SMED30009007

Overview
NameSMED30009007
Smed IDSMED30009007
Length (bp)547
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30009007 (SMED30009007) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30009007 (SMED30009007) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30009007 (SMED30009007) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30009007 (SMED30009007) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30009007

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 50

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
Smed sexual biotypeSMED30009007h1SMcG0004202 Contig4817newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30009007h1SMcG0004202 Contig4817uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30009007h1SMcG0014354 Contig45442uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30009007h1SMcG0014354 Contig45442newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30009007h1SMcG0014354 Contig20172uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30009007h1SMcG0014354 Contig20172newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30009007h1SMcG0014354 Contig4817newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30009007h1SMcG0014354 Contig4817uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
cephalic gangliaSMED30009007h1SMcG0014354 dd_Smed_v4_22711_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30009007h1SMcG0014354 dd_Smed_v4_22711_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
anterior sideSMED30009007h1SMcG0014354 dd_Smed_v4_22711_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30009007h1SMcG0014354 dd_Smed_v4_33016_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30009007h1SMcG0014354 dd_Smed_v4_33016_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30009007h1SMcG0014354 dd_Smed_v4_2438_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30009007h1SMcG0014354 dd_Smed_v4_2438_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30009007h1SMcG0014354 dd_Smed_v4_2438_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30009007h1SMcG0014354 dd_Smed_v4_2438_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30009007h1SMcG0014354 dd_Smed_v4_2438_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30009007h1SMcG0014354 dd_Smed_v4_2438_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30009007h1SMcG0014354 Contig8406newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30009007h1SMcG0014354 Contig8406uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
cephalic gangliaSMED30009007h1SMcG0014354 dd_Smed_v4_15537_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30009007h1SMcG0014354 dd_Smed_v4_15537_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
anterior sideSMED30009007h1SMcG0014354 dd_Smed_v4_15537_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30009007h1SMcG0014354 dd_Smed_v4_17069_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30009007h1SMcG0014354 dd_Smed_v4_17069_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30009007h1SMcG0014354 dd_Smed_v4_13910_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30009007h1SMcG0014354 dd_Smed_v4_13910_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30009007h1SMcG0014354 dd_Smed_v4_13910_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30009007h1SMcG0014354 dd_Smed_v4_13910_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30009007h1SMcG0014354 dd_Smed_v4_13910_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30009007h1SMcG0014354 dd_Smed_v4_14706_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30009007h1SMcG0014354 dd_Smed_v4_14706_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
anterior sideSMED30009007h1SMcG0014354 dd_Smed_v4_14706_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30009007h1SMcG0014354 dd_Smed_v6_22711_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
enteric muscle cellSMED30009007h1SMcG0014354 dd_Smed_v4_2438_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
enteric muscle cellSMED30009007h1SMcG0014354 dd_Smed_v4_15537_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
enteric muscle cellSMED30009007h1SMcG0014354 dd_Smed_v4_17069_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
enteric muscle cellSMED30009007h1SMcG0014354 dd_Smed_v4_13910_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
enteric muscle cellSMED30009007h1SMcG0014354 dd_Smed_v4_14706_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pharynx musculatureSMED30009007h1SMcG0014354 dd_Smed_v6_13910_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
musculature systemSMED30009007h1SMcG0014354 dd_Smed_v6_13910_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30009007h1SMcG0014354 dd_Smed_v6_15537_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pharynx musculatureSMED30009007h1SMcG0014354 dd_Smed_v6_15537_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
musculature systemSMED30009007h1SMcG0014354 dd_Smed_v6_15537_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pharynx musculatureSMED30009007h1SMcG0014354 dd_Smed_v6_14706_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pharynx musculatureSMED30009007h1SMcG0014354 dd_Smed_v6_2438_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
musculature systemSMED30009007h1SMcG0014354 dd_Smed_v6_2438_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pharynx musculatureSMED30009007h1SMcG0014354 dd_Smed_v6_17069_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
musculature systemSMED30009007h1SMcG0014354 dd_Smed_v6_17069_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30009007 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.000643:97469..98015 +2726
v31.000643:97072..97490 +682
Homology
BLAST of SMED30009007 vs. Planmine SMEST
Match: SMESG000005752.1 (SMESG000005752.1)

