phosphorylated CTD-interacting factor 1

Overview
Namephosphorylated CTD-interacting factor 1
Smed IDSMED30008994
Length (bp)2581
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of phosphorylated CTD-interacting factor 1 (SMED30008994) t-SNE clustered cells

Violin plots show distribution of expression levels for phosphorylated CTD-interacting factor 1 (SMED30008994) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of phosphorylated CTD-interacting factor 1 (SMED30008994) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for phosphorylated CTD-interacting factor 1 (SMED30008994) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30008994

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30008994SMESG000057164.1 dd_Smed_v4_9161_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30008994SMESG000057164.1 dd_Smed_v4_9161_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30008994SMESG000057164.1 dd_Smed_v4_9161_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of phosphorylated CTD-interacting factor 1 vs. Ensembl Human
Match: PCIF1 (PDX1 C-terminal inhibiting factor 1 [Source:HGNC Symbol;Acc:HGNC:16200])

HSP 1 Score: 400.208 bits (1027), Expect = 2.793e-127
Identity = 222/542 (40.96%), Postives = 306/542 (56.46%), Query Frame = 1
Query:  511 MVKGRRPNKSVFLPPHPLIEFERANLLNKLRSQFVNSCMTRENIHPPDGSFNRWLLQMKTIDYGYDPIFPSRCDKSIGSSMKRELLLSLPFPIVKPKYLNAAKTQLIRYSESVKGLVERRNASPPCRKIIKHNVDETLRWIRSEEYRSFDDYIEKLVSIKRICQPHIQDLVRESVEKICIKMYNLSQEYTMRLRTNHLKLFQQNGIPLPEILNDLNIEHVVQNPYNDLLDIDINQLTPKSNEFINQELTPCHPIGLACPCPLFTSLNTQM---TVTIQEELNISDPKASLVSIEIPDLAKFHITKCHFEKLETLYLVSTRDDPEKIAFNNRLWCLLQRYYSYLGCENGSFGGVINQAALPVAVFEVLNRLFDVNFEMFASPLNCYFPQYCSAFHDTDRYFGSCGPALEFFPVTGSFEANPPFCEELLLGFVNYVEKLLQNSELALSFIVFIPDWRDPPFEALTLLEVSPFNRHQMTLRAREHEYRIANFXXXXXXXXXXTRNQPEILKRSGHSTLVVFLQNNSGFQRWTPTTERLNELMAVY 2127
            ++K R P  S  LPPHP +E  R+ L+ KLR  +   C  RE I PP  SFNRW+L+ K +D G DP+ PS C+  +  SM RE++  +P  + + K+   AK  L +Y+E+ + L+E R+ASP  RK++K NV++T  W+R +   S +DY+++L  ++R C PH+    ++SVE IC K+Y++S EY  R+R  HL + ++N I                                     +   L  C+P+ LA   P   S+   M    V I+        K  +V +          ++ +F KL  LY  S  DD     F  R+WCLL+RY    G   G + G   Q +LPV VFE L+RLF V+FE FASPLNCYF QYCSAF DTD YFGS GP L+F P++GSFEANPPFCEEL+   V++ E+LL++S   LSFIVFIP+WR+PP  ALT +E S F RHQ+ L A EHEYR  +              + E+  ++ H+T V+FLQN+ GF +W PT ERL EL A Y
Sbjct:  185 VIKHRGP--SEVLPPHPEVELLRSQLILKLRQHYRELCQQREGIEPPRESFNRWMLERKVVDKGSDPLLPSNCEPVVSPSMFREIMNDIPIRLSRIKFREEAKRLLFKYAEAARRLIESRSASPDSRKVVKWNVEDTFSWLRKDHSASKEDYMDRLEHLRRQCGPHVSAAAKDSVEGICSKIYHISLEYVKRIREKHLAILKENNIS-----------------------------EEVEAPEVEPRLVYCYPVRLAVSAPPMPSVEMHMENNVVCIRY-------KGEMVKV----------SRNYFSKLWLLYRYSCIDDSAFERFLPRVWCLLRRYQMMFGV--GLYEGTGLQGSLPVHVFEALHRLFGVSFECFASPLNCYFRQYCSAFPDTDGYFGSRGPCLDFAPLSGSFEANPPFCEELMDAMVSHFERLLESSPEPLSFIVFIPEWREPPTPALTRMEQSRFKRHQLILPAFEHEYRSGS---------QHICKKEEMHYKAVHNTAVLFLQNDPGFAKWAPTPERLQELSAAY 667          

HSP 2 Score: 58.151 bits (139), Expect = 6.864e-8
Identity = 22/38 (57.89%), Postives = 29/38 (76.32%), Query Frame = 1
Query:  214 AHDLPENLLNAGWRKFWSKRENREYYYNKITGASLWDL 327
              DLPE L++AGW K WS+RENR YY+N+ T  SLW++
Sbjct:   37 VQDLPEELVHAGWEKCWSRRENRPYYFNRFTNQSLWEM 74          
BLAST of phosphorylated CTD-interacting factor 1 vs. Ensembl Human
Match: PCIF1 (PDX1 C-terminal inhibiting factor 1 [Source:HGNC Symbol;Acc:HGNC:16200])

HSP 1 Score: 205.682 bits (522), Expect = 3.448e-59
Identity = 118/241 (48.96%), Postives = 147/241 (61.00%), Query Frame = 1
Query: 1252 LTPCHPIGLACPCPLFTSLNTQM---TVTIQEELNISDPKASLVSIEIPDLAKFHITKCHFEKLETLYLVSTRDDPEKIAFNNRLWCLLQRYYSYLGCENGSFGGVINQAALPVAVFEVLNRLFDVNFEMFASPLNCYFPQYCSAFHDTDRYFGSCGPALEFFPVTGSFEANPPFCEELLLGFVNYVEKLLQNSELALSFIVFIPDWRDPPFEALTLLEVSPFNRHQMTLRAREHEYRIAN 1965
            L  C+P+ LA   P   S+   M    V I+        K  +V +          ++ +F KL  LY  S  DD     F  R+WCLL+RY    G   G + G   Q +LPV VFE L+RLF V+FE FASPLNCYF QYCSAF DTD YFGS GP L+F P++GSFEANPPFCEEL+   V++ E+LL++S   LSFIVFIP+WR+PP  ALT +E S F RHQ+ L A EHEYR  +
Sbjct:   20 LVYCYPVRLAVSAPPMPSVEMHMENNVVCIRY-------KGEMVKV----------SRNYFSKLWLLYRYSCIDDSAFERFLPRVWCLLRRYQMMFGV--GLYEGTGLQGSLPVHVFEALHRLFGVSFECFASPLNCYFRQYCSAFPDTDGYFGSRGPCLDFAPLSGSFEANPPFCEELMDAMVSHFERLLESSPEPLSFIVFIPEWREPPTPALTRMEQSRFKRHQLILPAFEHEYRSGS 241          
BLAST of phosphorylated CTD-interacting factor 1 vs. Ensembl Fly
Match: CG11399 (gene:FBgn0037021 transcript:FBtr0078277)

HSP 1 Score: 390.578 bits (1002), Expect = 1.127e-121
Identity = 235/660 (35.61%), Postives = 348/660 (52.73%), Query Frame = 1
Query:  211 YAHDLPENLLNAGWRKFWSKRENREYYYNKITGASLWDLNELQLQESSYNSITKRKASGDSDEINQKRACY-----------RSNIHIEP-----LLGP---AFVPGSLYNFVSSKYIPMVKGRRPNKSVFLP-PHPLIEFERANLLNKLRSQFVNSCMTRENIHPPDGSFNRWLLQMKTIDYGYDPIFPSRCDKSIGSSMKRELLLSLPFPIVKPKYLNAAKTQLIRYSESVKGLVERRNASPPCRKIIKHNVDETLRWIRSEEYRSFDDYIEKLVSIKRICQPHIQDLVRESVEKICIKMYNLSQEYTMRLRTNHLKLFQQNGIPLPEILNDLNIEHVVQNPYNDLLDIDINQLTPKSNEFINQELTPCHPIGLACPCPLFTSLNTQMTVTIQEELNISDPKASLVSIEIPDLAKFHITKCHFEKLETLYLVSTRDDPEKIAFNNRLWCLLQRYYSYLG-CENGSFGGVINQAALPVAVFEVLNRLFDVNFEMFASPLNCYFPQYCSAFHDTDRYFGSCGPALEFFPVTGSFEANPPFCEELLLGFVNYVEKLLQNSELALSFIVFIPDWRDPPFEALTLLEVSPFNRHQMTLRAREHEYRIANFXXXXXXXXXXTRNQPEILKRSGHSTLVVFLQNNSGFQRWTPTTERLNELMAVY 2127
            Y  +L   L+N GWRKFWSKRENR YY+NK+TG SLW++   +  +   + +    A G +  I                    ++HI P       GP    FV    ++        +V+  RP     LP PHP +E  RA    KL   + + CM RENI  P  SFNRWL++ K ID G DP+ PS C   I SSM RE++  +P  IVKPK+   A+ QL RY+E+ K ++E R+A    +K++K NV++T +W+R     S++D+ ++L  +KR C+PH+ + V+ SVE +C+K+Y+LS ++  ++R  H +L +++GI                                      + +   C+PI  A P P         T+   ++ +    K +  +I  PD    ++T  + +KLE LY  +  DD +   F  R+WCLL+RY ++LG   N S    + QAALPV VFE L+R F V+FE FASP N YF QYCSAF DTD YFGS GP L+F PV+GSF+ NPP CEEL+   + +++KLL ++   LSFIVF+P+W+     +++ L+ S + R  M +    HEYR                 + ++L +    T VV+LQN++G+ RW P   R+  L   +
Sbjct:  131 YGEELTAELVNQGWRKFWSKRENRPYYWNKVTGESLWEMPGTRPFDPLTDPLGICHAGGPTPIIPNMHQQQQHQHHHLKRRPSDDMHIHPNQHHMGGGPPMKKFVLAGPWDLEVCTNAVIVE--RP--PTLLPQPHPEVEALRAAFTMKLLKTYEDLCMRRENIKAPRDSFNRWLMERKVIDTGCDPLLPSSCMPEISSSMYREIMSDIPIKIVKPKFTGDARKQLSRYAEAAKQIIESRSAPAESKKVVKWNVEDTFQWLRRTVGASYEDFQDRLAHLKRQCEPHLVETVKSSVETLCVKIYHLSADHARKIRERHSQLLKEHGI----------------------------PEPTPPPPPPHLKKVWCYPIQFAVPSPRMP------TIEYLQDRDHMIIKYTPATINQPDAQYINLT--YLQKLEQLYRHNCFDDKKFDLFIGRVWCLLKRYQTFLGNALNSSQEAELTQAALPVPVFECLHRQFGVSFECFASPFNSYFRQYCSAFADTDAYFGSRGPFLDFKPVSGSFQVNPPHCEELIEASLLHIDKLLTDTMEPLSFIVFLPEWK-----SISKLDDSMYKRRSMVVLGMAHEYRHG---------YQHMLQKSDVLIKCMQGTQVVWLQNSAGYARWGPNEIRVEALREAF 736          
BLAST of phosphorylated CTD-interacting factor 1 vs. Ensembl Zebrafish
Match: pcif1 (PDX1 C-terminal inhibiting factor 1 [Source:NCBI gene;Acc:553360])

HSP 1 Score: 446.817 bits (1148), Expect = 2.933e-145
Identity = 257/696 (36.93%), Postives = 363/696 (52.16%), Query Frame = 1
Query:  217 HDLPENLLNAGWRKFWSKRENREYYYNKITGASLWDL---------------------NELQLQESSYNSITKRKASGDSDEINQ---KRACYR--------------SNIHIEPLL--------------GPA-FVPGSLYNFVSSKYIPMVKGRRPNKSVFLPPHPLIEFERANLLNKLRSQFVNSCMTRENIHPPDGSFNRWLLQMKTIDYGYDPIFPSRCDKSIGSSMKRELLLSLPFPIVKPKYLNAAKTQLIRYSESVKGLVERRNASPPCRKIIKHNVDETLRWIRSEEYRSFDDYIEKLVSIKRICQPHIQDLVRESVEKICIKMYNLSQEYTMRLRTNHLKLFQQNGIPLPEILNDLNIEHVVQNPYNDLLDIDINQLTPKSNEFINQELTPCHPIGLACPCPLFTSLNTQMTVTIQEELNISDPKASLVSIEIPDLAKFHITKCHFEKLETLYLVSTRDDPEKIAFNNRLWCLLQRYYSYLGCENGSFGGVINQAALPVAVFEVLNRLFDVNFEMFASPLNCYFPQYCSAFHDTDRYFGSCGPALEFFPVTGSFEANPPFCEELLLGFVNYVEKLLQNSELALSFIVFIPDWRDPPFEALTLLEVSPFNRHQMTLRAREHEYRIANFXXXXXXXXXXTRNQPEILKRSGHSTLVVFLQNNSGFQRWTPTTERLNELMAVYYTANLS 2145
             +LP+ L+ AGW K WSKRENR YY+N+ T  SLW++                      E        N   KR  S D+ +      KR                  S   ++P +               PA + P  +Y  +  +   +++ R P  +  LPPHP IE +RA L  KLR  +   C  RE I PP  SFNRWLL+ K +D G DP+ PS CD  I  SM RE++  +P  + + KY   A+  L +Y+E+ K +++ RNA+P  RK++K NV++T+ W+R +   S +DY+++L  +++ C PH+  + ++SVE IC K+Y++S EY  R+R  HL L ++  I                        +D  +     +  +   L  C+P+ L+ P P      T++ +  + ++     K  +V +          ++ HF KLE LY  S  DDP    F +R+WCL++RY    G  +G   G   Q +LPV VFE LN+ F V FE FASPLNCYF Q+CSAF D D +FGS GP L F P +GSFEANPPFCEEL+   V + E LL  S   LSFI+F+P+WRDPP  ALT +E S F RHQMT+ A EHEYR  +              + EI  ++ H T V+FLQNN+GF +W PTTER+ EL+A Y  +  S
Sbjct:   38 QELPDELIQAGWSKCWSKRENRPYYFNRFTNQSLWEMPVLGQHDVISDPLGLNAAPASGEANADAGLGNGQRKRHPSEDASQAGPNSFKRPKVEIPATPTTPTVPISPSTPGVKPWVNTTTDEKQGQASTPAPAPYRPSVVYWDLDIQTNAVIRERAP--ADHLPPHPEIELQRAQLTTKLRQHYHELCSQREGIEPPRESFNRWLLERKVVDKGLDPLLPSECDPVISPSMFREIMNDIPIRLSRIKYKEEARKLLFKYAEAAKKMIDSRNATPESRKVVKWNVEDTMNWLRRDHSASKEDYMDRLEHLRKQCGPHVASVAKDSVEGICSKIYHISAEYVRRIRQAHLTLLKECNI-----------------------SVDGTE-----SAEVQDRLVYCYPVRLSIPAPP----QTRVELHFENDIACLRFKGEMVKV----------SRGHFNKLELLYRYSCIDDPRFEKFLSRVWCLIKRYQVMFG--SGVNEGSGLQGSLPVPVFEALNKQFGVTFECFASPLNCYFKQFCSAFPDIDGFFGSRGPFLSFSPASGSFEANPPFCEELMDAMVTHFEDLLGRSSEPLSFIIFVPEWRDPPTPALTRMEASRFRRHQMTVPAFEHEYRSGS---------QHICKREEIYYKAIHGTAVIFLQNNAGFAKWEPTTERIQELLAAYKVSGRS 678          
BLAST of phosphorylated CTD-interacting factor 1 vs. Ensembl Zebrafish
Match: pcif1 (PDX1 C-terminal inhibiting factor 1 [Source:NCBI gene;Acc:553360])

