYLKGCLKEISTPFIVCHGDADEISEIRGSEYLMEIAPVQDKTFIIFQRAKHQLRMEIENVNIEFSKNILEWI 284          
BLAST of Alpha/beta hydrolase vs. Planmine SMEST
Match: SMESG000038746.1 (SMESG000038746.1)

HSP 1 Score: 199.519 bits (506), Expect = 3.375e-61
Identity = 98/284 (34.51%), Postives = 156/284 (54.93%), Query Frame = 2
Query:  116 SKKEYFINPDGVKLFKQLWRPNAQNIRAFVFIIHGLSENSSFYYEDLVAKPLNEIGCLVAAHDQVGHGKSEGNRRLLEKIDNLSRDVVAHIELIRKTENLSSDIPTFLYGHSMGGLVATVTAHNYPEIINGMVLESPPLTLDGKIGPWMKYFALAMSYVIPYYKVGKQDLENLTHNTEVIQVALNDPYRHNEPMTLTTAVQIGEAIHYLQSVFKEMTTPFLIAHGEHDVIVSIAGSQKLYKESKTKDKSLLVFKNAYHIIRVD----SQEFRENIVEWIEKHIK 955
            ++ +YF+NPD +KLF+ +++P   N++A VFI HGL E+    Y  L+  PL +IGC+V  HD  GHG SEG R ++  I +L RDV+  I+ +   +NL+ +IP F+YGHSMGGL++   +       NGM LE+P L++   +G    +    M+ V+P   + K +   +  N E ++   ND    +  +   + + I +A+  L+ + K + TPF+I HG+ D +  IAGS    +     DKS L F  A H +R +      EF   I+ WI   ++
Sbjct:    6 TENDYFLNPDKIKLFRLVYKPIDSNVKALVFICHGLFEHCQSGYLKLIINPLKDIGCMVVTHDHRGHGLSEGKRGMIYDIHSLVRDVLLDIDEVMIQQNLNKNIPVFIYGHSMGGLISVFASLERKSFFNGMCLEAPALSIPKIVGKGTIFLGRIMNKVLPSISIAKSNKSYICRNLECLKEIENDKLVIHRGLPARSGMSIMKALQQLKPLIKNVDTPFIIGHGDADKLCEIAGSHYFVENCSATDKSFLTFPGAKHRLRAEIDNVDVEFSTKIINWINNRME 289          
BLAST of Alpha/beta hydrolase vs. Planmine SMEST
Match: SMESG000038743.1 (SMESG000038743.1)

HSP 1 Score: 182.185 bits (461), Expect = 1.693e-54
Identity = 97/283 (34.28%), Postives = 151/283 (53.36%), Query Frame = 2
Query:  116 SKKEYFINPDGVKLFKQLWRPNAQNIRAFVFIIHGLSENSSFYYEDLVAKPLNEIGCLVAAHDQVGHGKSEGNRRLLEKIDNLSRDVVAHIELIRKTENLSSDIPTFLYGHSMGGLVATVTAHNYPEIINGMVLESPPLTLDGKIGPWMKYFALAMSYVIPYYKVGKQDLENLTHNTEVIQVALNDPYRHNEPMTLTTAVQIGEAIHYLQSVFKEMTTPFLIAHGEHDVIVSIAGSQKLYKESKTKDKSLLVFKNAYHIIRVD----SQEFRENIVEWIEKHI 952
            S+ +Y IN DG+KLF+ ++   +   +A VF+ HGL E+    Y + + K LN+I CLV  HD +GHG S G+R ++   D L RDV++ I+ +       S +P FLYGHS+GGLV+       P    GM LE+P L     +     Y    +S ++P   +G  D  +++ + E ++    D  R +  +   T ++I  A+  L+   + +TTPF+I HGE D +  + GS+ L K+S   DK  + F  A H IR++    S +F + IVEW    I
Sbjct:    6 SENDYIINVDGIKLFRMIYHSTSGTTKAIVFLCHGLFEHCQACYYEPIIKHLNDIDCLVVTHDHMGHGLSNGDRGMIYDFDLLVRDVLSDIDDVINKMQTKSQLPIFLYGHSLGGLVSVYATLKRPTFFKGMCLEAPFLMFPTNVSNVALYMGKIVSVLLPKMPLGSIDYNDISRDVEYLEHVRKDKLRIHSGIPAKTIIEIYNAVENLKGQMENVTTPFIIGHGEADKLSDVEGSKLLVKKSPITDKIFIPFPGAKHQIRMEPGNVSSDFVKQIVEWFRNKI 288          
The following BLAST results are available for this feature:
BLAST of Alpha/beta hydrolase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MGLL4.586e-3830.51monoglyceride lipase [Source:HGNC Symbol;Acc:HGNC:... [more]
MGLL4.586e-3830.51monoglyceride lipase [Source:HGNC Symbol;Acc:HGNC:... [more]
MGLL6.352e-3830.51monoglyceride lipase [Source:HGNC Symbol;Acc:HGNC:... [more]
MGLL1.482e-3431.58monoglyceride lipase [Source:HGNC Symbol;Acc:HGNC:... [more]
MGLL1.162e-3129.89monoglyceride lipase [Source:HGNC Symbol;Acc:HGNC:... [more]
back to top
BLAST of Alpha/beta hydrolase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Alpha/beta hydrolase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Alpha/beta hydrolase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
mgll1.119e-3729.35monoglyceride lipase [Source:ZFIN;Acc:ZDB-GENE-031... [more]
mgll4.983e-2227.67monoglyceride lipase [Source:ZFIN;Acc:ZDB-GENE-031... [more]
back to top
BLAST of Alpha/beta hydrolase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
slc35d13.189e-4130.77solute carrier family 35 member D1 [Source:Xenbase... [more]
