3'-5' exoribonuclease 1

Overview
Name3'-5' exoribonuclease 1
Smed IDSMED30008965
Length (bp)1429
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of 3'-5' exoribonuclease 1 (SMED30008965) t-SNE clustered cells

Violin plots show distribution of expression levels for 3'-5' exoribonuclease 1 (SMED30008965) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of 3'-5' exoribonuclease 1 (SMED30008965) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for 3'-5' exoribonuclease 1 (SMED30008965) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30008965

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30008965h1SMcG0003796 dd_Smed_v4_9578_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30008965h1SMcG0003796 dd_Smed_v4_9578_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30008965h1SMcG0003796 dd_Smed_v4_9578_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30008965h1SMcG0003796 dd_Smed_v4_9578_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
reproductive organSMED30008965h1SMcG0003796 Contig39923newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30008965h1SMcG0003796 Contig39923uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of 3'-5' exoribonuclease 1 vs. Ensembl Human
Match: ERI1 (exoribonuclease 1 [Source:HGNC Symbol;Acc:HGNC:23994])

HSP 1 Score: 204.912 bits (520), Expect = 3.342e-61
Identity = 113/281 (40.21%), Postives = 167/281 (59.43%), Query Frame = 2
Query:  116 ESDKYKYSNTANFKYNNSKQYALNTNRINKMPDEQLVGTLKYHGLNAKGSPEILRKRLKEFMKIQ--MNPDNNEISSQNDSKIYAYFLIIDFEATCDEINGLNFQHEIIEFPIILYDVILKRKVDVFHAYCKPFINPALSRFCMNLTNINQCTIDSAKSFPDVLTEVEQWLNKHHMFGK-SFAVVCDCNADMAKFMRIQCEISNIEFPFWCKQWINIMKSFRQFYTV-STDVKLNMQKMLSSLGLEFEGRQHSGLNDAENILRITETMMHDGCFLRINEKL 946
            +  K+  S+ ++F     K+ A+    IN+M  E+L   L    L  +G  ++L+KRLK + K Q  M  ++N   S      Y Y  IIDFEATC+E N   F HEIIEFP++L +       D F  Y +P IN  LS FC++LT I Q  +D A +FP VL +V  W+    +  K  ++++ D + DM+KF+ IQC++S +++P + K+WINI KS+  FY V  +  KL +  ML  LG++++GR H GL+D++NI RI   M+ DGC LRINEK+
Sbjct:   49 KGSKFITSSASDFSDPVYKEIAITNGCINRMSKEELRAKLSEFKLETRGVKDVLKKRLKNYYKKQKLMLKESNFADS-----YYDYICIIDFEATCEEGNPPEFVHEIIEFPVVLLNTHTLEIEDTFQQYVRPEINTQLSDFCISLTGITQDQVDRADTFPQVLKKVIDWMKLKELGTKYKYSLLTDGSWDMSKFLNIQCQLSRLKYPPFAKKWINIRKSYGNFYKVPRSQTKLTI--MLEKLGMDYDGRPHCGLDDSKNIARIAVRMLQDGCELRINEKM 322          
BLAST of 3'-5' exoribonuclease 1 vs. Ensembl Human
Match: ERI1 (exoribonuclease 1 [Source:HGNC Symbol;Acc:HGNC:23994])