HSP 1 Score: 342.428 bits (877), Expect = 4.382e-107
Identity = 202/581 (34.77%), Postives = 293/581 (50.43%), Query Frame = 1
Query:  217 HDLPENLLNAGWRKFWSKRENREYYYNKITGASLWDL---------------------NELQLQESSYNSITKRKASGDSDEINQ---KRACYR--------------SNIHIEPLL--------------GPA-FVPGSLYNFVSSKYIPMVKGRRPNKSVFLPPHPLIEFERANLLNKLRSQFVNSCMTRENIHPPDGSFNRWLLQMKTIDYGYDPIFPSRCDKSIGSSMKRELLLSLPFPIVKPKYLNAAKTQLIRYSESVKGLVERRNASPPCRKIIKHNVDETLRWIRSEEYRSFDDYIEKLVSIKRICQPHIQDLVRESVEKICIKMYNLSQEYTMRLRTNHLKLFQQNGIPLPEILNDLNIEHVVQNPYNDLLDIDINQLTPKSNEFINQELTPCHPIGLACPCPLFTSLNTQMTVTIQEELNISDPKASLVSIEIPDLAKFHITKCHFEKLETLYLVSTRDDPEKIAFNNRLWCLLQRYYSYLGCENGSFGGVINQAALPVAVFEVLNRLFDVNFEMFASPLNCYFPQYCSAFHDTDRYFGSCGPALEFFPVTGSFEANPPFCEELLLGFVNY 1800
             +LP+ L+ AGW K WSKRENR YY+N+ T  SLW++                      E        N   KR  S D+ +      KR                  S   ++P +               PA + P  +Y  +  +   +++ R P  +  LPPHP IE +RA L  KLR  +   C  RE I PP  SFNRWLL+ K +D G DP+ PS CD  I  SM RE++  +P  + + KY   A+  L +Y+E+ K +++ RNA+P  RK++K NV++T+ W+R +   S +DY+++L  +++ C PH+  + ++SVE IC K+Y++S EY  R+R  HL L ++  I                        +D  +     +  +   L  C+P+ L+ P P      T++ +  + ++     K  +V           +++ HF KLE LY  S  DDP    F +R+WCL++RY    G  +G   G   Q +LPV VFE LN+ F V FE FASPLNCYF Q+CSAF D D +FGS GP L F P +GSFEANPPFCEEL+   V +
Sbjct:   38 QELPDELIQAGWSKCWSKRENRPYYFNRFTNQSLWEMPVLGQHDVISDPLGLNAAPASGEANADAGLGNGQRKRHPSEDASQAGPNSFKRPKVEIPATPTTPTVPISPSTPGVKPWVNTTTDEKQGQASTPAPAPYRPSVVYWDLDIQTNAVIRERAP--ADHLPPHPEIELQRAQLTTKLRQHYHELCSQREGIEPPRESFNRWLLERKVVDKGLDPLLPSECDPVISPSMFREIMNDIPIRLSRIKYKEEARKLLFKYAEAAKKMIDSRNATPESRKVVKWNVEDTMNWLRRDHSASKEDYMDRLEHLRKQCGPHVASVAKDSVEGICSKIYHISAEYVRRIRQAHLTLLKECNI-----------------------SVDGTE-----SAEVQDRLVYCYPVRLSIPAP----PQTRVELHFENDIACLRFKGEMVK----------VSRGHFNKLELLYRYSCIDDPRFEKFLSRVWCLIKRYQVMFG--SGVNEGSGLQGSLPVPVFEALNKQFGVTFECFASPLNCYFKQFCSAFPDIDGFFGSRGPFLSFSPASGSFEANPPFCEELMDAMVTH 572          
BLAST of phosphorylated CTD-interacting factor 1 vs. Ensembl Xenopus
Match: iyd (iodotyrosine deiodinase [Source:Xenbase;Acc:XB-GENE-975245])

HSP 1 Score: 437.573 bits (1124), Expect = 6.735e-142
Identity = 256/683 (37.48%), Postives = 366/683 (53.59%), Query Frame = 1
Query:  220 DLPENLLNAGWRKFWSKRENREYYYNKITGASLWD---------------LNELQLQESSYNSI------TKRKASGDSDEINQKRACYRSNIHIEPLLGPAFVPGS---------------------LYNFVSSKYIPMVKGRRPNKSV-----FLPPHPLIEFERANLLNKLRSQFVNSCMTRENIHPPDGSFNRWLLQMKTIDYGYDPIFPSRCDKSIGSSMKRELLLSLPFPIVKPKYLNAAKTQLIRYSESVKGLVERRNASPPCRKIIKHNVDETLRWIRSEEYRSFDDYIEKLVSIKRICQPHIQDLVRESVEKICIKMYNLSQEYTMRLRTNHLKLFQQNGIPLPEILNDLNIEHVVQNPYNDLLDIDINQLTPKSNEFINQELTPCHPIGLACPCPLFTSLNTQMTVTIQEELNISDPKASLVSIEIPDLAKFHITKCHFEKLETLYLVSTRDDPEKIAFNNRLWCLLQRYYSYLGCENGSFGGVINQAALPVAVFEVLNRLFDVNFEMFASPLNCYFPQYCSAFHDTDRYFGSCGPALEFFPVTGSFEANPPFCEELLLGFVNYVEKLLQNSELALSFIVFIPDWRDPPFEALTLLEVSPFNRHQMTLRAREHEYRIANFXXXXXXXXXXTRNQPEILKRSGHSTLVVFLQNNSGFQRWTPTTERLNELMAVY 2127
            DLP+ L+ AGW K WSKRE+R YY+N+ T  SLW+               LN   +Q     ++      TK +    S++++      +  I   P+  P  VP S                     +Y  +  +   +VK   P+  +     FLPP+P +E  R+ L+ KLR  +   C  RE I PP  SFNRWLL+ K +D G DP+ PS CD ++  SM RE++  +P  + + K+   AK  L +Y+E+ K L+E R+AS   RK++K NV++T  W+R +   + +DY+++L  +++ C PH+  + ++SVE IC K+Y++S+EY  R+R  HL L +   IP+ ++                        ++P+           CHP+ L+ P     +L TQ  V +Q+E        SLV +         I + +F KL  LY +S  DD     F +R+WCLL+RY    G     + G   Q ALPV VF+ L+++F V  E FASPLNCYF QYCSAF DTD YFGS GP L FFPV+GSFEANPPF EEL+   V + E LL++S+  LSFI+FIP+WRDPP  ALT +E S F RHQ+ L A +HEYR  +              + E+  ++ H+T V+FLQN  GF +WTPT ER+ EL A Y
Sbjct:   34 DLPDELVQAGWEKCWSKRESRPYYFNRFTNQSLWEMPVLGQHDVISDPLGLNAAPVQVEGAGAVPETPKDTKPQKRRISEDLSAGETVKKLKIESTPVT-PGSVPSSPIFPGVSLDEKQLSALLKTTDVYWDLDIQSNVVVKPLPPSHLLPPPSQFLPPYPEVELLRSQLVLKLRQHYRELCQQREGIDPPRESFNRWLLERKVLDRGPDPLLPSDCDPAVSPSMFREIMNDVPIRLSRIKHREEAKRLLFKYAEAAKRLIESRSASSDSRKMVKWNVEDTFSWLRRDHLATKEDYMDRLEHLRKQCGPHMAAVAKDSVEGICSKIYHISREYVKRIREKHLALLRDANIPVDQV----------------------PAVSPQDRRVF------CHPVRLSVP-----ALPTQPGVEVQQE-------GSLVCVRYKG-ESVRINQSYFSKLYQLYRLSCIDDSGTERFLSRVWCLLRRYQVMFG--TAQYEGSGLQGALPVHVFQTLHKVFGVTLECFASPLNCYFKQYCSAFTDTDGYFGSRGPCLSFFPVSGSFEANPPFSEELMDAMVTHFENLLESSDQPLSFIIFIPEWRDPPTPALTRMESSRFKRHQLLLTAFQHEYRSGS---------QHMCKREELYYKAVHNTAVIFLQNEPGFLKWTPTAERIQELTASY 663          
BLAST of phosphorylated CTD-interacting factor 1 vs. Ensembl Xenopus
Match: iyd (iodotyrosine deiodinase [Source:Xenbase;Acc:XB-GENE-975245])

HSP 1 Score: 434.491 bits (1116), Expect = 3.625e-141
Identity = 249/649 (38.37%), Postives = 357/649 (55.01%), Query Frame = 1
Query:  220 DLPENLLNAGWRKFWSKRENREYYYNKITGASLWDLNELQLQESSYNSI------TKRKASGDSDEINQKRACYRSNIHIEPLLGPAF--VPGSLYNFVSSKYIPMVKGRRPNKSV-----FLPPHPLIEFERANLLNKLRSQFVNSCMTRENIHPPDGSFNRWLLQMKTIDYGYDPIFPSRCDKSIGSSMKRELLLSLPFPIVKPKYLNAAKTQLIRYSESVKGLVERRNASPPCRKIIKHNVDETLRWIRSEEYRSFDDYIEKLVSIKRICQPHIQDLVRESVEKICIKMYNLSQEYTMRLRTNHLKLFQQNGIPLPEILNDLNIEHVVQNPYNDLLDIDINQLTPKSNEFINQELTPCHPIGLACPCPLFTSLNTQMTVTIQEELNISDPKASLVSIEIPDLAKFHITKCHFEKLETLYLVSTRDDPEKIAFNNRLWCLLQRYYSYLGCENGSFGGVINQAALPVAVFEVLNRLFDVNFEMFASPLNCYFPQYCSAFHDTDRYFGSCGPALEFFPVTGSFEANPPFCEELLLGFVNYVEKLLQNSELALSFIVFIPDWRDPPFEALTLLEVSPFNRHQMTLRAREHEYRIANFXXXXXXXXXXTRNQPEILKRSGHSTLVVFLQNNSGFQRWTPTTERLNELMAVY 2127
            DLP+ L+ AGW K WSKRE+R YY+N+ T  SLW++  L   +   + +       + + +G   E  +     +  I  +   G     +   +Y  +  +   +VK   P+  +     FLPP+P +E  R+ L+ KLR  +   C  RE I PP  SFNRWLL+ K +D G DP+ PS CD ++  SM RE++  +P  + + K+   AK  L +Y+E+ K L+E R+AS   RK++K NV++T  W+R +   + +DY+++L  +++ C PH+  + ++SVE IC K+Y++S+EY  R+R  HL L +   IP+                            +P+           CHP+ L+ P     +L TQ  V +Q+E        SLV +         I + +F KL  LY +S  DD     F +R+WCLL+RY    G     + G   Q ALPV VF+ L+++F V  E FASPLNCYF QYCSAF DTD YFGS GP L FFPV+GSFEANPPF EEL+   V + E LL++S+  LSFI+FIP+WRDPP  ALT +E S F RHQ+ L A +HEYR  +              + E+  ++ H+T V+FLQN  GF +WTPT ER+ EL A Y
Sbjct:   34 DLPDELVQAGWEKCWSKRESRPYYFNRFTNQSLWEMPVLGQHDVISDPLGLNAAPVQVEGAGAVPETPKDTKPQKRRISEDLSAGETVKKLKVLVYWDLDIQSNVVVKPLPPSHLLPPPSQFLPPYPEVELLRSQLVLKLRQHYRELCQQREGIDPPRESFNRWLLERKVLDRGPDPLLPSDCDPAVSPSMFREIMNDVPIRLSRIKHREEAKRLLFKYAEAAKRLIESRSASSDSRKMVKWNVEDTFSWLRRDHLATKEDYMDRLEHLRKQCGPHMAAVAKDSVEGICSKIYHISREYVKRIREKHLALLRDANIPV----------------------------SPQDRRVF------CHPVRLSVP-----ALPTQPGVEVQQE-------GSLVCVRYKG-ESVRINQSYFSKLYQLYRLSCIDDSGTERFLSRVWCLLRRYQVMFG--TAQYEGSGLQGALPVHVFQTLHKVFGVTLECFASPLNCYFKQYCSAFTDTDGYFGSRGPCLSFFPVSGSFEANPPFSEELMDAMVTHFENLLESSDQPLSFIIFIPEWRDPPTPALTRMESSRFKRHQLLLTAFQHEYRSGS---------QHMCKREELYYKAVHNTAVIFLQNEPGFLKWTPTAERIQELTASY 624          
BLAST of phosphorylated CTD-interacting factor 1 vs. Ensembl Xenopus
Match: iyd (iodotyrosine deiodinase [Source:Xenbase;Acc:XB-GENE-975245])

