Protein phosphatase 1G

Overview
NameProtein phosphatase 1G
Smed IDSMED30008984
Length (bp)1550
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Protein phosphatase 1G (SMED30008984) t-SNE clustered cells

Violin plots show distribution of expression levels for Protein phosphatase 1G (SMED30008984) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Protein phosphatase 1G (SMED30008984) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Protein phosphatase 1G (SMED30008984) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30008984

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 17

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30008984SMESG000030206.1 SmedASXL_006466SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30008984SMESG000030206.1 SmedASXL_006466SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
pharynxSMED30008984SMESG000030206.1 dd_Smed_v4_2086_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30008984SMESG000030206.1 dd_Smed_v4_2086_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30008984SMESG000030206.1 dd_Smed_v4_2086_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30008984SMESG000030206.1 dd_Smed_v4_2086_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30008984SMESG000030206.1 dd_Smed_v4_2086_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30008984SMESG000030206.1 dd_Smed_v4_2086_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30008984SMESG000030206.1 dd_Smed_v4_2086_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30008984SMESG000030206.1 dd_Smed_v4_2086_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30008984SMESG000030206.1 dd_Smed_v4_2086_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30008984SMESG000030206.1 Contig17656uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30008984SMESG000030206.1 Contig17656newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30008984SMESG000030206.1 Contig44345uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30008984SMESG000030206.1 Contig44345newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
neoblastSMED30008984SMESG000030206.1 dd_Smed_v6_2086_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
zeta neoblastSMED30008984SMESG000030206.1 dd_Smed_v4_2086_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Protein phosphatase 1G vs. Ensembl Human
Match: PPM1G (protein phosphatase, Mg2+/Mn2+ dependent 1G [Source:HGNC Symbol;Acc:HGNC:9278])

HSP 1 Score: 218.779 bits (556), Expect = 6.157e-64
Identity = 110/211 (52.13%), Postives = 144/211 (68.25%), Query Frame = 1
Query:  802 PFQYLRNAPGFDSGSTAVLSLINRKTLKVYVANVGDSRCVLCRNGEAVDLSIDHKPEDEIESQRIAKAGGILSEDGRVNGGLNLSRSLGDHSYKKNKEIEMKDQMISAFPDIQTIDLKPHEDEFLVLACDGIWNTFSSQQLVEFVSKRTPTMSA-------TDIISEIFSHCLAPNTSGDGTGCDNMTCIIITFKFPSPISICNGKSNKRR 1413
            P    +  PG DSG+TAV++LI  K L   VAN GDSRCV+   G+A+D+S DHKPEDE+E  RI  AGG ++ DGRVNGGLNLSR++GDH YK+NK +  ++QMISA PDI+ + L   + EF+V+ACDGIWN  SSQ++V+F+  +             + I+ E+   CLAP+TSGDGTGCDNMTCIII FK P   +    +S KR+
Sbjct:  315 PGMEGKEEPGSDSGTTAVVALIRGKQL--IVANAGDSRCVVSEAGKALDMSYDHKPEDEVELARIKNAGGKVTMDGRVNGGLNLSRAIGDHFYKRNKNLPPEEQMISALPDIKVLTLT-DDHEFMVIACDGIWNVMSSQEVVDFIQSKISQRDENGELRLLSSIVEELLDQCLAPDTSGDGTGCDNMTCIIICFK-PRNTAELQPESGKRK 521          

HSP 2 Score: 102.064 bits (253), Expect = 2.071e-22
Identity = 54/120 (45.00%), Postives = 74/120 (61.67%), Query Frame = 1
Query:   58 MGAYLSKPVTDKELESGEDAF---LSYASGSMQGWRTSQEDAHNCILDFSSDYSLFAVYDGHGGPEVAQLCSQKLPDHIKNSVDFINGNYNDSLTNSFLSFDEAILSPEMQEALKKLANI 408
            MGAYLS+P T K    G  A    L Y   +MQGWR S EDAHNCI +  S+ ++F+VYDGHGG EVA  C++ LPD IK+   +  G    +L ++FL+ D  + +   +E +K+LA I
Sbjct:    1 MGAYLSQPNTVKCSGDGVGAPRLPLPYGFSAMQGWRVSMEDAHNCIPELDSETAMFSVYDGHGGEEVALYCAKYLPDIIKDQKAYKEGKLQKALEDAFLAIDAKLTT---EEVIKELAQI 117          
BLAST of Protein phosphatase 1G vs. Ensembl Human
Match: PPM1L (protein phosphatase, Mg2+/Mn2+ dependent 1L [Source:HGNC Symbol;Acc:HGNC:16381])

HSP 1 Score: 115.931 bits (289), Expect = 1.644e-29
Identity = 73/183 (39.89%), Postives = 109/183 (59.56%), Query Frame = 1
Query:  835 DSGSTAVLSLINRKTLKVYVANVGDSRCVLC-RNGEAVDLSIDHKPEDEIESQRIAKAGGILSEDG--RVNGGLNLSRSLGDHSYKKNKEIEMKDQMISAFPDIQTIDLKPHEDEFLVLACDGIWNTFSSQQLVEFVSKRT--PTMSATDIISEIFSHCLAPNTSGDGTGC-DNMTCIIITFK 1365
            ++G+T +++L++ K L V  ANVGDSR VLC ++G A+ LS DHKP    E +RI +AGG +S +G  RV G L +SRSLGD+  K N  + + D      PDI T DL   + EF++LA DG+W+ FS+++ V F+ +R   P   A  I+ + F             GC DN+T +++ F+
Sbjct:   11 EAGTTCLIALLSDKDLTV--ANVGDSRGVLCDKDGNAIPLSHDHKPYQLKERKRIKRAGGFISFNGSWRVQGILAMSRSLGDYPLK-NLNVVIPD------PDILTFDLDKLQPEFMILASDGLWDAFSNEEAVRFIKERLDEPHFGAKSIVLQSFYR-----------GCPDNITVMVVKFR 173          
BLAST of Protein phosphatase 1G vs. Ensembl Human
Match: PPM1L (protein phosphatase, Mg2+/Mn2+ dependent 1L [Source:HGNC Symbol;Acc:HGNC:16381])

HSP 1 Score: 116.701 bits (291), Expect = 3.147e-29
Identity = 73/183 (39.89%), Postives = 109/183 (59.56%), Query Frame = 1
Query:  835 DSGSTAVLSLINRKTLKVYVANVGDSRCVLC-RNGEAVDLSIDHKPEDEIESQRIAKAGGILSEDG--RVNGGLNLSRSLGDHSYKKNKEIEMKDQMISAFPDIQTIDLKPHEDEFLVLACDGIWNTFSSQQLVEFVSKRT--PTMSATDIISEIFSHCLAPNTSGDGTGC-DNMTCIIITFK 1365
            ++G+T +++L++ K L V  ANVGDSR VLC ++G A+ LS DHKP    E +RI +AGG +S +G  RV G L +SRSLGD+  K N  + + D      PDI T DL   + EF++LA DG+W+ FS+++ V F+ +R   P   A  I+ + F             GC DN+T +++ F+
Sbjct:   63 EAGTTCLIALLSDKDLTV--ANVGDSRGVLCDKDGNAIPLSHDHKPYQLKERKRIKRAGGFISFNGSWRVQGILAMSRSLGDYPLK-NLNVVIPD------PDILTFDLDKLQPEFMILASDGLWDAFSNEEAVRFIKERLDEPHFGAKSIVLQSFYR-----------GCPDNITVMVVKFR 225          
BLAST of Protein phosphatase 1G vs. Ensembl Human
Match: PPM1L (protein phosphatase, Mg2+/Mn2+ dependent 1L [Source:HGNC Symbol;Acc:HGNC:16381])

HSP 1 Score: 115.931 bits (289), Expect = 7.199e-28
Identity = 73/183 (39.89%), Postives = 109/183 (59.56%), Query Frame = 1
Query:  835 DSGSTAVLSLINRKTLKVYVANVGDSRCVLC-RNGEAVDLSIDHKPEDEIESQRIAKAGGILSEDG--RVNGGLNLSRSLGDHSYKKNKEIEMKDQMISAFPDIQTIDLKPHEDEFLVLACDGIWNTFSSQQLVEFVSKRT--PTMSATDIISEIFSHCLAPNTSGDGTGC-DNMTCIIITFK 1365
            ++G+T +++L++ K L V  ANVGDSR VLC ++G A+ LS DHKP    E +RI +AGG +S +G  RV G L +SRSLGD+  K N  + + D      PDI T DL   + EF++LA DG+W+ FS+++ V F+ +R   P   A  I+ + F             GC DN+T +++ F+
Sbjct:  190 EAGTTCLIALLSDKDLTV--ANVGDSRGVLCDKDGNAIPLSHDHKPYQLKERKRIKRAGGFISFNGSWRVQGILAMSRSLGDYPLK-NLNVVIPD------PDILTFDLDKLQPEFMILASDGLWDAFSNEEAVRFIKERLDEPHFGAKSIVLQSFYR-----------GCPDNITVMVVKFR 352          
BLAST of Protein phosphatase 1G vs. Ensembl Human
Match: PPM1A (protein phosphatase, Mg2+/Mn2+ dependent 1A [Source:HGNC Symbol;Acc:HGNC:9275])

HSP 1 Score: 113.62 bits (283), Expect = 2.576e-27
Identity = 67/176 (38.07%), Postives = 99/176 (56.25%), Query Frame = 1
Query:  838 SGSTAVLSLINRKTLKVYVANVGDSRCVLCRNGEAVDLSIDHKPEDEIESQRIAKAGGILSEDGRVNGGLNLSRSLGDHSYKKNKEIEMKDQMISAFPDIQTIDLKPHEDEFLVLACDGIWNTFSSQQLVEFVSKRTP-TMSATDIISEIFSHCLAPNTSGDGTGCDNMTCIIITF 1362
            SGSTAV  LI+ +    Y  N GDSR +LCRN +    + DHKP + +E +RI  AGG +    RVNG L +SR+LGD  YK        +Q++S  P++  I+    +D+F++LACDGIW+   +++L +FV  R   T     + +E+   CL   +       DNM+ I+I F
Sbjct:  125 SGSTAVGVLISPQ--HTYFINCGDSRGLLCRNRKVHFFTQDHKPSNPLEKERIQNAGGSVMIQ-RVNGSLAVSRALGDFDYKCVHGKGPTEQLVSPEPEVHDIERSEEDDQFIILACDGIWDVMGNEELCDFVRSRLEVTDDLEKVCNEVVDTCLYKGSR------DNMSVILICF 291          

HSP 2 Score: 86.6557 bits (213), Expect = 4.642e-18
Identity = 45/112 (40.18%), Postives = 58/112 (51.79%), Query Frame = 1
Query:   58 MGAYLSKPVTDKELESGEDAFLSYASGSMQGWRTSQEDAHNCILDFSS---DYSLFAVYDGHGGPEVAQLCSQKLPDHIKNSVDFING-------NYNDSLTNSFLSFDEAI 363
            MGA+L KP  +K    G+   L Y   SMQGWR   EDAH  ++   S    +S FAVYDGH G +VA+ C + L DHI N+ DF          N  + +   FL  DE +
Sbjct:    1 MGAFLDKPKMEKHNAQGQGNGLRYGLSSMQGWRVEMEDAHTAVIGLPSGLESWSFFAVYDGHAGSQVAKYCCEHLLDHITNNQDFKGSAGAPSVENVKNGIRTGFLEIDEHM 112          
BLAST of Protein phosphatase 1G vs. Ensembl Celegans
Match: ppm-1.G (Probable protein phosphatase 2C F42G9.1 [Source:UniProtKB/Swiss-Prot;Acc:P49595])

HSP 1 Score: 216.853 bits (551), Expect = 2.119e-64
Identity = 107/180 (59.44%), Postives = 135/180 (75.00%), Query Frame = 1
Query:  826 PGFDSGSTAVLSLINRKTLKVYVANVGDSRCVLCRNGEAVDLSIDHKPEDEIESQRIAKAGGILSEDGRVNGGLNLSRSLGDHSYKKNKEIEMKDQMISAFPDIQTIDLKPHEDEFLVLACDGIWNTFSSQQLVEFVSKRTPTMSA-TDIISEIFSHCLAPNTSGDGTGCDNMTCIIITF 1362
            PG DSG+TA + L+ +   KV VAN GDSR VLCRNG+AVDLS+DHKPEDE+E+ RI  AGG + EDGRVNGGLNLSR+ GDH+YKKN+E+ +K+QMI+A PD++   L P EDEF+V+ACDGIWN+  SQQ+V+FV       S+  ++   +   CLA +T GDGTGCDNMT I  TF
Sbjct:  289 PGEDSGTTACVCLVGKD--KVIVANAGDSRAVLCRNGKAVDLSVDHKPEDEVETNRIHAAGGQI-EDGRVNGGLNLSRAFGDHAYKKNQELGLKEQMITALPDVKIEALTP-EDEFIVVACDGIWNSMESQQVVDFVRDLLAKGSSCAEVCDALCDACLADSTDGDGTGCDNMTVICTTF 464          

HSP 2 Score: 72.4034 bits (176), Expect = 2.245e-13
Identity = 33/83 (39.76%), Postives = 54/83 (65.06%), Query Frame = 1
Query:  166 EDAHNCILDFSSDYSLFAVYDGHGGPEVAQLCSQKLPDHIKNSVDFINGNYNDSLTNSFLSFDEAILSPEMQEALKKLANIDD 414
            +DAHNC++D  +D+ +F VYDGHGG EV++  S KLPD +K    +   +  + L  +F+ FD+ I +   +E++K+L +I D
Sbjct:   15 QDAHNCVVDLHTDWHMFGVYDGHGGTEVSKFTSAKLPDFLKERKFWEADDVAECLQKAFVDFDDFIRA---EESMKELKDIGD 94          
BLAST of Protein phosphatase 1G vs. Ensembl Celegans
Match: ppm-1.G (Probable protein phosphatase 2C F42G9.1 [Source:UniProtKB/Swiss-Prot;Acc:P49595])

HSP 1 Score: 216.853 bits (551), Expect = 3.523e-64
Identity = 107/180 (59.44%), Postives = 135/180 (75.00%), Query Frame = 1
Query:  826 PGFDSGSTAVLSLINRKTLKVYVANVGDSRCVLCRNGEAVDLSIDHKPEDEIESQRIAKAGGILSEDGRVNGGLNLSRSLGDHSYKKNKEIEMKDQMISAFPDIQTIDLKPHEDEFLVLACDGIWNTFSSQQLVEFVSKRTPTMSA-TDIISEIFSHCLAPNTSGDGTGCDNMTCIIITF 1362
            PG DSG+TA + L+ +   KV VAN GDSR VLCRNG+AVDLS+DHKPEDE+E+ RI  AGG + EDGRVNGGLNLSR+ GDH+YKKN+E+ +K+QMI+A PD++   L P EDEF+V+ACDGIWN+  SQQ+V+FV       S+  ++   +   CLA +T GDGTGCDNMT I  TF
Sbjct:  311 PGEDSGTTACVCLVGKD--KVIVANAGDSRAVLCRNGKAVDLSVDHKPEDEVETNRIHAAGGQI-EDGRVNGGLNLSRAFGDHAYKKNQELGLKEQMITALPDVKIEALTP-EDEFIVVACDGIWNSMESQQVVDFVRDLLAKGSSCAEVCDALCDACLADSTDGDGTGCDNMTVICTTF 486          

HSP 2 Score: 118.242 bits (295), Expect = 2.414e-28
Identity = 55/119 (46.22%), Postives = 80/119 (67.23%), Query Frame = 1
Query:   58 MGAYLSKPVTDKELESGEDAFLSYASGSMQGWRTSQEDAHNCILDFSSDYSLFAVYDGHGGPEVAQLCSQKLPDHIKNSVDFINGNYNDSLTNSFLSFDEAILSPEMQEALKKLANIDD 414
            MGAYL+KP+ +KE E G    LSYA  +MQGWR +QEDAHNC++D  +D+ +F VYDGHGG EV++  S KLPD +K    +   +  + L  +F+ FD+ I +   +E++K+L +I D
Sbjct:    1 MGAYLNKPIIEKEKEEGSGNGLSYACTTMQGWRVNQEDAHNCVVDLHTDWHMFGVYDGHGGTEVSKFTSAKLPDFLKERKFWEADDVAECLQKAFVDFDDFIRA---EESMKELKDIGD 116          
BLAST of Protein phosphatase 1G vs. Ensembl Celegans
Match: ppm-2 (Probable protein phosphatase 2C T23F11.1 [Source:UniProtKB/Swiss-Prot;Acc:P49596])

HSP 1 Score: 146.747 bits (369), Expect = 2.465e-39
Identity = 83/178 (46.63%), Postives = 111/178 (62.36%), Query Frame = 1
Query:  838 SGSTAVLSLINRKTLKVYVANVGDSRCVLCRNGEAVDLSIDHKPEDEIESQRIAKAGGILSEDGRVNGGLNLSRSLGDHSYKKNKEIEMKDQMISAFPDIQTIDLKPHEDEFLVLACDGIWNTFSSQQLVEFV-----SKRTPTMSATDIISEIFSHCLAPNTSGDGTGCDNMTCIII 1356
            SG+TAV+ LI  K   VY  N GDSR V    GEA  LS DHKP  E E++RI  AGG + E  RVNG L LSR+LGD ++K       ++Q+++AFPD+ T  L P + EF+VLACDGIW+  ++Q++V+FV      KR P      I  E+ + CLAP+    G GCDNMT +++
Sbjct:  115 SGTTAVVVLI--KEGDVYCGNAGDSRAVSSVVGEARPLSFDHKPSHETEARRIIAAGGWV-EFNRVNGNLALSRALGDFAFKNCDTKPAEEQIVTAFPDVITDKLTP-DHEFIVLACDGIWDVMTNQEVVDFVREKLAEKRDP----QSICEELLTRCLAPDCQMGGLGCDNMTVVLV 284          

HSP 2 Score: 74.3294 bits (181), Expect = 3.461e-14
Identity = 40/104 (38.46%), Postives = 53/104 (50.96%), Query Frame = 1
Query:   58 MGAYLSKPVTDKELESGEDAFLSYASGSMQGWRTSQEDAHNCILDFSSD--YSLFAVYDGHGGPEVAQLCSQKLPDHIKNSVDFINGNYNDSLTNSFLSFDEAI 363
            MG  LS+PVT KE  S  +      S  MQGWR   EDAH  +L    D   + FAVYDGHGG +V+Q     L   +    +F  GN  +++   FL  D+ +
Sbjct:    1 MGQTLSEPVTKKESASCANENYLVGSSCMQGWRVDMEDAHTHLLSLPDDPKCAFFAVYDGHGGSKVSQYSGINLHKKVVAQKEFSEGNMKEAIEKGFLELDQQM 104          
BLAST of Protein phosphatase 1G vs. Ensembl Celegans
Match: ppm-2 (Probable protein phosphatase 2C T23F11.1 [Source:UniProtKB/Swiss-Prot;Acc:P49596])

HSP 1 Score: 146.747 bits (369), Expect = 2.465e-39
Identity = 83/178 (46.63%), Postives = 111/178 (62.36%), Query Frame = 1
Query:  838 SGSTAVLSLINRKTLKVYVANVGDSRCVLCRNGEAVDLSIDHKPEDEIESQRIAKAGGILSEDGRVNGGLNLSRSLGDHSYKKNKEIEMKDQMISAFPDIQTIDLKPHEDEFLVLACDGIWNTFSSQQLVEFV-----SKRTPTMSATDIISEIFSHCLAPNTSGDGTGCDNMTCIII 1356
            SG+TAV+ LI  K   VY  N GDSR V    GEA  LS DHKP  E E++RI  AGG + E  RVNG L LSR+LGD ++K       ++Q+++AFPD+ T  L P + EF+VLACDGIW+  ++Q++V+FV      KR P      I  E+ + CLAP+    G GCDNMT +++
Sbjct:  115 SGTTAVVVLI--KEGDVYCGNAGDSRAVSSVVGEARPLSFDHKPSHETEARRIIAAGGWV-EFNRVNGNLALSRALGDFAFKNCDTKPAEEQIVTAFPDVITDKLTP-DHEFIVLACDGIWDVMTNQEVVDFVREKLAEKRDP----QSICEELLTRCLAPDCQMGGLGCDNMTVVLV 284          

HSP 2 Score: 74.3294 bits (181), Expect = 3.461e-14
Identity = 40/104 (38.46%), Postives = 53/104 (50.96%), Query Frame = 1
Query:   58 MGAYLSKPVTDKELESGEDAFLSYASGSMQGWRTSQEDAHNCILDFSSD--YSLFAVYDGHGGPEVAQLCSQKLPDHIKNSVDFINGNYNDSLTNSFLSFDEAI 363
            MG  LS+PVT KE  S  +      S  MQGWR   EDAH  +L    D   + FAVYDGHGG +V+Q     L   +    +F  GN  +++   FL  D+ +
Sbjct:    1 MGQTLSEPVTKKESASCANENYLVGSSCMQGWRVDMEDAHTHLLSLPDDPKCAFFAVYDGHGGSKVSQYSGINLHKKVVAQKEFSEGNMKEAIEKGFLELDQQM 104          
BLAST of Protein phosphatase 1G vs. Ensembl Celegans
Match: ppm-2 (Probable protein phosphatase 2C T23F11.1 [Source:UniProtKB/Swiss-Prot;Acc:P49596])

HSP 1 Score: 146.747 bits (369), Expect = 2.465e-39
Identity = 83/178 (46.63%), Postives = 111/178 (62.36%), Query Frame = 1
Query:  838 SGSTAVLSLINRKTLKVYVANVGDSRCVLCRNGEAVDLSIDHKPEDEIESQRIAKAGGILSEDGRVNGGLNLSRSLGDHSYKKNKEIEMKDQMISAFPDIQTIDLKPHEDEFLVLACDGIWNTFSSQQLVEFV-----SKRTPTMSATDIISEIFSHCLAPNTSGDGTGCDNMTCIII 1356
            SG+TAV+ LI  K   VY  N GDSR V    GEA  LS DHKP  E E++RI  AGG + E  RVNG L LSR+LGD ++K       ++Q+++AFPD+ T  L P + EF+VLACDGIW+  ++Q++V+FV      KR P      I  E+ + CLAP+    G GCDNMT +++
Sbjct:  115 SGTTAVVVLI--KEGDVYCGNAGDSRAVSSVVGEARPLSFDHKPSHETEARRIIAAGGWV-EFNRVNGNLALSRALGDFAFKNCDTKPAEEQIVTAFPDVITDKLTP-DHEFIVLACDGIWDVMTNQEVVDFVREKLAEKRDP----QSICEELLTRCLAPDCQMGGLGCDNMTVVLV 284          