HSP 1 Score: 204.912 bits (520), Expect = 3.342e-61
Identity = 113/281 (40.21%), Postives = 167/281 (59.43%), Query Frame = 2
Query:  116 ESDKYKYSNTANFKYNNSKQYALNTNRINKMPDEQLVGTLKYHGLNAKGSPEILRKRLKEFMKIQ--MNPDNNEISSQNDSKIYAYFLIIDFEATCDEINGLNFQHEIIEFPIILYDVILKRKVDVFHAYCKPFINPALSRFCMNLTNINQCTIDSAKSFPDVLTEVEQWLNKHHMFGK-SFAVVCDCNADMAKFMRIQCEISNIEFPFWCKQWINIMKSFRQFYTV-STDVKLNMQKMLSSLGLEFEGRQHSGLNDAENILRITETMMHDGCFLRINEKL 946
            +  K+  S+ ++F     K+ A+    IN+M  E+L   L    L  +G  ++L+KRLK + K Q  M  ++N   S      Y Y  IIDFEATC+E N   F HEIIEFP++L +       D F  Y +P IN  LS FC++LT I Q  +D A +FP VL +V  W+    +  K  ++++ D + DM+KF+ IQC++S +++P + K+WINI KS+  FY V  +  KL +  ML  LG++++GR H GL+D++NI RI   M+ DGC LRINEK+
Sbjct:   49 KGSKFITSSASDFSDPVYKEIAITNGCINRMSKEELRAKLSEFKLETRGVKDVLKKRLKNYYKKQKLMLKESNFADS-----YYDYICIIDFEATCEEGNPPEFVHEIIEFPVVLLNTHTLEIEDTFQQYVRPEINTQLSDFCISLTGITQDQVDRADTFPQVLKKVIDWMKLKELGTKYKYSLLTDGSWDMSKFLNIQCQLSRLKYPPFAKKWINIRKSYGNFYKVPRSQTKLTI--MLEKLGMDYDGRPHCGLDDSKNIARIAVRMLQDGCELRINEKM 322          
BLAST of 3'-5' exoribonuclease 1 vs. Ensembl Human
Match: ERI2 (ERI1 exoribonuclease family member 2 [Source:HGNC Symbol;Acc:HGNC:30541])

HSP 1 Score: 116.701 bits (291), Expect = 6.884e-29
Identity = 66/251 (26.29%), Postives = 114/251 (45.42%), Query Frame = 2
Query:  275 LRKRLKEFMKIQMNPDNNEISSQNDSKIYAYFLIIDFEATCDEINGLNFQHEIIEFPIILYDVILKRKVDVFHAYCKPFINPALSRFCMNLTNINQCTIDSAKSFPDVLTEVEQWLNKHH-----MFGKSF-----------AVVCDCNADMAKFMRIQCEISNIEFPFWCKQWINIMKSFRQFYTVSTDVKLNMQKMLSSLGLEFEGRQHSGLNDAENILRITETMMHDGCFLRINEKLDPFPPHFTASV 979
            L ++L    +  + P N  +      +++ Y ++IDFE+TC      +   EIIEFP +L +    +    F AY +P  +P LS FCM LT I Q  +D        L++  +W++K       +F               A V   + D+   +  +C+   +  P +   WI++  +++ FY         +   L  +G+EF GR+HSGL+D+ N   +   M+ DGC ++I   L+   P    +V
Sbjct:    6 LARQLGLIRRKSIAPANGNLGRSKSKQLFDYLIVIDFESTCWNDGKHHHSQEIIEFPAVLLNTSTGQIDSEFQAYVQPQEHPILSEFCMELTGIKQAQVDEGVPLKICLSQFCKWIHKIQQQKNIIFATGISEPSASEVKLCAFVTWSDWDLGVCLEYECKRKQLLKPVFLNSWIDLRATYKLFYRRKPK---GLSGALQEVGIEFSGREHSGLDDSRNTALLAWKMIRDGCVMKITRSLNKVVPKGIHAV 253          
BLAST of 3'-5' exoribonuclease 1 vs. Ensembl Human
Match: ERI2 (ERI1 exoribonuclease family member 2 [Source:HGNC Symbol;Acc:HGNC:30541])