HSP 1 Score: 431.024 bits (1107), Expect = 8.521e-140
Identity = 246/646 (38.08%), Postives = 357/646 (55.26%), Query Frame = 1
Query:  229 ENLLNAGWRKFWSKRENREYYYNKITGASLWDLNELQLQESSYNSI------TKRKASGDSDEINQKRACYRSNIHIEPLLGPAF--VPGSLYNFVSSKYIPMVKGRRPNKSV-----FLPPHPLIEFERANLLNKLRSQFVNSCMTRENIHPPDGSFNRWLLQMKTIDYGYDPIFPSRCDKSIGSSMKRELLLSLPFPIVKPKYLNAAKTQLIRYSESVKGLVERRNASPPCRKIIKHNVDETLRWIRSEEYRSFDDYIEKLVSIKRICQPHIQDLVRESVEKICIKMYNLSQEYTMRLRTNHLKLFQQNGIPLPEILNDLNIEHVVQNPYNDLLDIDINQLTPKSNEFINQELTPCHPIGLACPCPLFTSLNTQMTVTIQEELNISDPKASLVSIEIPDLAKFHITKCHFEKLETLYLVSTRDDPEKIAFNNRLWCLLQRYYSYLGCENGSFGGVINQAALPVAVFEVLNRLFDVNFEMFASPLNCYFPQYCSAFHDTDRYFGSCGPALEFFPVTGSFEANPPFCEELLLGFVNYVEKLLQNSELALSFIVFIPDWRDPPFEALTLLEVSPFNRHQMTLRAREHEYRIANFXXXXXXXXXXTRNQPEILKRSGHSTLVVFLQNNSGFQRWTPTTERLNELMAVY 2127
            + L+ AGW K WSKRE+R YY+N+ T  SLW++  L   +   + +       + + +G   E  +     +  I  +   G     +   +Y  +  +   +VK   P+  +     FLPP+P +E  R+ L+ KLR  +   C  RE I PP  SFNRWLL+ K +D G DP+ PS CD ++  SM RE++  +P  + + K+   AK  L +Y+E+ K L+E R+AS   RK++K NV++T  W+R +   + +DY+++L  +++ C PH+  + ++SVE IC K+Y++S+EY  R+R  HL L +   IP+ ++                        ++P+           CHP+ L+ P     +L TQ  V +Q+E        SLV +         I + +F KL  LY +S  DD     F +R+WCLL+RY    G     + G   Q ALPV VF+ L+++F V  E FASPLNCYF QYCSAF DTD YFGS GP L FFPV+GSFEANPPF EEL+   V + E LL++S+  LSFI+FIP+WRDPP  ALT +E S F RHQ+ L A +HEYR  +              + E+  ++ H+T V+FLQN  GF +WTPT ER+ EL A Y
Sbjct:   31 DELVQAGWEKCWSKRESRPYYFNRFTNQSLWEMPVLGQHDVISDPLGLNAAPVQVEGAGAVPETPKDTKPQKRRISEDLSAGETVKKLKVLVYWDLDIQSNVVVKPLPPSHLLPPPSQFLPPYPEVELLRSQLVLKLRQHYRELCQQREGIDPPRESFNRWLLERKVLDRGPDPLLPSDCDPAVSPSMFREIMNDVPIRLSRIKHREEAKRLLFKYAEAAKRLIESRSASSDSRKMVKWNVEDTFSWLRRDHLATKEDYMDRLEHLRKQCGPHMAAVAKDSVEGICSKIYHISREYVKRIREKHLALLRDANIPVDQV----------------------PAVSPQDRRVF------CHPVRLSVP-----ALPTQPGVEVQQE-------GSLVCVRYKG-ESVRINQSYFSKLYQLYRLSCIDDSGTERFLSRVWCLLRRYQVMFG--TAQYEGSGLQGALPVHVFQTLHKVFGVTLECFASPLNCYFKQYCSAFTDTDGYFGSRGPCLSFFPVSGSFEANPPFSEELMDAMVTHFENLLESSDQPLSFIIFIPEWRDPPTPALTRMESSRFKRHQLLLTAFQHEYRSGS---------QHMCKREELYYKAVHNTAVIFLQNEPGFLKWTPTAERIQELTASY 624          
BLAST of phosphorylated CTD-interacting factor 1 vs. Ensembl Xenopus
Match: iyd (iodotyrosine deiodinase [Source:Xenbase;Acc:XB-GENE-975245])

HSP 1 Score: 405.986 bits (1042), Expect = 2.209e-130
Identity = 237/629 (37.68%), Postives = 337/629 (53.58%), Query Frame = 1
Query:  220 DLPENLLNAGWRKFWSKRENREYYYNKITGASLWD---------------LNELQLQESSYNSI------TKRKASGDSDEINQKRACYRSNIHIEPLLGPAFVPGS---------------------LYNFVSSKYIPMVKGRRPNKSV-----FLPPHPLIEFERANLLNKLRSQFVNSCMTRENIHPPDGSFNRWLLQMKTIDYGYDPIFPSRCDKSIGSSMKRELLLSLPFPIVKPKYLNAAKTQLIRYSESVKGLVERRNASPPCRKIIKHNVDETLRWIRSEEYRSFDDYIEKLVSIKRICQPHIQDLVRESVEKICIKMYNLSQEYTMRLRTNHLKLFQQNGIPLPEILNDLNIEHVVQNPYNDLLDIDINQLTPKSNEFINQELTPCHPIGLACPCPLFTSLNTQMTVTIQEELNISDPKASLVSIEIPDLAKFHITKCHFEKLETLYLVSTRDDPEKIAFNNRLWCLLQRYYSYLGCENGSFGGVINQAALPVAVFEVLNRLFDVNFEMFASPLNCYFPQYCSAFHDTDRYFGSCGPALEFFPVTGSFEANPPFCEELLLGFVNYVEKLLQNSELALSFIVFIPDWRDPPFEALTLLEVSPFNRHQMTLRAREHEYRIAN 1965
            DLP+ L+ AGW K WSKRE+R YY+N+ T  SLW+               LN   +Q     ++      TK +    S++++      +  I   P+  P  VP S                     +Y  +  +   +VK   P+  +     FLPP+P +E  R+ L+ KLR  +   C  RE I PP  SFNRWLL+ K +D G DP+ PS CD ++  SM RE++  +P  + + K+   AK  L +Y+E+ K L+E R+AS   RK++K NV++T  W+R +   + +DY+++L  +++ C PH+  + ++SVE IC K+Y++S+EY  R+R  HL L +   IP+P +                         +P+           CHP+ L+ P     +L TQ  V +Q+E        SLV +         I + +F KL  LY +S  DD     F +R+WCLL+RY    G     + G   Q ALPV VF+ L+++F V  E FASPLNCYF QYCSAF DTD YFGS GP L FFPV+GSFEANPPF EEL+   V + E LL++S+  LSFI+FIP+WRDPP  ALT +E S F RHQ+ L A +HEYR  +
Sbjct:   34 DLPDELVQAGWEKCWSKRESRPYYFNRFTNQSLWEMPVLGQHDVISDPLGLNAAPVQVEGAGAVPETPKDTKPQKRRISEDLSAGETVKKLKIESTPVT-PGSVPSSPIFPGVSLDEKQLSALLKTTDVYWDLDIQSNVVVKPLPPSHLLPPPSQFLPPYPEVELLRSQLVLKLRQHYRELCQQREGIDPPRESFNRWLLERKVLDRGPDPLLPSDCDPAVSPSMFREIMNDVPIRLSRIKHREEAKRLLFKYAEAAKRLIESRSASSDSRKMVKWNVEDTFSWLRRDHLATKEDYMDRLEHLRKQCGPHMAAVAKDSVEGICSKIYHISREYVKRIREKHLALLRDANIPVPAV-------------------------SPQDRRVF------CHPVRLSVP-----ALPTQPGVEVQQE-------GSLVCVRYKG-ESVRINQSYFSKLYQLYRLSCIDDSGTERFLSRVWCLLRRYQVMFG--TAQYEGSGLQGALPVHVFQTLHKVFGVTLECFASPLNCYFKQYCSAFTDTDGYFGSRGPCLSFFPVSGSFEANPPFSEELMDAMVTHFENLLESSDQPLSFIIFIPEWRDPPTPALTRMESSRFKRHQLLLTAFQHEYRSGS 615          
BLAST of phosphorylated CTD-interacting factor 1 vs. Ensembl Xenopus
Match: iyd (iodotyrosine deiodinase [Source:Xenbase;Acc:XB-GENE-975245])

HSP 1 Score: 401.364 bits (1030), Expect = 2.409e-128
Identity = 244/684 (35.67%), Postives = 350/684 (51.17%), Query Frame = 1
Query:  220 DLPENLLNAGWRKFWSKRENREYYYNKITGASLWD---------------LNELQLQESSYNSI------TKRKASGDSDEINQKRACYRSNIHIEPLLGPAFVPGS---------------------LYNFVSSKYIPMVKGRRPNKSV-----FLPPHPLIEFERANLLNKLRSQFVNSCMTRENIHPPDGSFNRWLLQMKTIDYGYDPIFPSRCDKSIGSSMKRELLLSLPFPIVKPKYLNAAKTQLIRYSESVKGLVERRNASPPCRKIIKHNVDETLRWIRSEEYRSFDDYIEKLVSIKRICQPHIQDLVRESVEKICIKMYNLSQEYTMRLRTNHLKLFQQNGIPLPEILNDLNIEHVVQNPYNDLLDIDINQLTPKSNEFINQELTPCHPIGLACPCPLFTSLNTQMTVTIQEELNISDPKASLVSIEIPDLAKFHITKCHFEKLETLYLVSTRDDPEKIAFNNRLWCLLQRYYSYLGC-ENGSFGGVINQAALPVAVFEVLNRLFDVNFEMFASPLNCYFPQYCSAFHDTDRYFGSCGPALEFFPVTGSFEANPPFCEELLLGFVNYVEKLLQNSELALSFIVFIPDWRDPPFEALTLLEVSPFNRHQMTLRAREHEYRIANFXXXXXXXXXXTRNQPEILKRSGHSTLVVFLQNNSGFQRWTPTTERLNELMAVY 2127
            DLP+ L+ AGW K WSKRE+R YY+N+ T  SLW+               LN   +Q     ++      TK +    S++++      +  I   P+  P  VP S                     +Y  +  +   +VK   P+  +     FLPP+P +E  R+ L+ KLR  +   C  RE I PP  SFNRWLL+ K +D G DP+ PS CD ++  SM RE++  +P  + + K+   AK  L +Y+E+ K L+E R+AS   RK++K NV++T  W+R +   + +DY+++L  +++ C PH+  + ++SVE IC K+Y++S+EY  R+R  HL L +   IP+ ++                        ++P+           CHP+ L+ P     +L TQ  V +Q+E +                                 LV  R   E +  N       Q Y+S L       + G   Q ALPV VF+ L+++F V  E FASPLNCYF QYCSAF DTD YFGS GP L FFPV+GSFEANPPF EEL+   V + E LL++S+  LSFI+FIP+WRDPP  ALT +E S F RHQ+ L A +HEYR  +              + E+  ++ H+T V+FLQN  GF +WTPT ER+ EL A Y
Sbjct:   34 DLPDELVQAGWEKCWSKRESRPYYFNRFTNQSLWEMPVLGQHDVISDPLGLNAAPVQVEGAGAVPETPKDTKPQKRRISEDLSAGETVKKLKIESTPVT-PGSVPSSPIFPGVSLDEKQLSALLKTTDVYWDLDIQSNVVVKPLPPSHLLPPPSQFLPPYPEVELLRSQLVLKLRQHYRELCQQREGIDPPRESFNRWLLERKVLDRGPDPLLPSDCDPAVSPSMFREIMNDVPIRLSRIKHREEAKRLLFKYAEAAKRLIESRSASSDSRKMVKWNVEDTFSWLRRDHLATKEDYMDRLEHLRKQCGPHMAAVAKDSVEGICSKIYHISREYVKRIREKHLALLRDANIPVDQV----------------------PAVSPQDRRVF------CHPVRLSVP-----ALPTQPGVEVQQEGS---------------------------------LVCVRYKGESVRIN-------QSYFSKLVMFGTAQYEGSGLQGALPVHVFQTLHKVFGVTLECFASPLNCYFKQYCSAFTDTDGYFGSRGPCLSFFPVSGSFEANPPFSEELMDAMVTHFENLLESSDQPLSFIIFIPEWRDPPTPALTRMESSRFKRHQLLLTAFQHEYRSGS---------QHMCKREELYYKAVHNTAVIFLQNEPGFLKWTPTAERIQELTASY 634          
BLAST of phosphorylated CTD-interacting factor 1 vs. Ensembl Mouse
Match: Pcif1 (PDX1 C-terminal inhibiting factor 1 [Source:MGI Symbol;Acc:MGI:2443858])

HSP 1 Score: 414.461 bits (1064), Expect = 5.432e-133
Identity = 226/547 (41.32%), Postives = 319/547 (58.32%), Query Frame = 1
Query:  511 MVKGRRPNKSVFLPPHPLIEFERANLLNKLRSQFVNSCMTRENIHPPDGSFNRWLLQMKTIDYGYDPIFPSRCDKSIGSSMKRELLLSLPFPIVKPKYLNAAKTQLIRYSESVKGLVERRNASPPCRKIIKHNVDETLRWIRSEEYRSFDDYIEKLVSIKRICQPHIQDLVRESVEKICIKMYNLSQEYTMRLRTNHLKLFQQNGIPLPEILNDLNIEHVVQNPYNDLLDIDINQLTPKSNEFINQELTPCHPIGLACPCPLFTSLNTQMTVTIQEELNISDPKASLVSIEIPDLAKFHITKCHFEKLETLYLVSTRDDPEKIAFNNRLWCLLQRYYSYLGCENGSFGGVINQAALPVAVFEVLNRLFDVNFEMFASPLNCYFPQYCSAFHDTDRYFGSCGPALEFFPVTGSFEANPPFCEELLLGFVNYVEKLLQNSELALSFIVFIPDWRDPPFEALTLLEVSPFNRHQMTLRAREHEYRIANFXXXXXXXXXXTRNQPEILKRSGHSTLVVFLQNNSGFQRWTPTTERLNELMAVYYTANLSNN 2151
            ++K R P++   LPPHP +E  R+ L+ KLR  +   C  RE I PP  SFNRW+L+ K +D G DP+ PS C+  +  SM RE++  +P  + + K+   AK  L +Y+E+ + L+E R+ASP  RK++K NV++T  W+R E   S +DY+++L  ++R C PH+    ++SVE IC K+Y++S EY  R+R  HL + ++N IP                      +++ ++L P+        L  C+P+ LA   P   S+          E+++ +   S+V I         +++ +F KL  LY  S  DD     F  R+WCLL+RY    G   G + G   Q +LPV VFE L+RLF V+FE FASPLNCYF QYCSAF DTD YFGS GP L+F P++GSFEANPPFCEEL+   V++ EKLL++S   LSFIVFIP+WR+PP  ALT +E S F RHQ+ L A EHEYR  +              + E+  ++ H+T V+FLQN  GF +W PT ERL EL A Y  +  S+ 
Sbjct:  184 VIKHRGPSE--VLPPHPDVELLRSQLILKLRQHYRELCQQREGIEPPRESFNRWMLERKVVDKGCDPLLPSNCEPVVSPSMFREIMNDIPIRLSRIKFREEAKRLLFKYAEAARRLIESRSASPDSRKVVKWNVEDTFSWLRKEHSASKEDYMDRLEHLRRQCGPHVSAAAKDSVEGICSKIYHISLEYVKRIREKHLAVLKENNIP---------------------EEVEASELEPR--------LVYCYPVRLAVSAPPMPSV----------EMHVEN---SVVCIRYKG-EMVKVSRSYFSKLWLLYRYSCVDDSAFERFLPRVWCLLRRYQMMFGV--GLYEGTGLQGSLPVHVFETLHRLFGVSFECFASPLNCYFRQYCSAFPDTDGYFGSRGPCLDFTPLSGSFEANPPFCEELMDAMVSHFEKLLESSAEPLSFIVFIPEWREPPTPALTRMEQSRFKRHQLVLPAFEHEYRSGS---------QHICKKEEMHYKAVHNTAVLFLQNGPGFAKWGPTPERLQELTAAYKQSGRSHG 674          

HSP 2 Score: 56.225 bits (134), Expect = 1.511e-7
Identity = 21/37 (56.76%), Postives = 29/37 (78.38%), Query Frame = 1
Query:  217 HDLPENLLNAGWRKFWSKRENREYYYNKITGASLWDL 327
             DLPE L++AGW K WS+RE+R YY+N+ T  SLW++
Sbjct:   38 QDLPEELVHAGWEKCWSRRESRPYYFNRFTNQSLWEM 74          
BLAST of phosphorylated CTD-interacting factor 1 vs. UniProt/SwissProt
Match: sp|A0A0R4IKJ1|CAPAM_DANRE (mRNA (2'-O-methyladenosine-N(6)-)-methyltransferase OS=Danio rerio OX=7955 GN=pcif1 PE=1 SV=1)