HSP 2 Score: 74.3294 bits (181), Expect = 3.461e-14
Identity = 40/104 (38.46%), Postives = 53/104 (50.96%), Query Frame = 1
Query:   58 MGAYLSKPVTDKELESGEDAFLSYASGSMQGWRTSQEDAHNCILDFSSD--YSLFAVYDGHGGPEVAQLCSQKLPDHIKNSVDFINGNYNDSLTNSFLSFDEAI 363
            MG  LS+PVT KE  S  +      S  MQGWR   EDAH  +L    D   + FAVYDGHGG +V+Q     L   +    +F  GN  +++   FL  D+ +
Sbjct:    1 MGQTLSEPVTKKESASCANENYLVGSSCMQGWRVDMEDAHTHLLSLPDDPKCAFFAVYDGHGGSKVSQYSGINLHKKVVAQKEFSEGNMKEAIEKGFLELDQQM 104          
BLAST of Protein phosphatase 1G vs. Ensembl Fly
Match: CG10417 (gene:FBgn0033021 transcript:FBtr0086091)

HSP 1 Score: 224.557 bits (571), Expect = 2.205e-65
Identity = 108/181 (59.67%), Postives = 138/181 (76.24%), Query Frame = 1
Query:  826 PGFDSGSTAVLSLINRKTLKVYVANVGDSRCVLCRNGEAVDLSIDHKPEDEIESQRIAKAGGILSEDGRVNGGLNLSRSLGDHSYKKNKEIEMKDQMISAFPDIQTIDLKPHEDEFLVLACDGIWNTFSSQQLVEFVSKR-TPTMSATDIISEIFSHCLAPNTSGDGTGCDNMTCIIITFK 1365
            PG DSG TAV+ L+  + L  YVAN GDSRCV+ R+G+A+++SIDHKPED+ E+ RI KAGG ++ DGRVNGGLNLSR+LGDH+YK N  +  ++QMISA PDI+ + + P EDEF+VLACDGIWN  SS+++VEFV  R       + I  E+F +CLAPNT GDGTGCDNMT +I+ FK
Sbjct:  388 PGKDSGCTAVVCLLQGRDL--YVANAGDSRCVISRSGQAIEMSIDHKPEDDEEASRIIKAGGRVTLDGRVNGGLNLSRALGDHAYKTNVTLPAEEQMISALPDIKKLIITP-EDEFMVLACDGIWNYMSSEEVVEFVRCRLKDNKKLSTICEELFDNCLAPNTMGDGTGCDNMTAVIVQFK 565          

HSP 2 Score: 124.405 bits (311), Expect = 7.915e-30
Identity = 60/115 (52.17%), Postives = 75/115 (65.22%), Query Frame = 1
Query:   58 MGAYLSKPVTDKELESGEDAFLSYASGSMQGWRTSQEDAHNCILDFSSDYSLFAVYDGHGGPEVAQLCSQKLPDHIKNSVDFINGNYNDSLTNSFLSFDEAILSPEMQEALKKLA 402
            MGAYLS P TDK      +  L+  + SMQGWR SQEDAHN IL+F ++ S FAVYDGHGG EVAQ C+ KLP  +KN   + NG +  +L  +FL FD+ +L P +   LK LA
Sbjct:    1 MGAYLSHPKTDKTSTDQFNELLAVGASSMQGWRNSQEDAHNSILNFDNNTSFFAVYDGHGGAEVAQYCADKLPHFLKNLETYKNGQFEVALKEAFLGFDKTLLDPSIVSILKILA 115          
BLAST of Protein phosphatase 1G vs. Ensembl Fly
Match: CG10417 (gene:FBgn0033021 transcript:FBtr0086092)

HSP 1 Score: 224.557 bits (571), Expect = 2.205e-65
Identity = 108/181 (59.67%), Postives = 138/181 (76.24%), Query Frame = 1
Query:  826 PGFDSGSTAVLSLINRKTLKVYVANVGDSRCVLCRNGEAVDLSIDHKPEDEIESQRIAKAGGILSEDGRVNGGLNLSRSLGDHSYKKNKEIEMKDQMISAFPDIQTIDLKPHEDEFLVLACDGIWNTFSSQQLVEFVSKR-TPTMSATDIISEIFSHCLAPNTSGDGTGCDNMTCIIITFK 1365
            PG DSG TAV+ L+  + L  YVAN GDSRCV+ R+G+A+++SIDHKPED+ E+ RI KAGG ++ DGRVNGGLNLSR+LGDH+YK N  +  ++QMISA PDI+ + + P EDEF+VLACDGIWN  SS+++VEFV  R       + I  E+F +CLAPNT GDGTGCDNMT +I+ FK
Sbjct:  388 PGKDSGCTAVVCLLQGRDL--YVANAGDSRCVISRSGQAIEMSIDHKPEDDEEASRIIKAGGRVTLDGRVNGGLNLSRALGDHAYKTNVTLPAEEQMISALPDIKKLIITP-EDEFMVLACDGIWNYMSSEEVVEFVRCRLKDNKKLSTICEELFDNCLAPNTMGDGTGCDNMTAVIVQFK 565          

HSP 2 Score: 124.405 bits (311), Expect = 7.915e-30
Identity = 60/115 (52.17%), Postives = 75/115 (65.22%), Query Frame = 1
Query:   58 MGAYLSKPVTDKELESGEDAFLSYASGSMQGWRTSQEDAHNCILDFSSDYSLFAVYDGHGGPEVAQLCSQKLPDHIKNSVDFINGNYNDSLTNSFLSFDEAILSPEMQEALKKLA 402
            MGAYLS P TDK      +  L+  + SMQGWR SQEDAHN IL+F ++ S FAVYDGHGG EVAQ C+ KLP  +KN   + NG +  +L  +FL FD+ +L P +   LK LA
Sbjct:    1 MGAYLSHPKTDKTSTDQFNELLAVGASSMQGWRNSQEDAHNSILNFDNNTSFFAVYDGHGGAEVAQYCADKLPHFLKNLETYKNGQFEVALKEAFLGFDKTLLDPSIVSILKILA 115          
BLAST of Protein phosphatase 1G vs. Ensembl Fly
Match: CG17746 (gene:FBgn0035425 transcript:FBtr0073094)

HSP 1 Score: 153.295 bits (386), Expect = 1.512e-41
Identity = 92/217 (42.40%), Postives = 131/217 (60.37%), Query Frame = 1
Query:  805 FQYLRNAPGFD--SGSTAVLSLINRKTLKVYVANVGDSRCVLCRNGEAVDLSIDHKPEDEIESQRIAKAGGILSEDGRVNGGLNLSRSLGDHSYK-KNKEIEMKDQMISAFPDIQTIDLKPHEDEFLVLACDGIWNTFSSQQLVEFVSKRTPT-MSATDIISEIFSHCLAPNTSGDGTGCDNMTCIIITFKFPSPISICNGKSNKRRAATKELDEES 1443
            +  LRN    D  +GSTAV+ L+  K  K+Y AN GDSR + C NG+   LS+DHKP +E ES+RI + GG + E  RVNG L LSR+LGD+ +K +NK+ E  DQ+++AFPD++T  +   + EF+VLACDGIW+  S+ +++EF   R    M   +I  E+ +HCLAP+    G G DNMT +++      P S    +      AT    EE+
Sbjct:  101 YVMLRNKTCGDQMAGSTAVVVLV--KDNKLYCANAGDSRAIACVNGQLEVLSLDHKPNNEAESKRIIQGGGWV-EFNRVNGNLALSRALGDYVFKHENKKPE--DQIVTAFPDVETRKIMD-DWEFIVLACDGIWDVMSNAEVLEFCRTRIGMGMFPEEICEELMNHCLAPDCQMGGLGGDNMTVVLVCLLHGRPYSDLIARCRNGSQATNNDQEEA 311          

HSP 2 Score: 74.7146 bits (182), Expect = 3.565e-14
Identity = 42/105 (40.00%), Postives = 55/105 (52.38%), Query Frame = 1
Query:   58 MGAYLSKPVTDKELESGEDAFLSYASGSMQGWRTSQEDAHNCILDFSSD--YSLFAVYDGHGGPEVAQLCSQKLPDHIKNSVDFINGNYNDSLTNSFLSFDEAIL 366
            MG  LS+PVT KE    ++A     S  MQGWR + ED+H  IL    D   + FAVYDGHGG  VAQ   + L  ++    ++ N N   +L   FL  D  +L
Sbjct:    1 MGQTLSEPVTAKESAYCQNAAYRVGSSCMQGWRINMEDSHTHILSLPDDPGAAFFAVYDGHGGATVAQYAGKHLHKYVLKRPEY-NDNIEQALQQGFLDIDYVML 104          
BLAST of Protein phosphatase 1G vs. Ensembl Fly
Match: CG17746 (gene:FBgn0035425 transcript:FBtr0073093)

HSP 1 Score: 153.295 bits (386), Expect = 1.512e-41
Identity = 92/217 (42.40%), Postives = 131/217 (60.37%), Query Frame = 1
Query:  805 FQYLRNAPGFD--SGSTAVLSLINRKTLKVYVANVGDSRCVLCRNGEAVDLSIDHKPEDEIESQRIAKAGGILSEDGRVNGGLNLSRSLGDHSYK-KNKEIEMKDQMISAFPDIQTIDLKPHEDEFLVLACDGIWNTFSSQQLVEFVSKRTPT-MSATDIISEIFSHCLAPNTSGDGTGCDNMTCIIITFKFPSPISICNGKSNKRRAATKELDEES 1443
            +  LRN    D  +GSTAV+ L+  K  K+Y AN GDSR + C NG+   LS+DHKP +E ES+RI + GG + E  RVNG L LSR+LGD+ +K +NK+ E  DQ+++AFPD++T  +   + EF+VLACDGIW+  S+ +++EF   R    M   +I  E+ +HCLAP+    G G DNMT +++      P S    +      AT    EE+
Sbjct:  101 YVMLRNKTCGDQMAGSTAVVVLV--KDNKLYCANAGDSRAIACVNGQLEVLSLDHKPNNEAESKRIIQGGGWV-EFNRVNGNLALSRALGDYVFKHENKKPE--DQIVTAFPDVETRKIMD-DWEFIVLACDGIWDVMSNAEVLEFCRTRIGMGMFPEEICEELMNHCLAPDCQMGGLGGDNMTVVLVCLLHGRPYSDLIARCRNGSQATNNDQEEA 311          

HSP 2 Score: 74.7146 bits (182), Expect = 3.565e-14
Identity = 42/105 (40.00%), Postives = 55/105 (52.38%), Query Frame = 1
Query:   58 MGAYLSKPVTDKELESGEDAFLSYASGSMQGWRTSQEDAHNCILDFSSD--YSLFAVYDGHGGPEVAQLCSQKLPDHIKNSVDFINGNYNDSLTNSFLSFDEAIL 366
            MG  LS+PVT KE    ++A     S  MQGWR + ED+H  IL    D   + FAVYDGHGG  VAQ   + L  ++    ++ N N   +L   FL  D  +L
Sbjct:    1 MGQTLSEPVTAKESAYCQNAAYRVGSSCMQGWRINMEDSHTHILSLPDDPGAAFFAVYDGHGGATVAQYAGKHLHKYVLKRPEY-NDNIEQALQQGFLDIDYVML 104          
BLAST of Protein phosphatase 1G vs. Ensembl Fly
Match: Ppm1 (gene:FBgn0035143 transcript:FBtr0072553)

HSP 1 Score: 139.428 bits (350), Expect = 1.412e-36
Identity = 80/209 (38.28%), Postives = 122/209 (58.37%), Query Frame = 1
Query:  838 SGSTAVLSLINRKTLKVYVANVGDSRCVLCRNGEAVDLSIDHKPEDEIESQRIAKAGGILSEDGRVNGGLNLSRSLGDHSYKKNKEIEMKDQMISAFPDIQTIDLKPHED-EFLVLACDGIWNTFSSQQLVEFVSKRT-PTMSATDIISEIFSHCLAPNTSGDGTGCDNMTCIIITF----KFPSPISICNGKSNKRRAATKELDEESI 1446
            +G TA++ LI  +  ++Y AN GDSR + C +G    LS+DHKP D  ES+RI  +GG + E  RVNG L LSR+LGD  YKKN     ++Q+++A+PD++ +D+   ED EF++LACDGIW+  S+ ++ +FV KR    M    I  E+ + CL+P+      G DNMT I++       +      C GK         ++ ++S+
Sbjct:  115 AGCTAIVVLIRER--RLYCANAGDSRAIACISGMVHALSVDHKPNDAKESKRIMASGGWV-EFNRVNGNLALSRALGDFIYKKNLLKTPEEQIVTAYPDVEVLDIT--EDLEFVLLACDGIWDVMSNFEVCQFVHKRIRDGMEPELICEELMNSCLSPDGHTGNVGGDNMTVILVCLLHNKSYEDLAVRCGGKRKTPVETVGDIQDQSV 318          

HSP 2 Score: 75.8702 bits (185), Expect = 1.427e-14
Identity = 41/105 (39.05%), Postives = 54/105 (51.43%), Query Frame = 1
Query:   58 MGAYLSKPVTDKELESGEDAFLSYASGSMQGWRTSQEDAHNCILDFSSD--YSLFAVYDGHGGPEVAQLCSQKLPDHIKNSVDFINGNYNDSLTNSFLSFDEAIL 366
            MG  LS+PVT K+     +A     S  MQGWR   EDAH  IL    D   + FAVYDGHGG  VA+   + L   I    ++ + +   +L  +FL FD  +L
Sbjct:    1 MGQTLSEPVTTKDTACCANASYRVGSSCMQGWRVDMEDAHTHILSLPDDPQAAFFAVYDGHGGASVAKYAGKHLHKFITKRPEYRDNSIEVALKKAFLDFDREML 105          
BLAST of Protein phosphatase 1G vs. Ensembl Zebrafish
Match: ppm1g (protein phosphatase, Mg2+/Mn2+ dependent, 1G [Source:ZFIN;Acc:ZDB-GENE-030425-4])

HSP 1 Score: 233.417 bits (594), Expect = 1.146e-69
Identity = 119/232 (51.29%), Postives = 159/232 (68.53%), Query Frame = 1
Query:  793 CFPPFQYLRNAPGFDSGSTAVLSLINRKTLKVYVANVGDSRCVLCRNGEAVDLSIDHKPEDEIESQRIAKAGGILSEDGRVNGGLNLSRSLGDHSYKKNKEIEMKDQMISAFPDIQTIDLKPHEDEFLVLACDGIWNTFSSQQLVEFVSKRTPTMSATD-----IISEIFSHCLAPNTSGDGTGCDNMTCIIITFKFPSPISICNGKSNKRRAATKELDEESIPTAKLIKTQ 1473
            C P     +  PG DSG+TAV++LI  K L   VAN GDSRCV+   G+A+D+S DHKPEDE+E  RI  AGG ++ DGRVNGGLNLSR++GDH YK+NK +  ++QMISA PD++ + L   + EF+V+ACDGIWN  SSQ++++FVS+R  T S  +     II E+  HCLAP+TSGDGTGCDNMTC+I+TF   S  ++  G   K+R   +   EE+   +K  KT+
Sbjct:  312 CLPGMDG-KEEPGSDSGTTAVVALIRGKQL--IVANAGDSRCVVSEKGKALDMSYDHKPEDELELARIKNAGGKVTMDGRVNGGLNLSRAIGDHFYKRNKALPAEEQMISALPDVKVLTLN-DDHEFMVIACDGIWNVMSSQEVIDFVSERMKTESGKNNPLSAIIDELLDHCLAPDTSGDGTGCDNMTCMIVTFSPRSGSNVAEG--TKKRKPEETAVEENGNDSKKPKTE 537          

HSP 2 Score: 108.227 bits (269), Expect = 1.290e-24
Identity = 56/130 (43.08%), Postives = 75/130 (57.69%), Query Frame = 1
Query:   58 MGAYLSKPVTDKELESGEDAFLSYASGSMQGWRTSQEDAHNCILDFSSDYSLFAVYDGHGGPEVAQLCSQKLPDHIKNSVDFINGNYNDSLTNSFLSFDEAILSPEM-----------QEALKKLANIDD 414
            MGAYLS+P T+K   +G    L+Y   +MQGWR S EDAHNCI +   + ++FAVYDGHGG EVA  CS+ LP  IK    +  G    +L ++FL  D  I + E+           QE  +K+A+ DD
Sbjct:    1 MGAYLSQPNTEKSTGNGGSKNLNYGFSAMQGWRVSMEDAHNCIPELDDETAMFAVYDGHGGEEVALYCSKYLPGIIKEQKTYKEGKLQKALEDAFLDIDARITTEEVIKELVQIAGRPQEETEKVADEDD 130          
BLAST of Protein phosphatase 1G vs. Ensembl Zebrafish
Match: ppm1g (protein phosphatase, Mg2+/Mn2+ dependent, 1G [Source:ZFIN;Acc:ZDB-GENE-030425-4])

HSP 1 Score: 198.749 bits (504), Expect = 8.305e-57
Identity = 98/181 (54.14%), Postives = 129/181 (71.27%), Query Frame = 1
Query:  793 CFPPFQYLRNAPGFDSGSTAVLSLINRKTLKVYVANVGDSRCVLCRNGEAVDLSIDHKPEDEIESQRIAKAGGILSEDGRVNGGLNLSRSLGDHSYKKNKEIEMKDQMISAFPDIQTIDLKPHEDEFLVLACDGIWNTFSSQQLVEFVSKRTPTMSATD-----IISEIFSHCLAPNTSGD 1320
            C P     +  PG DSG+TAV++LI  K L   VAN GDSRCV+   G+A+D+S DHKPEDE+E  RI  AGG ++ DGRVNGGLNLSR++GDH YK+NK +  ++QMISA PD++ + L   + EF+V+ACDGIWN  SSQ++++FVS+R  T S  +     II E+  HCLAP+TSGD
Sbjct:  312 CLPGMDG-KEEPGSDSGTTAVVALIRGKQL--IVANAGDSRCVVSEKGKALDMSYDHKPEDELELARIKNAGGKVTMDGRVNGGLNLSRAIGDHFYKRNKALPAEEQMISALPDVKVLTLN-DDHEFMVIACDGIWNVMSSQEVIDFVSERMKTESGKNNPLSAIIDELLDHCLAPDTSGD 488          

HSP 2 Score: 107.842 bits (268), Expect = 1.743e-24
Identity = 56/130 (43.08%), Postives = 75/130 (57.69%), Query Frame = 1
Query:   58 MGAYLSKPVTDKELESGEDAFLSYASGSMQGWRTSQEDAHNCILDFSSDYSLFAVYDGHGGPEVAQLCSQKLPDHIKNSVDFINGNYNDSLTNSFLSFDEAILSPEM-----------QEALKKLANIDD 414
            MGAYLS+P T+K   +G    L+Y   +MQGWR S EDAHNCI +   + ++FAVYDGHGG EVA  CS+ LP  IK    +  G    +L ++FL  D  I + E+           QE  +K+A+ DD
Sbjct:    1 MGAYLSQPNTEKSTGNGGSKNLNYGFSAMQGWRVSMEDAHNCIPELDDETAMFAVYDGHGGEEVALYCSKYLPGIIKEQKTYKEGKLQKALEDAFLDIDARITTEEVIKELVQIAGRPQEETEKVADEDD 130          
BLAST of Protein phosphatase 1G vs. Ensembl Zebrafish
Match: ppm1lb (protein phosphatase, Mg2+/Mn2+ dependent, 1Lb [Source:ZFIN;Acc:ZDB-GENE-060929-136])

HSP 1 Score: 120.939 bits (302), Expect = 6.427e-30
Identity = 74/183 (40.44%), Postives = 109/183 (59.56%), Query Frame = 1
Query:  835 DSGSTAVLSLINRKTLKVYVANVGDSRCVLC-RNGEAVDLSIDHKPEDEIESQRIAKAGGILSEDG--RVNGGLNLSRSLGDHSYKKNKEIEMKDQMISAFPDIQTIDLKPHEDEFLVLACDGIWNTFSSQQLVEFVSKRT--PTMSATDIISEIFSHCLAPNTSGDGTGC-DNMTCIIITFK 1365
            ++G+T +++L++ K L V  ANVGDSR VLC ++G A+ LS DHKP    E +RI KAGG +S  G  RV G L++SRSLGD   KK K       ++   PD+ T DL   + +F++LA DG+W+TFS+++ V F+ +R   P   A  I+ + F             GC DN+T +++ FK
Sbjct:  179 EAGTTCLVALLSEKELTV--ANVGDSRAVLCDKDGNAIPLSHDHKPYQLKERKRIKKAGGFISFSGSWRVQGVLSMSRSLGDFPLKKLK-------VLIPDPDLMTFDLDTLQPQFMILASDGLWDTFSNEEAVHFIKERLDEPHFGAKSIVLQSFYR-----------GCPDNITVMVVKFK 341          
BLAST of Protein phosphatase 1G vs. Ensembl Zebrafish
Match: ppm1la (protein phosphatase, Mg2+/Mn2+ dependent, 1La [Source:ZFIN;Acc:ZDB-GENE-061103-118])

HSP 1 Score: 117.857 bits (294), Expect = 9.547e-29
Identity = 75/183 (40.98%), Postives = 109/183 (59.56%), Query Frame = 1
Query:  835 DSGSTAVLSLINRKTLKVYVANVGDSRCVLC-RNGEAVDLSIDHKPEDEIESQRIAKAGGILSEDG--RVNGGLNLSRSLGDHSYKKNKEIEMKDQMISAFPDIQTIDLKPHEDEFLVLACDGIWNTFSSQQLVEFVSKRT--PTMSATDIISEIFSHCLAPNTSGDGTGC-DNMTCIIITFK 1365
            ++G+T +++L++ + L V  ANVGDSR VLC ++G AV LS DHKP    E +RI +AGG +S +G  RV G L +SRSLGD+  K N  + + D      PDI T DL   + EF++LA DG+W+ FS+++ V FV +R   P   A  I+ + F             GC DN+T +++ FK
Sbjct:  190 EAGTTCLIALLSDRELTV--ANVGDSRGVLCDKDGNAVALSHDHKPYQLKERKRIKRAGGFISFNGSWRVQGILAMSRSLGDYPLK-NLNVVIPD------PDILTFDLDKLQPEFMILASDGLWDAFSNEEAVRFVRERLDEPHFGAKSIVLQSFYR-----------GCPDNITVMVVKFK 352          
BLAST of Protein phosphatase 1G vs. Ensembl Zebrafish
Match: ppm1nb (protein phosphatase, Mg2+/Mn2+ dependent, 1Nb (putative) [Source:ZFIN;Acc:ZDB-GENE-071004-34])