HSP 1 Score: 117.472 bits (293), Expect = 9.635e-29
Identity = 79/326 (24.23%), Postives = 141/326 (43.25%), Query Frame = 2
Query:  275 LRKRLKEFMKIQMNPDNNEISSQNDSKIYAYFLIIDFEATCDEINGLNFQHEIIEFPIILYDVILKRKVDVFHAYCKPFINPALSRFCMNLTNINQCTIDSAKSFPDVLTEVEQWLNKHH-----MFGKSF-----------AVVCDCNADMAKFMRIQCEISNIEFPFWCKQWINIMKSFRQFYTVSTDVKLNMQKMLSSLGLEFEGRQHSGLNDAENILRITETMMHDGCFLRINEKLDPFP---PHFTA----------SVGRNEAVCNNYGLNNQRIDISNKTAISANPFTSVTESMNPLNFADLSICTDDNSSQPLVNSDY 1165
            L ++L    +  + P N  +      +++ Y ++IDFE+TC      +   EIIEFP +L +    +    F AY +P  +P LS FCM LT I Q  +D        L++  +W++K       +F               A V   + D+   +  +C+   +  P +   WI++  +++ FY         +   L  +G+EF GR+HSGL+D+ N   +   M+ DGC ++I   L+  P   P +T           +  + E  C  Y    Q+ ++S +   +    T V  S+  L   + + C  + +SQ +    +
Sbjct:    6 LARQLGLIRRKSIAPANGNLGRSKSKQLFDYLIVIDFESTCWNDGKHHHSQEIIEFPAVLLNTSTGQIDSEFQAYVQPQEHPILSEFCMELTGIKQAQVDEGVPLKICLSQFCKWIHKIQQQKNIIFATGISEPSASEVKLCAFVTWSDWDLGVCLEYECKRKQLLKPVFLNSWIDLRATYKLFYRRKPK---GLSGALQEVGIEFSGREHSGLDDSRNTALLAWKMIRDGCVMKITRSLNKGPFLLPSWTWNSDLASGDQHAFLQQEFGCGTYRTLLQKPNMSKQEKGNILWLTMVWLSLACLQRKNYNDCMLNTASQTVTTEKF 328          
BLAST of 3'-5' exoribonuclease 1 vs. Ensembl Human
Match: ERI2 (ERI1 exoribonuclease family member 2 [Source:HGNC Symbol;Acc:HGNC:30541])

HSP 1 Score: 118.627 bits (296), Expect = 8.453e-28
Identity = 65/244 (26.64%), Postives = 112/244 (45.90%), Query Frame = 2
Query:  275 LRKRLKEFMKIQMNPDNNEISSQNDSKIYAYFLIIDFEATCDEINGLNFQHEIIEFPIILYDVILKRKVDVFHAYCKPFINPALSRFCMNLTNINQCTIDSAKSFPDVLTEVEQWLNKHH-----MFGKSF-----------AVVCDCNADMAKFMRIQCEISNIEFPFWCKQWINIMKSFRQFYTVSTDVKLNMQKMLSSLGLEFEGRQHSGLNDAENILRITETMMHDGCFLRINEKLDPFP 958
            L ++L    +  + P N  +      +++ Y ++IDFE+TC      +   EIIEFP +L +    +    F AY +P  +P LS FCM LT I Q  +D        L++  +W++K       +F               A V   + D+   +  +C+   +  P +   WI++  +++ FY         +   L  +G+EF GR+HSGL+D+ N   +   M+ DGC ++I   L+  P
Sbjct:    6 LARQLGLIRRKSIAPANGNLGRSKSKQLFDYLIVIDFESTCWNDGKHHHSQEIIEFPAVLLNTSTGQIDSEFQAYVQPQEHPILSEFCMELTGIKQAQVDEGVPLKICLSQFCKWIHKIQQQKNIIFATGISEPSASEVKLCAFVTWSDWDLGVCLEYECKRKQLLKPVFLNSWIDLRATYKLFYRRKPK---GLSGALQEVGIEFSGREHSGLDDSRNTALLAWKMIRDGCVMKITRSLNKVP 246          
BLAST of 3'-5' exoribonuclease 1 vs. Ensembl Celegans
Match: eri-1 (3'-5' exonuclease eri-1 [Source:UniProtKB/Swiss-Prot;Acc:O44406])

HSP 1 Score: 156.377 bits (394), Expect = 2.177e-42
Identity = 94/257 (36.58%), Postives = 141/257 (54.86%), Query Frame = 2
Query:  191 NRINKMPDEQLVGTLKYHGLNAKGSPEILRKRLKEFMKIQMNPDNNEISSQND--SKIYAYFLIIDFEATCDEINGLNFQHEIIEFPIILYDVILKRKVDVFHAYCKPFINPALSRFCMNLTNINQCTIDSAKSFPDVLTEVEQWLNKHHMFGKS--FAVVCDCNADMAKFMRIQCEISNIEFPFWCKQWINIMKSFRQFYT--VSTDVKLNMQKMLSSLGLEFEGRQHSGLNDAENILRITETMMHDGCFLRINEK 943
             +++ M  EQL   L    ++  G+ + LRKR+ ++ + +    N ++    D  ++ + Y + IDFE TC EI   ++ HEIIE P +L DV   + +  F  Y +P  NP LS FCM  T I Q T+D+A  F + L  +  W+ K ++  K+  FA V D   DM KFM+ QC +SNI  P   + +INI K+F++ +   +  + K  ++ ML  L L F G +HSGL+DA NI  I   MM     LRIN+K
Sbjct:   90 RQMDTMTAEQLKQALMKIKVSTGGNKKTLRKRVAQYYRKENALLNRKMEPNADKTARFFDYLIAIDFECTCVEI-IYDYPHEIIELPAVLIDVREMKIISEFRTYVRPVRNPKLSEFCMQFTKIAQETVDAAPYFREALQRLYTWMRKFNLGQKNSRFAFVTDGPHDMWKFMQFQCLLSNIRMPHMFRSFINIKKTFKEKFNGLIKGNGKSGIENMLERLDLSFVGNKHSGLDDATNIAAIAIQMMKLKIELRINQK 345          
BLAST of 3'-5' exoribonuclease 1 vs. Ensembl Celegans
Match: eri-1 (3'-5' exonuclease eri-1 [Source:UniProtKB/Swiss-Prot;Acc:O44406])