HSP 1 Score: 446.817 bits (1148), Expect = 2.214e-144
Identity = 257/696 (36.93%), Postives = 363/696 (52.16%), Query Frame = 1
Query:  217 HDLPENLLNAGWRKFWSKRENREYYYNKITGASLWDL---------------------NELQLQESSYNSITKRKASGDSDEINQ---KRACYR--------------SNIHIEPLL--------------GPA-FVPGSLYNFVSSKYIPMVKGRRPNKSVFLPPHPLIEFERANLLNKLRSQFVNSCMTRENIHPPDGSFNRWLLQMKTIDYGYDPIFPSRCDKSIGSSMKRELLLSLPFPIVKPKYLNAAKTQLIRYSESVKGLVERRNASPPCRKIIKHNVDETLRWIRSEEYRSFDDYIEKLVSIKRICQPHIQDLVRESVEKICIKMYNLSQEYTMRLRTNHLKLFQQNGIPLPEILNDLNIEHVVQNPYNDLLDIDINQLTPKSNEFINQELTPCHPIGLACPCPLFTSLNTQMTVTIQEELNISDPKASLVSIEIPDLAKFHITKCHFEKLETLYLVSTRDDPEKIAFNNRLWCLLQRYYSYLGCENGSFGGVINQAALPVAVFEVLNRLFDVNFEMFASPLNCYFPQYCSAFHDTDRYFGSCGPALEFFPVTGSFEANPPFCEELLLGFVNYVEKLLQNSELALSFIVFIPDWRDPPFEALTLLEVSPFNRHQMTLRAREHEYRIANFXXXXXXXXXXTRNQPEILKRSGHSTLVVFLQNNSGFQRWTPTTERLNELMAVYYTANLS 2145
             +LP+ L+ AGW K WSKRENR YY+N+ T  SLW++                      E        N   KR  S D+ +      KR                  S   ++P +               PA + P  +Y  +  +   +++ R P  +  LPPHP IE +RA L  KLR  +   C  RE I PP  SFNRWLL+ K +D G DP+ PS CD  I  SM RE++  +P  + + KY   A+  L +Y+E+ K +++ RNA+P  RK++K NV++T+ W+R +   S +DY+++L  +++ C PH+  + ++SVE IC K+Y++S EY  R+R  HL L ++  I                        +D  +     +  +   L  C+P+ L+ P P      T++ +  + ++     K  +V +          ++ HF KLE LY  S  DDP    F +R+WCL++RY    G  +G   G   Q +LPV VFE LN+ F V FE FASPLNCYF Q+CSAF D D +FGS GP L F P +GSFEANPPFCEEL+   V + E LL  S   LSFI+F+P+WRDPP  ALT +E S F RHQMT+ A EHEYR  +              + EI  ++ H T V+FLQNN+GF +W PTTER+ EL+A Y  +  S
Sbjct:   38 QELPDELIQAGWSKCWSKRENRPYYFNRFTNQSLWEMPVLGQHDVISDPLGLNAAPASGEANADAGLGNGQRKRHPSEDASQAGPNSFKRPKVEIPATPTTPTVPISPSTPGVKPWVNTTTDEKQGQASTPAPAPYRPSVVYWDLDIQTNAVIRERAP--ADHLPPHPEIELQRAQLTTKLRQHYHELCSQREGIEPPRESFNRWLLERKVVDKGLDPLLPSECDPVISPSMFREIMNDIPIRLSRIKYKEEARKLLFKYAEAAKKMIDSRNATPESRKVVKWNVEDTMNWLRRDHSASKEDYMDRLEHLRKQCGPHVASVAKDSVEGICSKIYHISAEYVRRIRQAHLTLLKECNI-----------------------SVDGTE-----SAEVQDRLVYCYPVRLSIPAPP----QTRVELHFENDIACLRFKGEMVKV----------SRGHFNKLELLYRYSCIDDPRFEKFLSRVWCLIKRYQVMFG--SGVNEGSGLQGSLPVPVFEALNKQFGVTFECFASPLNCYFKQFCSAFPDIDGFFGSRGPFLSFSPASGSFEANPPFCEELMDAMVTHFEDLLGRSSEPLSFIIFVPEWRDPPTPALTRMEASRFRRHQMTVPAFEHEYRSGS---------QHICKREEIYYKAIHGTAVIFLQNNAGFAKWEPTTERIQELLAAYKVSGRS 678          
BLAST of phosphorylated CTD-interacting factor 1 vs. UniProt/SwissProt
Match: sp|P59114|CAPAM_MOUSE (mRNA (2'-O-methyladenosine-N(6)-)-methyltransferase OS=Mus musculus OX=10090 GN=Pcif1 PE=1 SV=1)

HSP 1 Score: 414.461 bits (1064), Expect = 3.800e-132
Identity = 226/547 (41.32%), Postives = 319/547 (58.32%), Query Frame = 1
Query:  511 MVKGRRPNKSVFLPPHPLIEFERANLLNKLRSQFVNSCMTRENIHPPDGSFNRWLLQMKTIDYGYDPIFPSRCDKSIGSSMKRELLLSLPFPIVKPKYLNAAKTQLIRYSESVKGLVERRNASPPCRKIIKHNVDETLRWIRSEEYRSFDDYIEKLVSIKRICQPHIQDLVRESVEKICIKMYNLSQEYTMRLRTNHLKLFQQNGIPLPEILNDLNIEHVVQNPYNDLLDIDINQLTPKSNEFINQELTPCHPIGLACPCPLFTSLNTQMTVTIQEELNISDPKASLVSIEIPDLAKFHITKCHFEKLETLYLVSTRDDPEKIAFNNRLWCLLQRYYSYLGCENGSFGGVINQAALPVAVFEVLNRLFDVNFEMFASPLNCYFPQYCSAFHDTDRYFGSCGPALEFFPVTGSFEANPPFCEELLLGFVNYVEKLLQNSELALSFIVFIPDWRDPPFEALTLLEVSPFNRHQMTLRAREHEYRIANFXXXXXXXXXXTRNQPEILKRSGHSTLVVFLQNNSGFQRWTPTTERLNELMAVYYTANLSNN 2151
            ++K R P++   LPPHP +E  R+ L+ KLR  +   C  RE I PP  SFNRW+L+ K +D G DP+ PS C+  +  SM RE++  +P  + + K+   AK  L +Y+E+ + L+E R+ASP  RK++K NV++T  W+R E   S +DY+++L  ++R C PH+    ++SVE IC K+Y++S EY  R+R  HL + ++N IP                      +++ ++L P+        L  C+P+ LA   P   S+          E+++ +   S+V I         +++ +F KL  LY  S  DD     F  R+WCLL+RY    G   G + G   Q +LPV VFE L+RLF V+FE FASPLNCYF QYCSAF DTD YFGS GP L+F P++GSFEANPPFCEEL+   V++ EKLL++S   LSFIVFIP+WR+PP  ALT +E S F RHQ+ L A EHEYR  +              + E+  ++ H+T V+FLQN  GF +W PT ERL EL A Y  +  S+ 
Sbjct:  184 VIKHRGPSE--VLPPHPDVELLRSQLILKLRQHYRELCQQREGIEPPRESFNRWMLERKVVDKGCDPLLPSNCEPVVSPSMFREIMNDIPIRLSRIKFREEAKRLLFKYAEAARRLIESRSASPDSRKVVKWNVEDTFSWLRKEHSASKEDYMDRLEHLRRQCGPHVSAAAKDSVEGICSKIYHISLEYVKRIREKHLAVLKENNIP---------------------EEVEASELEPR--------LVYCYPVRLAVSAPPMPSV----------EMHVEN---SVVCIRYKG-EMVKVSRSYFSKLWLLYRYSCVDDSAFERFLPRVWCLLRRYQMMFGV--GLYEGTGLQGSLPVHVFETLHRLFGVSFECFASPLNCYFRQYCSAFPDTDGYFGSRGPCLDFTPLSGSFEANPPFCEELMDAMVSHFEKLLESSAEPLSFIVFIPEWREPPTPALTRMEQSRFKRHQLVLPAFEHEYRSGS---------QHICKKEEMHYKAVHNTAVLFLQNGPGFAKWGPTPERLQELTAAYKQSGRSHG 674          

HSP 2 Score: 56.225 bits (134), Expect = 1.057e-6
Identity = 21/37 (56.76%), Postives = 29/37 (78.38%), Query Frame = 1
Query:  217 HDLPENLLNAGWRKFWSKRENREYYYNKITGASLWDL 327
             DLPE L++AGW K WS+RE+R YY+N+ T  SLW++
Sbjct:   38 QDLPEELVHAGWEKCWSRRESRPYYFNRFTNQSLWEM 74          
BLAST of phosphorylated CTD-interacting factor 1 vs. UniProt/SwissProt
Match: sp|Q9H4Z3|CAPAM_HUMAN (mRNA (2'-O-methyladenosine-N(6)-)-methyltransferase OS=Homo sapiens OX=9606 GN=PCIF1 PE=1 SV=1)

HSP 1 Score: 400.208 bits (1027), Expect = 1.341e-126
Identity = 222/542 (40.96%), Postives = 306/542 (56.46%), Query Frame = 1
Query:  511 MVKGRRPNKSVFLPPHPLIEFERANLLNKLRSQFVNSCMTRENIHPPDGSFNRWLLQMKTIDYGYDPIFPSRCDKSIGSSMKRELLLSLPFPIVKPKYLNAAKTQLIRYSESVKGLVERRNASPPCRKIIKHNVDETLRWIRSEEYRSFDDYIEKLVSIKRICQPHIQDLVRESVEKICIKMYNLSQEYTMRLRTNHLKLFQQNGIPLPEILNDLNIEHVVQNPYNDLLDIDINQLTPKSNEFINQELTPCHPIGLACPCPLFTSLNTQM---TVTIQEELNISDPKASLVSIEIPDLAKFHITKCHFEKLETLYLVSTRDDPEKIAFNNRLWCLLQRYYSYLGCENGSFGGVINQAALPVAVFEVLNRLFDVNFEMFASPLNCYFPQYCSAFHDTDRYFGSCGPALEFFPVTGSFEANPPFCEELLLGFVNYVEKLLQNSELALSFIVFIPDWRDPPFEALTLLEVSPFNRHQMTLRAREHEYRIANFXXXXXXXXXXTRNQPEILKRSGHSTLVVFLQNNSGFQRWTPTTERLNELMAVY 2127
            ++K R P  S  LPPHP +E  R+ L+ KLR  +   C  RE I PP  SFNRW+L+ K +D G DP+ PS C+  +  SM RE++  +P  + + K+   AK  L +Y+E+ + L+E R+ASP  RK++K NV++T  W+R +   S +DY+++L  ++R C PH+    ++SVE IC K+Y++S EY  R+R  HL + ++N I                                     +   L  C+P+ LA   P   S+   M    V I+        K  +V +          ++ +F KL  LY  S  DD     F  R+WCLL+RY    G   G + G   Q +LPV VFE L+RLF V+FE FASPLNCYF QYCSAF DTD YFGS GP L+F P++GSFEANPPFCEEL+   V++ E+LL++S   LSFIVFIP+WR+PP  ALT +E S F RHQ+ L A EHEYR  +              + E+  ++ H+T V+FLQN+ GF +W PT ERL EL A Y
Sbjct:  185 VIKHRGP--SEVLPPHPEVELLRSQLILKLRQHYRELCQQREGIEPPRESFNRWMLERKVVDKGSDPLLPSNCEPVVSPSMFREIMNDIPIRLSRIKFREEAKRLLFKYAEAARRLIESRSASPDSRKVVKWNVEDTFSWLRKDHSASKEDYMDRLEHLRRQCGPHVSAAAKDSVEGICSKIYHISLEYVKRIREKHLAILKENNIS-----------------------------EEVEAPEVEPRLVYCYPVRLAVSAPPMPSVEMHMENNVVCIRY-------KGEMVKV----------SRNYFSKLWLLYRYSCIDDSAFERFLPRVWCLLRRYQMMFGV--GLYEGTGLQGSLPVHVFEALHRLFGVSFECFASPLNCYFRQYCSAFPDTDGYFGSRGPCLDFAPLSGSFEANPPFCEELMDAMVSHFERLLESSPEPLSFIVFIPEWREPPTPALTRMEQSRFKRHQLILPAFEHEYRSGS---------QHICKKEEMHYKAVHNTAVLFLQNDPGFAKWAPTPERLQELSAAY 667          

HSP 2 Score: 58.151 bits (139), Expect = 3.296e-7
Identity = 22/38 (57.89%), Postives = 29/38 (76.32%), Query Frame = 1
Query:  214 AHDLPENLLNAGWRKFWSKRENREYYYNKITGASLWDL 327
              DLPE L++AGW K WS+RENR YY+N+ T  SLW++
Sbjct:   37 VQDLPEELVHAGWEKCWSRRENRPYYFNRFTNQSLWEM 74          
BLAST of phosphorylated CTD-interacting factor 1 vs. TrEMBL
Match: R7U274 (WW domain-containing protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_219923 PE=4 SV=1)

HSP 1 Score: 465.692 bits (1197), Expect = 5.277e-150
Identity = 261/655 (39.85%), Postives = 359/655 (54.81%), Query Frame = 1
Query:  208 DYAHDLPENLLNAGWRKFWSKRENREYYYNKITGASLW---------DLNELQLQESSYNSITKRKASGD------SDEINQKRACYRSNIHIEPLLGPAFVPGSLYNFVSSKYIPMVKGRRPNKSVFLPPHPLIEFERANLLNKLRSQFVNSCMTRENIHPPDGSFNRWLLQMKTIDYGYDPIFPSRCDKSIGSSMKRELLLSLPFPIVKPKYLNAAKTQLIRYSESVKGLVERRNASPPCRKIIKHNVDETLRWIRSEEYRSFDDYIEKLVSIKRICQPHIQDLVRESVEKICIKMYNLSQEYTMRLRTNHLKLFQQNGIPLPEILNDLNIEHVVQNPYNDLLDIDINQLTPKSNEFINQELTPCHPIGLACPCPLFTSLNTQMTVTIQEELNISDPKASLVSIEIPDLAKFHITKCHFEKLETLYLVSTRDDPEKIAFNNRLWCLLQRYYSYLGCENGSFGGVINQAALPVAVFEVLNRLFDVNFEMFASPLNCYFPQYCSAFHDTDRYFGSCGPALEFFPVTGSFEANPPFCEELLLGFVNYVEKLLQNSELALSFIVFIPDWRDPPFEALTLLEVSPFNRHQMTLRAREHEYRIANFXXXXXXXXXXTRNQPEILKRSGHSTLVVFLQNNSGFQRWTPTTERLNELMAVY 2127
            D  HDLP +LL AGWR+FWS+RE R Y++NK++  S W         D + L + ++S   +  R  S D      S+ +  KR        + P    +F     +NF     + M+  R+P      PPHP IE  R  L++KLR Q+ + C  RE I PP  SFNRWLL+ K ID G+DP+ P  C   +  SM RE++  +P  +VK KY N  K QL +Y+++ K L++ R+AS   RK++K  V++ ++W++  E  S+ DY  +LV +K+ CQPHI ++ + SVE IC+KMYN + ++  ++   H            EIL ++ I      P             P+ N        PC+PI +  P P  + +   +             +  +VS+         +   HF KLE LY  + RDDP+   F  R+WCLL+RY++Y G       G+  Q ALPV VFE L+R+F+V FE FASPLNCYF QYCSAF DTD YFGS GP L+F P +GSFEANPPF EEL+   V++ E LL  S   LSFIVF+PDWRDPP EAL  LE S F R Q T+ A EHEYR                N+ +   R+ H T+++FLQN +GF +W PT ERLNEL+  Y
Sbjct:   38 DPVHDLPHDLLEAGWRRFWSRREGRPYFFNKVSNESRWEIPGQDAFTDSDPLGI-DASPAPMPSRSLSIDTAMPSTSNGVGMKRRSSEDPNLMSPAKKISFSYSPYWNFDIPTNV-MIWERKP--CYLPPPHPEIELLRTQLMSKLRIQYKDLCRNREKIEPPRESFNRWLLERKVIDKGHDPVLPCLCTPEVSPSMYREIMHDIPMKVVKCKYFNETKRQLSKYAQAAKELMDSRSASAESRKLVKWQVEDVIQWLQRTENASYADYDSRLVHLKKQCQPHIMEVAKSSVEGICLKMYNTAVDHVKKIHERHW-----------EILAEMKIYPSTTGP-----------PPPRRN-------IPCYPIQMVIPAPRMSGIEHHI-------------EGDVVSLRFKSEHLIKVNTSHFHKLEQLYRCNCRDDPKFENFLPRVWCLLRRYHTYFGLSADEGSGL--QGALPVPVFECLHRVFNVTFECFASPLNCYFKQYCSAFVDTDGYFGSRGPLLDFSPTSGSFEANPPFGEELMEAMVDHFESLLSESNDPLSFIVFVPDWRDPPTEALMRLESSRFKRKQATVVAYEHEYRQG---------FQHIVNKADTNIRASHGTVIIFLQNEAGFNKWGPTRERLNELLLAY 635          
BLAST of phosphorylated CTD-interacting factor 1 vs. TrEMBL
Match: A0A1S3HUP7 (phosphorylated CTD-interacting factor 1 OS=Lingula unguis OX=7574 GN=LOC106158373 PE=4 SV=1)