HSP 1 Score: 257.299 bits (656), Expect = 2.390e-79
Identity = 181/182 (99.45%), Postives = 181/182 (99.45%), Query Frame = 1
Query:    1 TKDNKELQILSENVEIHDEHQTETFQEFDEVNLESKAEENVFKTQVIEEHPQFVEALITDNIEDEVVNDVAVLSEGVEQTQKLDENEVXXXXXXXXXXTALTSLIKNILEDKVCEHKSEMPEVNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGSFEIEMELSDIEREIVKADFETKDNKEL 546
            TKDNKELQILSENVE HDEHQTETFQEFDEVNLESKAEENVFKTQVIEEHPQFVEALITDNIEDEVVNDVAVLSEGVEQTQKLDENEVKEEIPEIKPITALTSLIKNILEDKVCEHKSEMPEVNVLEEVKTEMEVVETEDVIKEIIEKQESIEGSFEIEMELSDIEREIVKADFETKDNKEL
Sbjct: 8744 TKDNKELQILSENVENHDEHQTETFQEFDEVNLESKAEENVFKTQVIEEHPQFVEALITDNIEDEVVNDVAVLSEGVEQTQKLDENEVKEEIPEIKPITALTSLIKNILEDKVCEHKSEMPEVNVLEEVKTEMEVVETEDVIKEIIEKQESIEGSFEIEMELSDIEREIVKADFETKDNKEL 8925          

HSP 2 Score: 103.99 bits (258), Expect = 5.969e-26
Identity = 104/197 (52.79%), Postives = 141/197 (71.57%), Query Frame = 1
Query:    1 TKDNKELQILSENVEIHDEHQTETFQE-FDEVNLESKAEENVFKTQVIEEHPQFVEALITDNIEDEV--------------VNDVAVLSEGVEQTQKLDENEVXXXXXXXXXXTALTSLIKNILEDKVCEHKSEMPEVNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGSFEIEMELSDIEREIVKADFETKDNKEL 546
            TKDN+ELQI+SENVEI DEH+TET +E F E  LE+K E +V +T++IEE+PQ +EA    N+ED V               N++  LSE VEQ ++++++E+K+E  EIK     T++ +N  EDKV E KSE PE+NV EE+K E E+V+ E+V +E IEK+ESIE SFEIE+ELSD+E E V+ADF+TKDN+EL
Sbjct: 7330 TKDNEELQIVSENVEIVDEHETETCKEEFYEAPLENKME-SVIETELIEEYPQSLEA---SNVEDIVEEEINTIEATIIKPKNELLALSEAVEQIERVEQDEIKDEDLEIKQEETFTAVFENNSEDKVFETKSEKPEINVFEEMKIEEEIVKIEEVFEETIEKEESIEDSFEIEIELSDVEHENVEADFKTKDNEEL 7522          

HSP 3 Score: 101.293 bits (251), Expect = 5.588e-25
Identity = 101/197 (51.27%), Postives = 139/197 (70.56%), Query Frame = 1
Query:    1 TKDNKELQILSENVEIHDEHQTETFQE-FDEVNLESKAEENVFKTQVIEEHPQFVEALITDNIEDEV--------------VNDVAVLSEGVEQTQKLDENEVXXXXXXXXXXTALTSLIKNILEDKVCEHKSEMPEVNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGSFEIEMELSDIEREIVKADFETKDNKEL 546
            TKDN+ELQI+SENVEI DEH+ +T +E   +  LESK E NVF+T+VIE++PQ +EA    N+ED V               N++  LSE VEQ ++++++E+K+E  EIK     T++ +N  EDK  E KSE PE+NV EE+K E E+V+ E+V +E IEK++SIE SFEIE+ELSD+E E V+ADF+TKDN+EL
Sbjct: 7516 TKDNEELQIVSENVEIVDEHEAKTCEEELYKKPLESKVE-NVFETKVIEQYPQALEA---SNVEDIVEEEINTIEATIIKPKNELLALSEAVEQIERVEQDEIKDEDLEIKQEETFTAVFENNSEDKFFETKSEKPEINVFEEMKIEEEIVKIEEVFEETIEKEDSIEDSFEIEIELSDVEHENVEADFKTKDNEEL 7708          