HSP 1 Score: 117.472 bits (293), Expect = 3.720e-28
Identity = 68/179 (37.99%), Postives = 101/179 (56.42%), Query Frame = 1
Query:  829 GFDSGSTAVLSLINRKTLKVYVANVGDSRCVLCRNGEAVDLSIDHKPEDEIESQRIAKAGGILSEDGRVNGGLNLSRSLGDHSYKKNKEIEMKDQMISAFPDIQTIDLKPHEDEFLVLACDGIWNTFSSQQLVEFVSKRTPTMS-ATDIISEIFSHCLAPNTSGDGTGCDNMTCIIITF 1362
            G++ G T V+S        +Y  N GDSR VLCR G     + DHKP    E +RI  AGG ++   RVNG L +SR+LGD SYK  +   + +QM+S  P++  ++  P  DEFLVLACDG+W+T S+++L  FV  R    +   ++ S++   CL   +       DN++ I++ F
Sbjct:  172 GWERGGTTVVSTAITPH-HIYFVNCGDSRAVLCRAGRVAFSTEDHKPFSPGEKERIESAGGSVTLQ-RVNGSLAVSRALGDFSYKTVEWRSVTEQMVSPEPEVSVVERSP-ADEFLVLACDGVWDTVSNEELCAFVHSRLRICTDLREVCSQVIDLCLYKGS------LDNISIILVCF 341          

HSP 2 Score: 78.1814 bits (191), Expect = 4.882e-15
Identity = 38/77 (49.35%), Postives = 48/77 (62.34%), Query Frame = 1
Query:   67 YLSKPVTDKELESGEDAF-LSYASGSMQGWRTSQEDAHNCILDFS---SDYSLFAVYDGHGGPEVAQLCSQKLPDHI 285
            YL +PV DK ++ G  ++ L+YA  SMQGWR   ED HNC        S ++ FAV+DGH G  VAQ CS+ L DHI
Sbjct:   58 YLDRPVLDKHMQEGCASWGLTYALASMQGWRAHMEDFHNCFPQLGGELSHWAFFAVFDGHAGSAVAQNCSRNLLDHI 134          
BLAST of Protein phosphatase 1G vs. Ensembl Xenopus
Match: ppm1g (protein phosphatase, Mg2+/Mn2+ dependent 1G [Source:NCBI gene;Acc:548557])

HSP 1 Score: 228.794 bits (582), Expect = 8.435e-68
Identity = 117/219 (53.42%), Postives = 150/219 (68.49%), Query Frame = 1
Query:  802 PFQYLRNAPGFDSGSTAVLSLINRKTLKVYVANVGDSRCVLCRNGEAVDLSIDHKPEDEIESQRIAKAGGILSEDGRVNGGLNLSRSLGDHSYKKNKEIEMKDQMISAFPDIQTIDLKPHEDEFLVLACDGIWNTFSSQQLVEFVS-------KRTPTMSATDIISEIFSHCLAPNTSGDGTGCDNMTCIIITFKFPSPISICNGKSNKRRAATKELDE 1437
            P    +  PG DSG+TAV++LI  K L   VAN GDSRCV+   G+A+D+S DHKPEDE+E  RI  AGG ++ DGRVNGGLNLSR++GDH YK+NK +  ++QMISA PDI+ + L   E EF+VLACDGIWN  SSQ++V+FV        ++  T+S T I+ E+   CLAP+TSGDGTGCDNMTCIII F+   P S    ++ KR+    E  E
Sbjct:  308 PGMAGKEEPGSDSGTTAVVALIRGKQL--IVANAGDSRCVVSEGGKALDMSYDHKPEDELELARIKNAGGKVTMDGRVNGGLNLSRAIGDHFYKRNKNLPPEEQMISALPDIKVVTLS-EEHEFMVLACDGIWNVMSSQEVVDFVHEKIESQLQKGETLSLTSIVEELLDQCLAPDTSGDGTGCDNMTCIIIDFRPHCPPSA--PEAAKRKVENAEESE 521          

HSP 2 Score: 72.7886 bits (177), Expect = 5.836e-13
Identity = 31/79 (39.24%), Postives = 53/79 (67.09%), Query Frame = 1
Query:  166 EDAHNCILDFSSDYSLFAVYDGHGGPEVAQLCSQKLPDHIKNSVDFINGNYNDSLTNSFLSFDEAILSPEMQEALKKLA 402
            +DAHNCI +  S+ ++F+VYDGHGG EVA  C++ LP+ IK+   + +G    +L ++FL+ D+ +   E+ + L ++A
Sbjct:   20 QDAHNCIPELDSETAMFSVYDGHGGEEVALYCAKYLPEVIKSQKAYKDGKLQKALEDAFLAIDQKLTQEEVIKELAQMA 98          
BLAST of Protein phosphatase 1G vs. Ensembl Xenopus
Match: ppm1g (protein phosphatase, Mg2+/Mn2+ dependent 1G [Source:NCBI gene;Acc:548557])

HSP 1 Score: 229.18 bits (583), Expect = 9.302e-68
Identity = 113/201 (56.22%), Postives = 143/201 (71.14%), Query Frame = 1
Query:  802 PFQYLRNAPGFDSGSTAVLSLINRKTLKVYVANVGDSRCVLCRNGEAVDLSIDHKPEDEIESQRIAKAGGILSEDGRVNGGLNLSRSLGDHSYKKNKEIEMKDQMISAFPDIQTIDLKPHEDEFLVLACDGIWNTFSSQQLVEFVS-------KRTPTMSATDIISEIFSHCLAPNTSGDGTGCDNMTCIIITFKFPSPIS 1383
            P    +  PG DSG+TAV++LI  K L   VAN GDSRCV+   G+A+D+S DHKPEDE+E  RI  AGG ++ DGRVNGGLNLSR++GDH YK+NK +  ++QMISA PDI+ + L   E EF+VLACDGIWN  SSQ++V+FV        ++  T+S T I+ E+   CLAP+TSGDGTGCDNMTCIII F+   P S
Sbjct:  325 PGMAGKEEPGSDSGTTAVVALIRGKQL--IVANAGDSRCVVSEGGKALDMSYDHKPEDELELARIKNAGGKVTMDGRVNGGLNLSRAIGDHFYKRNKNLPPEEQMISALPDIKVVTLS-EEHEFMVLACDGIWNVMSSQEVVDFVHEKIESQLQKGETLSLTSIVEELLDQCLAPDTSGDGTGCDNMTCIIIDFRPHCPPS 522          

HSP 2 Score: 112.079 bits (279), Expect = 1.153e-25
Identity = 52/116 (44.83%), Postives = 75/116 (64.66%), Query Frame = 1
Query:   58 MGAYLSKPVTDKELESGEDAFLSYASGSMQGWRTSQEDAHNCILDFSSDYSLFAVYDGHGGPEVAQLCSQKLPDHIKNSVDFINGNYNDSLTNSFLSFDEAILSPEMQEALKKLAN 405
            MGAYLS+P TDK    G    LSY   +MQGWR S EDAHNCI +  S+ ++F+VYDGHGG EVA  C++ LP+ IK+   + +G    +L ++FL+ D+ +   E+ + L ++A 
Sbjct:    1 MGAYLSQPNTDKSSGQGGGHRLSYGYSAMQGWRVSMEDAHNCIPELDSETAMFSVYDGHGGEEVALYCAKYLPEVIKSQKAYKDGKLQKALEDAFLAIDQKLTQEEVIKELAQMAG 116          
BLAST of Protein phosphatase 1G vs. Ensembl Xenopus
Match: ppm1g (protein phosphatase, Mg2+/Mn2+ dependent 1G [Source:NCBI gene;Acc:548557])

HSP 1 Score: 219.935 bits (559), Expect = 1.711e-64
Identity = 112/206 (54.37%), Postives = 144/206 (69.90%), Query Frame = 1
Query:  841 GSTAVLSLINRKTLKVYVANVGDSRCVLCRNGEAVDLSIDHKPEDEIESQRIAKAGGILSEDGRVNGGLNLSRSLGDHSYKKNKEIEMKDQMISAFPDIQTIDLKPHEDEFLVLACDGIWNTFSSQQLVEFVS-------KRTPTMSATDIISEIFSHCLAPNTSGDGTGCDNMTCIIITFKFPSPISICNGKSNKRRAATKELDE 1437
            G+TAV++LI  K L   VAN GDSRCV+   G+A+D+S DHKPEDE+E  RI  AGG ++ DGRVNGGLNLSR++GDH YK+NK +  ++QMISA PDI+ + L   E EF+VLACDGIWN  SSQ++V+FV        ++  T+S T I+ E+   CLAP+TSGDGTGCDNMTCIII F+   P S    ++ KR+    E  E
Sbjct:  316 GTTAVVALIRGKQL--IVANAGDSRCVVSEGGKALDMSYDHKPEDELELARIKNAGGKVTMDGRVNGGLNLSRAIGDHFYKRNKNLPPEEQMISALPDIKVVTLS-EEHEFMVLACDGIWNVMSSQEVVDFVHEKIESQLQKGETLSLTSIVEELLDQCLAPDTSGDGTGCDNMTCIIIDFRPHCPPSA--PEAAKRKVENAEESE 516          

HSP 2 Score: 111.694 bits (278), Expect = 1.093e-25
Identity = 52/115 (45.22%), Postives = 75/115 (65.22%), Query Frame = 1
Query:   58 MGAYLSKPVTDKELESGEDAFLSYASGSMQGWRTSQEDAHNCILDFSSDYSLFAVYDGHGGPEVAQLCSQKLPDHIKNSVDFINGNYNDSLTNSFLSFDEAILSPEMQEALKKLA 402
            MGAYLS+P TDK    G    LSY   +MQGWR S EDAHNCI +  S+ ++F+VYDGHGG EVA  C++ LP+ IK+   + +G    +L ++FL+ D+ +   E+ + L ++A
Sbjct:    1 MGAYLSQPNTDKSSGQGGGHRLSYGYSAMQGWRVSMEDAHNCIPELDSETAMFSVYDGHGGEEVALYCAKYLPEVIKSQKAYKDGKLQKALEDAFLAIDQKLTQEEVIKELAQMA 115          
BLAST of Protein phosphatase 1G vs. Ensembl Xenopus
Match: ppm1g (protein phosphatase, Mg2+/Mn2+ dependent 1G [Source:NCBI gene;Acc:548557])

HSP 1 Score: 215.312 bits (547), Expect = 6.145e-63
Identity = 111/212 (52.36%), Postives = 144/212 (67.92%), Query Frame = 1
Query:  802 PFQYLRNAPGFDSGSTAVLSLINRKTLKVYVANVGDSRCVLCRNGEAVDLSIDHKPEDEIESQRIAKAGGILSEDGRVNGGLNLSRSLGDHSYKKNKEIEMKDQMISAFPDIQTIDLKPHEDEFLVLACDGIWNTFSSQQLVEFVSKRTPTMSATDIISEIFSHCLAPNTSGDGTGCDNMTCIIITFKFPSPISICNGKSNKRRAATKELDE 1437
            P    +  PG DSG+TAV++LI  K L   VAN GDSRCV+   G+A+D+S DHKPEDE+E  RI  AGG ++ DGRVNGGLNLSR++GDH YK+NK +  ++QMISA PDI+ + L   E EF+VLACDGIWN  SSQ++V+F       + +  +  ++   CLAP+TSGDGTGCDNMTCIII F+   P S    ++ KR+    E  E
Sbjct:  309 PGMAGKEEPGSDSGTTAVVALIRGKQL--IVANAGDSRCVVSEGGKALDMSYDHKPEDELELARIKNAGGKVTMDGRVNGGLNLSRAIGDHFYKRNKNLPPEEQMISALPDIKVVTLS-EEHEFMVLACDGIWNVMSSQEVVDFS-----LLISALLPPQLLDQCLAPDTSGDGTGCDNMTCIIIDFRPHCPPSA--PEAAKRKVENAEESE 510          

HSP 2 Score: 111.694 bits (278), Expect = 1.267e-25
Identity = 52/116 (44.83%), Postives = 75/116 (64.66%), Query Frame = 1
Query:   58 MGAYLSKPVTDKELESGEDAFLSYASGSMQGWRTSQEDAHNCILDFSSDYSLFAVYDGHGGPEVAQLCSQKLPDHIKNSVDFINGNYNDSLTNSFLSFDEAILSPEMQEALKKLAN 405
            MGAYLS+P TDK    G    LSY   +MQGWR S EDAHNCI +  S+ ++F+VYDGHGG EVA  C++ LP+ IK+   + +G    +L ++FL+ D+ +   E+ + L ++A 
Sbjct:    1 MGAYLSQPNTDKSSGQGGGHRLSYGYSAMQGWRVSMEDAHNCIPELDSETAMFSVYDGHGGEEVALYCAKYLPEVIKSQKAYKDGKLQKALEDAFLAIDQKLTQEEVIKELAQMAG 116          
BLAST of Protein phosphatase 1G vs. Ensembl Xenopus
Match: ppm1g (protein phosphatase, Mg2+/Mn2+ dependent 1G [Source:NCBI gene;Acc:548557])

HSP 1 Score: 181.03 bits (458), Expect = 4.074e-50
Identity = 91/172 (52.91%), Postives = 119/172 (69.19%), Query Frame = 1
Query:  802 PFQYLRNAPGFDSGSTAVLSLINRKTLKVYVANVGDSRCVLCRNGEAVDLSIDHKPEDEIESQRIAKAGGILSEDGRVNGGLNLSRSLGDHSYKKNKEIEMKDQMISAFPDIQTIDLKPHEDEFLVLACDGIWNTFSSQQLVEFVS-------KRTPTMSATDIISEIFSHC 1296
            P    +  PG DSG+TAV++LI  K L   VAN GDSRCV+   G+A+D+S DHKPEDE+E  RI  AGG ++ DGRVNGGLNLSR++GDH YK+NK +  ++QMISA PDI+ + L   E EF+VLACDGIWN  SSQ++V+FV        ++  T+S T I+ E+   C
Sbjct:  325 PGMAGKEEPGSDSGTTAVVALIRGKQL--IVANAGDSRCVVSEGGKALDMSYDHKPEDELELARIKNAGGKVTMDGRVNGGLNLSRAIGDHFYKRNKNLPPEEQMISALPDIKVVTLS-EEHEFMVLACDGIWNVMSSQEVVDFVHEKIESQLQKGETLSLTSIVEEVSDGC 493          

HSP 2 Score: 112.079 bits (279), Expect = 1.009e-25
Identity = 52/116 (44.83%), Postives = 75/116 (64.66%), Query Frame = 1
Query:   58 MGAYLSKPVTDKELESGEDAFLSYASGSMQGWRTSQEDAHNCILDFSSDYSLFAVYDGHGGPEVAQLCSQKLPDHIKNSVDFINGNYNDSLTNSFLSFDEAILSPEMQEALKKLAN 405
            MGAYLS+P TDK    G    LSY   +MQGWR S EDAHNCI +  S+ ++F+VYDGHGG EVA  C++ LP+ IK+   + +G    +L ++FL+ D+ +   E+ + L ++A 
Sbjct:    1 MGAYLSQPNTDKSSGQGGGHRLSYGYSAMQGWRVSMEDAHNCIPELDSETAMFSVYDGHGGEEVALYCAKYLPEVIKSQKAYKDGKLQKALEDAFLAIDQKLTQEEVIKELAQMAG 116          
BLAST of Protein phosphatase 1G vs. Ensembl Mouse
Match: Ppm1g (protein phosphatase 1G (formerly 2C), magnesium-dependent, gamma isoform [Source:MGI Symbol;Acc:MGI:106065])

HSP 1 Score: 219.164 bits (557), Expect = 2.787e-65
Identity = 109/211 (51.66%), Postives = 145/211 (68.72%), Query Frame = 1
Query:  802 PFQYLRNAPGFDSGSTAVLSLINRKTLKVYVANVGDSRCVLCRNGEAVDLSIDHKPEDEIESQRIAKAGGILSEDGRVNGGLNLSRSLGDHSYKKNKEIEMKDQMISAFPDIQTIDLKPHEDEFLVLACDGIWNTFSSQQLVEFVSKRTPTMSA-------TDIISEIFSHCLAPNTSGDGTGCDNMTCIIITFKFPSPISICNGKSNKRR 1413
            P    +  PG DSG+TAV++LI  K L   VAN GDSRCV+   G+A+D+S DHKPEDE+E  RI  AGG ++ DGRVNGGLNLSR++GDH YK+NK +  ++QMISA PDI+ + L   + EF+V+ACDGIWN  SSQ++V+F+  +             + I+ E+   CLAP+TSGDGTGCDNMTCIII FK  + + +   +S KR+
Sbjct:  205 PGMEGKEEPGSDSGTTAVVALIRGKQL--IVANAGDSRCVVSEAGKALDMSYDHKPEDEVELARIKNAGGKVTMDGRVNGGLNLSRAIGDHFYKRNKNLPPQEQMISALPDIKVLTLT-DDHEFMVIACDGIWNVMSSQEVVDFIQSKISQRDENGELRLLSSIVEELLDQCLAPDTSGDGTGCDNMTCIIICFKPRNTVEL-QAESGKRK 411          

HSP 2 Score: 100.908 bits (250), Expect = 1.686e-22
Identity = 53/120 (44.17%), Postives = 74/120 (61.67%), Query Frame = 1
Query:   58 MGAYLSKPVTDKELESGEDAF---LSYASGSMQGWRTSQEDAHNCILDFSSDYSLFAVYDGHGGPEVAQLCSQKLPDHIKNSVDFINGNYNDSLTNSFLSFDEAILSPEMQEALKKLANI 408
            MGAYLS+P T K    G  A    L Y   +MQGWR S EDAHNCI +  ++ ++F+VYDGHGG EVA  C++ LPD IK+   +  G    +L ++FL+ D  + +   +E +K+LA I
Sbjct:    1 MGAYLSQPNTVKCSGDGVGAPRLPLPYGFSAMQGWRVSMEDAHNCIPELDNETAMFSVYDGHGGEEVALYCAKYLPDIIKDQKAYKEGKLQKALQDAFLAIDAKLTT---EEVIKELAQI 117          
BLAST of Protein phosphatase 1G vs. Ensembl Mouse
Match: Ppm1g (protein phosphatase 1G (formerly 2C), magnesium-dependent, gamma isoform [Source:MGI Symbol;Acc:MGI:106065])

HSP 1 Score: 218.779 bits (556), Expect = 4.004e-64
Identity = 109/211 (51.66%), Postives = 145/211 (68.72%), Query Frame = 1
Query:  802 PFQYLRNAPGFDSGSTAVLSLINRKTLKVYVANVGDSRCVLCRNGEAVDLSIDHKPEDEIESQRIAKAGGILSEDGRVNGGLNLSRSLGDHSYKKNKEIEMKDQMISAFPDIQTIDLKPHEDEFLVLACDGIWNTFSSQQLVEFVSKRTPTMSA-------TDIISEIFSHCLAPNTSGDGTGCDNMTCIIITFKFPSPISICNGKSNKRR 1413
            P    +  PG DSG+TAV++LI  K L   VAN GDSRCV+   G+A+D+S DHKPEDE+E  RI  AGG ++ DGRVNGGLNLSR++GDH YK+NK +  ++QMISA PDI+ + L   + EF+V+ACDGIWN  SSQ++V+F+  +             + I+ E+   CLAP+TSGDGTGCDNMTCIII FK  + + +   +S KR+
Sbjct:  312 PGMEGKEEPGSDSGTTAVVALIRGKQL--IVANAGDSRCVVSEAGKALDMSYDHKPEDEVELARIKNAGGKVTMDGRVNGGLNLSRAIGDHFYKRNKNLPPQEQMISALPDIKVLTLT-DDHEFMVIACDGIWNVMSSQEVVDFIQSKISQRDENGELRLLSSIVEELLDQCLAPDTSGDGTGCDNMTCIIICFKPRNTVEL-QAESGKRK 518          

HSP 2 Score: 100.908 bits (250), Expect = 4.147e-22
Identity = 53/120 (44.17%), Postives = 74/120 (61.67%), Query Frame = 1
Query:   58 MGAYLSKPVTDKELESGEDAF---LSYASGSMQGWRTSQEDAHNCILDFSSDYSLFAVYDGHGGPEVAQLCSQKLPDHIKNSVDFINGNYNDSLTNSFLSFDEAILSPEMQEALKKLANI 408
            MGAYLS+P T K    G  A    L Y   +MQGWR S EDAHNCI +  ++ ++F+VYDGHGG EVA  C++ LPD IK+   +  G    +L ++FL+ D  + +   +E +K+LA I
Sbjct:    1 MGAYLSQPNTVKCSGDGVGAPRLPLPYGFSAMQGWRVSMEDAHNCIPELDNETAMFSVYDGHGGEEVALYCAKYLPDIIKDQKAYKEGKLQKALQDAFLAIDAKLTT---EEVIKELAQI 117          
BLAST of Protein phosphatase 1G vs. Ensembl Mouse
Match: Ppm1b (protein phosphatase 1B, magnesium dependent, beta isoform [Source:MGI Symbol;Acc:MGI:101841])

HSP 1 Score: 119.013 bits (297), Expect = 8.027e-29
Identity = 75/195 (38.46%), Postives = 110/195 (56.41%), Query Frame = 1
Query:  805 FQYLRNAPGFD-SGSTAVLSLINRKTLKVYVANVGDSRCVLCRNGEAVDLSIDHKPEDEIESQRIAKAGGILSEDGRVNGGLNLSRSLGDHSYKKNKEIEMKDQMISAFPDIQTIDLKPHEDEFLVLACDGIWNTFSSQQLVEFVSKRTPTM-SATDIISEIFSHCLAPNTSGDGTGCDNMTCIIITFKFPSPIS 1383
            F  LRN  G D SGSTAV  +++     +Y  N GDSR VLCRNG+    + DHKP + +E +RI  AGG +    RVNG L +SR+LGD+ YK        +Q++S  P++  I ++  EDEF+VLACDGIW+  S+++L EFV  R        ++ + +   CL   +       DNM+ +++ F     +S
Sbjct:  120 FSDLRN--GMDRSGSTAVGVMVS--PTHMYFINCGDSRAVLCRNGQVCFSTQDHKPCNPVEKERIQNAGGSVMIQ-RVNGSLAVSRALGDYDYKCVDGKGPTEQLVSPEPEVYEI-VRAEEDEFVVLACDGIWDVMSNEELCEFVKSRLEVSDDLENVCNWVVDTCLHKGSR------DNMSVVLVCFSNAPKVS 302          