HSP 1 Score: 465.692 bits (1197), Expect = 2.040e-149
Identity = 273/678 (40.27%), Postives = 368/678 (54.28%), Query Frame = 1
Query:  160 SYLSPATHDSEGSIEKDYAHDLPENLLNAGWRKFWSKRENREYYYNKITGASLWDLNEL---QLQESS--------------YNSITKRKASGD--SDEINQKRACYRSNIHI---EPLLGPAFVPGSLYNFVSSKYIPMVKGRRPNKSVFLPPHPLIEFERANLLNKLRSQFVNSCMTRENIHPPDGSFNRWLLQMKTIDYGYDPIFPSRCDKSIGSSMKRELLLSLPFPIVKPKYLNAAKTQLIRYSESVKGLVERRNASPPCRKIIKHNVDETLRWIRSEEYRSFDDYIEKLVSIKRICQPHIQDLVRESVEKICIKMYNLSQEYTMRLRTNHLKLFQQNGIPLPEILNDLNIEHVVQNPYNDLLDIDINQLTPKSNEFINQELTPCHPIGLACPCPLFTSLNTQMTVTIQEELNISDPKASLVSIEIPDLAKFHITKCHFEKLETLYLVSTRDDPEKIAFNNRLWCLLQRYYSYLGCENGSFGGVINQAALPVAVFEVLNRLFDVNFEMFASPLNCYFPQYCSAFHDTDRYFGSCGPALEFFPVTGSFEANPPFCEELLLGFVNYVEKLLQNSELALSFIVFIPDWRDPPFEALTLLEVSPFNRHQMTLRAREHEYRIANFXXXXXXXXXXTRNQPEILKRSGHSTLVVFLQNNSGFQRWTPTTERLNELMAVY 2127
            S +SP    +E   E      LP  LL AGWR+FWSKRE R YY+NK+T  SLWDL +L   QL   S               + I   + S D  S ++  KR      +      P+  P  +    +NF     + + +      S  LPPHP +E  RA L+ KLR Q+   C +RE I  P  SFNRWLL+ K ID G D +FPS C   I  SM RE++  +P  +VKPKY   A+ QL +Y+E+ K +VE RNASP  RK++K + ++T +W+R +   ++DDY+E+L  +KR CQP++ +  + SVE IC K+Y LS EY  ++     ++ Q++G+  P++          + P   ++                     C+P+ L  PCP   ++       I+ E      K   + I             HF+KLE LY  + +DDP    F  R+WCLL+RY +Y G +     G + Q ALPV VFE L+RLF V FE FASPLNC++ QYCSAF D D YFGS GP L+F PV+GSFEANPPFCEEL+   V++ E LL  S   LSFIVFIP+WRDPP EAL  LE S F R Q+T+   EHEYR                 + E+  +S H TLV+FLQN +GF +W PTTER+NEL+  Y
Sbjct:   81 SQMSPPQSTNESEAE------LPMELLQAGWRRFWSKREGRPYYFNKLTNQSLWDLQQLLDTQLDPLSDPLGIATPSPPPMSPSDIRMTRLSVDIPSPQVGNKRRSSGEALASPVKRPMQQPVPIISPTWNFEIPTNVVIYER---AMSHILPPHPEVEVLRAQLILKLRQQYQEMCHSREGIDSPLESFNRWLLERKVIDKGNDCMFPSNCSPEISQSMYREIVNDIPIKLVKPKYSADARRQLSKYAEAAKKMVETRNASPESRKLVKWHAEDTFQWLRKQPNATYDDYLERLAHLKRQCQPYLIEAAKGSVEGICSKIYALSCEYAKKVNEKSWQILQEHGVKDPDL---------PEPPRRKVM---------------------CYPVLLGVPCPRMPTVEHH----IEGETTYVRFKGETMKI----------NTSHFQKLEQLYRWNCKDDPRFDKFLARVWCLLRRYQTYFGPQQNE--GFLLQGALPVPVFECLHRLFGVTFECFASPLNCFYKQYCSAFADIDSYFGSRGPILDFHPVSGSFEANPPFCEELMEAMVDHFESLLAESSEPLSFIVFIPEWRDPPTEALVRLENSVFKRGQVTIPPFEHEYRHG---------FQHICPKTELNVKSSHGTLVIFLQNEAGFVKWAPTTERVNELLLAY 694          
BLAST of phosphorylated CTD-interacting factor 1 vs. TrEMBL
Match: T1J547 (WW domain-containing protein OS=Strigamia maritima OX=126957 PE=4 SV=1)

HSP 1 Score: 464.537 bits (1194), Expect = 9.164e-149
Identity = 265/677 (39.14%), Postives = 369/677 (54.51%), Query Frame = 1
Query:  145 SMDNSSYLSPATHDSEGSIEK-------DYAHDLPENLLNAGWRKFWSKRENREYYYNKITGASLWDLNELQLQESSYNSITKR---------KASGDSDEINQKRACYRSNIHIEPLLGPAFVPGSLYNFVSSKYIPMVKGRRPNKSVFLPPHPLIEFERANLLNKLRSQFVNSCMTRENIHPPDGSFNRWLLQMKTIDYGYDPIFPSRCDKSIGSSMKRELLLSLPFPIVKPKYLNAAKTQLIRYSESVKGLVERRNASPPCRKIIKHNVDETLRWIRSEEYRSFDDYIEKLVSIKRICQPHIQDLVRESVEKICIKMYNLSQEYTMRLRTNHLKLFQQNGIPLPEILNDLNIEHVVQNPYNDLLDIDINQLTPKSNEFINQELTPCHPIGLACPCPLFTSLNTQMTVTIQEELNISDPKASLVSIEIPDLAKFHITKCHFEKLETLYLVSTRDDPEKIAFNNRLWCLLQRYYSYLGCENGSFGGVINQAALPVAVFEVLNRLFDVNFEMFASPLNCYFPQYCSAFHDTDRYFGSCGPALEFFPVTGSFEANPPFCEELLLGFVNYVEKLLQNSELALSFIVFIPDWRDPPFEALTLLEVSPFNRHQMTLRAREHEYRIANFXXXXXXXXXXTRNQPEILKRSGHSTLVVFLQNNSGFQRWTPTTERLNELMAVY 2127
            S D S   SPA     G           D AH+LP+ L+N GW+KFWSKRENR Y++NK+T  SLW++  +    S Y+ +T             S  +  I  KR    ++    P     FV G  ++ +  + I ++  R P  S+  PPHP IE  RAN + +LR  +   C +RE I  P  SFNRWLL+ K  D G DP+ PS C + I  SM RE++  +P  +V+PKY   A+ QL +Y+E+ K ++E RN SP  RKI+K NV++  +W+R  +  ++DDY+E+L  +K  CQPH+ +  + SVE IC+K+Y+LS +Y  ++   H  L  ++GI   EI + L     V NP   L                      C+P+ LA   P   ++             + D   ++++    +     I   +F+KLE LY  +  DD +   F +R+WCLL+RY +Y G  N    G   Q ALPV+VF+ L R FDV+FE FASPLNCYF Q+CSAF DTD +FGS GP L+F PV+GSFEANPPFCEEL+   V + EKLL +S   LSFIVF+ +WRDP   AL  LE S F RH + + A EHEYR                N+ E+  +S H T+ V+LQN +G+ RW PT ER+   +  Y
Sbjct:   31 SNDGSRDSSPAAATPTGDFASPQHPLSLDPAHELPQELINQGWKKFWSKRENRPYFWNKMTNESLWEMPRM-ANSSQYDPMTDPLGIQCSPMPSESPATPVIAAKRRASDTDGSSSPS-AKRFVLGGPWD-LEVQTIAVMWERTP--SLLPPPHPQIELLRANYVGRLRQHYQEMCHSREGIDAPKESFNRWLLERKVADTGSDPVLPSACFREISMSMYREIMNDIPIKLVRPKYSGDARKQLSKYAEAAKKMIESRNVSPRSRKIVKWNVEDAFQWLRKTQNATYDDYLERLAHLKHQCQPHLTEAAKSSVEGICLKIYHLSIDYAKKIHDKHWALLNEHGI--AEIRSSLQ----VTNPKKVL----------------------CYPVQLALSSPRLPTVEF-----------VQDKDMTILTF---NGDSVRINSLYFQKLEQLYRWNCSDDRKFENFLSRVWCLLKRYQTYFGVSNNE--GHCTQGALPVSVFQALQRNFDVSFECFASPLNCYFRQFCSAFPDTDGFFGSRGPILDFRPVSGSFEANPPFCEELMETVVEHFEKLLSHSNEPLSFIVFMAEWRDPTPVALAKLEASSFRRHHVVVSAMEHEYRHG---------FQHVCNRTEVNIKSAHGTVAVWLQNEAGYSRWGPTKERIEAFLDSY 649          
BLAST of phosphorylated CTD-interacting factor 1 vs. TrEMBL
Match: K1QQ00 (Phosphorylated CTD-interacting factor 1 OS=Crassostrea gigas OX=29159 GN=CGI_10011691 PE=4 SV=1)

HSP 1 Score: 461.07 bits (1185), Expect = 1.108e-147
Identity = 268/659 (40.67%), Postives = 355/659 (53.87%), Query Frame = 1
Query:  199 IEKDYAHDLPENLLNAGWRKFWSKRENREYYYNKITGASLWDLNELQLQESSYNSI----------------TKRKASGDSDEINQKRACYRSNIHIEPLLGPAFVPGSLYNFVSSKYIP---MVKGRRPNKSVFLPPHPLIEFERANLLNKLRSQFVNSCMTRENIHPPDGSFNRWLLQMKTIDYGYDPIFPSRCDKSIGSSMKRELLLSLPFPIVKPKYLNAAKTQLIRYSESVKGLVERRNASPPCRKIIKHNVDETLRWIRSEEYRSFDDYIEKLVSIKRICQPHIQDLVRESVEKICIKMYNLSQEYTMRLRTNHLKLFQQNGIPLPEILNDLNIEHVVQNPYNDLLDIDINQLTPKSNEFINQELTPCHPIGLACPCPLFTSLNTQMTVTIQEELNISDPKASLVSIEIPDLAKFHITKCHFEKLETLYLVSTRDDPEKIAFNNRLWCLLQRYYSYLGCENGSFGGVINQAALPVAVFEVLNRLFDVNFEMFASPLNCYFPQYCSAFHDTDRYFGSCGPALEFFPVTGSFEANPPFCEELLLGFVNYVEKLLQNSELALSFIVFIPDWRDPPFEALTLLEVSPFNRHQMTLRAREHEYRIANFXXXXXXXXXXTRNQPEILKRSGHSTLVVFLQNNSGFQRWTPTTERLNELM 2118
            +  D  HDLP  LL  GWR+FWSKRE R Y++NK T  SLWD+       S  N+                    + S  S +I Q +   +    +E L  P+  P   Y+   +  IP   ++  R P      PP P +E  R   +NKLR Q+   C TRE I  P  SFNRWLL+ K  D G DP+ PS+C   +  SM RE++  +P  +VKPKY   A+ QL +Y+ES K ++E R+AS   RKI+K NV++T+ W+R +   S++DY+E+L  +KR CQPH+ +  + SVE IC KMYN+S E   ++   H +L +++GI  P    D                             IN     C+PI +  PCP         TV + ++      K +    EI       I   HF KLE LY ++ RDDP    F  R+WCLL+RY++  G   G   G   Q AL V+VFE L+R+F V FE FASPLNCYF QYCSAF DTD YFGS GP L F PV+GSFEANPPF EEL+   V++ E LLQ S+  LSF VF+P+WRDPP EAL  LE S + R  + L   EHEYR                 + ++  +S H TLVVFLQN++GFQRW PT E++ EL+
Sbjct:   76 MSPDPVHDLPVELLQMGWRRFWSKREQRPYFFNKNTNESLWDMPHFPGMSSPQNNFLTDPLGIGGEGPTPHHMDARLSRPSTDIPQPQTGEKRRASMEGLGSPSKRPAFAYSPFWNFDIPTNVVIFERVP--CCLPPPMPEVEKFRTQFVNKLRQQYQELCHTREGIDAPSESFNRWLLERKVCDRGKDPMLPSQCTPEVSQSMYREIMNDIPVKLVKPKYTGDARKQLFKYAESAKRMIETRSASSDSRKIVKWNVEDTITWLRKQGSPSYEDYLERLAHLKRQCQPHLTETAKSSVEGICSKMYNISCESVRKIHEFHWQLLKEHGIKEPAKFPDP----------------------------INPRKVLCYPIQMCVPCPRL------QTVELMQDKETHTLKCN---GEI-----LKINSSHFCKLEQLYKLNCRDDPRFDHFLGRVWCLLRRYHTLFGL--GPNEGFGLQGALSVSVFECLHRVFGVTFECFASPLNCYFKQYCSAFEDTDGYFGSRGPVLNFKPVSGSFEANPPFSEELMEAMVDHFENLLQESKEPLSFCVFVPEWRDPPTEALIRLESSRYKRKSVVLPPYEHEYRHG---------FQHMCPKDDMNVKSSHGTLVVFLQNDAGFQRWNPTPEKIKELL 679          
BLAST of phosphorylated CTD-interacting factor 1 vs. TrEMBL
Match: A0A267DFP2 (WW domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig032164g4 PE=4 SV=1)