HSP 1 Score: 156.762 bits (395), Expect = 1.284e-41
Identity = 94/256 (36.72%), Postives = 141/256 (55.08%), Query Frame = 2
Query:  194 RINKMPDEQLVGTLKYHGLNAKGSPEILRKRLKEFMKIQMNPDNNEISSQND--SKIYAYFLIIDFEATCDEINGLNFQHEIIEFPIILYDVILKRKVDVFHAYCKPFINPALSRFCMNLTNINQCTIDSAKSFPDVLTEVEQWLNKHHMFGKS--FAVVCDCNADMAKFMRIQCEISNIEFPFWCKQWINIMKSFRQFYT--VSTDVKLNMQKMLSSLGLEFEGRQHSGLNDAENILRITETMMHDGCFLRINEK 943
            +++ M  EQL   L    ++  G+ + LRKR+ ++ + +    N ++    D  ++ + Y + IDFE TC EI   ++ HEIIE P +L DV   + +  F  Y +P  NP LS FCM  T I Q T+D+A  F + L  +  W+ K ++  K+  FA V D   DM KFM+ QC +SNI  P   + +INI K+F++ +   +  + K  ++ ML  L L F G +HSGL+DA NI  I   MM     LRIN+K
Sbjct:   91 QMDTMTAEQLKQALMKIKVSTGGNKKTLRKRVAQYYRKENALLNRKMEPNADKTARFFDYLIAIDFECTCVEI-IYDYPHEIIELPAVLIDVREMKIISEFRTYVRPVRNPKLSEFCMQFTKIAQETVDAAPYFREALQRLYTWMRKFNLGQKNSRFAFVTDGPHDMWKFMQFQCLLSNIRMPHMFRSFINIKKTFKEKFNGLIKGNGKSGIENMLERLDLSFVGNKHSGLDDATNIAAIAIQMMKLKIELRINQK 345          
BLAST of 3'-5' exoribonuclease 1 vs. Ensembl Celegans
Match: M02B7.2 (pep chromosome:WBcel235:IV:3803581:3804949:1 gene:WBGene00019724.1 transcript:M02B7.2a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:M02B7.2)

HSP 1 Score: 114.005 bits (284), Expect = 1.516e-28
Identity = 68/206 (33.01%), Postives = 105/206 (50.97%), Query Frame = 2
Query:  341 QNDSKIYAYFLIIDFEATC-DEING-LNFQHEIIEFPIILYDVILKRKVDVFHAYCKPFINPALSRFCMNLTNINQCTIDSAKSFPDVLTEVEQWLNKHHMFGKS-FAVVCDCNADMAKFMRIQCEISNIEFPFWCKQWINIMKSFRQFYTVSTDVKLNMQKMLSSLGLEFEGRQHSGLNDAENILRITETMMHDGCFLRINEKLD 949
            Q  S+ + Y L++DFEATC D   G ++   EIIEFP++        ++  FH Y KP   P L+ FC +LT I Q  +D     P+VL+E + WL +     +  FA V   + D+   +  + +  NIE P +  QWIN+ K++ +    +      M ++L+   L+ +GR HSG++D  NI  I   +  DG   RI    D
Sbjct:   52 QKISQHFDYLLVLDFEATCQDNWKGPMHPVQEIIEFPVVQLSTADWSEIRRFHQYIKPTEFPRLTSFCTSLTRIIQEMVDEKPKLPEVLSEFDSWLKEDSRLKQGNFAFVTCGDWDLKVALPSEAKFKNIEIPEYFNQWINVKKAYAEH---TNHFAKGMTQLLAIYKLQHQGRLHSGIDDVANICEIVRCLGRDGHNYRITGSKD 254          
BLAST of 3'-5' exoribonuclease 1 vs. Ensembl Celegans
Match: R02D3.8 (pep chromosome:WBcel235:IV:255966:257199:-1 gene:WBGene00019825.1 transcript:R02D3.8.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:R02D3.8)