HSP 2 Score: 79.337 bits (194), Expect = 1.796e-15
Identity = 39/85 (45.88%), Postives = 47/85 (55.29%), Query Frame = 1
Query:   58 MGAYLSKPVTDKELESGEDAFLSYASGSMQGWRTSQEDAHNCILDFSS---DYSLFAVYDGHGGPEVAQLCSQKLPDHIKNSVDF 303
            MGA+L KP T+K    G    L Y   SMQGWR   EDAH  ++       ++S FAVYDGH G  VA  CS  L +HI  + DF
Sbjct:    1 MGAFLDKPKTEKHNAHGAGNGLRYGLSSMQGWRVEMEDAHTAVVGIPHGLDNWSFFAVYDGHAGSRVANYCSTHLLEHITTNEDF 85          
BLAST of Protein phosphatase 1G vs. Ensembl Mouse
Match: Ppm1b (protein phosphatase 1B, magnesium dependent, beta isoform [Source:MGI Symbol;Acc:MGI:101841])

HSP 1 Score: 119.013 bits (297), Expect = 8.264e-29
Identity = 75/195 (38.46%), Postives = 110/195 (56.41%), Query Frame = 1
Query:  805 FQYLRNAPGFD-SGSTAVLSLINRKTLKVYVANVGDSRCVLCRNGEAVDLSIDHKPEDEIESQRIAKAGGILSEDGRVNGGLNLSRSLGDHSYKKNKEIEMKDQMISAFPDIQTIDLKPHEDEFLVLACDGIWNTFSSQQLVEFVSKRTPTM-SATDIISEIFSHCLAPNTSGDGTGCDNMTCIIITFKFPSPIS 1383
            F  LRN  G D SGSTAV  +++     +Y  N GDSR VLCRNG+    + DHKP + +E +RI  AGG +    RVNG L +SR+LGD+ YK        +Q++S  P++  I ++  EDEF+VLACDGIW+  S+++L EFV  R        ++ + +   CL   +       DNM+ +++ F     +S
Sbjct:  120 FSDLRN--GMDRSGSTAVGVMVS--PTHMYFINCGDSRAVLCRNGQVCFSTQDHKPCNPVEKERIQNAGGSVMIQ-RVNGSLAVSRALGDYDYKCVDGKGPTEQLVSPEPEVYEI-VRAEEDEFVVLACDGIWDVMSNEELCEFVKSRLEVSDDLENVCNWVVDTCLHKGSR------DNMSVVLVCFSNAPKVS 302          

HSP 2 Score: 79.337 bits (194), Expect = 1.748e-15
Identity = 39/85 (45.88%), Postives = 47/85 (55.29%), Query Frame = 1
Query:   58 MGAYLSKPVTDKELESGEDAFLSYASGSMQGWRTSQEDAHNCILDFSS---DYSLFAVYDGHGGPEVAQLCSQKLPDHIKNSVDF 303
            MGA+L KP T+K    G    L Y   SMQGWR   EDAH  ++       ++S FAVYDGH G  VA  CS  L +HI  + DF
Sbjct:    1 MGAFLDKPKTEKHNAHGAGNGLRYGLSSMQGWRVEMEDAHTAVVGIPHGLDNWSFFAVYDGHAGSRVANYCSTHLLEHITTNEDF 85          
BLAST of Protein phosphatase 1G vs. Ensembl Mouse
Match: Ppm1b (protein phosphatase 1B, magnesium dependent, beta isoform [Source:MGI Symbol;Acc:MGI:101841])

HSP 1 Score: 119.013 bits (297), Expect = 8.264e-29
Identity = 75/195 (38.46%), Postives = 110/195 (56.41%), Query Frame = 1
Query:  805 FQYLRNAPGFD-SGSTAVLSLINRKTLKVYVANVGDSRCVLCRNGEAVDLSIDHKPEDEIESQRIAKAGGILSEDGRVNGGLNLSRSLGDHSYKKNKEIEMKDQMISAFPDIQTIDLKPHEDEFLVLACDGIWNTFSSQQLVEFVSKRTPTM-SATDIISEIFSHCLAPNTSGDGTGCDNMTCIIITFKFPSPIS 1383
            F  LRN  G D SGSTAV  +++     +Y  N GDSR VLCRNG+    + DHKP + +E +RI  AGG +    RVNG L +SR+LGD+ YK        +Q++S  P++  I ++  EDEF+VLACDGIW+  S+++L EFV  R        ++ + +   CL   +       DNM+ +++ F     +S
Sbjct:  120 FSDLRN--GMDRSGSTAVGVMVS--PTHMYFINCGDSRAVLCRNGQVCFSTQDHKPCNPVEKERIQNAGGSVMIQ-RVNGSLAVSRALGDYDYKCVDGKGPTEQLVSPEPEVYEI-VRAEEDEFVVLACDGIWDVMSNEELCEFVKSRLEVSDDLENVCNWVVDTCLHKGSR------DNMSVVLVCFSNAPKVS 302          

HSP 2 Score: 79.337 bits (194), Expect = 1.748e-15
Identity = 39/85 (45.88%), Postives = 47/85 (55.29%), Query Frame = 1
Query:   58 MGAYLSKPVTDKELESGEDAFLSYASGSMQGWRTSQEDAHNCILDFSS---DYSLFAVYDGHGGPEVAQLCSQKLPDHIKNSVDF 303
            MGA+L KP T+K    G    L Y   SMQGWR   EDAH  ++       ++S FAVYDGH G  VA  CS  L +HI  + DF
Sbjct:    1 MGAFLDKPKTEKHNAHGAGNGLRYGLSSMQGWRVEMEDAHTAVVGIPHGLDNWSFFAVYDGHAGSRVANYCSTHLLEHITTNEDF 85          
BLAST of Protein phosphatase 1G vs. UniProt/SwissProt
Match: sp|Q7K4Q5|Y0417_DROME (Probable protein phosphatase CG10417 OS=Drosophila melanogaster OX=7227 GN=CG10417 PE=1 SV=1)

HSP 1 Score: 224.557 bits (571), Expect = 2.210e-64
Identity = 108/181 (59.67%), Postives = 138/181 (76.24%), Query Frame = 1
Query:  826 PGFDSGSTAVLSLINRKTLKVYVANVGDSRCVLCRNGEAVDLSIDHKPEDEIESQRIAKAGGILSEDGRVNGGLNLSRSLGDHSYKKNKEIEMKDQMISAFPDIQTIDLKPHEDEFLVLACDGIWNTFSSQQLVEFVSKR-TPTMSATDIISEIFSHCLAPNTSGDGTGCDNMTCIIITFK 1365
            PG DSG TAV+ L+  + L  YVAN GDSRCV+ R+G+A+++SIDHKPED+ E+ RI KAGG ++ DGRVNGGLNLSR+LGDH+YK N  +  ++QMISA PDI+ + + P EDEF+VLACDGIWN  SS+++VEFV  R       + I  E+F +CLAPNT GDGTGCDNMT +I+ FK
Sbjct:  388 PGKDSGCTAVVCLLQGRDL--YVANAGDSRCVISRSGQAIEMSIDHKPEDDEEASRIIKAGGRVTLDGRVNGGLNLSRALGDHAYKTNVTLPAEEQMISALPDIKKLIITP-EDEFMVLACDGIWNYMSSEEVVEFVRCRLKDNKKLSTICEELFDNCLAPNTMGDGTGCDNMTAVIVQFK 565          

HSP 2 Score: 124.405 bits (311), Expect = 7.934e-29
Identity = 60/115 (52.17%), Postives = 75/115 (65.22%), Query Frame = 1
Query:   58 MGAYLSKPVTDKELESGEDAFLSYASGSMQGWRTSQEDAHNCILDFSSDYSLFAVYDGHGGPEVAQLCSQKLPDHIKNSVDFINGNYNDSLTNSFLSFDEAILSPEMQEALKKLA 402
            MGAYLS P TDK      +  L+  + SMQGWR SQEDAHN IL+F ++ S FAVYDGHGG EVAQ C+ KLP  +KN   + NG +  +L  +FL FD+ +L P +   LK LA
Sbjct:    1 MGAYLSHPKTDKTSTDQFNELLAVGASSMQGWRNSQEDAHNSILNFDNNTSFFAVYDGHGGAEVAQYCADKLPHFLKNLETYKNGQFEVALKEAFLGFDKTLLDPSIVSILKILA 115          
BLAST of Protein phosphatase 1G vs. UniProt/SwissProt
Match: sp|Q4R4V2|PPM1G_MACFA (Protein phosphatase 1G OS=Macaca fascicularis OX=9541 GN=PPM1G PE=2 SV=1)

HSP 1 Score: 219.164 bits (557), Expect = 2.402e-63
Identity = 110/211 (52.13%), Postives = 144/211 (68.25%), Query Frame = 1
Query:  802 PFQYLRNAPGFDSGSTAVLSLINRKTLKVYVANVGDSRCVLCRNGEAVDLSIDHKPEDEIESQRIAKAGGILSEDGRVNGGLNLSRSLGDHSYKKNKEIEMKDQMISAFPDIQTIDLKPHEDEFLVLACDGIWNTFSSQQLVEFVSKRTPTMSA-------TDIISEIFSHCLAPNTSGDGTGCDNMTCIIITFKFPSPISICNGKSNKRR 1413
            P    +  PG DSG+TAV++LI  K L   VAN GDSRCV+   G+A+D+S DHKPEDE+E  RI  AGG ++ DGRVNGGLNLSR++GDH YK+NK +  ++QMISA PDI+ + L   + EF+V+ACDGIWN  SSQ++V+F+  +             + I+ E+   CLAP+TSGDGTGCDNMTCIII FK P   +    +S KR+
Sbjct:  316 PGMEGKEEPGSDSGTTAVVALIRGKQL--IVANAGDSRCVVSEAGKALDMSYDHKPEDEVELARIKNAGGKVTMDGRVNGGLNLSRAIGDHFYKRNKNLPPEEQMISALPDIKVLTLT-DDHEFMVIACDGIWNVMSSQEVVDFIQSKISQRDENGELRLLSSIVEELLDQCLAPDTSGDGTGCDNMTCIIICFK-PRNTAELQPESGKRK 522          

HSP 2 Score: 103.99 bits (258), Expect = 2.514e-22
Identity = 55/120 (45.83%), Postives = 75/120 (62.50%), Query Frame = 1
Query:   58 MGAYLSKPVTDKELESGEDAF---LSYASGSMQGWRTSQEDAHNCILDFSSDYSLFAVYDGHGGPEVAQLCSQKLPDHIKNSVDFINGNYNDSLTNSFLSFDEAILSPEMQEALKKLANI 408
            MGAYLS+P T K    G  A    LSY   +MQGWR S EDAHNCI +  S+ ++F+VYDGHGG EVA  C++ LPD IK+   +  G    +L ++FL+ D  + +   +E +K+LA I
Sbjct:    1 MGAYLSQPNTVKCSGDGVGAPRLPLSYGFSAMQGWRVSMEDAHNCIPELDSETAMFSVYDGHGGEEVALYCAKYLPDIIKDQKAYKEGKLQKALEDAFLAIDAKLTT---EEVIKELAQI 117          
BLAST of Protein phosphatase 1G vs. UniProt/SwissProt
Match: sp|Q61074|PPM1G_MOUSE (Protein phosphatase 1G OS=Mus musculus OX=10090 GN=Ppm1g PE=1 SV=3)

HSP 1 Score: 218.779 bits (556), Expect = 2.801e-63
Identity = 109/211 (51.66%), Postives = 145/211 (68.72%), Query Frame = 1
Query:  802 PFQYLRNAPGFDSGSTAVLSLINRKTLKVYVANVGDSRCVLCRNGEAVDLSIDHKPEDEIESQRIAKAGGILSEDGRVNGGLNLSRSLGDHSYKKNKEIEMKDQMISAFPDIQTIDLKPHEDEFLVLACDGIWNTFSSQQLVEFVSKRTPTMSA-------TDIISEIFSHCLAPNTSGDGTGCDNMTCIIITFKFPSPISICNGKSNKRR 1413
            P    +  PG DSG+TAV++LI  K L   VAN GDSRCV+   G+A+D+S DHKPEDE+E  RI  AGG ++ DGRVNGGLNLSR++GDH YK+NK +  ++QMISA PDI+ + L   + EF+V+ACDGIWN  SSQ++V+F+  +             + I+ E+   CLAP+TSGDGTGCDNMTCIII FK  + + +   +S KR+
Sbjct:  312 PGMEGKEEPGSDSGTTAVVALIRGKQL--IVANAGDSRCVVSEAGKALDMSYDHKPEDEVELARIKNAGGKVTMDGRVNGGLNLSRAIGDHFYKRNKNLPPQEQMISALPDIKVLTLT-DDHEFMVIACDGIWNVMSSQEVVDFIQSKISQRDENGELRLLSSIVEELLDQCLAPDTSGDGTGCDNMTCIIICFKPRNTVEL-QAESGKRK 518          

HSP 2 Score: 100.908 bits (250), Expect = 2.901e-21
Identity = 53/120 (44.17%), Postives = 74/120 (61.67%), Query Frame = 1
Query:   58 MGAYLSKPVTDKELESGEDAF---LSYASGSMQGWRTSQEDAHNCILDFSSDYSLFAVYDGHGGPEVAQLCSQKLPDHIKNSVDFINGNYNDSLTNSFLSFDEAILSPEMQEALKKLANI 408
            MGAYLS+P T K    G  A    L Y   +MQGWR S EDAHNCI +  ++ ++F+VYDGHGG EVA  C++ LPD IK+   +  G    +L ++FL+ D  + +   +E +K+LA I
Sbjct:    1 MGAYLSQPNTVKCSGDGVGAPRLPLPYGFSAMQGWRVSMEDAHNCIPELDNETAMFSVYDGHGGEEVALYCAKYLPDIIKDQKAYKEGKLQKALQDAFLAIDAKLTT---EEVIKELAQI 117          
BLAST of Protein phosphatase 1G vs. UniProt/SwissProt
Match: sp|O15355|PPM1G_HUMAN (Protein phosphatase 1G OS=Homo sapiens OX=9606 GN=PPM1G PE=1 SV=1)

HSP 1 Score: 218.779 bits (556), Expect = 2.957e-63
Identity = 110/211 (52.13%), Postives = 144/211 (68.25%), Query Frame = 1
Query:  802 PFQYLRNAPGFDSGSTAVLSLINRKTLKVYVANVGDSRCVLCRNGEAVDLSIDHKPEDEIESQRIAKAGGILSEDGRVNGGLNLSRSLGDHSYKKNKEIEMKDQMISAFPDIQTIDLKPHEDEFLVLACDGIWNTFSSQQLVEFVSKRTPTMSA-------TDIISEIFSHCLAPNTSGDGTGCDNMTCIIITFKFPSPISICNGKSNKRR 1413
            P    +  PG DSG+TAV++LI  K L   VAN GDSRCV+   G+A+D+S DHKPEDE+E  RI  AGG ++ DGRVNGGLNLSR++GDH YK+NK +  ++QMISA PDI+ + L   + EF+V+ACDGIWN  SSQ++V+F+  +             + I+ E+   CLAP+TSGDGTGCDNMTCIII FK P   +    +S KR+
Sbjct:  315 PGMEGKEEPGSDSGTTAVVALIRGKQL--IVANAGDSRCVVSEAGKALDMSYDHKPEDEVELARIKNAGGKVTMDGRVNGGLNLSRAIGDHFYKRNKNLPPEEQMISALPDIKVLTLT-DDHEFMVIACDGIWNVMSSQEVVDFIQSKISQRDENGELRLLSSIVEELLDQCLAPDTSGDGTGCDNMTCIIICFK-PRNTAELQPESGKRK 521          

HSP 2 Score: 102.064 bits (253), Expect = 9.947e-22
Identity = 54/120 (45.00%), Postives = 74/120 (61.67%), Query Frame = 1
Query:   58 MGAYLSKPVTDKELESGEDAF---LSYASGSMQGWRTSQEDAHNCILDFSSDYSLFAVYDGHGGPEVAQLCSQKLPDHIKNSVDFINGNYNDSLTNSFLSFDEAILSPEMQEALKKLANI 408
            MGAYLS+P T K    G  A    L Y   +MQGWR S EDAHNCI +  S+ ++F+VYDGHGG EVA  C++ LPD IK+   +  G    +L ++FL+ D  + +   +E +K+LA I
Sbjct:    1 MGAYLSQPNTVKCSGDGVGAPRLPLPYGFSAMQGWRVSMEDAHNCIPELDSETAMFSVYDGHGGEEVALYCAKYLPDIIKDQKAYKEGKLQKALEDAFLAIDAKLTT---EEVIKELAQI 117          
BLAST of Protein phosphatase 1G vs. UniProt/SwissProt
Match: sp|P79126|PPM1G_BOVIN (Protein phosphatase 1G OS=Bos taurus OX=9913 GN=PPM1G PE=2 SV=2)

HSP 1 Score: 218.394 bits (555), Expect = 3.952e-63
Identity = 109/211 (51.66%), Postives = 144/211 (68.25%), Query Frame = 1
Query:  802 PFQYLRNAPGFDSGSTAVLSLINRKTLKVYVANVGDSRCVLCRNGEAVDLSIDHKPEDEIESQRIAKAGGILSEDGRVNGGLNLSRSLGDHSYKKNKEIEMKDQMISAFPDIQTIDLKPHEDEFLVLACDGIWNTFSSQQLVEFVSKRTPTMSA-------TDIISEIFSHCLAPNTSGDGTGCDNMTCIIITFKFPSPISICNGKSNKRR 1413
            P    +  PG DSG+TAV++LI  K L   VAN GDSRCV+   G+A+D+S DHKPEDE+E  RI  AGG ++ DGRVNGGLNLSR++GDH YK+NK +  ++QMISA PDI+ + L   + EF+V+ACDGIWN  SSQ++++F+  +             + I+ E+   CLAP+TSGDGTGCDNMTCIII FK P   +    +S KR+
Sbjct:  313 PGMEGKEEPGSDSGTTAVVALIRGKQL--IVANAGDSRCVVSEAGKALDMSYDHKPEDEVELARIKNAGGKVTMDGRVNGGLNLSRAIGDHFYKRNKNLPPEEQMISALPDIKVLTLT-DDHEFMVIACDGIWNVMSSQEVIDFIQSKISQRDENGELRLLSSIVEELLDQCLAPDTSGDGTGCDNMTCIIICFK-PRNTAAPQPESGKRK 519          

HSP 2 Score: 102.449 bits (254), Expect = 9.052e-22
Identity = 54/120 (45.00%), Postives = 74/120 (61.67%), Query Frame = 1
Query:   58 MGAYLSKPVTDKELESGEDAF---LSYASGSMQGWRTSQEDAHNCILDFSSDYSLFAVYDGHGGPEVAQLCSQKLPDHIKNSVDFINGNYNDSLTNSFLSFDEAILSPEMQEALKKLANI 408
            MGAYLS+P T K    G  A    L Y   +MQGWR S EDAHNCI +  S+ ++F+VYDGHGG EVA  C++ LPD IK+   +  G    +L ++FL+ D  + +   +E +K+LA I
Sbjct:    1 MGAYLSQPNTVKCSGDGVGASRLPLPYGFSAMQGWRVSMEDAHNCIPELDSETAMFSVYDGHGGEEVALYCAKYLPDIIKDQKAYKEGKLQKALEDAFLAIDAKLTT---EEVIKELAQI 117          
BLAST of Protein phosphatase 1G vs. TrEMBL
Match: A0A443SP85 (PPM-type phosphatase domain-containing protein OS=Leptotrombidium deliense OX=299467 GN=B4U80_00411 PE=3 SV=1)

HSP 1 Score: 257.684 bits (657), Expect = 1.801e-74
Identity = 128/231 (55.41%), Postives = 163/231 (70.56%), Query Frame = 1
Query:  796 FPPFQYLRNAPGFDSGSTAVLSLINRKTLKVYVANVGDSRCVLCRNGEAVDLSIDHKPEDEIESQRIAKAGGILSEDGRVNGGLNLSRSLGDHSYKKNKEIEMKDQMISAFPDIQTIDLKPHEDEFLVLACDGIWNTFSSQQLVEFVSKRTP-TMSATDIISEIFSHCLAPNTSGDGTGCDNMTCIIITFKFPSPISICNGKSNKRRAATKELDEESIPTAKLIKTQTEES 1485
            F    Y    PG DSG TAVLSL+  +  K+YVAN GDSRCV+CRNG+A+D+SIDHKPEDE E +RI KAGG ++ DGRVNGGLNLSR++GDHSYK+N  + +KDQMISA PD++ I L P ED+F+VLACDGIWN+ +SQQ+V+F+S+R   T   + I  E+F HCL+P+T GDGTGCDNMTC+I+          C GK  + R  + E + +    AK  K Q  ES
Sbjct:  416 FMSSAYEYEEPGKDSGCTAVLSLL--RGNKLYVANAGDSRCVICRNGKAIDMSIDHKPEDEYERRRIEKAGGEVTSDGRVNGGLNLSRAIGDHSYKENPNVSLKDQMISASPDVKDITLVPGEDKFMVLACDGIWNSMTSQQVVDFISQRIDNTDKLSKICEELFLHCLSPDTMGDGTGCDNMTCVIVRLD-------CIGKKKREREES-ETEVQQSDDAKQTKKQKTES 636          