HSP 1 Score: 459.144 bits (1180), Expect = 9.394e-147
Identity = 259/639 (40.53%), Postives = 365/639 (57.12%), Query Frame = 1
Query:  214 AHDLPENLLNAGWRKFWSKRENREYYYNKITGASLWDLNELQLQESSYNSITKRKASGDSDEINQKRACYRSNIHIEPLLGPAFVPGSLYNFVSSKYIPMVKGRRPNKSVFLPPHPLIEFERANLLNKLRSQFVNSCMTRENIHPPDGSFNRWLLQMKTIDYGYDPIFPSRCDKSIGSSMKRELLLSLPFPIVKPKYLNAAKTQLIRYSESVKGLVERRNASPPCRKIIKHNVDETLRWIRSEEYRSFDDYIEKLVSIKRICQPHIQDLVRESVEKICIKMYNLSQEYTMRLRTNHLKLFQQNGIPLPEILNDLNIEHVVQNPYNDLLDIDINQLTPKSNEFINQELTPCHPIGLACPCPLFTSLNTQMTVTIQEELNISDPKASLVSIEIPDLAKFHITKCHFEKLETLY-LVSTRDDPEKIAFNNRLWCLLQRYYSYLGCENGSFGGVINQAALPVAVFEVLNRLFDVNFEMFASPLNCYFPQYCSAFHDTDRYFGSCGPALEFFPVTGSFEANPPFCEELLLGFVNYVEKLLQNSELALSFIVFIPDWRDPPFEALTLLEVSPFNRHQMTLRAREHEYRIANFXXXXXXXXXXTRNQPEILKRSGHSTLVVFLQNNSGFQRWTPTTERLNELMAVY 2127
            +HDL E LL AGWRKFWSKRENR YY+NK+T  SLW+     L            A  +    + ++     +    P  G      + +NF  S +   V   RP + +F P HP  E  RA L+ KLR  +   C++RENI PP  SFNRWL++    D G DP+FPS CD  +  ++ RE++  LP  + +PK    AK QL RY+E+ K ++E R A+P  RKI+K NV++T +++R  +  +++D +E+L  +KR CQPHI++  +ESVEKIC K+Y+LS EY  ++R     LF+                  V NP +   D+      PK           C+P+ +  P P   +   Q+      E   +D +   V     + ++  I +  F KL+ LY L  T +DP    F  RLWC+L RY ++LG ++ +      QAALP+ VFE ++RLF V FE+FASPLNCYF QYCSAF DTD YFGS GP LEF+P+ GSFEANPPF EEL++  VN++E LL+ +   LSF+VF+PDWRDPP EAL  LE SP+NR Q  +   EH YR               R++ ++  +S H TL+VFLQN++GF +WTPT+E++ +L+  +
Sbjct:  106 SHDLSEELLAAGWRKFWSKRENRPYYFNKLTNQSLWEPPTAALPGVKRTLSDPAAAVPNHHHHHHQQG---PSAPKRPSFGGPQALDAAWNF--SVHSNCVTLERPPRRLFQP-HPETELLRAQLIAKLRQHYSELCVSRENIQPPPDSFNRWLIERYLSDKGSDPLFPSDCDNELSYALFREIINDLPVRLCRPKLSADAKKQLYRYAEASKAMIESRVANPESRKIVKWNVEQTYQFLRQAKMPTYEDCLERLAHLKRTCQPHIEEAAKESVEKICTKLYHLSVEYAKKVRELQETLFK------------------VTNPTDPWADLPPWSGDPKRR-------VRCYPVQICSPAPR-PAAQQQLV-----ETGCTD-RMQFVRYGRDNSSQQGICRSVFAKLQQLYTLHCTEEDPSMEKFFPRLWCMLTRYQAFLGQQSQN-----TQAALPIPVFEAISRLFGVTFELFASPLNCYFKQYCSAFPDTDCYFGSRGPVLEFYPLEGSFEANPPFSEELMVAMVNHMENLLKEATGPLSFMVFLPDWRDPPTEALVRLEASPYNRRQTCVLPFEHSYRNG-------MQHCLERDE-DLYVKSAHGTLIVFLQNDAGFMKWTPTSEKIKDLLIAF 693          
BLAST of phosphorylated CTD-interacting factor 1 vs. Ensembl Cavefish
Match: pcif1 (PDX1 C-terminal inhibiting factor 1 [Source:NCBI gene;Acc:103029407])

HSP 1 Score: 421.009 bits (1081), Expect = 2.351e-135
Identity = 217/528 (41.10%), Postives = 305/528 (57.77%), Query Frame = 1
Query:  544 FLPPHPLIEFERANLLNKLRSQFVNSCMTRENIHPPDGSFNRWLLQMKTIDYGYDPIFPSRCDKSIGSSMKRELLLSLPFPIVKPKYLNAAKTQLIRYSESVKGLVERRNASPPCRKIIKHNVDETLRWIRSEEYRSFDDYIEKLVSIKRICQPHIQDLVRESVEKICIKMYNLSQEYTMRLRTNHLKLFQQNGIPLPEILNDLNIEHVVQNPYNDLLDIDINQLTPKSNEFINQELTPCHPIGLACPCPLFTSLNTQMTVTIQEELNISDPKASLVSIEIPDLAKFHITKCHFEKLETLYLVSTRDDPEKIAFNNRLWCLLQRYYSYLGCENGSFGGVINQAALPVAVFEVLNRLFDVNFEMFASPLNCYFPQYCSAFHDTDRYFGSCGPALEFFPVTGSFEANPPFCEELLLGFVNYVEKLLQNSELALSFIVFIPDWRDPPFEALTLLEVSPFNRHQMTLRAREHEYRIANFXXXXXXXXXXTRNQPEILKRSGHSTLVVFLQNNSGFQRWTPTTERLNELMAVY 2127
            +LPPHP IE +RA L  KLR  +   C  RE I PP  SFNRWLL+ K +D G DP+ PS CD ++  SM RE++  +P  + + KY   A+  L +Y+E+ K ++E RNA+P  RK++K NV++T+ W+R +   S +DY+++L  +++ C PH+  + ++SVE IC K+Y++S EY  R+R  HL L ++  I +  +                             N  +   L  C+P+ L+   P       ++ +  + E+     K  +V +          ++ HF KLE LY  S  DDP    F +R+WCL++RY    G  +G   G   Q ALPV VFE LN+ F V+FE FASPLNCY+ Q+CSAF D D +FGS GP L F PV+GSFEANPPFCEE +   V + E LL+ S   LSFI+F+P+WRDPP  ALT +E S F RHQMT+ A EHEYR  +              + E+  ++ H T V+FLQNN+GF +W PTTER+ EL+A Y
Sbjct:  197 YLPPHPEIELQRAQLTTKLRQHYHELCSQREGIEPPRESFNRWLLERKVVDKGVDPLLPSECDPAVSPSMFREVMNDIPIRLSRIKYKEEARKLLFKYAEAAKKMIESRNATPDSRKVVKWNVEDTMNWLRRDHSASKEDYMDRLEHLRKQCGPHVTAVAKDSVEGICSKIYHISAEYVRRIRQAHLNLLKECNITVDGV----------------------------ENAEVQDRLVYCYPVRLSIASPP----QPRVELHFENEVACLRYKGEMVKV----------SRGHFNKLELLYRYSCIDDPRFEKFLSRVWCLIKRYQVMFG--SGVNEGTGLQGALPVPVFEALNKQFGVSFECFASPLNCYYKQFCSAFPDIDGFFGSRGPFLSFSPVSGSFEANPPFCEEFMDAMVTHFEDLLEKSSEPLSFIIFVPEWRDPPTPALTRMESSRFRRHQMTVPAFEHEYRSGS---------QHVCKREEMYYKAVHGTAVIFLQNNAGFAKWEPTTERIQELLAAY 671          

HSP 2 Score: 57.7658 bits (138), Expect = 4.808e-8
Identity = 26/58 (44.83%), Postives = 38/58 (65.52%), Query Frame = 1
Query:  154 NSSYLSPATHDSEGSIEKDYAHDLPENLLNAGWRKFWSKRENREYYYNKITGASLWDL 327
            +SS  +P T  +  +I+     +LP+ L+ AGW K WSKRENR YY+N+ T  SLW++
Sbjct:   22 SSSQAAPLTPSTSKAIQ-----ELPDELIQAGWAKCWSKRENRPYYFNRFTNQSLWEM 74          
BLAST of phosphorylated CTD-interacting factor 1 vs. Ensembl Cavefish
Match: pcif1 (PDX1 C-terminal inhibiting factor 1 [Source:NCBI gene;Acc:103029407])

HSP 1 Score: 419.083 bits (1076), Expect = 1.020e-134
Identity = 217/528 (41.10%), Postives = 304/528 (57.58%), Query Frame = 1
Query:  544 FLPPHPLIEFERANLLNKLRSQFVNSCMTRENIHPPDGSFNRWLLQMKTIDYGYDPIFPSRCDKSIGSSMKRELLLSLPFPIVKPKYLNAAKTQLIRYSESVKGLVERRNASPPCRKIIKHNVDETLRWIRSEEYRSFDDYIEKLVSIKRICQPHIQDLVRESVEKICIKMYNLSQEYTMRLRTNHLKLFQQNGIPLPEILNDLNIEHVVQNPYNDLLDIDINQLTPKSNEFINQELTPCHPIGLACPCPLFTSLNTQMTVTIQEELNISDPKASLVSIEIPDLAKFHITKCHFEKLETLYLVSTRDDPEKIAFNNRLWCLLQRYYSYLGCENGSFGGVINQAALPVAVFEVLNRLFDVNFEMFASPLNCYFPQYCSAFHDTDRYFGSCGPALEFFPVTGSFEANPPFCEELLLGFVNYVEKLLQNSELALSFIVFIPDWRDPPFEALTLLEVSPFNRHQMTLRAREHEYRIANFXXXXXXXXXXTRNQPEILKRSGHSTLVVFLQNNSGFQRWTPTTERLNELMAVY 2127
            +LPPHP IE +RA L  KLR  +   C  RE I PP  SFNRWLL+ K +D G DP+ PS CD ++  SM RE++  +P  + + KY   A+  L +Y+E+ K ++E RNA+P  RK++K NV++T+ W+R +   S +DY+++L  +++ C PH+  + ++SVE IC K+Y++S EY  R+R  HL L ++  I +                                N  +   L  C+P+ L+   P       ++ +  + E+     K  +V +          ++ HF KLE LY  S  DDP    F +R+WCL++RY    G  +G   G   Q ALPV VFE LN+ F V+FE FASPLNCY+ Q+CSAF D D +FGS GP L F PV+GSFEANPPFCEE +   V + E LL+ S   LSFI+F+P+WRDPP  ALT +E S F RHQMT+ A EHEYR  +              + E+  ++ H T V+FLQNN+GF +W PTTER+ EL+A Y
Sbjct:  185 YLPPHPEIELQRAQLTTKLRQHYHELCSQREGIEPPRESFNRWLLERKVVDKGVDPLLPSECDPAVSPSMFREVMNDIPIRLSRIKYKEEARKLLFKYAEAAKKMIESRNATPDSRKVVKWNVEDTMNWLRRDHSASKEDYMDRLEHLRKQCGPHVTAVAKDSVEGICSKIYHISAEYVRRIRQAHLNLLKECNITV-------------------------------ENAEVQDRLVYCYPVRLSIASPP----QPRVELHFENEVACLRYKGEMVKV----------SRGHFNKLELLYRYSCIDDPRFEKFLSRVWCLIKRYQVMFG--SGVNEGTGLQGALPVPVFEALNKQFGVSFECFASPLNCYYKQFCSAFPDIDGFFGSRGPFLSFSPVSGSFEANPPFCEEFMDAMVTHFEDLLEKSSEPLSFIIFVPEWRDPPTPALTRMESSRFRRHQMTVPAFEHEYRSGS---------QHVCKREEMYYKAVHGTAVIFLQNNAGFAKWEPTTERIQELLAAY 656          

HSP 2 Score: 57.7658 bits (138), Expect = 4.153e-8
Identity = 26/58 (44.83%), Postives = 38/58 (65.52%), Query Frame = 1
Query:  154 NSSYLSPATHDSEGSIEKDYAHDLPENLLNAGWRKFWSKRENREYYYNKITGASLWDL 327
            +SS  +P T  +  +I+     +LP+ L+ AGW K WSKRENR YY+N+ T  SLW++
Sbjct:   22 SSSQAAPLTPSTSKAIQ-----ELPDELIQAGWAKCWSKRENRPYYFNRFTNQSLWEM 74          
BLAST of phosphorylated CTD-interacting factor 1 vs. Ensembl Sea Lamprey
Match: pcif1 (PDX1 C-terminal inhibiting factor 1 [Source:NCBI gene;Acc:553360])

HSP 1 Score: 375.941 bits (964), Expect = 3.831e-119
Identity = 210/526 (39.92%), Postives = 295/526 (56.08%), Query Frame = 1
Query:  553 PHPLIEFERANLLNKLRSQFVNSCMTRENIHPPDGSFNRWLLQMKTIDYGYDPIFPSRCDKSIGSSMKRELLLSLPFPIVKPKYLNAAKTQLIRYSESVKGLVERRNASPPCRKIIKHNVDETLRWIRSEEYRSFDDYIEKLVSIKRICQPHIQDLVRESVEKICIKMYNLSQEYTMRLRTNHLKLFQQNGIPLPEILNDLNIEHVVQNPYNDLLDIDINQLTPKSNEFINQELTPCHPIGLACP-CPLFTSLNTQMTVTIQEELNISDPKASLVSIEIPDLAKFHITKCHFEKLETLYLVSTRDDPEKIAFNNRLWCLLQRYYSYLGCENGSFGGVINQAALPVAVFEVLNRLFDVNFEMFASPLNCYFPQYCSAFHDTDRYFGSCGPALEFFPVTGSFEANPPFCEELLLGFVNYVEKLLQNSELALSFIVFIPDWRDPPFEALTLLEVSPFNRHQMTLRAREHEYRIANFXXXXXXXXXXTRNQPEILKRSGHSTLVVFLQNNSGFQRWTPTTERLNELMAVY 2127
            PHP +E  RA L  +LR Q+   C  RE +  P  SFNRWLL+ K ID G DP+ PS C+  +  SM RE+L  +P  + + KY + AK QL +Y+E+ K +++ RNASP  RKI+K NV+ET  W+R E   S +DY+++L  ++R C PH+ ++ +ESVE IC K++ LS +Y  R+R  +L + ++N + L                       +       +       L  C P  L+ P  PL      ++ +  + ++     +  +V I           + +F KLE LY + + DDP    F  R+WCLL+RY   +    GS G  ++  ALPV VFE L+R F V FE FASPLNCYF QYCSAF DTD YFGS GP L+F PV+GSFEANPPF EEL+   V++ E L+ +S   LSFIVF+P+WR+P   AL  +E S F R Q+ + A EHEYR           +       ++  R+ H T ++FLQN++GF RW PT +RL  L+  Y
Sbjct:  177 PHPEVELFRAQLTVRLRHQYQELCQQREGVDAPRESFNRWLLERKVIDKGRDPMLPSDCEPVVSVSMFREILNDIPIRLSRIKYRDDAKKQLFKYAEAAKRMIDNRNASPDSRKIVKWNVEETFNWLRKEPSPSKEDYLDRLDHLRRQCGPHLAEVAKESVEGICAKIFTLSCDYVKRIRDKNLDMLKENKLAL----------------------PEEAAAVAVAVPPAVDRLVYCFPARLSIPPWPL-----PRVEMHTENDMTCLRYRGEMVKI----------NQNYFNKLEHLYRLGSTDDPRFEKFLARVWCLLRRYRQTMFGVGGSEGAGLH-GALPVPVFEALHRHFGVTFECFASPLNCYFRQYCSAFADTDGYFGSRGPILDFNPVSGSFEANPPFGEELMNAMVDHFENLMSSSTEPLSFIVFVPEWREPVTPALLRMEESRFKRRQVLVPAFEHEYRNG---------AQHVCKGEDLHIRAVHGTAIIFLQNDAGFARWEPTADRLRLLLEAY 655          