HSP 4 Score: 94.3597 bits (233), Expect = 1.677e-22
Identity = 79/196 (40.31%), Postives = 121/196 (61.73%), Query Frame = 1
Query:    1 TKDNKELQILSENVEIHDEHQTETFQE-FDEVNLESKAEENVFKTQVIEEHPQFVEALITDNIEDEVVNDV-----------AVLSEGVEQTQKL--DENEVXXXXXXXXXXTALTSLIKNILEDKVCEHKSEMPEVNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGSFEIEMELSDIEREIVKADFETKDNKEL 546
            TKDNKELQ +SEN+EI DEH+     E  +EV+++ K EENVFKT++I+E P+F+EAL+ +NI +E +++V            VL+E VEQ ++L  D++EV E    +      +++++++LE  +  H+SE+ E+++      E E    +               SFEIEMELSD+E E V+A+F+TKDNKEL
Sbjct: 8576 TKDNKELQNVSENLEITDEHEANIHDEALEEVSIQHKLEENVFKTEIIKEQPEFLEALVAENIVEEEMHNVEGTLVKTEKQQTVLAEAVEQIKELEHDKDEVSEIKQALVS----SAVMEDVLETNI--HESEVKELDIKVIDSIEREESIED---------------SFEIEMELSDVENEDVEAEFKTKDNKEL 8750          

HSP 5 Score: 92.0485 bits (227), Expect = 8.868e-22
Identity = 80/194 (41.24%), Postives = 126/194 (64.95%), Query Frame = 1
Query:    1 TKDNKELQILSENVEIHDEHQTETFQE-FDEVNLESKAEENVFKTQVIEEHPQFVEALITDNIEDE---------VVND--VAVLSEGVEQTQKLDENEVXXXXXXXXXXTALTSLIKNILEDKVCEHKSEMPEVNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGSFEIEMELSDIEREIVKADFETKDNKEL 546
            TKD+++ +I+S  +E  DEH+ E F+E  +EV+LE+K EENVF+ + IE+ P F+E L+T+NI +E         V +D  V VLSE VEQTQK ++ E+  ++ EI+ + A  S++  ++E +  E +SE P++N+LEE K E E+ E E+ I++          SFEIE+ELSD E + ++ADF+ K++  L
Sbjct: 8218 TKDSEDFKIVSGCIETVDEHEAEAFKEVLNEVSLENKIEENVFQIKAIEKQPHFLEELVTENIAEEEIKTIDAIVVPSDAMVPVLSEAVEQTQKYEQGEINADVAEIEQVIASKSVVGKVIESRAIELESEKPKLNLLEESKIETEITEKEESIED----------SFEIEIELSDAENQELEADFKAKESLAL 8401          

HSP 6 Score: 77.7962 bits (190), Expect = 9.778e-17
Identity = 82/194 (42.27%), Postives = 118/194 (60.82%), Query Frame = 1
Query:    1 TKDNKELQILSENVE-IHDEHQTETFQEFDEVNLESKAEENVFKTQVIEEHPQFVEALITDNIEDEVVNDV-----------AVLSEGVEQTQKLDENEVXXXXXXXXXXTALTSLIKNILEDKVCEHKSEMPEVNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGSFEIEMELSDIEREIVKADFETKDNKEL 546
             K++  LQ +SENVE I D     + +E +EV LE++ E+NV+ T  I EHPQ +EA+ T+NI ++ +N +           + LSE VEQ  K+++  V E+I EI    A T+LI+N LE+     KSE  +VNVLE  K E  + +        ++++   + SFEIEMELSD+E E V+ADF+TKDNKEL
Sbjct: 8395 AKESLALQNVSENVENICDYAGHLSEEELNEVYLENEVEDNVYDTIAIVEHPQTLEAMATENIIEQEINTIEATIVKTEKKLSTLSEAVEQNVKIEQGGVNEDILEIIETRASTALIENSLEN-----KSEKLDVNVLENSKVEETMKDEAVFEDIFVQEESIED-SFEIEMELSDLENEDVEADFKTKDNKEL 8582          