HSP 2 Score: 93.2041 bits (230), Expect = 2.842e-16
Identity = 44/87 (50.57%), Postives = 57/87 (65.52%), Query Frame = 1
Query:  142 MQGWRTSQEDAHNCILDFSSDYSLFAVYDGHGGPEVAQLCSQKLPDHIKNSVDFINGNYNDSLTNSFLSFDEAILSPEMQEALKKLA 402
            MQGWR SQEDAH CILDF +D SLFAV+DGHGG EVA   ++ LP  +K    +      ++L  +FL FD ++ S E+ + LK LA
Sbjct:    1 MQGWRVSQEDAHTCILDFDTDTSLFAVFDGHGGAEVAIYSAKNLPQVLKQLPAYKEDRIAEALEEAFLKFDSSLTSAEVIKELKALA 87          
BLAST of Protein phosphatase 1G vs. TrEMBL
Match: A0A1Y1M5J2 (PPM-type phosphatase domain-containing protein OS=Photinus pyralis OX=7054 GN=PPYR_12130 PE=3 SV=1)

HSP 1 Score: 255.373 bits (651), Expect = 2.690e-74
Identity = 122/222 (54.95%), Postives = 164/222 (73.87%), Query Frame = 1
Query:  814 LRNAPGFDSGSTAVLSLINRKTLKVYVANVGDSRCVLCRNGEAVDLSIDHKPEDEIESQRIAKAGGILSEDGRVNGGLNLSRSLGDHSYKKNKEIEMKDQMISAFPDIQTIDLKPHEDEFLVLACDGIWNTFSSQQLVEFVSKRTPTMSA--TDIISEIFSHCLAPNTSGDGTGCDNMTCIIITFKFPSPISICNGKSNKRRAATKELDEESIPTAKLIKTQ 1473
            +R  PG DSG TAV++L+    L  YVAN GDSRC++CRNG+AVD+S+DHKPED++E+QRI KAGG ++ DGRVNGGLNLSR++GDH+YK+NKE+  ++QMI+A PD++T+ + P EDEF+VLACDGIWN  SSQQ+V+FV  +  +     + I  E+F +CLAP+T  DGTGCDNMT II+ FK     S+C      +RAAT + + ES+  AK   T+
Sbjct:  368 MREEPGSDSGCTAVVALLRENQL--YVANAGDSRCIVCRNGKAVDMSLDHKPEDDLETQRILKAGGRVTHDGRVNGGLNLSRAIGDHAYKQNKELSDREQMITALPDVKTLTINPGEDEFMVLACDGIWNFMSSQQVVDFVKSKLESSPGKLSKICEEMFDYCLAPDTMCDGTGCDNMTAIIVQFKS----SVC------KRAATDDEETESVKRAKTDHTE 577          

HSP 2 Score: 125.946 bits (315), Expect = 4.285e-27
Identity = 59/115 (51.30%), Postives = 79/115 (68.70%), Query Frame = 1
Query:   58 MGAYLSKPVTDKELESGEDAFLSYASGSMQGWRTSQEDAHNCILDFSSDYSLFAVYDGHGGPEVAQLCSQKLPDHIKNSVDFINGNYNDSLTNSFLSFDEAILSPEMQEALKKLA 402
            MG+YL+KP+T+K     E+  L   + SMQGWR SQEDAHNC+LDF  + +LFAVYDGHGG EVA  C+QKLPD IK+   + + +   +L  SFL FD  I +P++   LK++A
Sbjct:    1 MGSYLAKPITEKISTDEENHRLKIGASSMQGWRVSQEDAHNCLLDFDVNTALFAVYDGHGGHEVAHYCAQKLPDFIKSCEPYKSNDLEKALEESFLGFDATIETPKVITQLKEIA 115          
BLAST of Protein phosphatase 1G vs. TrEMBL
Match: Q17L51 (AAEL001462-PA OS=Aedes aegypti OX=7159 GN=AAEL001462 PE=4 SV=1)

HSP 1 Score: 243.817 bits (621), Expect = 9.136e-74
Identity = 120/207 (57.97%), Postives = 159/207 (76.81%), Query Frame = 1
Query:  814 LRNAPGFDSGSTAVLSLINRKTLKVYVANVGDSRCVLCRNGEAVDLSIDHKPEDEIESQRIAKAGGILSEDGRVNGGLNLSRSLGDHSYKKNKEIEMKDQMISAFPDIQTIDLKPHEDEFLVLACDGIWNTFSSQQLVEFVSKRT--PTMSATDIISEIFSHCLAPNTSGDGTGCDNMTCIIITFKFPSPISICNGKSNKRRAATKE 1428
            + + PG DSG TAV++L++ K L  +VAN GDSRCV+CRNG+A+++SIDHKPED++E +RI KAGG ++ DGRVNGGLNLSR++GDH YK NK++  ++QMISA PDI+ I ++P EDEF+VLACDGIWN  +S  +VEFV +R   PT   TDI  E+F +CLAP+T GDGTGCDNMT II+ FK P+      G ++++RA T E
Sbjct:    4 ITDEPGKDSGCTAVVALLHDKEL--FVANAGDSRCVVCRNGKALEMSIDHKPEDQVEFERIQKAGGRVTLDGRVNGGLNLSRAIGDHGYKMNKKVRPEEQMISALPDIKKITIEP-EDEFMVLACDGIWNFMTSDDVVEFVQERIADPTKKLTDICEEMFDYCLAPHTKGDGTGCDNMTAIIVQFK-PN----FTGAASRKRACTPE 202          
BLAST of Protein phosphatase 1G vs. TrEMBL
Match: A0A1B6ML21 (PPM-type phosphatase domain-containing protein OS=Graphocephala atropunctata OX=36148 GN=g.19480 PE=4 SV=1)

HSP 1 Score: 240.736 bits (613), Expect = 7.214e-71
Identity = 120/222 (54.05%), Postives = 156/222 (70.27%), Query Frame = 1
Query:  802 PFQYLRNAPGFDSGSTAVLSLINRKTLKVYVANVGDSRCVLCRNGEAVDLSIDHKPEDEIESQRIAKAGGILSEDGRVNGGLNLSRSLGDHSYKKNKEIEMKDQMISAFPDIQTIDLKPHEDEFLVLACDGIWNTFSSQQLVEFVSKR--TPTMSATDIISEIFSHCLAPNTSGDGTGCDNMTCIIITFKFPSPISICNGKSNKRRAATKELDEES-IPTAK 1458
            P   ++  PG DSG TAV++L+    L  +VAN GDSRCV+CR+G+A+++S DHKPEDE E +RI  AGG ++ DGRVNGGLNLSR++GDHSYK+ K +    QMI+A PD+Q + + P  D+F+VLACDGIWN+ SSQ++V+FV  +    T   + I  E+F HCLAPNT GDGTGCDNMTC+I+ FK P   +   GK    RAA  E+DE S  PT K
Sbjct:  155 PGMDVKEEPGSDSGCTAVVALLVGSEL--WVANAGDSRCVVCRDGKALEMSQDHKPEDEPERERIETAGGKVTCDGRVNGGLNLSRAIGDHSYKQVKLLSPSQQMITALPDVQRLTVDPGRDQFMVLACDGIWNSMSSQEVVDFVRAKLEQKTEKLSQICEELFDHCLAPNTQGDGTGCDNMTCVIVQFK-PQAEASGTGK----RAAESEVDEASEQPTKK 369          
BLAST of Protein phosphatase 1G vs. TrEMBL
Match: A0A4D5RKD5 (Protein phosphatase (Fragment) OS=Ixodes scapularis OX=6945 PE=3 SV=1)

HSP 1 Score: 244.588 bits (623), Expect = 1.927e-70
Identity = 113/199 (56.78%), Postives = 147/199 (73.87%), Query Frame = 1
Query:  829 GFDSGSTAVLSLINRKTLKVYVANVGDSRCVLCRNGEAVDLSIDHKPEDEIESQRIAKAGGILSEDGRVNGGLNLSRSLGDHSYKKNKEIEMKDQMISAFPDIQTIDLKPHEDEFLVLACDGIWNTFSSQQLVEFVSKR--TPTMSATDIISEIFSHCLAPNTSGDGTGCDNMTCIIITFK---FPSPISICNGKSNKR 1410
            G+DSG TAV++L+  +TL   VAN GDSRCV+CR+G+AVD+S+DHKPED  E  RI +AGG ++ DGRVNGGLNLSR++GDH+YK+N E+E++DQMI+A PDI+T++L P  DEF++LACDGIWN  +SQ+ V+FV +     T   + I   +F  CLAP+TSGDGTGCDNMTCI+  F    F  P    N K  KR
Sbjct:  330 GYDSGCTAVVALVRGRTL--VVANAGDSRCVVCRSGKAVDMSLDHKPEDATELSRICRAGGRVTRDGRVNGGLNLSRAIGDHAYKRNTELELRDQMITALPDIKTLELDPETDEFMILACDGIWNNMTSQETVDFVKQELDKGTKPLSKICELLFDACLAPDTSGDGTGCDNMTCIVAQFHREDFGDPSGASNTKERKR 526          

HSP 2 Score: 119.783 bits (299), Expect = 4.414e-25
Identity = 56/115 (48.70%), Postives = 74/115 (64.35%), Query Frame = 1
Query:   58 MGAYLSKPVTDKELESGEDAFLSYASGSMQGWRTSQEDAHNCILDFSSDYSLFAVYDGHGGPEVAQLCSQKLPDHIKNSVDFINGNYNDSLTNSFLSFDEAILSPEMQEALKKLA 402
            MGAYLS+P+T+K         +SY + SMQGWR +QEDAHN IL++  D S FAVYDGHGG EVA+ C+ KLPD +K+   +  G   ++L   FL FD  +++P     LK LA
Sbjct:    1 MGAYLSEPITEKCSTDESGPRVSYGASSMQGWRMTQEDAHNTILNYDKDTSFFAVYDGHGGSEVAKYCALKLPDFVKSLKSYAEGELTEALCEGFLQFDATLITPGGLSELKMLA 115          
BLAST of Protein phosphatase 1G vs. Ensembl Cavefish
Match: ppm1g (protein phosphatase, Mg2+/Mn2+ dependent 1G [Source:NCBI gene;Acc:103045343])

HSP 1 Score: 236.884 bits (603), Expect = 4.887e-71
Identity = 121/232 (52.16%), Postives = 162/232 (69.83%), Query Frame = 1
Query:  793 CFPPFQYLRNAPGFDSGSTAVLSLINRKTLKVYVANVGDSRCVLCRNGEAVDLSIDHKPEDEIESQRIAKAGGILSEDGRVNGGLNLSRSLGDHSYKKNKEIEMKDQMISAFPDIQTIDLKPHEDEFLVLACDGIWNTFSSQQLVEFVSKRTPT-----MSATDIISEIFSHCLAPNTSGDGTGCDNMTCIIITFKFPSPISICNGKSNKRRAATKELDEESIPTAKLIKTQ 1473
            C P     +  PG DSG+TAV++LI  K L   VAN GDSRCV+   G+AVD+S DHKPEDE+E  RI  AGG ++ DGRVNGGLNLSR++GDH YK+NK +  ++QMISA PD++ + L   E EF+V+ACDGIWN  SSQ++V+FV++R  T      + + II E+  HCLAP+TSGDGTGCDNMTC+I+TF   SP++  N    K+R   +++ EE+   +K  KT+
Sbjct:  321 CLPGMDG-KEEPGSDSGTTAVVALIRGKQL--IVANAGDSRCVVSERGKAVDMSYDHKPEDELELTRIKNAGGKVTMDGRVNGGLNLSRAIGDHFYKRNKALPPEEQMISALPDVKVLTLN-EEHEFMVVACDGIWNVMSSQEVVDFVNERLKTDGSENRALSSIIEELLDHCLAPDTSGDGTGCDNMTCMIVTF---SPMTSSN--VTKKRKQDEQVSEENGSDSKKPKTE 543          

HSP 2 Score: 110.538 bits (275), Expect = 2.203e-25
Identity = 53/115 (46.09%), Postives = 73/115 (63.48%), Query Frame = 1
Query:   58 MGAYLSKPVTDKELESGEDAFLSYASGSMQGWRTSQEDAHNCILDFSSDYSLFAVYDGHGGPEVAQLCSQKLPDHIKNSVDFINGNYNDSLTNSFLSFDEAILSPEMQEALKKLA 402
            MGAYLS+P T+K    G +  L Y   +MQGWR S EDAHNCI +   + ++FAVYDGHGG EVA  CS+ LPD IK    + +G    +L ++FL+ D  I + E+ + L ++A
Sbjct:    1 MGAYLSQPNTEKTSADGGNHKLQYGFAAMQGWRISMEDAHNCIPELDDETAMFAVYDGHGGEEVALYCSKYLPDIIKEQKAYKDGKLQKALEDAFLAIDSRITTEEVIKELVQIA 115          
BLAST of Protein phosphatase 1G vs. Ensembl Cavefish
Match: ppm1la (protein phosphatase, Mg2+/Mn2+ dependent, 1La [Source:ZFIN;Acc:ZDB-GENE-061103-118])

HSP 1 Score: 118.627 bits (296), Expect = 1.904e-29
Identity = 77/193 (39.90%), Postives = 113/193 (58.55%), Query Frame = 1
Query:  835 DSGSTAVLSLINRKTLKVYVANVGDSRCVLC-RNGEAVDLSIDHKPEDEIESQRIAKAGGILSEDG--RVNGGLNLSRSLGDHSYKKNKEIEMKDQMISAFPDIQTIDLKPHEDEFLVLACDGIWNTFSSQQLVEFVSKR--TPTMSATDIISEIFSHCLAPNTSGDGTGC-DNMTCIIITFKFPSPISICNG 1395
            ++G+T +++L++ + L V  ANVGDSR VLC ++G AV LS DHKP    E +RI +AGG +S +G  RV G L +SRSLGD+  K N  + + D      PDI T DL   + EF++LA DG+W+ FS+++ V FV +R   P   A  I+ + F             GC DN+T +++ F+  SP+   N 
Sbjct:  131 EAGTTCLVALLSDRELTV--ANVGDSRGVLCDKDGNAVALSHDHKPYQLKERKRIKRAGGFISFNGSWRVQGILAMSRSLGDYPLK-NLNVVIPD------PDILTFDLDKLQPEFMILASDGLWDAFSNEEAVRFVRERLDEPHFGAKSIVLQSFYR-----------GCPDNITVMVVKFR-SSPVFSSNA 302          
BLAST of Protein phosphatase 1G vs. Ensembl Cavefish
Match: ppm1la (protein phosphatase, Mg2+/Mn2+ dependent, 1La [Source:ZFIN;Acc:ZDB-GENE-061103-118])

HSP 1 Score: 117.472 bits (293), Expect = 4.182e-29
Identity = 75/186 (40.32%), Postives = 110/186 (59.14%), Query Frame = 1
Query:  835 DSGSTAVLSLINRKTLKVYVANVGDSRCVLC-RNGEAVDLSIDHKPEDEIESQRIAKAGGILSEDG--RVNGGLNLSRSLGDHSYKKNKEIEMKDQMISAFPDIQTIDLKPHEDEFLVLACDGIWNTFSSQQLVEFVSKR--TPTMSATDIISEIFSHCLAPNTSGDGTGC-DNMTCIIITFKFPS 1374
            ++G+T +++L++ + L V  ANVGDSR VLC ++G AV LS DHKP    E +RI +AGG +S +G  RV G L +SRSLGD+  K N  + + D      PDI T DL   + EF++LA DG+W+ FS+++ V FV +R   P   A  I+ + F             GC DN+T +++ F+  S
Sbjct:  131 EAGTTCLVALLSDRELTV--ANVGDSRGVLCDKDGNAVALSHDHKPYQLKERKRIKRAGGFISFNGSWRVQGILAMSRSLGDYPLK-NLNVVIPD------PDILTFDLDKLQPEFMILASDGLWDAFSNEEAVRFVRERLDEPHFGAKSIVLQSFYR-----------GCPDNITVMVVKFRRSS 296          
BLAST of Protein phosphatase 1G vs. Ensembl Cavefish
Match: ppm1nb (protein phosphatase 1A [Source:NCBI gene;Acc:103042386])

HSP 1 Score: 120.168 bits (300), Expect = 4.513e-29
Identity = 70/179 (39.11%), Postives = 102/179 (56.98%), Query Frame = 1
Query:  829 GFDSGSTAVLSLINRKTLKVYVANVGDSRCVLCRNGEAVDLSIDHKPEDEIESQRIAKAGGILSEDGRVNGGLNLSRSLGDHSYKKNKEIEMKDQMISAFPDIQTIDLKPHEDEFLVLACDGIWNTFSSQQLVEFVSKRTPTMS-ATDIISEIFSHCLAPNTSGDGTGCDNMTCIIITF 1362
            G++ G T V+S +      +Y  N GDSR VLCR G     + DHKP    E +RI  AGG ++   RVNG L +SR+LGD SYK  +     +QM+S  P+I T++  P  DEF+VLACDG+W+T S+++L  FV  R    +   D+ S++   CL   +       DN++ I++ F
Sbjct:  172 GWERGGTTVVSTVITPH-HIYFVNCGDSRAVLCRGGRVAFSTEDHKPFCPGEKERIENAGGSVTLQ-RVNGSLAVSRALGDFSYKAAEWRPATEQMVSPEPEICTVERSP-ADEFVVLACDGVWDTVSNEELCAFVRSRLRVCTDLRDVCSQVIDLCLYKGS------LDNISIILVCF 341          

HSP 2 Score: 80.8777 bits (198), Expect = 5.116e-16
Identity = 46/118 (38.98%), Postives = 61/118 (51.69%), Query Frame = 1
Query:   67 YLSKPVTDKELESGEDAF-LSYASGSMQGWRTSQEDAHNCILDFS---SDYSLFAVYDGHGGPEVAQLCSQKLPDHI----KNSVDFINGNYNDSLTNSFLSFDEAILSPEMQEALKK 396
            YL +PV DK +E G  ++ L+YA  SMQGWR   ED HNC        S +  FAVYDGH G  VAQ CS+ L DHI    K   D      N+ +   F   D+ + +   +E  ++
Sbjct:   58 YLDRPVLDKYMEEGCASWGLTYALASMQGWRAHMEDFHNCFPQLGGELSHWGFFAVYDGHAGSTVAQHCSRNLLDHILGTGKIRADEDVEQVNEGIKEGFFLMDKHLHAMACREGWER 175          
BLAST of Protein phosphatase 1G vs. Ensembl Cavefish
Match: ppm1ba (protein phosphatase, Mg2+/Mn2+ dependent 1B [Source:NCBI gene;Acc:103024377])

HSP 1 Score: 114.775 bits (286), Expect = 1.397e-27
Identity = 72/188 (38.30%), Postives = 105/188 (55.85%), Query Frame = 1
Query:  805 FQYLRNAPGFD-SGSTAVLSLINRKTLKVYVANVGDSRCVLCRNGEAVDLSIDHKPEDEIESQRIAKAGGILSEDGRVNGGLNLSRSLGDHSYKKNKEIEMKDQMISAFPDIQTIDLKPHEDEFLVLACDGIWNTFSSQQLVEFVSKRTPTMSATD-IISEIFSHCLAPNTSGDGTGCDNMTCIIITF 1362
            F  LRN  G D SGSTAV  L++ + +  Y  N GDSR +LCRN      ++DHKP +  E +RI  AGG +    RVNG L +SR+LGD+ YK  +     +Q++S  P++  I     EDEF+VLACDGIW+  S+++L  FV  R       + + +E+   CL   +       DNM+ +++  
Sbjct:  122 FTDLRN--GMDRSGSTAVAVLLSPEHM--YFINCGDSRALLCRNAHVCFSTLDHKPCNPREKERIQNAGGSVMIQ-RVNGSLAVSRALGDYDYKSVEGKGPTEQLVSPEPEVFEIVRSEAEDEFVVLACDGIWDVMSNEELCAFVRARLEVSDDLEKVCNEVVDTCLHKGSR------DNMSVVLVCL 298          

HSP 2 Score: 78.5666 bits (192), Expect = 2.218e-15
Identity = 39/79 (49.37%), Postives = 44/79 (55.70%), Query Frame = 1
Query:   58 MGAYLSKPVTDKELESGEDAFLSYASGSMQGWRTSQEDAHNCILDFSS---DYSLFAVYDGHGGPEVAQLCSQKLPDHI 285
            MGA+L KP T+K    GE   L Y   SMQGWR   EDAH   +       D+S FAVYDGH G  VA  CS  L +HI
Sbjct:    1 MGAFLDKPKTEKHNAHGEGNGLRYGLSSMQGWRVEMEDAHTAAVGLPHGLDDWSFFAVYDGHAGSRVANYCSNHLLEHI 79          
BLAST of Protein phosphatase 1G vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003549.1 (pep scaffold:Pmarinus_7.0:GL496710:143:1226:1 gene:ENSPMAG00000003243.1 transcript:ENSPMAT00000003549.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 146.747 bits (369), Expect = 2.272e-40
Identity = 77/179 (43.02%), Postives = 112/179 (62.57%), Query Frame = 1
Query:  838 SGSTAVLSLINRKTLKVYVANVGDSRCVLCRNGEAVDLSIDHKPEDEIESQRIAKAGGILSEDGRVNGGLNLSRSLGDHSYKKNKEIEMKDQMISAFPDIQTIDLKPHEDEFLVLACDGIWNTFSSQQLVEFVSK--RTPTMSATDIISEIFSHCLAPNT-SGDGTGCDNMTCIIITFK 1365
            +G TAV ++I      +YV N GDSR VL      +++S DHKP++ +E QRI +AGG + ED RV G LNLSRS+GD  YK NK + + DQMI+  P+++   +  +E  FL+LACDGIW+  SSQ+   FV +  +      + ++ +IF   +A +  S  G GCDNMTC+++ FK
Sbjct:  133 TGCTAVSAIIT--PTDIYVGNSGDSRVVLAVKYHGIEMSEDHKPDNRLEKQRIERAGGFV-EDNRVKGVLNLSRSIGDLEYKLNKSLSVDDQMITVVPEVRREKI-TNETAFLILACDGIWDCLSSQECTNFVGELLKKKDRRLSSVVEDIFDKIIATDVASSGGIGCDNMTCVVVQFK 307          