back to top
BLAST of Alpha/beta hydrolase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Mgll9.333e-4129.64monoglyceride lipase [Source:MGI Symbol;Acc:MGI:13... [more]
Mgll9.333e-4129.64monoglyceride lipase [Source:MGI Symbol;Acc:MGI:13... [more]
Mgll1.930e-4029.64monoglyceride lipase [Source:MGI Symbol;Acc:MGI:13... [more]
Mgll7.279e-3728.57monoglyceride lipase [Source:MGI Symbol;Acc:MGI:13... [more]
Mgll6.875e-2826.79monoglyceride lipase [Source:MGI Symbol;Acc:MGI:13... [more]
back to top
BLAST of Alpha/beta hydrolase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O35678|MGLL_MOUSE6.529e-4029.64Monoglyceride lipase OS=Mus musculus OX=10090 GN=M... [more]
sp|Q8R431|MGLL_RAT8.720e-3828.21Monoglyceride lipase OS=Rattus norvegicus OX=10116... [more]
sp|Q99685|MGLL_HUMAN2.202e-3730.51Monoglyceride lipase OS=Homo sapiens OX=9606 GN=MG... [more]
sp|Q9C942|CSE_ARATH9.620e-2726.96Caffeoylshikimate esterase OS=Arabidopsis thaliana... [more]
sp|A0QNZ7|MGLL_MYCS29.963e-2525.36Monoacylglycerol lipase OS=Mycolicibacterium smegm... [more]
back to top
BLAST of Alpha/beta hydrolase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A023G7K11.006e-5035.40Putative lysophospholipase OS=Amblyomma triste OX=... [more]
G3MI933.266e-5035.04Hydrolase_4 domain-containing protein (Fragment) O... [more]
A0A224Z3S05.400e-5034.05Lysophospholipase OS=Rhipicephalus zambeziensis OX... [more]
A0A1E1X7Q52.315e-4934.31Putative lysophospholipase (Fragment) OS=Amblyomma... [more]
A0A023FID44.070e-4835.83Putative lysophospholipase (Fragment) OS=Amblyomma... [more]
back to top
BLAST of Alpha/beta hydrolase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
mgll6.507e-4231.16monoglyceride lipase [Source:NCBI gene;Acc:1030267... [more]
back to top
BLAST of Alpha/beta hydrolase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
mgll3.975e-4032.28monoglyceride lipase [Source:ZFIN;Acc:ZDB-GENE-031... [more]
mgll2.138e-3428.85monoglyceride lipase [Source:ZFIN;Acc:ZDB-GENE-031... [more]
mgll7.646e-1926.24monoglyceride lipase [Source:ZFIN;Acc:ZDB-GENE-031... [more]
back to top
BLAST of Alpha/beta hydrolase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
YJU37.865e-1023.65Monoglyceride lipase (MGL); functional ortholog of... [more]
back to top
BLAST of Alpha/beta hydrolase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO294356.789e-4330.04Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Alpha/beta hydrolase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
mgll4.472e-4330.28monoglyceride lipase [Source:NCBI gene;Acc:1011698... [more]
mgll4.811e-4330.28monoglyceride lipase [Source:NCBI gene;Acc:1011698... [more]
mgll6.939e-4330.28monoglyceride lipase [Source:NCBI gene;Acc:1011698... [more]
back to top
BLAST of Alpha/beta hydrolase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000022359.10.000e+099.29SMESG000022359.1[more]
SMESG000004815.11.536e-9950.35SMESG000004815.1[more]
SMESG000038748.11.981e-6135.74SMESG000038748.1[more]
SMESG000038746.13.375e-6134.51SMESG000038746.1[more]
SMESG000038743.11.693e-5434.28SMESG000038743.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30009014 ID=SMED30009014|Name=Alpha/beta hydrolase|organism=Schmidtea mediterranea sexual|type=transcript|length=1187bp
GTCTGAAAGCAGAACTTTTAGTGATTTGAAAACCAACAAAACTTGGTCAA
ATCATTGATTATTGCACATAATTGCACTGGTTCAGAATTGATTTTTAGCA
CTATATCTGAACATGTCTAAGAAAGAATATTTTATCAATCCTGACGGAGT