HSP 2 Score: 55.8398 bits (133), Expect = 3.817e-8
Identity = 22/40 (55.00%), Postives = 28/40 (70.00%), Query Frame = 1
Query:  217 HDLPENLLNAGWRKFWSKRENREYYYNKITGASLWDLNEL 336
             DLP+ L+  GW K WS+RENR Y+YN+ T  SLW+L  L
Sbjct:   10 QDLPDELIQGGWSKCWSRRENRPYFYNRFTKQSLWELPAL 49          
BLAST of phosphorylated CTD-interacting factor 1 vs. Ensembl Sea Lamprey
Match: pcif1 (PDX1 C-terminal inhibiting factor 1 [Source:NCBI gene;Acc:553360])

HSP 1 Score: 374.4 bits (960), Expect = 6.107e-119
Identity = 228/633 (36.02%), Postives = 326/633 (51.50%), Query Frame = 1
Query:  217 HDLPENLLNAGWRKFWSKRENREYYYNKITGASLWDLNELQLQESSYN----------------------------SITKRKASGD---SDEINQKRACYRSNIHIEPLLGPAFVPGSLY-------NFVSSKYIPMVKGR------RPNKSVF--------LPPHPLIEFERANLLNKLRSQFVNSCMTRENIHPPDGSFNRWLLQMKTIDYGYDPIFPSRCDKSIGSSMKRELLLSLPFPIVKPKYLNAAKTQLIRYSESVKGLVERRNASPPCRKIIKHNVDETLRWIRSEEYRSFDDYIEKLVSIKRICQPHIQDLVRESVEKICIKMYNLSQEYTMRLRTNHLKLFQQNGIPLPEILNDLNIEHVVQNPYNDLLDIDINQLTPKSNEFINQELTPCHPIGLAC-PCPLFTSLNTQMTVTIQEELNISDPKASLVSIEIPDLAKFHITKCHFEKLETLYLVSTRDDPEKIAFNNRLWCLLQRYYSYLGCENGSFGGVINQAALPVAVFEVLNRLFDVNFEMFASPLNCYFPQYCSAFHDTDRYFGSCGPALEFFPVTGSFEANPPFCEELLLGFVNYVEKLLQNSELALSFIVFIPDWRDPPFEALTLLEVSPFNRHQMTLRAREHEYR 1956
             DLP+ L+  GW K WS+RENR Y+YN+ T  SLW+L  L   +   +                            ++ KR+ S +              R+   +EP    +      +       +F +S+++P+V  R       P  +V           PHP +E  RA L  +LR Q+   C  RE +  P  SFNRWLL+ K ID G DP+ PS C+  +  SM RE+L  +P  + + KY + AK QL +Y+E+ K +++ RNASP  RKI+K NV+ET  W+R E   S +DY+++L  ++R C PH+ ++ +ESVE IC K++ LS +Y  R+R  +L + ++N + L                       +       +       L  C P  L+  P PL      ++ +  + ++     +  +V           I + +F KLE LY + + DDP    F  R+WCLL+RY   +    GS G  ++  ALPV VFE L+R F V FE FASPLNCYF QYCSAF DTD YFGS GP L+F PV+GSFEANPPF EEL+   V++ E L+ +S   LSFIVF+P+WR+P   AL  +E S F R Q+ + A EHEYR
Sbjct:   47 QDLPDELIQGGWSKCWSRRENRPYFYNRFTKQSLWELPALGQHDVISDPLGLNAAPVGGVPGAPAAGATGASAEDAALRKRRLSEEIGAGVAGAASAVSKRTKAPMEPKTEASIGATQSFKLYCFNFSFKNSEFLPLVTNRIYWNLEVPTNAVIKERGLFDTFHPHPEVELFRAQLTVRLRHQYQELCQQREGVDAPRESFNRWLLERKVIDKGRDPMLPSDCEPVVSVSMFREILNDIPIRLSRIKYRDDAKKQLFKYAEAAKRMIDNRNASPDSRKIVKWNVEETFNWLRKEPSPSKEDYLDRLDHLRRQCGPHLAEVAKESVEGICAKIFTLSCDYVKRIRDKNLDMLKENKLAL----------------------PEEAAAVAVAVPPAVDRLVYCFPARLSIPPWPL-----PRVEMHTENDMTCLRYRGEMVK----------INQNYFNKLEHLYRLGSTDDPRFEKFLARVWCLLRRYRQTMFGVGGSEGAGLH-GALPVPVFEALHRHFGVTFECFASPLNCYFRQYCSAFADTDGYFGSRGPILDFNPVSGSFEANPPFGEELMNAMVDHFENLMSSSTEPLSFIVFVPEWREPVTPALLRMEESRFKRRQVLVPAFEHEYR 641          
BLAST of phosphorylated CTD-interacting factor 1 vs. Ensembl Medaka
Match: pcif1 (PDX1 C-terminal inhibiting factor 1 [Source:NCBI gene;Acc:101156006])

HSP 1 Score: 415.616 bits (1067), Expect = 6.644e-133
Identity = 224/534 (41.95%), Postives = 308/534 (57.68%), Query Frame = 1
Query:  526 RPNKSVFLPPHPLIEFERANLLNKLRSQFVNSCMTRENIHPPDGSFNRWLLQMKTIDYGYDPIFPSRCDKSIGSSMKRELLLSLPFPIVKPKYLNAAKTQLIRYSESVKGLVERRNASPPCRKIIKHNVDETLRWIRSEEYRSFDDYIEKLVSIKRICQPHIQDLVRESVEKICIKMYNLSQEYTMRLRTNHLKLFQQNGIPLPEILNDLNIEHVVQNPYNDLLDIDINQLTPKSNEFINQELTPCHPIGLACPCPLFTSLNTQMTVTIQEELNISDPKASLVSIEIPDLAKFHITKCHFEKLETLYLVSTRDDPEKIAFNNRLWCLLQRYYSYLGCENGSFGGVINQAALPVAVFEVLNRLFDVNFEMFASPLNCYFPQYCSAFHDTDRYFGSCGPALEFFPVTGSFEANPPFCEELLLGFVNYVEKLLQNSELALSFIVFIPDWRDPPFEALTLLEVSPFNRHQMTLRAREHEYRIANFXXXXXXXXXXTRNQPEILKRSGHSTLVVFLQNNSGFQRWTPTTERLNELMAVY 2127
            RP+ ++ LPPHP IE +RA L+ KLR  +   C  RE I PP  SFNRWLL+ K ID G DP+ PS C+  I  SM RE++  +P  + + KY   A+  L +Y+E+ K +++ RNASP  RK++K N ++T+ W+R +   S +DY+++L  +++ C PH+  + ++SVE IC K+Y LS EY+ RLR  H+ L Q     +PE                          +P+ +  +      C+P+ LA P P       ++ +  + ++     K  +V +           + HF KLE LY  S  DDP    F +R+WCLL+RY    G  N    G+  Q ALPV+VFE LNR F V+FE FASPLNCYF QYCSAF D D +FGS GP L F PV+GSFEANPPFCEEL+   V + E LL+ S   LSFI+FIP+WRDP   ALT +E S F RHQ+++ A EHEYR  +              + ++  R+ H T V+FLQN++GF +W PT ERL EL A Y
Sbjct:  211 RPS-AMDLPPHPEIELQRAQLVTKLRQHYHELCHQREGIDPPRESFNRWLLERKVIDKGQDPLLPSDCEPIISPSMFREVMNDIPIRLSRIKYKEEARKLLFKYAEAAKRMIDSRNASPESRKVVKWNAEDTMNWLRRDHSASKEDYMDRLEHLRQQCGPHVTAVAKDSVEGICSKIYQLSAEYSRRLRETHMGLLQDPATEVPE--------------------------SPQPSRLVY-----CYPVRLAIPTPSLP----RVELHFENDVACLRFKGEMVKV----------NRGHFSKLELLYRYSCIDDPRFEKFLSRVWCLLKRYQVMFGNSNNEGTGL--QGALPVSVFEALNRQFGVSFECFASPLNCYFKQYCSAFPDIDGFFGSRGPFLSFRPVSGSFEANPPFCEELMDRMVTHFEDLLEQSSEPLSFIIFIPEWRDPVTPALTRMEESRFLRHQLSVSAYEHEYRSGS---------QHVCKREDMYYRAVHGTAVLFLQNDAGFAKWAPTPERLAELTAAY 687          

HSP 2 Score: 56.9954 bits (136), Expect = 8.339e-8
Identity = 29/82 (35.37%), Postives = 42/82 (51.22%), Query Frame = 1
Query:  214 AHDLPENLLNAGWRKFWSKRENREYYYNKITGASLWDLNELQLQESSYNSITKRKASGDSDEINQKRACYRSNIHIEPLLGP 459
            A +LP+ L+ AGW K WS+RENR YY+N+ T  SLW++  L   +   + +    A  +S E N      +     E   GP
Sbjct:   38 APELPDELVQAGWAKCWSRRENRPYYFNRFTNQSLWEVPVLGQHDVISDPLGLNAAPAESGESNLGNGQRKRRSSGEQGAGP 119          
BLAST of phosphorylated CTD-interacting factor 1 vs. Planmine SMEST
Match: SMESG000057164.1 (SMESG000057164.1)

HSP 1 Score: 1388.63 bits (3593), Expect = 0.000e+0
Identity = 683/684 (99.85%), Postives = 683/684 (99.85%), Query Frame = 1
Query:  148 MDNSSYLSPATHDSEGSIEKDYAHDLPENLLNAGWRKFWSKRENREYYYNKITGASLWDLNELQLQESSYNSITKRKASGDSDEINQKRACYRSNIHIEPLLGPAFVPGSLYNFVSSKYIPMVKGRRPNKSVFLPPHPLIEFERANLLNKLRSQFVNSCMTRENIHPPDGSFNRWLLQMKTIDYGYDPIFPSRCDKSIGSSMKRELLLSLPFPIVKPKYLNAAKTQLIRYSESVKGLVERRNASPPCRKIIKHNVDETLRWIRSEEYRSFDDYIEKLVSIKRICQPHIQDLVRESVEKICIKMYNLSQEYTMRLRTNHLKLFQQNGIPLPEILNDLNIEHVVQNPYNDLLDIDINQLTPKSNEFINQELTPCHPIGLACPCPLFTSLNTQMTVTIQEELNISDPKASLVSIEIPDLAKFHITKCHFEKLETLYLVSTRDDPEKIAFNNRLWCLLQRYYSYLGCENGSFGGVINQAALPVAVFEVLNRLFDVNFEMFASPLNCYFPQYCSAFHDTDRYFGSCGPALEFFPVTGSFEANPPFCEELLLGFVNYVEKLLQNSELALSFIVFIPDWRDPPFEALTLLEVSPFNRHQMTLRAREHEYRIANFXXXXXXXXXXTRNQPEILKRSGHSTLVVFLQNNSGFQRWTPTTERLNELMAVYYTANLSNNIPSRRDFDEEYVNSVS 2199
            MDNSSYLSPATHDSEGSIEKDYAHDLPENLLNAGWRKFWSKRENREYYYNKITGASLWDLNELQLQESSYNSITKRKASGDSDEINQKRACYRSNIHIEPLLGPAFVPGSLYNFVSSKYIPMVKGRRPNKSVFLPPHPLIEFERANLLNKLRSQFVNSCMTRENIHPPDGSFNRWLLQMKTIDYGYDPIFPSRCDKSIGSSMKRELLLSLPFPIVKPKYLNAAKTQLIRYSESVKGLVERRNASPPCRKIIKHNVDETLRWIRSEEYRSFDDYIEKLVSIKRICQPHIQDLVRESVEKICIKMYNLSQEYTMRLRTNHLKLFQQNGIPLPEILNDLNIEHVVQNPYNDLLDIDINQLT KSNEFINQELTPCHPIGLACPCPLFTSLNTQMTVTIQEELNISDPKASLVSIEIPDLAKFHITKCHFEKLETLYLVSTRDDPEKIAFNNRLWCLLQRYYSYLGCENGSFGGVINQAALPVAVFEVLNRLFDVNFEMFASPLNCYFPQYCSAFHDTDRYFGSCGPALEFFPVTGSFEANPPFCEELLLGFVNYVEKLLQNSELALSFIVFIPDWRDPPFEALTLLEVSPFNRHQMTLRAREHEYRIANFPPNNNNPSSSTRNQPEILKRSGHSTLVVFLQNNSGFQRWTPTTERLNELMAVYYTANLSNNIPSRRDFDEEYVNSVS
Sbjct:    1 MDNSSYLSPATHDSEGSIEKDYAHDLPENLLNAGWRKFWSKRENREYYYNKITGASLWDLNELQLQESSYNSITKRKASGDSDEINQKRACYRSNIHIEPLLGPAFVPGSLYNFVSSKYIPMVKGRRPNKSVFLPPHPLIEFERANLLNKLRSQFVNSCMTRENIHPPDGSFNRWLLQMKTIDYGYDPIFPSRCDKSIGSSMKRELLLSLPFPIVKPKYLNAAKTQLIRYSESVKGLVERRNASPPCRKIIKHNVDETLRWIRSEEYRSFDDYIEKLVSIKRICQPHIQDLVRESVEKICIKMYNLSQEYTMRLRTNHLKLFQQNGIPLPEILNDLNIEHVVQNPYNDLLDIDINQLTQKSNEFINQELTPCHPIGLACPCPLFTSLNTQMTVTIQEELNISDPKASLVSIEIPDLAKFHITKCHFEKLETLYLVSTRDDPEKIAFNNRLWCLLQRYYSYLGCENGSFGGVINQAALPVAVFEVLNRLFDVNFEMFASPLNCYFPQYCSAFHDTDRYFGSCGPALEFFPVTGSFEANPPFCEELLLGFVNYVEKLLQNSELALSFIVFIPDWRDPPFEALTLLEVSPFNRHQMTLRAREHEYRIANFPPNNNNPSSSTRNQPEILKRSGHSTLVVFLQNNSGFQRWTPTTERLNELMAVYYTANLSNNIPSRRDFDEEYVNSVS 684          
BLAST of phosphorylated CTD-interacting factor 1 vs. Planmine SMEST
Match: SMESG000072135.1 (SMESG000072135.1)