HSP 2 Score: 97.0561 bits (240), Expect = 1.456e-22
Identity = 45/105 (42.86%), Postives = 58/105 (55.24%), Query Frame = 1
Query:   58 MGAYLSKPVTDKELESGEDAFLSYASGSMQGWRTSQEDAHNCILDFSSDYSLFAVYDGHGGPEVAQLCSQKLPDHIKNSVDFINGNYNDSLTNSFLSFDEAILSP 372
            MG YL+ P  +KE E GE+  L Y +  MQGWR + ED+H   LD     S F VYDGHGG EVA      L D +K    F   NY  +L + ++  DE +L+P
Sbjct:    1 MGPYLTVPRKEKESEDGENTKLRYGATGMQGWRNTMEDSHIACLDLGHGVSFFGVYDGHGGNEVADFVRDHLVDELKKLPSFQGSNYEQALKDIYIHLDEMLLTP 105          
BLAST of Protein phosphatase 1G vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003550.1 (pep scaffold:Pmarinus_7.0:GL496710:143:1226:1 gene:ENSPMAG00000003243.1 transcript:ENSPMAT00000003550.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 146.362 bits (368), Expect = 2.863e-40
Identity = 77/179 (43.02%), Postives = 112/179 (62.57%), Query Frame = 1
Query:  838 SGSTAVLSLINRKTLKVYVANVGDSRCVLCRNGEAVDLSIDHKPEDEIESQRIAKAGGILSEDGRVNGGLNLSRSLGDHSYKKNKEIEMKDQMISAFPDIQTIDLKPHEDEFLVLACDGIWNTFSSQQLVEFVSK--RTPTMSATDIISEIFSHCLAPNT-SGDGTGCDNMTCIIITFK 1365
            +G TAV ++I      +YV N GDSR VL      +++S DHKP++ +E QRI +AGG + ED RV G LNLSRS+GD  YK NK + + DQMI+  P+++   +  +E  FL+LACDGIW+  SSQ+   FV +  +      + ++ +IF   +A +  S  G GCDNMTC+++ FK
Sbjct:  132 TGCTAVSAIIT--PTDIYVGNSGDSRVVLAVKYHGIEMSEDHKPDNRLEKQRIERAGGFV-EDNRVKGVLNLSRSIGDLEYKLNKSLSVDDQMITVVPEVRREKI-TNETAFLILACDGIWDCLSSQECTNFVGELLKKKDRRLSSVVEDIFDKIIATDVASSGGIGCDNMTCVVVQFK 306          

HSP 2 Score: 97.0561 bits (240), Expect = 1.474e-22
Identity = 45/105 (42.86%), Postives = 58/105 (55.24%), Query Frame = 1
Query:   58 MGAYLSKPVTDKELESGEDAFLSYASGSMQGWRTSQEDAHNCILDFSSDYSLFAVYDGHGGPEVAQLCSQKLPDHIKNSVDFINGNYNDSLTNSFLSFDEAILSP 372
            MG YL+ P  +KE E GE+  L Y +  MQGWR + ED+H   LD     S F VYDGHGG EVA      L D +K    F   NY  +L + ++  DE +L+P
Sbjct:    1 MGPYLTVPRKEKESEDGENTKLRYGATGMQGWRNTMEDSHIACLDLGHGVSFFGVYDGHGGNEVADFVRDHLVDELKKLPSFQGSNYEQALKDIYIHLDEMLLTP 105          
BLAST of Protein phosphatase 1G vs. Ensembl Sea Lamprey
Match: ppm1aa (protein phosphatase, Mg2+/Mn2+ dependent, 1Aa [Source:ZFIN;Acc:ZDB-GENE-991102-15])

HSP 1 Score: 110.153 bits (274), Expect = 2.411e-26
Identity = 77/223 (34.53%), Postives = 120/223 (53.81%), Query Frame = 1
Query:  829 GFD-SGSTAVLSLINRKTLKVYVANVGDSRCVLCRNGEAVDLSIDHKPEDEIESQRIAKAGGILSEDGRVNGGLNLSRSLGDHSYKKNKEIEMKDQMISAFPDIQTIDLKPHEDEFLVLACDGIWNTFSSQQLVEFVSKR-TPTMSATDIISEIFSHCLAPNTSGDGTGCDNMTCIIITFKFPSPISICNGKSNKRRAATKELDEESIPTAKLIKTQTEESVK 1491
            G D SGSTAV  +++ K L  Y  N GDSR VL RNG     + DHKP +  E +RI   G ++ +  RVNG L +SR+LGD  YK        +Q++S  P+++ I+ +   DEF+VLACDGIW+  S+++L +FV  R   T     I +++   CL   +       DNM+ +++ F     +++      +  A  +ELD       K ++T+ EE ++
Sbjct:  122 GLDRSGSTAVAVMLSPKHL--YFINCGDSRAVLYRNGSVHFCTEDHKPCNPAEKERIQNGGSVMIQ--RVNGSLAVSRALGDFDYKCVDGKGPTEQLVSPEPEVRAIE-RSDGDEFVVLACDGIWDVMSNEELGQFVHSRLLLTDDLEKICNQVLDTCLYKGSR------DNMSIVLVCFPNAPKVTV------EAVAREEELD-------KFLETKVEEVLE 320          

HSP 2 Score: 79.7221 bits (195), Expect = 3.147e-16
Identity = 39/85 (45.88%), Postives = 47/85 (55.29%), Query Frame = 1
Query:   58 MGAYLSKPVTDKELESGEDAFLSYASGSMQGWRTSQEDAHNCILDFSSD---YSLFAVYDGHGGPEVAQLCSQKLPDHIKNSVDF 303
            MGA+L KP T+K    G    L YA  SMQGWR   EDAH  ++        +S FAVYDGH G  VA  CS+ L +HI  +  F
Sbjct:    1 MGAFLDKPKTEKHTTHGGGNGLRYALSSMQGWRVEMEDAHTAVVGIPRGLKTWSFFAVYDGHAGSRVATFCSEHLLEHIITNEHF 85          
BLAST of Protein phosphatase 1G vs. Ensembl Sea Lamprey
Match: si:ch211-149b19.3 (si:ch211-149b19.3 [Source:ZFIN;Acc:ZDB-GENE-110411-37])

HSP 1 Score: 92.0485 bits (227), Expect = 5.961e-21
Identity = 60/167 (35.93%), Postives = 90/167 (53.89%), Query Frame = 1
Query:  805 FQYLRNAPGFDS----GSTAVLSLINRKTLKVYVANVGDSRCVLCRNGEAVDLSIDHKPEDEIESQRIAKAGGILSEDG----RVNGGLNLSRSLGDHSYKKNKEIEMKDQMISAFPDIQTIDLKPHEDEFLVLACDGIWNTFSSQQLVEFVSKRTPTMSATDIISE 1281
            F     APG ++    G+TA ++L+ R  +++ V +VGDSR +LCR G +  L+ DH PE   E +RI K GG ++        VNG L ++RS+GD        I +K   ++A PD + I LK  +D FLVL  DGI    +SQ++   VS+      A  ++ E
Sbjct:  101 FTLAARAPGNEALLPCGTTATVALL-RDGVELVVGSVGDSRAILCRRGLSRKLTEDHTPERRDEKERIQKCGGFIAWTSLGQPHVNGRLAMTRSIGD--------IALKAVGVTAEPDTRRIMLKHGDDSFLVLTTDGINVIMNSQEICNIVSQCNEPSEAAQLVGE 258          
BLAST of Protein phosphatase 1G vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006941.1 (pep scaffold:Pmarinus_7.0:GL476378:621905:629923:1 gene:ENSPMAG00000006271.1 transcript:ENSPMAT00000006941.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 86.6557 bits (213), Expect = 8.227e-19
Identity = 54/152 (35.53%), Postives = 85/152 (55.92%), Query Frame = 1
Query:  838 SGSTAVLSLINRKTLKVYVANVGDSRCVLCRNGEAVDLSIDHKPEDEIESQRIAKAGGILSED----GRVNGGLNLSRSLGDHSYKKNKEIEMKDQMISAFPDIQTIDLKPHEDEFLVLACDGIWNTFSSQQLVEFVSKRTPTMSATDIISE 1281
            SGSTA ++L+ R   ++ V +VGDSR VLCR G+A+ L+ DH  + + E  R+   GG ++       R+NG L ++RS+GD        I +K   + A P+IQ + L   +D FLVL  DGI    ++Q++ + VS       A  +I++
Sbjct:  173 SGSTATVALL-RDGQELAVGSVGDSRAVLCRRGKAMGLTKDHTAQRKDERTRVKACGGFVTWSTTGHSRINGTLAMTRSIGD--------IALKPYGVIADPEIQQLQLNHEDDSFLVLTTDGINFIMNNQEVCDAVSSSHTPGEAAHLITD 315          
BLAST of Protein phosphatase 1G vs. Ensembl Yeast
Match: PTC3 (Type 2C protein phosphatase (PP2C); dephosphorylates Hog1p (see also Ptc2p) to limit maximal kinase activity induced by osmotic stress; dephosphorylates T169 phosphorylated Cdc28p (see also Ptc2p); role in DNA damage checkpoint inactivation; PTC3 has a paralog, PTC2, that arose from the whole genome duplication [Source:SGD;Acc:S000000152])

HSP 1 Score: 133.265 bits (334), Expect = 2.010e-34
Identity = 73/177 (41.24%), Postives = 102/177 (57.63%), Query Frame = 1
Query:  838 SGSTAVLSLINRKTLKVYVANVGDSRCVLCRNGEAVDLSIDHKPEDEIESQRIAKAGGILSEDGRVNGGLNLSRSLGDHSYKKNKEIEMKDQMISAFPDIQTIDLKPHEDEFLVLACDGIWNTFSSQQLVEFVSK--RTPTMSATDIISEIFSHCLAPNTSGDGTGCDNMTCIIITF 1362
            SG TA + L+++    +  AN GDSR VL   G +  +S DHKP    E  RI  A G +  D RVNG L LSR++GD  +K N ++   +Q+++  PDI   +L   EDEF++LACDGIW+  +SQ+ V+ V        M+ +DI S I   C +P T G G GCDNM+  I+  
Sbjct:  118 SGCTATVILVSQLKKLLICANSGDSRTVLSTGGNSKAMSFDHKPTLLSEKSRIVAADGFVEMD-RVNGNLALSRAIGDFEFKSNTKLGPHEQVVTCVPDIICHNLNYDEDEFVILACDGIWDCLTSQECVDLVHYGISQGNMTLSDISSRIVDVCCSPTTEGSGIGCDNMSISIVAL 293          

HSP 2 Score: 79.337 bits (194), Expect = 2.855e-16
Identity = 40/111 (36.04%), Postives = 60/111 (54.05%), Query Frame = 1
Query:   58 MGAYLSKPVTDKELESGEDAFLSYASGSMQGWRTSQEDAH----NCILDFSSDY-SLFAVYDGHGGPEVAQLCSQKLPDHIKNSVDFINGNYNDSLTNSFLSFDEAILSPE 375
            MG  LS P+ DKE  SG D   ++   +MQGWR S EDAH    N + +   ++ + + ++DGHGG  VA+ C  K+   +K    F +G     L ++FL+ D  +L  E
Sbjct:    1 MGQILSNPIIDKEHHSGTDCLTAFGLCAMQGWRMSMEDAHIVEPNLLAESDEEHLAFYGIFDGHGGSSVAEFCGSKMISILKKQESFKSGMLEQCLIDTFLATDVELLKDE 111          
BLAST of Protein phosphatase 1G vs. Ensembl Yeast
Match: PTC2 (Type 2C protein phosphatase (PP2C); dephosphorylates Hog1p to limit maximal osmostress induced kinase activity; dephosphorylates Ire1p to downregulate the unfolded protein response; dephosphorylates Cdc28p; inactivates the DNA damage checkpoint; PTC2 has a paralog, PTC3, that arose from the whole genome duplication [Source:SGD;Acc:S000000891])

HSP 1 Score: 130.954 bits (328), Expect = 1.543e-33
Identity = 72/178 (40.45%), Postives = 101/178 (56.74%), Query Frame = 1
Query:  838 SGSTAVLSLINRKTLKVYVANVGDSRCVLCRNGEAVDLSIDHKPEDEIESQRIAKAGGILSEDGRVNGGLNLSRSLGDHSYKKNKEIEMKDQMISAFPDIQTIDLKPHEDEFLVLACDGIWNTFSSQQLVEFVS---KRTPTMSATDIISEIFSHCLAPNTSGDGTGCDNMTCIIITF 1362
            SG TA   L+++    +   N GDSR VL  +G A  LS DHKP    E  RI  A G +  D RVNG L LSR++GD  +K N ++  ++Q+++  PDI    L    DEF++LACDGIW+  +SQ  V+ V    +   T++  +I S I   C AP T G G GCDNM+ +++  
Sbjct:  118 SGCTATSILVSKSQNLLVCGNAGDSRTVLATDGNAKALSYDHKPTLASEKSRIVAADGFVEMD-RVNGNLALSRAIGDFEFKSNPKLGPEEQIVTCVPDILEHSLDYDRDEFVILACDGIWDCLTSQDCVDLVHLGLREGKTLN--EISSRIIDVCCAPTTEGTGIGCDNMSIVVVAL 292          

HSP 2 Score: 81.2629 bits (199), Expect = 6.858e-17
Identity = 42/115 (36.52%), Postives = 66/115 (57.39%), Query Frame = 1
Query:   58 MGAYLSKPVTDKELESGEDAFLSYASGSMQGWRTSQEDAH----NCILDFSSDY-SLFAVYDGHGGPEVAQLCSQKLPDHIKNSVDFINGNYNDSLTNSFLSFDEAILS-PEMQE 384
            MG  LS PV DKE  SG D+  ++   +MQGWR S ED+H    N +     D+ + + ++DGHGG +VA+ C  K+ + ++    F  GN   +L ++F++ D  +L  P M+E
Sbjct:    1 MGQILSNPVIDKESHSGADSLTAFGLCAMQGWRMSMEDSHILEPNVLTKSDKDHIAFYGIFDGHGGAKVAEYCGNKIVEILQEQKSFHEGNLPRALIDTFINTDVKLLQDPVMKE 115          
BLAST of Protein phosphatase 1G vs. Ensembl Yeast
Match: PTC4 (Cytoplasmic type 2C protein phosphatase (PP2C); identified as a high-copy number suppressor of cnb1 mpk1 synthetic lethality; overexpression decreases high-osmolarity induced Hog1p phosphorylation and kinase activity [Source:SGD;Acc:S000000329])

HSP 1 Score: 112.464 bits (280), Expect = 1.428e-27
Identity = 70/195 (35.90%), Postives = 108/195 (55.38%), Query Frame = 1
Query:  841 GSTAVLS-LINRKTLKVYVANVGDSRCVLCRNGEAVD-LSIDHKPEDEIESQRIAKAGGILSEDGRVNGGLNLSRSLGDHSYKK-----NKEIEM-------------KDQMISAFPDIQTIDLKPHEDEFLVLACDGIWNTFSSQQLVEFVSKRTPTMSATD-IISEIFSHCLAPNTSGDGTGCDNMTCIIITF 1362
            GSTAV++ +IN ++L  YVAN GDSRC+L      +  +S DHKP+   E  RI   GG +S  GRV G L LSR+  D  +K+     ++  ++             ++  ++  PD+    +   +DEFLVLACDGIW+ ++++QL+ F+     + +  D II+++  H +A   S  G G DNMT II+  
Sbjct:  177 GSTAVVACIINEESL--YVANCGDSRCILSSKSNGIKTMSFDHKPQHIGELIRINDNGGTVSL-GRVGGVLALSRAFSDFQFKRGVTYPHRRTKLTNITQNLTYGTPPQEAQVTVEPDVLMHKIDYSKDEFLVLACDGIWDIYNNKQLIHFIKYHLVSGTKLDTIITKLLDHGIAQANSNTGVGFDNMTAIIVVL 368          

HSP 2 Score: 46.2098 bits (108), Expect = 8.122e-6
Identity = 33/95 (34.74%), Postives = 45/95 (47.37%), Query Frame = 1
Query:   58 MGAYLSKPVTDKELESGEDAFLSYASG----------SMQGWRTSQEDAH--------------NCILDFSSDYSL--FAVYDGHGGPEVAQLCS 264
            MG  LS P+T+K +E  E      ++G          SMQG+R +QEDAH              N  +D     SL  FAV+DGHGG + ++  S
Sbjct:    1 MGQLLSHPLTEKTIEYNEYKNNQASTGIVPRFYNCVGSMQGYRLTQEDAHLIRNENSVVYVRFFNPFIDKYETLSLNVFAVFDGHGGDDCSKFLS 95          
BLAST of Protein phosphatase 1G vs. Ensembl Yeast
Match: PTC1 (Type 2C protein phosphatase (PP2C); dephosphorylates Hog1p, inactivating osmosensing MAPK cascade; involved in Fus3p activation during pheromone response; deletion affects precursor tRNA splicing, mitochondrial inheritance, and sporulation [Source:SGD;Acc:S000002164])

HSP 1 Score: 99.3673 bits (246), Expect = 8.433e-24
Identity = 56/158 (35.44%), Postives = 88/158 (55.70%), Query Frame = 1
Query:  883 KVYVANVGDSRCVLCRNGEAVDLSIDHKPEDEIESQRIAKAGGILSEDGRVNGGLNLSRSLGDHSYKKNKEIEMKDQMISAFPDIQTIDLKPHEDEFLVLACDGIWNTFSSQQLVEFVSKRTPTMSATDIISEIFSHCLAPNTSGDGTGCDNMTCIII 1356
            K+Y ANVGDSR VL RNG ++ L+ DHK  D +E QR+ +AGG++ +  RVNG L ++RSLGD  +         D ++   P   ++++   ED+FL+LACDG+W+    Q   E +   T    A  +   +  + L   T+      DN+T +++
Sbjct:  142 KLYTANVGDSRIVLFRNGNSIRLTYDHKASDTLEMQRVEQAGGLIMK-SRVNGMLAVTRSLGDKFF---------DSLVVGSPFTTSVEITS-EDKFLILACDGLWDVIDDQDACELIKDITEPNEAAKV---LVRYALENGTT------DNVTVMVV 279          

HSP 2 Score: 47.3654 bits (111), Expect = 2.662e-6
Identity = 26/74 (35.14%), Postives = 42/74 (56.76%), Query Frame = 1
Query:  151 WRTSQEDAHNCILDFSS--DYSLFAVYDGHGGPEVAQLCSQKLPDHI-KNSVDFINGNYNDSLTNSFLSFDEAI 363
            +R + ED H  + +F+S  D+  FAV+DGH G + ++ C + L   I +N +     +  D L +SFL+ DE I
Sbjct:   31 FRRTMEDVHTYVKNFASRLDWGYFAVFDGHAGIQASKWCGKHLHTIIEQNILADETRDVRDVLNDSFLAIDEEI 104          
BLAST of Protein phosphatase 1G vs. Ensembl Yeast
Match: CYR1 (Adenylate cyclase; required for cAMP production and cAMP-dependent protein kinase signaling; the cAMP pathway controls a variety of cellular processes, including metabolism, cell cycle, stress response, stationary phase, and sporulation [Source:SGD;Acc:S000003542])

HSP 1 Score: 50.0618 bits (118), Expect = 8.112e-7
Identity = 36/122 (29.51%), Postives = 64/122 (52.46%), Query Frame = 1
Query:  838 SGSTAVLSLINRKTLKVYVANVGDSRCVLCRN-GEAVDLSIDHKPEDEIESQRIAKAGGILSEDGRVNGGLNLSRSLGDHSYKKNKEIEMKDQMISAFPDIQTIDLKPHEDEFLVLACDGIW 1200
            SG+ + +  I  K  K++ AN+GD   +L +N G+   L+  H P    E +RI  +GG ++ +G+++G +++SR++G      +         I A PDI  + L    DE L++A   +W
Sbjct: 1470 SGACSTVIYIRGK--KLFAANLGDCMAILSKNNGDYQTLTKQHLPTKREEYERIRISGGYVN-NGKLDGVVDVSRAVGFFDLLPH---------IHASPDISVVTLT-KADEMLIVATHKLW 1578          
BLAST of Protein phosphatase 1G vs. Ensembl Nematostella
Match: EDO31490 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SXS4])

HSP 1 Score: 216.083 bits (549), Expect = 6.628e-66
Identity = 104/182 (57.14%), Postives = 136/182 (74.73%), Query Frame = 1
Query:  826 PGFDSGSTAVLSLINRKTLKVYVANVGDSRCVLCRNGEAVDLSIDHKPEDEIESQRIAKAGGILSEDGRVNGGLNLSRSLGDHSYKKNKEIEMKDQMISAFPDIQTIDLKPHEDEFLVLACDGIWNTFSSQQLVEFVSK--RTPTMSATDIISEIFSHCLAPNTSGDGTGCDNMTCIIITFK 1365
             G+DSG+TA+++L+    L V  ANVGDSRCVLCRNG A+D+SIDHKPEDE E  RI KAGG ++ +GRVNGGLNLSR+LGDHSYK   E+   +Q I+A PDI+   L    DEF+V+ACDGIWN  +SQ++V+FV +  +    + + I  ++F  CLAP+TSGDG GCDNMTC+I++FK
Sbjct:  157 AGYDSGTTAIVALVKDNNLTV--ANVGDSRCVLCRNGIALDMSIDHKPEDEKELNRIHKAGGKVTCEGRVNGGLNLSRALGDHSYKGQSELGAHEQQITAMPDIRQTTL-TEADEFMVIACDGIWNVKNSQEVVDFVKQEMKNGEENLSSICEKLFDACLAPDTSGDGAGCDNMTCVIVSFK 335          

HSP 2 Score: 119.783 bits (299), Expect = 4.261e-30
Identity = 54/106 (50.94%), Postives = 73/106 (68.87%), Query Frame = 1
Query:   58 MGAYLSKPVTDKELESGEDAFLSYASGSMQGWRTSQEDAHNCILDFSSDYSLFAVYDGHGGPEVAQLCSQKLPDHIKNSVDFINGNYNDSLTNSFLSFDEAILSPE 375
            MGAYLSKP T+    +  ++ +SY + +MQGWR S EDAH C+LDF  D SLFAVYDGHGG EVA+  S+ LPD ++  + +  GN   +L ++FL  DE+I+S E
Sbjct:    1 MGAYLSKPKTEMNSVTESNSKMSYGASAMQGWRVSMEDAHTCLLDFDEDTSLFAVYDGHGGQEVAEYVSKHLPDVLRGDIGYKEGNTKQALIDTFLKVDESIVSEE 106          
BLAST of Protein phosphatase 1G vs. Ensembl Nematostella
Match: EDO40449 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S778])