HSP 7 Score: 71.2478 bits (173), Expect = 1.468e-14
Identity = 76/193 (39.38%), Postives = 119/193 (61.66%), Query Frame = 1
Query:    1 TKDNKELQILSENVEIHDEHQTETFQE-FDEVNLESKAEENVFKTQVIEEHPQFVEALITDNIEDE--------VVND---VAVLSEGVEQTQKLDENEVXXXXXXXXXXTALTSLIKNILEDKVCEHKSEMPEVNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGSFEIEMELSDIEREIVKADFETKDNKE 543
            T+ N +LQ +SE++E  ++H T  ++E  DEV LE+  E NVFKT++I+EHPQF+E+L  D +  E        +V     + VLSE VEQ + ++++E+++++  I+    L     N++E +V E K E  +  +  E K E+E    E   +E IEK+ESI+ SFEIEMELS+++ E VK +F+ KD  E
Sbjct: 7850 TESNVDLQNVSEDIENLEQHATNIYEERLDEVQLENVTELNVFKTEIIQEHPQFLESLTNDTMAGEEMRILEAIIVAPKEVIKVLSEAVEQIETIEQSEIQDDLANIEQDIVLA----NVIEAQVLETKLEQADEYISMETKIEIETPNPEATTEETIEKEESIDDSFEIEMELSEVKNEDVKEEFKMKDKVE 8038          

HSP 8 Score: 70.0922 bits (170), Expect = 3.441e-14
Identity = 47/98 (47.96%), Postives = 63/98 (64.29%), Query Frame = 1
Query:    1 TKDNKELQILSENVEIHDEHQTETFQE-FDEVNLESKAEENVFKTQVIEEHPQFVE--------ALITDNIEDEVVND---VAVLSEGVEQTQKLDEN 258
            TKDNKELQ+LSEN EI +EH+TE  +E   EVNLESK EEN   ++VIEEHPQ +E            + +E  +V     + VLSE +EQ +KL+++
Sbjct: 8919 TKDNKELQVLSENAEIQEEHETEKCKEELYEVNLESKMEENASMSKVIEEHPQILEKEINENIVEEEINTVEATIVRSEEQLPVLSEVIEQIEKLEKD 9016          

HSP 9 Score: 65.855 bits (159), Expect = 1.215e-12
Identity = 73/193 (37.82%), Postives = 108/193 (55.96%), Query Frame = 1
Query:    4 KDNKELQILSENVEIHDEHQTETFQE-FDEVNLESKAEENVFKTQVIEEHPQFVEALI--------TDNIEDEVVND---VAVLSEGVEQTQKLDENEVXXXXXXXXXXTALTSLIKNILEDKVCEHKSEMPEVNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGSFEIEMELSDIEREIVKADFETKDNKEL 546
            KD  E    SEN+EI  E + ET  E  DEV L S+ E+N+F+TQVIEE PQF+E  I        T ++E  +V     + +LSE +EQTQ L ++E+ E         ++  +I N  E+ V   K E  +V  + E   + + V   +V   I+   ES+E SFE+EMEL D+E   V+A+F+TKD+++ 
Sbjct: 8034 KDKVEHHGASENIEIVHEQKAETSGETMDEVCLASRVEQNLFETQVIEEIPQFLETTIISDIVEEETKSVEGTIVKPEVKMEILSEAIEQTQNLKQSEINEISEIKPNAASVL-VIDNSPEENVLGLKPETFDV-PILEESNKQDEVTEMEVKGNIVVNAESLEDSFEMEMELLDVESANVEAEFKTKDSEDF 8224          