HSP 1 Score: 64.3142 bits (155), Expect = 2.226e-10
Identity = 44/118 (37.29%), Postives = 57/118 (48.31%), Query Frame = 1
Query: 1546 SFGGVINQAALPVAVFEVLNRLFDVNFEMFASPLNCYFPQY-----CSAFHDTDRYFGSCGPALEFFPV-----TGSFEANPPFCEELLLGFVNYVEKLLQNSELALSFIVFIPDWRD 1869
            SFG    Q   P  V +VL   F+V  E FASP+N  F +Y     CS F DTDR FGS G    FF V     +G +  NPPF  +L+    + + ++L +      F  F P W D
Sbjct:  252 SFGNGSYQWGDPKEVHKVLYDRFNVRHEGFASPVNSRFIEYEQTHFCSLFPDTDRVFGSLG---NFFDVDMRQHSGGWSVNPPFLNDLMKNVADRINQVLDDRCPCYFFCTF-PWWED 365          
BLAST of phosphorylated CTD-interacting factor 1 vs. Planmine SMEST
Match: SMESG000035258.1 (SMESG000035258.1)

HSP 1 Score: 53.9138 bits (128), Expect = 2.861e-7
Identity = 50/146 (34.25%), Postives = 68/146 (46.58%), Query Frame = 1
Query: 1504 LLQRYYSYLGCENGSFGGVINQAALPVAVFEVLNRLFDVNFEMFASPLNCYFP-----QYCSAFHDTDRYFGSCGPALEFFPVT-----GSFEANPPFCEELLLGFVNYVEKLLQNSELALSFIVFIPDWRDPPFEALTLLEVSPF 1911
            +L RY S LG  NGS+     Q   P+ +     R ++V +E FASP+N  F      ++CS F + D  FGS G    FF +      G +  NPPF   +L    N V   L++   +  F  + P WRD   E   LLE S F
Sbjct:  154 MLLRYES-LG--NGSY-----QWGDPMELHLAYYRHYNVRYEGFASPINSRFLTLQYCRFCSLFPEIDSQFGSLG---NFFDINLAEYPGGWSINPPFVNVVLKDAANKVISTLKSGTKSHFFCTY-PLWRDS--EGWKLLENSSF 285          
The following BLAST results are available for this feature:
BLAST of phosphorylated CTD-interacting factor 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 2
Match NameE-valueIdentityDescription
PCIF12.793e-12740.96PDX1 C-terminal inhibiting factor 1 [Source:HGNC S... [more]
PCIF13.448e-5948.96PDX1 C-terminal inhibiting factor 1 [Source:HGNC S... [more]
back to top
BLAST of phosphorylated CTD-interacting factor 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of phosphorylated CTD-interacting factor 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
CG113991.127e-12135.61gene:FBgn0037021 transcript:FBtr0078277[more]
back to top
BLAST of phosphorylated CTD-interacting factor 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
pcif12.933e-14536.93PDX1 C-terminal inhibiting factor 1 [Source:NCBI g... [more]
pcif14.382e-10734.77PDX1 C-terminal inhibiting factor 1 [Source:NCBI g... [more]
back to top
BLAST of phosphorylated CTD-interacting factor 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
iyd6.735e-14237.48iodotyrosine deiodinase [Source:Xenbase;Acc:XB-GEN... [more]
iyd3.625e-14138.37iodotyrosine deiodinase [Source:Xenbase;Acc:XB-GEN... [more]
iyd8.521e-14038.08iodotyrosine deiodinase [Source:Xenbase;Acc:XB-GEN... [more]
iyd2.209e-13037.68iodotyrosine deiodinase [Source:Xenbase;Acc:XB-GEN... [more]
iyd2.409e-12835.67iodotyrosine deiodinase [Source:Xenbase;Acc:XB-GEN... [more]
back to top
BLAST of phosphorylated CTD-interacting factor 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Pcif15.432e-13341.32PDX1 C-terminal inhibiting factor 1 [Source:MGI Sy... [more]
back to top
BLAST of phosphorylated CTD-interacting factor 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 3
Match NameE-valueIdentityDescription
sp|A0A0R4IKJ1|CAPAM_DANRE2.214e-14436.93mRNA (2'-O-methyladenosine-N(6)-)-methyltransferas... [more]
sp|P59114|CAPAM_MOUSE3.800e-13241.32mRNA (2'-O-methyladenosine-N(6)-)-methyltransferas... [more]
sp|Q9H4Z3|CAPAM_HUMAN1.341e-12640.96mRNA (2'-O-methyladenosine-N(6)-)-methyltransferas... [more]
back to top
BLAST of phosphorylated CTD-interacting factor 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
R7U2745.277e-15039.85WW domain-containing protein OS=Capitella teleta O... [more]
A0A1S3HUP72.040e-14940.27phosphorylated CTD-interacting factor 1 OS=Lingula... [more]
T1J5479.164e-14939.14WW domain-containing protein OS=Strigamia maritima... [more]
K1QQ001.108e-14740.67Phosphorylated CTD-interacting factor 1 OS=Crassos... [more]
A0A267DFP29.394e-14740.53WW domain-containing protein OS=Macrostomum lignan... [more]
back to top
BLAST of phosphorylated CTD-interacting factor 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
pcif12.351e-13541.10PDX1 C-terminal inhibiting factor 1 [Source:NCBI g... [more]
pcif11.020e-13441.10PDX1 C-terminal inhibiting factor 1 [Source:NCBI g... [more]
back to top
BLAST of phosphorylated CTD-interacting factor 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
pcif13.831e-11939.92PDX1 C-terminal inhibiting factor 1 [Source:NCBI g... [more]
pcif16.107e-11936.02PDX1 C-terminal inhibiting factor 1 [Source:NCBI g... [more]
back to top
BLAST of phosphorylated CTD-interacting factor 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of phosphorylated CTD-interacting factor 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of phosphorylated CTD-interacting factor 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
pcif16.644e-13341.95PDX1 C-terminal inhibiting factor 1 [Source:NCBI g... [more]
back to top
BLAST of phosphorylated CTD-interacting factor 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000057164.10.000e+099.85SMESG000057164.1[more]
SMESG000072135.12.226e-1037.29SMESG000072135.1[more]
SMESG000035258.12.861e-734.25SMESG000035258.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30008994 ID=SMED30008994|Name=phosphorylated CTD-interacting factor 1|organism=Schmidtea mediterranea sexual|type=transcript|length=2581bp
GAAAATAATTTAGCTATTGAACTTTAATTAAATAATTTATCATATTAAGT
AAAATAAAATAGTTTTATTCAAAAACTATGCTTTCTAAATCATTTTAATC
CATGAAAACTTAAAATGCTTGCATAAGCGTCATTCTGTTAATTTTCTATG
GATAATTCATCTTATTTATCACCCGCTACTCATGATTCTGAAGGTTCCAT
TGAAAAAGACTATGCTCATGATTTACCAGAAAATTTATTAAATGCTGGAT
GGCGGAAATTTTGGTCTAAACGTGAAAATCGAGAATATTATTATAATAAA
ATAACTGGAGCAAGTTTATGGGATTTAAACGAACTCCAATTACAAGAGTC
CAGTTATAATAGCATAACCAAACGGAAAGCAAGTGGTGATAGTGATGAAA
TTAATCAAAAGCGTGCTTGCTATCGAAGCAACATACATATCGAGCCATTA
TTGGGCCCAGCCTTTGTTCCTGGATCCTTGTATAATTTTGTTAGTTCAAA
ATATATTCCAATGGTCAAAGGTCGACGTCCTAATAAATCTGTATTTTTAC
CACCGCATCCATTGATAGAATTCGAGAGAGCAAATTTGTTAAATAAATTA
CGTAGCCAATTTGTCAATTCATGCATGACCCGAGAAAATATTCACCCGCC
AGATGGATCTTTCAATCGGTGGTTGTTACAAATGAAAACAATTGATTATG
GTTATGATCCAATTTTTCCGAGTCGATGCGATAAAAGCATTGGTTCATCA
ATGAAACGCGAATTGCTGTTGTCACTTCCGTTTCCAATTGTCAAACCAAA
ATATCTCAATGCGGCTAAAACTCAATTGATTCGATATTCGGAGTCGGTTA
AAGGCCTAGTTGAAAGACGAAATGCTAGTCCACCTTGTCGTAAAATAATT
AAACACAATGTGGATGAAACCCTTAGATGGATCAGAAGTGAAGAATACCG
TTCTTTTGATGATTATATAGAAAAATTAGTGAGTATTAAAAGAATTTGTC
AGCCACATATTCAGGATTTGGTTCGCGAAAGTGTAGAAAAAATATGTATA
AAAATGTATAATCTGAGTCAAGAGTATACAATGAGATTGCGAACAAACCA
TCTAAAACTATTTCAGCAAAATGGAATACCATTACCAGAAATATTAAATG
ATTTAAATATCGAACATGTTGTGCAAAATCCATATAATGATTTACTGGAT
ATAGATATTAATCAATTGACTCCAAAGTCAAATGAATTCATTAATCAAGA
GTTAACTCCTTGCCATCCTATTGGGCTGGCTTGTCCTTGTCCTTTATTTA
CCTCTTTAAATACTCAGATGACAGTTACAATTCAAGAAGAGCTTAATATA
TCTGATCCTAAAGCAAGTTTAGTGTCTATTGAAATCCCAGATTTAGCAAA
ATTTCATATTACCAAGTGCCATTTTGAAAAACTTGAAACTCTTTATCTAG
TCAGTACAAGAGATGATCCTGAAAAAATTGCATTTAATAATCGTCTTTGG
TGTTTACTTCAAAGATATTACAGTTATCTTGGCTGTGAAAATGGTTCATT
TGGTGGAGTCATCAATCAAGCTGCATTACCAGTTGCAGTTTTCGAAGTCT
TAAATAGATTATTTGATGTTAATTTCGAGATGTTTGCTTCTCCTCTCAAC
TGTTATTTTCCTCAATACTGTTCTGCATTCCATGATACAGATCGATACTT
CGGATCATGTGGACCAGCTTTGGAATTTTTTCCTGTAACAGGATCTTTTG
AAGCTAACCCTCCATTTTGTGAAGAATTACTTCTTGGATTTGTTAATTAT
GTGGAAAAACTTTTGCAAAATTCTGAATTGGCATTAAGTTTCATTGTATT
CATTCCTGATTGGAGAGATCCTCCATTTGAAGCGCTCACTTTATTGGAAG
TTTCACCTTTCAATAGACATCAAATGACCCTCCGAGCACGAGAACATGAA
TATAGAATTGCAAATTTTCCACCTAATAATAACAATCCGAGTTCTAGTAC
AAGAAATCAACCAGAAATATTGAAACGATCTGGTCACAGTACTTTGGTGG
TCTTTTTACAGAATAATTCCGGATTTCAGCGCTGGACACCTACTACTGAA
CGCTTAAATGAGTTAATGGCAGTATATTATACTGCAAATCTGTCAAATAA
TATTCCAAGTAGACGAGACTTTGATGAAGAATACGTCAATTCTGTTTCAT
AAAGAGATCATTTAAAGACTATAAAACTATAAAAATCATTTGAATTTCAA
ACATTCGACTGCCTGTATTCAACATTTATTAATATTTCAAAATTAATTTA
CAGACATTTTATCTTACTGCCTTGTATTAATTTTTCATTTCTGTATTAAA
TTTTTGTATTATTTCAAATATCAACTATTTCATCGGTGTAGGTATTGCCG
TTGACTAAATTTTCAGCAGCTAAATGTAATTGGATCATCTACCTTTAGCC
AATGGCTGTCATTTATTATTCACTATAAATAGCTGAAATCATTACTTATG
TTTTAGATTTTGATTGTTACATCCAAATGGTAAGATTGATGATTAATTGT
AATTGTTATTTTTAATTCATATTATTTGATG
back to top

protein sequence of SMED30008994-orf-1

>SMED30008994-orf-1 ID=SMED30008994-orf-1|Name=SMED30008994-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=685bp
MDNSSYLSPATHDSEGSIEKDYAHDLPENLLNAGWRKFWSKRENREYYYN
KITGASLWDLNELQLQESSYNSITKRKASGDSDEINQKRACYRSNIHIEP
LLGPAFVPGSLYNFVSSKYIPMVKGRRPNKSVFLPPHPLIEFERANLLNK
LRSQFVNSCMTRENIHPPDGSFNRWLLQMKTIDYGYDPIFPSRCDKSIGS
SMKRELLLSLPFPIVKPKYLNAAKTQLIRYSESVKGLVERRNASPPCRKI
IKHNVDETLRWIRSEEYRSFDDYIEKLVSIKRICQPHIQDLVRESVEKIC
IKMYNLSQEYTMRLRTNHLKLFQQNGIPLPEILNDLNIEHVVQNPYNDLL
DIDINQLTPKSNEFINQELTPCHPIGLACPCPLFTSLNTQMTVTIQEELN
ISDPKASLVSIEIPDLAKFHITKCHFEKLETLYLVSTRDDPEKIAFNNRL
WCLLQRYYSYLGCENGSFGGVINQAALPVAVFEVLNRLFDVNFEMFASPL
NCYFPQYCSAFHDTDRYFGSCGPALEFFPVTGSFEANPPFCEELLLGFVN
YVEKLLQNSELALSFIVFIPDWRDPPFEALTLLEVSPFNRHQMTLRAREH
EYRIANFPPNNNNPSSSTRNQPEILKRSGHSTLVVFLQNNSGFQRWTPTT
ERLNELMAVYYTANLSNNIPSRRDFDEEYVNSVS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0016422mRNA (2'-O-methyladenosine-N6-)-methyltransferase activity
GO:0099122RNA polymerase II C-terminal domain binding
GO:0005515protein binding
GO:0003674molecular_function
Vocabulary: biological process
TermDefinition
GO:0080009mRNA methylation
GO:0010923negative regulation of phosphatase activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
Vocabulary: INTERPRO
TermDefinition
IPR039881PCIF1-like
IPR036020WW_dom_sf
IPR001202WW_dom
IPR022035PCIF1_WW
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005654nucleoplasm
GO:0015630microtubule cytoskeleton
GO:0045171intercellular bridge
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:2.20.70.10coord: 22..73
e-value: 4.9E-16
score: 59.9
NoneNo IPR availablePANTHERPTHR21727:SF0PHOSPHORYLATED CTD-INTERACTING FACTOR 1coord: 14..663
IPR022035PCIF1, WW domainPFAMPF12237PCIF1_WWcoord: 428..603
e-value: 9.5E-58
score: 194.6
IPR001202WW domainPFAMPF00397WWcoord: 31..59
e-value: 1.6E-7
score: 31.3
IPR001202WW domainPROSITEPS50020WW_DOMAIN_2coord: 29..63
score: 9.202
IPR001202WW domainCDDcd00201WWcoord: 32..59
e-value: 9.73461E-5
score: 37.8926
IPR039881mRNA (2'-O-methyladenosine-N(6)-)-methyltransferase PCIF1-likePANTHERPTHR21727PHOSPHORYLATED CTD INTERACTING FACTOR 1coord: 14..663
IPR036020WW domain superfamilySUPERFAMILYSSF51045WW domaincoord: 24..59