HSP 1 Score: 159.073 bits (401), Expect = 1.394e-44
Identity = 81/164 (49.39%), Postives = 108/164 (65.85%), Query Frame = 1
Query:  874 KTLKVYVANVGDSRCVLCRNGEAVDLSIDHKPEDEIESQRIAKAGGILSEDGRVNGGLNLSRSLGDHSYKKNKEIEMKDQMISAFPDIQTIDLKPHEDEFLVLACDGIWNTFSSQQLVEFVSKR-TPTMSATDIISEIFSHCLAPNTSGDGTGCDNMTCIIITF 1362
            K  K+Y ANVGDSR + C+ G    LS DHKP +E E++RI  AGG + E  RVNG L LSR+LGD  +KKN +   ++Q+++A PD+   DL P + EFLVLACDGIW+  S+Q++V+F+  R    M    I  E+ + CLAP+    G GCDNMT II+TF
Sbjct:  125 KNNKLYCANVGDSRAIACKKGLVEQLSFDHKPSNEEETRRIIAAGGWV-EFNRVNGNLALSRALGDFCFKKNDKKPPEEQIVTAMPDVIVKDLTP-DHEFLVLACDGIWDVLSNQEVVDFIRSRLAQRMELEQICEELLTRCLAPDCQMGGLGCDNMTVIILTF 286          

HSP 2 Score: 81.6481 bits (200), Expect = 4.313e-17
Identity = 46/108 (42.59%), Postives = 55/108 (50.93%), Query Frame = 1
Query:   58 MGAYLSKPVTDKELESGEDAFLSYASGSMQGWRTSQEDAHNCILDFSSD--YSLFAVYDGHGGPEVAQLCSQKLPDHIKNSVDFINGNYNDSLTNSFLSFDEAILSPE 375
            MG  LS+PVT KE  S  +     AS  MQGWR + EDAH  IL    D   +   VYDGHGG  VAQ   Q L   I +   +  GN  ++L   FLS D  +L  E
Sbjct:    1 MGQTLSEPVTTKETSSCSNKSYKLASSCMQGWRINMEDAHTEILSLKEDKNTAFLGVYDGHGGARVAQYVGQNLQKKIASQPAWAKGNVIEALKKGFLSCDTDMLKDE 108          
BLAST of Protein phosphatase 1G vs. Ensembl Nematostella
Match: EDO36040 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJS2])

HSP 1 Score: 111.309 bits (277), Expect = 5.905e-27
Identity = 69/177 (38.98%), Postives = 98/177 (55.37%), Query Frame = 1
Query:  838 SGSTAVLSLINRKTLKVYV-ANVGDSRCVLCRNGEAVDLSIDHKPEDEIESQRIAKAGGILSEDGRVNGGLNLSRSLGDHSYKKNKEIEMKDQMISAFPDIQTIDLKPHEDEFLVLACDGIWNTFSSQQLVEFVSKRTPTMSATDIIS-EIFSHCLAPNTSGDGTGCDNMTCIIITF 1362
            SGSTA+  L+   T K Y+ AN GDSR +L  NGE +  ++DHKP +  E  RI  AGG +    RVNG L +SR+LGD  YK +  +    Q++S  PDI     +  +DEF+VLACDG+W+  ++ ++  FV  R         +S E+   CL   +       DNM+ III+ 
Sbjct:  129 SGSTAIALLV---TPKYYIFANCGDSRGILSHNGEVIYNTVDHKPGNPDEKTRIENAGGSVMIQ-RVNGALAVSRALGDFEYKLDSSLHATKQLVSPEPDI-FFQSRSDQDEFIVLACDGVWDVMTNDEVGAFVRSRLQITDDLQRVSCELLDTCLTKGSR------DNMSVIIISL 294          

HSP 2 Score: 79.7221 bits (195), Expect = 3.412e-16
Identity = 36/75 (48.00%), Postives = 47/75 (62.67%), Query Frame = 1
Query:   58 MGAYLSKPVTDKELESGEDAFLSYASGSMQGWRTSQEDAHNCILDFS---SDYSLFAVYDGHGGPEVAQLCSQKL 273
            MGA+L KP T+KE ++GE   L Y   +MQGWR   EDAH  ++  S    D+S FAV+DGH G  V++ CS  L
Sbjct:    1 MGAFLDKPRTEKETKTGEGNGLRYGLAAMQGWRVEMEDAHTAVIGLSDHLKDWSFFAVFDGHAGENVSKYCSSNL 75          
BLAST of Protein phosphatase 1G vs. Ensembl Nematostella
Match: EDO39603 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S9M4])

HSP 1 Score: 97.8265 bits (242), Expect = 7.491e-23
Identity = 65/154 (42.21%), Postives = 84/154 (54.55%), Query Frame = 1
Query:  808 QYLRNA----PGFDSGSTAVLSLINRKTLKVYVANVGDSRCVLCRNGEA-----VDLSIDHKPEDEIESQRIAKAGGILSEDGRVNGGLNLSRSLGDHSYKKNKEIEMKDQMISAFPDIQTIDLKPHEDEFLVLACDGIWNTFSSQQLVEFVSK 1242
            Q+L  A    P +  GSTAV  L+   TL  YVAN+GDS+ ++CR   A     V LS DH P    E  RI KAGG + +DGRV G L +SRS+GD  +K+   I   D M     D          D FL+LACDG+W  FS  + V+++SK
Sbjct:   97 QFLHEASKGTPVWKDGSTAVSVLVINNTL--YVANLGDSKALVCRCDSAGKISVVRLSKDHSPTGYDERMRIQKAGGYV-KDGRVLGVLEVSRSIGDGRFKRCGVISTPDIMRCTLTD---------NDRFLLLACDGLWKGFSVDEAVKYISK 238          
BLAST of Protein phosphatase 1G vs. Ensembl Nematostella
Match: EDO44137 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RWJ9])

HSP 1 Score: 95.5153 bits (236), Expect = 6.740e-22
Identity = 56/144 (38.89%), Postives = 82/144 (56.94%), Query Frame = 1
Query:  829 GFDSGSTAVLSLINRKTLKVYVANVGDSRCVLCRNGEAVDLSIDHKPEDEIESQRIAKAGGILSEDG--RVNGGLNLSRSLGDHSYKKNKEIEMKDQMISAFPDIQTIDLKPHEDEFLVLACDGIWNTFSSQQLVEFVSKRTPT 1254
            G  SG TAV  LI  + L  Y+A +GDS+ +LC++GE ++L   HKPE + E  RI   GG +   G  RVNG L++SR++GD  +K           IS  PD+    L   E EF++LACDG+W+T   +Q ++ V +   +
Sbjct:  135 GLRSGCTAVSILITNEAL--YLAWLGDSQAILCKDGEFIELMQPHKPERQDEKDRIEGLGGCVVWFGAWRVNGSLSVSRAIGDAEHKP---------FISGEPDVAEYALDG-EQEFVILACDGLWDTVKPEQAIKLVKEHIAS 266          
BLAST of Protein phosphatase 1G vs. Ensembl Medaka
Match: ppm1g (protein phosphatase, Mg2+/Mn2+ dependent 1G [Source:NCBI gene;Acc:101166615])

HSP 1 Score: 227.254 bits (578), Expect = 8.248e-68
Identity = 114/221 (51.58%), Postives = 150/221 (67.87%), Query Frame = 1
Query:  793 CFPPFQYLRNAPGFDSGSTAVLSLINRKTLKVYVANVGDSRCVLCRNGEAVDLSIDHKPEDEIESQRIAKAGGILSEDGRVNGGLNLSRSLGDHSYKKNKEIEMKDQMISAFPDIQTIDLKPHEDEFLVLACDGIWNTFSSQQLVEFVSKRT------PTMSATDIISEIFSHCLAPNTSGDGTGCDNMTCIIITFKFPSPISICNGKSNKRRAATKELDE 1437
            C P     +  PG DSG+TAV++LI  K L   VAN GDSRCV+   G+AVD+S DHKPEDE+E  RI  AGG ++ DGRVNGGLNLSR++GDH YK+N  +  ++QMISA PD++ + L    D F+V+ACDGIWN  SSQ++V+F+S+R            + I+ E+  HCLAP+TSGDGTGCDNMTCII+TF+ P P    + K  K +   +E D+
Sbjct:  274 CLPGMDG-KEEPGSDSGTTAVVALIRGKQL--IVANAGDSRCVVSERGKAVDMSYDHKPEDELELARIKNAGGKVTMDGRVNGGLNLSRAIGDHFYKRNDALPPEEQMISAMPDVKVLTLNEDHD-FMVIACDGIWNVLSSQEVVDFISERLKPDEGGEVRPLSSIVEELLDHCLAPDTSGDGTGCDNMTCIIVTFQ-PHPTQSEDTKKRKIQEEAEETDK 489          

HSP 2 Score: 112.079 bits (279), Expect = 4.037e-26
Identity = 55/117 (47.01%), Postives = 75/117 (64.10%), Query Frame = 1
Query:   58 MGAYLSKPVTDKELESGEDAFLSYASGSMQGWRTSQEDAHNCILDFSSDYSLFAVYDGHGGPEVAQLCSQKLPDHIKNSVDFINGNYNDSLTNSFLSFDEAILSPEMQEALKKLANI 408
            MGAYLS+P T K    G ++ +SY   +MQGWR S EDAHNCI DF  D ++F+VYDGHGG EVA  CS+ LPD IK    + +G    +L ++FL+ D  I + ++   +K+L  I
Sbjct:    1 MGAYLSQPNTTKTSSDGGNSKMSYGFSAMQGWRVSMEDAHNCIPDFDVDTAMFSVYDGHGGEEVALYCSKYLPDIIKEQKTYKDGKLQKALEDAFLAIDGRITTADV---IKELVQI 114          
BLAST of Protein phosphatase 1G vs. Ensembl Medaka
Match: ppm1g (protein phosphatase, Mg2+/Mn2+ dependent 1G [Source:NCBI gene;Acc:101166615])

HSP 1 Score: 227.639 bits (579), Expect = 1.860e-67
Identity = 114/221 (51.58%), Postives = 150/221 (67.87%), Query Frame = 1
Query:  793 CFPPFQYLRNAPGFDSGSTAVLSLINRKTLKVYVANVGDSRCVLCRNGEAVDLSIDHKPEDEIESQRIAKAGGILSEDGRVNGGLNLSRSLGDHSYKKNKEIEMKDQMISAFPDIQTIDLKPHEDEFLVLACDGIWNTFSSQQLVEFVSKR------TPTMSATDIISEIFSHCLAPNTSGDGTGCDNMTCIIITFKFPSPISICNGKSNKRRAATKELDE 1437
            C P     +  PG DSG+TAV++LI  K L   VAN GDSRCV+   G+AVD+S DHKPEDE+E  RI  AGG ++ DGRVNGGLNLSR++GDH YK+N  +  ++QMISA PD++ + L    D F+V+ACDGIWN  SSQ++V+F+S+R            + I+ E+  HCLAP+TSGDGTGCDNMTCII+TF+ P P    + K  K +   +E D+
Sbjct:  330 CLPGMDG-KEEPGSDSGTTAVVALIRGKQL--IVANAGDSRCVVSERGKAVDMSYDHKPEDELELARIKNAGGKVTMDGRVNGGLNLSRAIGDHFYKRNDALPPEEQMISAMPDVKVLTLNEDHD-FMVIACDGIWNVLSSQEVVDFISERLKPDEGGEVRPLSSIVEELLDHCLAPDTSGDGTGCDNMTCIIVTFQ-PHPTQSEDTKKRKIQEEAEETDK 545          

HSP 2 Score: 112.464 bits (280), Expect = 4.737e-26
Identity = 55/117 (47.01%), Postives = 75/117 (64.10%), Query Frame = 1
Query:   58 MGAYLSKPVTDKELESGEDAFLSYASGSMQGWRTSQEDAHNCILDFSSDYSLFAVYDGHGGPEVAQLCSQKLPDHIKNSVDFINGNYNDSLTNSFLSFDEAILSPEMQEALKKLANI 408
            MGAYLS+P T K    G ++ +SY   +MQGWR S EDAHNCI DF  D ++F+VYDGHGG EVA  CS+ LPD IK    + +G    +L ++FL+ D  I + ++   +K+L  I
Sbjct:    1 MGAYLSQPNTTKTSSDGGNSKMSYGFSAMQGWRVSMEDAHNCIPDFDVDTAMFSVYDGHGGEEVALYCSKYLPDIIKEQKTYKDGKLQKALEDAFLAIDGRITTADV---IKELVQI 114          
BLAST of Protein phosphatase 1G vs. Ensembl Medaka
Match: ppm1lb (protein phosphatase, Mg2+/Mn2+ dependent 1L [Source:NCBI gene;Acc:101158218])

HSP 1 Score: 119.398 bits (298), Expect = 2.454e-29
Identity = 74/183 (40.44%), Postives = 110/183 (60.11%), Query Frame = 1
Query:  835 DSGSTAVLSLINRKTLKVYVANVGDSRCVLC-RNGEAVDLSIDHKPEDEIESQRIAKAGGILSEDG--RVNGGLNLSRSLGDHSYKKNKEIEMKDQMISAFPDIQTIDLKPHEDEFLVLACDGIWNTFSSQQLVEFVSKRT--PTMSATDIISEIFSHCLAPNTSGDGTGC-DNMTCIIITFK 1365
            ++G+T +++L++ K L V  ANVGDSR VLC +NG+A+ LS DHKP    E +RI KAGG +S +G  RV G L +SRSLGD+  K N  + + D      PD+ + DL   + +F++LA DG+W+TFS+++ V F+  R   P   A  I+ + F             GC DN+T +++ FK
Sbjct:  187 EAGTTCLVALLSDKELTV--ANVGDSRGVLCDKNGKAIPLSHDHKPYQLKERKRIKKAGGFISFNGSWRVQGILAMSRSLGDYPLK-NLNVVVSD------PDVMSFDLDKLQPQFMILASDGLWDTFSNEEAVRFIKDRLDEPHFGAKSIVLQSFYR-----------GCPDNITVMVVKFK 349          
BLAST of Protein phosphatase 1G vs. Ensembl Medaka
Match: ppm1nb (protein phosphatase 1B [Source:NCBI gene;Acc:101170947])

HSP 1 Score: 120.168 bits (300), Expect = 3.342e-29
Identity = 68/175 (38.86%), Postives = 103/175 (58.86%), Query Frame = 1
Query:  841 GSTAVLSLINRKTLKVYVANVGDSRCVLCRNGEAVDLSIDHKPEDEIESQRIAKAGGILSEDGRVNGGLNLSRSLGDHSYKKNKEIEMKDQMISAFPDIQTIDLKPHEDEFLVLACDGIWNTFSSQQLVEFVSKRTPTMSA-TDIISEIFSHCLAPNTSGDGTGCDNMTCIIITF 1362
            G+T V +LI+     +Y AN GDSR +LCR+G+    + DHKP   +E +RI  AGG +S   R+NG L +SR+LGD SYK  +      QM+S  P++  ++  P  DEFLVLACDG+W+T S+++L  F+  R    +   D+ +++   CL   +       DN++ I+I F
Sbjct:  175 GTTVVAALIS--PYYIYFANCGDSRAMLCRSGQVCFSTEDHKPFSPLEKERIESAGGTVSLQ-RINGSLAVSRALGDFSYKGAENRTPCQQMVSPEPEVCVVERSP-ADEFLVLACDGVWDTISNEELCAFIHNRLRVCNELRDVCAQVIDLCLYKGS------LDNISIILICF 339          

HSP 2 Score: 82.8037 bits (203), Expect = 1.456e-16
Identity = 48/119 (40.34%), Postives = 67/119 (56.30%), Query Frame = 1
Query:   67 YLSKPVTDKELESGEDAF-LSYASGSMQGWRTSQEDAHNCILDFS---SDYSLFAVYDGHGGPEVAQLCSQKLPDHIKNSVDFINGNYN-----DSLTNSFLSFDEAILSPEMQEALKK 396
            YL +PV DK  E G   + L+YA GSMQGWR + ED HNC+       +D+S FAV+DGH G  VAQ CSQ L  HI  + D I  + N      ++ + F+  D+ + S   +E  ++
Sbjct:   56 YLDRPVLDKLTEEGCVRWGLTYALGSMQGWRANMEDFHNCVPQLGGELADWSFFAVFDGHAGSTVAQYCSQHLLGHIL-AADGIAADDNPEKVRGAIIDGFMQTDKHLHSVARREGWER 173          
BLAST of Protein phosphatase 1G vs. Ensembl Medaka
Match: ppm1la (protein phosphatase 1L [Source:NCBI gene;Acc:101174949])

HSP 1 Score: 117.472 bits (293), Expect = 1.461e-28
Identity = 74/183 (40.44%), Postives = 109/183 (59.56%), Query Frame = 1
Query:  835 DSGSTAVLSLINRKTLKVYVANVGDSRCVLC-RNGEAVDLSIDHKPEDEIESQRIAKAGGILSEDG--RVNGGLNLSRSLGDHSYKKNKEIEMKDQMISAFPDIQTIDLKPHEDEFLVLACDGIWNTFSSQQLVEFVSKRT--PTMSATDIISEIFSHCLAPNTSGDGTGC-DNMTCIIITFK 1365
            ++G+T +++L++ + L V  ANVGDSR VLC ++G A+ LS DHKP    E +RI +AGG +S +G  RV G L +SRSLGD+  K N  + + D      PDI T DL   + EF++LA DG+W+ FS+++ V FV +R   P   A  I+ + F             GC DN+T +++ FK
Sbjct:  190 EAGTTCLVALLSDRELTV--ANVGDSRGVLCDKDGNAIALSHDHKPYQLKERKRIKRAGGFISFNGSWRVQGILAMSRSLGDYPLK-NLNVVIPD------PDIMTFDLDKLQPEFMILASDGLWDAFSNEEAVRFVRERLDEPHFGAKSIVLQSFYR-----------GCPDNITVMVVKFK 352          
BLAST of Protein phosphatase 1G vs. Planmine SMEST
Match: SMESG000030206.1 (SMESG000030206.1)

HSP 1 Score: 781.941 bits (2018), Expect = 0.000e+0
Identity = 478/479 (99.79%), Postives = 479/479 (100.00%), Query Frame = 1
Query:   58 MGAYLSKPVTDKELESGEDAFLSYASGSMQGWRTSQEDAHNCILDFSSDYSLFAVYDGHGGPEVAQLCSQKLPDHIKNSVDFINGNYNDSLTNSFLSFDEAILSPEMQEALKKLANIDDAKSXXXXXXXXXXXXXXXXXXXXXILKKYQMALKXXXXXXXXXXXXXXXXXXXKVKRPESSDIVNNGVKSLKKVQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXCFPPFQYLRNAPGFDSGSTAVLSLINRKTLKVYVANVGDSRCVLCRNGEAVDLSIDHKPEDEIESQRIAKAGGILSEDGRVNGGLNLSRSLGDHSYKKNKEIEMKDQMISAFPDIQTIDLKPHEDEFLVLACDGIWNTFSSQQLVEFVSKRTPTMSATDIISEIFSHCLAPNTSGDGTGCDNMTCIIITFKFPSPISICNGKSNKRRAATKELDEESIPTAKLIKTQTEESVKI 1494
            MGAYLSKPVTDKELESGEDAFLSYASGSMQGWRTSQEDAHNCILDFSSDYSLFAVYDGHGGPEVAQLCSQKLPDHIKNSVDFINGNYNDSLTNSFLSFDEAILSPEMQEALKKLANIDDAKSE+EEEDDAALLQEEALAPLSEILKKYQMALKSSSDDEIEIENHEEDEQEEKVKRPESSDIVNNGVKSLKKVQEVTEEEEEDDDDEEFVVEDEEEIEDENDDENDEEDEEEEEENESEDSENNSCFPPFQYLRNAPGFDSGSTAVLSLINRKTLKVYVANVGDSRCVLCRNGEAVDLSIDHKPEDEIESQRIAKAGGILSEDGRVNGGLNLSRSLGDHSYKKNKEIEMKDQMISAFPDIQTIDLKPHEDEFLVLACDGIWNTFSSQQLVEFVSKRTPTMSATDIISEIFSHCLAPNTSGDGTGCDNMTCIIITFKFPSPISICNGKSNKRRAATKELDEESIPTAKLIKTQTEESVKI
Sbjct:    1 MGAYLSKPVTDKELESGEDAFLSYASGSMQGWRTSQEDAHNCILDFSSDYSLFAVYDGHGGPEVAQLCSQKLPDHIKNSVDFINGNYNDSLTNSFLSFDEAILSPEMQEALKKLANIDDAKSEVEEEDDAALLQEEALAPLSEILKKYQMALKSSSDDEIEIENHEEDEQEEKVKRPESSDIVNNGVKSLKKVQEVTEEEEEDDDDEEFVVEDEEEIEDENDDENDEEDEEEEEENESEDSENNSCFPPFQYLRNAPGFDSGSTAVLSLINRKTLKVYVANVGDSRCVLCRNGEAVDLSIDHKPEDEIESQRIAKAGGILSEDGRVNGGLNLSRSLGDHSYKKNKEIEMKDQMISAFPDIQTIDLKPHEDEFLVLACDGIWNTFSSQQLVEFVSKRTPTMSATDIISEIFSHCLAPNTSGDGTGCDNMTCIIITFKFPSPISICNGKSNKRRAATKELDEESIPTAKLIKTQTEESVKI 479          
BLAST of Protein phosphatase 1G vs. Planmine SMEST
Match: SMESG000022854.1 (SMESG000022854.1)

HSP 1 Score: 142.51 bits (358), Expect = 3.925e-38
Identity = 74/181 (40.88%), Postives = 110/181 (60.77%), Query Frame = 1
Query:  838 SGSTAVLSLINRKTLKVYVANVGDSRCVLCRNGEAVDLSIDHKPEDEIESQRIAKAGGILSEDGRVNGGLNLSRSLGDHSYKKNKEIEMKDQMISAFPDIQTIDLKPHEDEFLVLACDGIWNTFSSQQLVEFVSKRTPT-MSATDIISEIFSHCLAPNTSGDGTGCDNMTCIIITFKFPSP 1377
            +GST ++ L+  K   +Y  N GDSR V    G AV LS DHKP  + E +RI  AGG +  + RVNG L LSR+LGD  +KKN +   ++Q+++A PD+  +  K  + EF+++ACDGIW+  ++Q+++ F+ +R    +  T I  E+   CLAP+    G GCDNMT ++I F    P
Sbjct:  115 AGSTGIIILM--KDNNIYCGNAGDSRAVASVGGRAVSLSHDHKPSIQAERERIISAGGWVDWN-RVNGNLALSRALGDFVFKKNTKRTAEEQIVTANPDV-IVKEKNDDYEFIIMACDGIWDVLTNQEVINFIRQRIANGLDPTHICEELMMRCLAPDCQNSGLGCDNMTVLLICFLNDQP 291          