TAAATTATTCAAACAACTGTGGCGGCCAAATGCTCAAAATATTAGAGCAT
TTGTTTTCATAATTCATGGGCTTAGTGAAAATTCATCTTTTTACTACGAG
GATTTGGTGGCGAAACCCTTGAATGAAATTGGATGTCTCGTTGCAGCGCA
CGATCAAGTGGGTCACGGTAAAAGTGAAGGAAATCGGCGATTATTGGAGA
AAATCGACAACCTGTCTAGGGACGTTGTTGCTCATATAGAACTGATTCGT
AAAACAGAAAACCTTTCAAGTGATATTCCTACTTTTTTATATGGACATTC
GATGGGAGGTCTTGTTGCCACAGTGACTGCCCACAATTATCCGGAAATAA
TAAACGGAATGGTTTTAGAATCGCCACCATTGACATTGGATGGGAAAATT
GGTCCGTGGATGAAATACTTTGCACTTGCAATGTCATATGTAATCCCATA
TTATAAAGTGGGGAAACAAGATCTAGAAAATCTCACTCATAACACAGAAG
TCATTCAAGTTGCACTCAATGATCCTTATAGGCACAACGAACCAATGACT
TTAACAACCGCCGTTCAAATCGGGGAAGCAATTCATTATTTGCAGTCAGT
CTTCAAGGAAATGACAACGCCATTTTTAATTGCCCATGGGGAACACGATG
TGATCGTTTCGATTGCTGGATCTCAGAAACTGTATAAAGAGAGTAAAACA
AAAGACAAATCTCTATTAGTATTTAAAAACGCTTATCATATTATACGAGT
CGACTCTCAAGAATTTAGAGAAAATATTGTGGAATGGATTGAAAAACATA
TAAAATAATGTTTTTCTATTTACTATAAACTTAAACAATTCTTTAAATAT
CCAAATTTTGTGATGAAGTATCCACTCTAATATTTTAATTGTCTTGTCTC
TAAAACATAAGTATGTTATAATCAAGGCCGGAGCCAGTTGCGGTGTTTCT
TTGATGCCCAAAACTATAGTTGTATTACTAAAAAAATGTCTTTTCTACAT
TTTGAAAGCTTTTTTAAAAAAAATTTGAATATACTTG
back to top

protein sequence of SMED30009014-orf-1

>SMED30009014-orf-1 ID=SMED30009014-orf-1|Name=SMED30009014-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=282bp
MSKKEYFINPDGVKLFKQLWRPNAQNIRAFVFIIHGLSENSSFYYEDLVA
KPLNEIGCLVAAHDQVGHGKSEGNRRLLEKIDNLSRDVVAHIELIRKTEN
LSSDIPTFLYGHSMGGLVATVTAHNYPEIINGMVLESPPLTLDGKIGPWM
KYFALAMSYVIPYYKVGKQDLENLTHNTEVIQVALNDPYRHNEPMTLTTA
VQIGEAIHYLQSVFKEMTTPFLIAHGEHDVIVSIAGSQKLYKESKTKDKS
LLVFKNAYHIIRVDSQEFRENIVEWIEKHIK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000018Category 4 cell
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR000073AB_hydrolase_1
IPR029058AB_hydrolase
IPR022742Hydrolase_4
Vocabulary: cellular component
TermDefinition
GO:0005654nucleoplasm
GO:0005737cytoplasm
GO:0005829cytosol
GO:0016020membrane
GO:0019898extrinsic component of membrane
GO:0030424axon
GO:0043196varicosity
GO:0045202synapse
Vocabulary: biological process
TermDefinition
GO:0006629lipid metabolic process
GO:0006631fatty acid metabolic process
GO:0006633fatty acid biosynthetic process
GO:0009966regulation of signal transduction
GO:0016042lipid catabolic process
GO:0019369arachidonic acid metabolic process
GO:0019433triglyceride catabolic process
GO:0030516regulation of axon extension
GO:0046464acylglycerol catabolic process
GO:0050727regulation of inflammatory response
GO:0051930regulation of sensory perception of pain
GO:0060292long term synaptic depression
GO:2000124regulation of endocannabinoid signaling pathway
Vocabulary: molecular function
TermDefinition
GO:0016787hydrolase activity
GO:0042803protein homodimerization activity
GO:0047372acylglycerol lipase activity
GO:0052689carboxylic ester hydrolase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000073Alpha/beta hydrolase fold-1PRINTSPR00111ABHYDROLASEcoord: 57..72
score: 39.01
coord: 221..235
score: 30.57
coord: 123..136
score: 32.27
coord: 109..122
score: 41.38
IPR022742Serine aminopeptidase, S33PFAMPF12146Hydrolase_4coord: 26..264
e-value: 3.3E-52
score: 177.2
IPR029058Alpha/Beta hydrolase foldGENE3DG3DSA:3.40.50.1820coord: 1..281
e-value: 1.8E-58
score: 200.1
IPR029058Alpha/Beta hydrolase foldSUPERFAMILYSSF53474alpha/beta-Hydrolasescoord: 6..280
NoneNo IPR availablePANTHERPTHR11614PHOSPHOLIPASE-RELATEDcoord: 5..278
NoneNo IPR availablePANTHERPTHR11614:SF87MONOGLYCERIDE LIPASEcoord: 5..278