HSP 10 Score: 57.3806 bits (137), Expect = 8.997e-10
Identity = 59/180 (32.78%), Postives = 96/180 (53.33%), Query Frame = 1
Query:   52 DEHQTETFQEF-DEVNLESKAEENVFKTQVIEEHPQFVEALITDNIEDEVVNDV------------AVLSEGVEQTQKLDENEVXXXXXXXXXXTALTSLIKNILEDKVCEHKSEMPEVNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGSFEIEME--LSDIEREIVKADFETKDNKEL 546
            DE +   +Q+  D V+LE+K E +V +T+VI+E  +F+E L+TDNI +E +N V             ++SE VE   K+DE+E+ +     +  +  T++++N LE +V + K++ PE+N+L E   +                        E+EME  L   E   V+ADF+TKDN+EL
Sbjct: 7184 DEQEANIYQDLLDVVSLENKIENDVLETRVIKEQSEFLEPLVTDNIPEEEMNSVELVTVKPEELTTVLISESVE---KVDESEIIDIAEIKQTDST-TTVVENFLEIQVIDEKADKPEINILTETNIQS-----------------------EVEMETALEHTENVNVEADFKTKDNEEL 7336          

HSP 11 Score: 51.2174 bits (121), Expect = 1.112e-7
Identity = 47/123 (38.21%), Postives = 73/123 (59.35%), Query Frame = 1
Query:    1 TKDNKELQILSENVEIHDEHQTETF-QEFDEVNLESKAEENVFKTQVIEEHPQFVEALITDNIEDEVVNDVAVLSEGVEQTQKLDENEVXXXXXXXXXXTALTSLIKNILEDKVCEHKSEMPE 366
            TKDN+ELQI+SEN+EI DEH+ +T  +E  E +L SK E+    T+ I   P            D++ N   +LSE VEQ +K+++ E+K+E  E+    A  ++++N+L+ K  E K+  PE
Sbjct: 7702 TKDNEELQIVSENIEIVDEHEAKTCGEELYEKSLTSKVED--VSTEAIIIKP------------DDMKN---ILSESVEQIEKVEQCEIKDEFAEVMQDKAFEAVLENVLDVKATEPKTTKPE 7807          
The following BLAST results are available for this feature:
BLAST of SMED30009007 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30009007 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30009007 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30009007 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30009007 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30009007 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30009007 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30009007 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30009007 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30009007 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30009007 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30009007 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30009007 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30009007 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000005752.12.390e-7999.45SMESG000005752.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30009007 ID=SMED30009007|Name=SMED30009007|organism=Schmidtea mediterranea sexual|type=transcript|length=547bp
ACAAAAGACAATAAAGAACTTCAAATTCTTTCTGAAAATGTTGAGATCCA
TGACGAACATCAAACTGAAACATTCCAAGAATTCGATGAAGTTAATTTAG
AAAGTAAAGCAGAAGAAAATGTGTTCAAAACGCAAGTAATTGAAGAACAT
CCACAATTTGTAGAAGCGTTGATAACAGATAACATTGAAGATGAAGTGGT
AAATGATGTTGCAGTTTTATCTGAAGGAGTTGAACAGACACAAAAACTTG
ATGAGAATGAAGTTAAAGAGGAAATTCCTGAAATAAAACCAATAACAGCT
TTGACAAGTCTTATTAAAAACATACTTGAAGATAAGGTCTGTGAACATAA
ATCGGAAATGCCTGAAGTAAATGTTTTAGAAGAAGTGAAAACGGAAATGG
AAGTTGTTGAAACTGAAGACGTTATCAAAGAAATAATTGAAAAACAAGAA
TCGATAGAGGGCTCTTTTGAAATAGAAATGGAATTATCAGATATCGAAAG
AGAAATTGTAAAAGCAGATTTTGAAACAAAAGACAATAAAGAACTTC
back to top

protein sequence of SMED30009007-orf-1

>SMED30009007-orf-1 ID=SMED30009007-orf-1|Name=SMED30009007-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=182bp
TKDNKELQILSENVEIHDEHQTETFQEFDEVNLESKAEENVFKTQVIEEH
PQFVEALITDNIEDEVVNDVAVLSEGVEQTQKLDENEVKEEIPEIKPITA
LTSLIKNILEDKVCEHKSEMPEVNVLEEVKTEMEVVETEDVIKEIIEKQE
SIEGSFEIEMELSDIEREIVKADFETKDNKEL
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000101muscle cell
PLANA:0000428musculature system
PLANA:0000478pharynx musculature
PLANA:0003104enteric muscle cell
PLANA:0003117parapharyngeal cell