HSP 2 Score: 76.2554 bits (186), Expect = 6.730e-15
Identity = 45/117 (38.46%), Postives = 63/117 (53.85%), Query Frame = 1
Query:   58 MGAYLSKPVTDKELESGEDAFLSYASGSMQGWRTSQEDAHNCILDFSSD--YSLFAVYDGHGGPEVAQLCSQKLPDHIKNSVDFINGNYNDSLTNSFLSFDEAILSPEMQEALKKLA 402
            MG  LS+PVT KE     +  L  +S  MQGWR   EDAH   L+  SD   S F V+DGHGG +VAQ     L   +    ++  G+  +++  SFL+ D+ +L  E +E   +LA
Sbjct:    1 MGQTLSEPVTSKETNQYGNNSLLVSSSCMQGWRIHMEDAHTGYLNLPSDKSASYFGVFDGHGGTKVAQYAGNNLHKLLTAQAEYEKGDLPEAIRKSFLALDQNML--EDKEVRDELA 115          
BLAST of Protein phosphatase 1G vs. Planmine SMEST
Match: SMESG000032910.1 (SMESG000032910.1)

HSP 1 Score: 111.309 bits (277), Expect = 3.536e-27
Identity = 63/177 (35.59%), Postives = 100/177 (56.50%), Query Frame = 1
Query:  838 SGSTAVLSLINRKTLKVYVANVGDSRCVLCRNGEAVDLSIDHKPEDEIESQRIAKAGGILSEDGRVNGGLNLSRSLGDHSYKKNKEIEMKDQMISAFPDIQTIDLKPHEDEFLVLACDGIWNTFSSQQLVEFVSKRTP-TMSATDIISEIFSHCLAPNTSGDGTGCDNMTCIIITFK 1365
            SGSTAV  L++ K   ++ AN GDSR +L R+G+    ++DHKP + +E +RI  AGG +    RVNG L +SR++GD  YK        +Q++S  P++  +D   + DE LVLACDGIW+  ++  + +F+  R   +     I +E    CL   +       DNM+ +++ F+
Sbjct:   36 SGSTAVCVLVSPK--HIFFANCGDSRALLIRDGKVCFATVDHKPANPVEKERIQNAGGSVMIQ-RVNGSLAVSRAIGDFEYKNVDGKGPTEQLVSPEPEVTVLDRDNNNDELLVLACDGIWDVMTNDDICQFLQHRIRCSDDLMKICNETIDTCLYKGSR------DNMSIVLVAFE 203          
BLAST of Protein phosphatase 1G vs. Planmine SMEST
Match: SMESG000032910.1 (SMESG000032910.1)

HSP 1 Score: 111.309 bits (277), Expect = 1.615e-26
Identity = 63/177 (35.59%), Postives = 100/177 (56.50%), Query Frame = 1
Query:  838 SGSTAVLSLINRKTLKVYVANVGDSRCVLCRNGEAVDLSIDHKPEDEIESQRIAKAGGILSEDGRVNGGLNLSRSLGDHSYKKNKEIEMKDQMISAFPDIQTIDLKPHEDEFLVLACDGIWNTFSSQQLVEFVSKRTP-TMSATDIISEIFSHCLAPNTSGDGTGCDNMTCIIITFK 1365
            SGSTAV  L++ K   ++ AN GDSR +L R+G+    ++DHKP + +E +RI  AGG +    RVNG L +SR++GD  YK        +Q++S  P++  +D   + DE LVLACDGIW+  ++  + +F+  R   +     I +E    CL   +       DNM+ +++ F+
Sbjct:  127 SGSTAVCVLVSPK--HIFFANCGDSRALLIRDGKVCFATVDHKPANPVEKERIQNAGGSVMIQ-RVNGSLAVSRAIGDFEYKNVDGKGPTEQLVSPEPEVTVLDRDNNNDELLVLACDGIWDVMTNDDICQFLQHRIRCSDDLMKICNETIDTCLYKGSR------DNMSIVLVAFE 294          

HSP 2 Score: 82.0333 bits (201), Expect = 1.363e-16
Identity = 45/114 (39.47%), Postives = 60/114 (52.63%), Query Frame = 1
Query:   58 MGAYLSKPVTDKELESGEDAFLSYASGSMQGWRTSQEDAHNCILDFSSD---YSLFAVYDGHGGPEVAQLCSQKLPDHIKNSVDFIN---------GNYNDSLTNSFLSFDEAI 363
            MGA+L KP TDK  ESG    L +   SMQGWR   EDAH  I   S +   +S FAV+DGH G  V+++C+ +L  +I  + +F N             D +   FL+ DE I
Sbjct:    1 MGAFLDKPKTDKHNESGIGNGLRFGLASMQGWRIEMEDAHCAITQLSGNLGGWSFFAVFDGHAGARVSEICAAQLLKNIVETEEFKNIDPEMAPSVQEIRDGIREGFLTLDERI 114          
BLAST of Protein phosphatase 1G vs. Planmine SMEST
Match: SMESG000072821.1 (SMESG000072821.1)

HSP 1 Score: 110.923 bits (276), Expect = 3.663e-26
Identity = 70/177 (39.55%), Postives = 98/177 (55.37%), Query Frame = 1
Query:  838 SGSTAVLSLINRKTLKVYVANVGDSRCVLCRNGEAVDLSIDHKPEDEIESQRIAKAGGILSEDGRVNGGLNLSRSLGDHSYKKNKEIEMKDQMISAFPDIQTIDLKPHEDEFLVLACDGIWNTFSSQQLVEFVSKRTPTMS-ATDIISEIFSHCLAPNTSGDGTGCDNMTCIIITFK 1365
            SGST +   +  K   V  AN GDSR VL R+      + DHKP + IE  RI KAGG +    R+NG L +SRSLGD  YKK       +Q++S  P+I  I+    ED+ +VLACDG+W+  S+++L EFV  R   +   + I  E+  +CL   +       DNM+ +II+ K
Sbjct:  130 SGSTVISVFVTPKY--VIFANCGDSRGVLIRSNTVHFSTEDHKPMNPIERDRIIKAGGTVMIQ-RINGSLAVSRSLGDFDYKKVDSKGPTEQLVSPDPEITVIEKVNDEDQLIVLACDGVWDVMSNEELGEFVIHRCQRVKDLSKIAEEVIDNCLYKGSR------DNMSVVIISTK 297          

HSP 2 Score: 80.8777 bits (198), Expect = 3.606e-16
Identity = 45/117 (38.46%), Postives = 59/117 (50.43%), Query Frame = 1
Query:   58 MGAYLSKPVTDKELESGEDAFLSYASGSMQGWRTSQEDAHNCILDFSS---DYSLFAVYDGHGGPEVAQLCSQKLPDHIKNSVDFINGNYND------------SLTNSFLSFDEAI 363
            MGA+L KP T+K   S     LSY   +MQGWR   EDAH  IL   +    ++ F VYDGH G  V+++CSQKL   I N+ +F     +D             + N FL  D+ I
Sbjct:    1 MGAFLEKPKTEKSSHSESGQNLSYGLSAMQGWRIDMEDAHTSILSLPAPFKSWAYFGVYDGHAGSSVSEICSQKLLPSILNTSEFKKMELDDFGNPVDVELAKRGIRNGFLELDKTI 117          
The following BLAST results are available for this feature:
BLAST of Protein phosphatase 1G vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PPM1G6.157e-6452.13protein phosphatase, Mg2+/Mn2+ dependent 1G [Sourc... [more]
PPM1L1.644e-2939.89protein phosphatase, Mg2+/Mn2+ dependent 1L [Sourc... [more]
PPM1L3.147e-2939.89protein phosphatase, Mg2+/Mn2+ dependent 1L [Sourc... [more]
PPM1L7.199e-2839.89protein phosphatase, Mg2+/Mn2+ dependent 1L [Sourc... [more]
PPM1A2.576e-2738.07protein phosphatase, Mg2+/Mn2+ dependent 1A [Sourc... [more]
back to top
BLAST of Protein phosphatase 1G vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ppm-1.G2.119e-6459.44Probable protein phosphatase 2C F42G9.1 [Source:U... [more]
ppm-1.G3.523e-6459.44Probable protein phosphatase 2C F42G9.1 [Source:U... [more]
ppm-22.465e-3946.63Probable protein phosphatase 2C T23F11.1 [Source:... [more]
ppm-22.465e-3946.63Probable protein phosphatase 2C T23F11.1 [Source:... [more]
ppm-22.465e-3946.63Probable protein phosphatase 2C T23F11.1 [Source:... [more]
back to top
BLAST of Protein phosphatase 1G vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG104172.205e-6559.67gene:FBgn0033021 transcript:FBtr0086091[more]
CG104172.205e-6559.67gene:FBgn0033021 transcript:FBtr0086092[more]
CG177461.512e-4142.40gene:FBgn0035425 transcript:FBtr0073094[more]
CG177461.512e-4142.40gene:FBgn0035425 transcript:FBtr0073093[more]
Ppm11.412e-3638.28gene:FBgn0035143 transcript:FBtr0072553[more]
back to top
BLAST of Protein phosphatase 1G vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ppm1g1.146e-6951.29protein phosphatase, Mg2+/Mn2+ dependent, 1G [Sour... [more]
ppm1g8.305e-5754.14protein phosphatase, Mg2+/Mn2+ dependent, 1G [Sour... [more]
ppm1lb6.427e-3040.44protein phosphatase, Mg2+/Mn2+ dependent, 1Lb [Sou... [more]
ppm1la9.547e-2940.98protein phosphatase, Mg2+/Mn2+ dependent, 1La [Sou... [more]
ppm1nb3.720e-2837.99protein phosphatase, Mg2+/Mn2+ dependent, 1Nb (put... [more]
back to top
BLAST of Protein phosphatase 1G vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ppm1g8.435e-6853.42protein phosphatase, Mg2+/Mn2+ dependent 1G [Sourc... [more]
ppm1g9.302e-6856.22protein phosphatase, Mg2+/Mn2+ dependent 1G [Sourc... [more]
ppm1g1.711e-6454.37protein phosphatase, Mg2+/Mn2+ dependent 1G [Sourc... [more]
ppm1g6.145e-6352.36protein phosphatase, Mg2+/Mn2+ dependent 1G [Sourc... [more]
ppm1g4.074e-5052.91protein phosphatase, Mg2+/Mn2+ dependent 1G [Sourc... [more]
back to top
BLAST of Protein phosphatase 1G vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ppm1g2.787e-6551.66protein phosphatase 1G (formerly 2C), magnesium-de... [more]
Ppm1g4.004e-6451.66protein phosphatase 1G (formerly 2C), magnesium-de... [more]
Ppm1b8.027e-2938.46protein phosphatase 1B, magnesium dependent, beta ... [more]
Ppm1b8.264e-2938.46protein phosphatase 1B, magnesium dependent, beta ... [more]
Ppm1b8.264e-2938.46protein phosphatase 1B, magnesium dependent, beta ... [more]
back to top
BLAST of Protein phosphatase 1G vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q7K4Q5|Y0417_DROME2.210e-6459.67Probable protein phosphatase CG10417 OS=Drosophila... [more]
sp|Q4R4V2|PPM1G_MACFA2.402e-6352.13Protein phosphatase 1G OS=Macaca fascicularis OX=9... [more]
sp|Q61074|PPM1G_MOUSE2.801e-6351.66Protein phosphatase 1G OS=Mus musculus OX=10090 GN... [more]
sp|O15355|PPM1G_HUMAN2.957e-6352.13Protein phosphatase 1G OS=Homo sapiens OX=9606 GN=... [more]
sp|P79126|PPM1G_BOVIN3.952e-6351.66Protein phosphatase 1G OS=Bos taurus OX=9913 GN=PP... [more]
back to top
BLAST of Protein phosphatase 1G vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A443SP851.801e-7455.41PPM-type phosphatase domain-containing protein OS=... [more]
A0A1Y1M5J22.690e-7454.95PPM-type phosphatase domain-containing protein OS=... [more]
Q17L519.136e-7457.97AAEL001462-PA OS=Aedes aegypti OX=7159 GN=AAEL0014... [more]
A0A1B6ML217.214e-7154.05PPM-type phosphatase domain-containing protein OS=... [more]
A0A4D5RKD51.927e-7056.78Protein phosphatase (Fragment) OS=Ixodes scapulari... [more]
back to top
BLAST of Protein phosphatase 1G vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ppm1g4.887e-7152.16protein phosphatase, Mg2+/Mn2+ dependent 1G [Sourc... [more]
ppm1la1.904e-2939.90protein phosphatase, Mg2+/Mn2+ dependent, 1La [Sou... [more]
ppm1la4.182e-2940.32protein phosphatase, Mg2+/Mn2+ dependent, 1La [Sou... [more]
ppm1nb4.513e-2939.11protein phosphatase 1A [Source:NCBI gene;Acc:10304... [more]
ppm1ba1.397e-2738.30protein phosphatase, Mg2+/Mn2+ dependent 1B [Sourc... [more]
back to top
BLAST of Protein phosphatase 1G vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000003549.12.272e-4043.02pep scaffold:Pmarinus_7.0:GL496710:143:1226:1 gene... [more]
ENSPMAT00000003550.12.863e-4043.02pep scaffold:Pmarinus_7.0:GL496710:143:1226:1 gene... [more]
ppm1aa2.411e-2634.53protein phosphatase, Mg2+/Mn2+ dependent, 1Aa [Sou... [more]
si:ch211-149b19.35.961e-2135.93si:ch211-149b19.3 [Source:ZFIN;Acc:ZDB-GENE-110411... [more]
ENSPMAT00000006941.18.227e-1935.53pep scaffold:Pmarinus_7.0:GL476378:621905:629923:1... [more]
back to top
BLAST of Protein phosphatase 1G vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
PTC32.010e-3441.24Type 2C protein phosphatase (PP2C); dephosphorylat... [more]
PTC21.543e-3340.45Type 2C protein phosphatase (PP2C); dephosphorylat... [more]
PTC41.428e-2735.90Cytoplasmic type 2C protein phosphatase (PP2C); id... [more]
PTC18.433e-2435.44Type 2C protein phosphatase (PP2C); dephosphorylat... [more]
CYR18.112e-729.51Adenylate cyclase; required for cAMP production an... [more]
back to top
BLAST of Protein phosphatase 1G vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO314906.628e-6657.14Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO404491.394e-4449.39Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO360405.905e-2738.98Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO396037.491e-2342.21Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO441376.740e-2238.89Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Protein phosphatase 1G vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ppm1g8.248e-6851.58protein phosphatase, Mg2+/Mn2+ dependent 1G [Sourc... [more]
ppm1g1.860e-6751.58protein phosphatase, Mg2+/Mn2+ dependent 1G [Sourc... [more]
ppm1lb2.454e-2940.44protein phosphatase, Mg2+/Mn2+ dependent 1L [Sourc... [more]
ppm1nb3.342e-2938.86protein phosphatase 1B [Source:NCBI gene;Acc:10117... [more]
ppm1la1.461e-2840.44protein phosphatase 1L [Source:NCBI gene;Acc:10117... [more]
back to top
BLAST of Protein phosphatase 1G vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000030206.10.000e+099.79SMESG000030206.1[more]
SMESG000022854.13.925e-3840.88SMESG000022854.1[more]
SMESG000032910.13.536e-2735.59SMESG000032910.1[more]
SMESG000032910.11.615e-2635.59SMESG000032910.1[more]
SMESG000072821.13.663e-2639.55SMESG000072821.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30008984 ID=SMED30008984|Name=Protein phosphatase 1G|organism=Schmidtea mediterranea sexual|type=transcript|length=1550bp
ATATTTACTTTTGCTTAAATTCTATATTTATTTAAAAGTCAAGATCTTTT
TTAATAAATGGGAGCTTATCTTTCAAAACCGGTAACTGATAAAGAGCTTG
AATCAGGAGAAGATGCATTTTTGAGTTATGCGAGTGGTTCAATGCAAGGA
TGGCGTACTAGTCAAGAAGATGCTCACAATTGCATTTTAGATTTTAGTAG
TGATTACTCTTTGTTTGCTGTATATGATGGTCACGGTGGACCTGAAGTAG
CTCAGTTATGCTCGCAAAAATTGCCTGATCACATTAAAAATTCAGTTGAT
TTTATTAACGGAAATTATAATGATTCATTAACAAATTCATTTTTGTCATT
TGACGAAGCAATTTTGTCTCCGGAGATGCAAGAAGCATTAAAGAAGTTAG
CAAATATTGATGATGCAAAAAGTGAAATTGAAGAAGAGGATGATGCAGCA
CTTTTACAAGAAGAAGCTTTAGCACCTCTTAGCGAAATATTAAAAAAATA
TCAGATGGCGCTTAAAAGCTCTAGTGACGATGAGATAGAGATAGAAAATC
ACGAAGAAGATGAACAAGAAGAAAAAGTTAAACGACCAGAATCATCAGAT
ATTGTAAATAATGGAGTAAAATCTCTGAAAAAAGTTCAAGAGGTAACTGA
AGAAGAAGAAGAGGATGATGACGATGAAGAATTTGTTGTCGAGGATGAAG
AGGAGATTGAGGATGAGAACGATGATGAAAATGATGAGGAAGATGAAGAA
GAGGAAGAAGAAAACGAAAGTGAAGATAGTGAAAACAATTCTTGTTTTCC
TCCATTTCAATATCTACGTAATGCTCCGGGTTTCGACAGTGGCAGTACTG
CTGTTTTGTCTCTGATCAATAGAAAAACACTGAAGGTTTATGTGGCGAAT
GTCGGCGATTCGAGATGCGTTTTGTGCCGAAACGGAGAGGCAGTGGATTT
GTCGATTGACCATAAACCGGAAGACGAAATCGAATCTCAGAGAATTGCAA
AAGCCGGTGGAATTCTGAGTGAAGACGGCCGAGTCAATGGTGGATTGAAT
CTCAGCCGTTCTCTGGGCGATCACAGCTACAAGAAAAACAAAGAGATTGA
AATGAAAGATCAAATGATATCGGCATTTCCGGACATTCAAACGATTGATT
TGAAACCGCATGAAGATGAATTTCTCGTGTTGGCTTGCGATGGAATTTGG
AATACATTTTCTAGTCAGCAGTTGGTCGAGTTCGTCAGTAAGCGCACGCC
AACAATGTCAGCTACCGATATTATTTCAGAGATATTCTCTCATTGCTTGG
CTCCAAATACATCTGGAGACGGGACCGGTTGCGACAATATGACTTGCATC
ATCATCACCTTCAAGTTTCCCTCTCCCATCAGCATCTGCAACGGGAAATC
CAATAAAAGGCGAGCAGCAACCAAGGAACTCGACGAGGAATCTATTCCGA
CTGCGAAACTGATTAAGACTCAAACGGAAGAATCTGTAAAAATTTAAAAC
TTATTTTGCAGAAATTTTTTAATAATAAAAATATTGTACGGCTTAAAAAA
back to top

protein sequence of SMED30008984-orf-1

>SMED30008984-orf-1 ID=SMED30008984-orf-1|Name=SMED30008984-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=480bp
MGAYLSKPVTDKELESGEDAFLSYASGSMQGWRTSQEDAHNCILDFSSDY
SLFAVYDGHGGPEVAQLCSQKLPDHIKNSVDFINGNYNDSLTNSFLSFDE
AILSPEMQEALKKLANIDDAKSEIEEEDDAALLQEEALAPLSEILKKYQM
ALKSSSDDEIEIENHEEDEQEEKVKRPESSDIVNNGVKSLKKVQEVTEEE
EEDDDDEEFVVEDEEEIEDENDDENDEEDEEEEEENESEDSENNSCFPPF
QYLRNAPGFDSGSTAVLSLINRKTLKVYVANVGDSRCVLCRNGEAVDLSI
DHKPEDEIESQRIAKAGGILSEDGRVNGGLNLSRSLGDHSYKKNKEIEMK
DQMISAFPDIQTIDLKPHEDEFLVLACDGIWNTFSSQQLVEFVSKRTPTM
SATDIISEIFSHCLAPNTSGDGTGCDNMTCIIITFKFPSPISICNGKSNK
RRAATKELDEESIPTAKLIKTQTEESVKI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000429neoblast
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR036457PPM-type_dom_sf
IPR015655PP2C
IPR001932PPM-type_phosphatase_dom
IPR000222PP2C_BS
Vocabulary: molecular function
TermDefinition
GO:0003824catalytic activity
GO:0043169cation binding
GO:0004721phosphoprotein phosphatase activity
GO:0004722protein serine/threonine phosphatase activity
GO:0016787hydrolase activity
GO:0046872metal ion binding
Vocabulary: biological process
TermDefinition
GO:0006470protein dephosphorylation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 210..244
NoneNo IPR availableCOILSCoilCoilcoord: 107..127
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 157..245
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 197..241
NoneNo IPR availablePANTHERPTHR13832:SF656coord: 239..444
NoneNo IPR availablePANTHERPTHR13832:SF656coord: 1..109
IPR001932PPM-type phosphatase domainSMARTSM00332PP2C_4coord: 13..433
e-value: 7.6E-89
score: 311.1
IPR001932PPM-type phosphatase domainPFAMPF00481PP2Ccoord: 258..419
e-value: 2.1E-51
score: 175.1
coord: 24..107
e-value: 4.8E-13
score: 49.3
IPR001932PPM-type phosphatase domainPROSITEPS51746PPM_2coord: 23..435
score: 48.532
IPR001932PPM-type phosphatase domainCDDcd00143PP2Cccoord: 23..435
e-value: 6.06296E-65
score: 208.335
IPR036457PPM-type phosphatase domain superfamilyGENE3DG3DSA:3.60.40.10coord: 1..135
e-value: 1.0E-29
score: 105.8
coord: 177..436
e-value: 4.2E-65
score: 222.0
IPR036457PPM-type phosphatase domain superfamilySUPERFAMILYSSF81606PP2C-likecoord: 3..436
IPR015655Protein phosphatase 2C familyPANTHERPTHR13832PROTEIN PHOSPHATASE 2Ccoord: 1..109
IPR015655Protein phosphatase 2C familyPANTHERPTHR13832PROTEIN PHOSPHATASE 2Ccoord: 239..444
IPR000222PPM-type phosphatase, divalent cation bindingPROSITEPS01032PPM_1coord: 52..60