HSP 1 Score: 105.145 bits (261), Expect = 2.346e-25
Identity = 63/200 (31.50%), Postives = 102/200 (51.00%), Query Frame = 2
Query:  329 EISSQNDSKIYAYFLIIDFEATC-DEING-LNFQHEIIEFPIILYDVILKRKVDVFHAYCKPFINPALSRFCMNLTNINQCTIDSAKSFPDVLTEVEQWLNKHHMFGKS-FAVVCDCNADMAKFMRIQCEISNIEFPFWCKQWINIMKSFRQFYTVSTDVKLNMQKMLSSLGLEFEGRQHSGLNDAENILRITETMMHDG 919
            +  +Q  S+ + Y L++DFEATC D   G ++   EIIEFP++        ++  FH Y KP   P L+ FC +LT I Q  +D   + P VL+E + WL +     K  FA V   + D+   +  + +  NI  P +  QWIN+ K+  +    +      + ++L+   L+ +GR HSG++D  NI  I   +  +G
Sbjct:   48 DTKNQKMSQHFDYLLVLDFEATCQDNWKGPMHPVQEIIEFPVVQLSTADWSEIRRFHQYVKPTECPRLTSFCTSLTGIIQEMVDEKPTLPQVLSEFDSWLKEDSRLEKGKFAFVTCGDWDLKVALPNEAKFKNIGIPEYFNQWINVKKASAEH---TNHFAKGIAQLLAIYKLQHQGRHHSGIDDVANICEIVRCLGMNG 244          
BLAST of 3'-5' exoribonuclease 1 vs. Ensembl Celegans
Match: crn-4 (Cell death-related nuclease 4 [Source:UniProtKB/Swiss-Prot;Acc:Q10905])

HSP 1 Score: 104.375 bits (259), Expect = 8.728e-25
Identity = 67/199 (33.67%), Postives = 106/199 (53.27%), Query Frame = 2
Query:  368 FLIIDFEATCDEINGLNFQHEIIEFPIILYDVI-LKRKVDV-FHAYCKPFINPALSRFCMNLTNINQCTIDSAKSFPDVLTEVEQWLNKHHMFGKSFAVVCDCNADMAKFMRIQCEISNIEFPFWCKQWINIMKSFR----QFYTVSTDVKLNMQKMLSSLGLEFEGRQHSGLNDAENILRITETMMHDGCFLRINEKL 946
             LI+DFE T D  N  ++  E+I+F I+ YDV   K + D+ F+ Y KP +N  L++ C++ T I Q +ID+A +F  V  + +QWL    +    FA VCD   D+ +  + Q ++SNI+ P + +Q+IN+ K F     +          N+ KM     L   GR H  ++D  NI  I + M++ G  + +NE L
Sbjct:   11 LLILDFETTSDAANQ-DYPCEVIQFAIVAYDVPNDKIREDISFNKYVKPVLNRTLTKNCVDFTGIPQRSIDTADTFDVVYEQFQQWLITLGLEEGKFAFVCDSRQDLWRIAQYQMKLSNIQMPAFFRQYINLYKIFTNEMDRMGPKELSATTNIGKMNEYYDLPTIGRAHDAMDDCLNIATILQRMINMGAKVTVNELL 208          
BLAST of 3'-5' exoribonuclease 1 vs. Ensembl Fly
Match: Snp (gene:FBgn0265192 transcript:FBtr0339100)

HSP 1 Score: 110.538 bits (275), Expect = 1.191e-27
Identity = 68/215 (31.63%), Postives = 101/215 (46.98%), Query Frame = 2
Query:  359 YAYFLIIDFEATCDEINGLN--FQHEIIEFPIILYDVILKRKVDVFHAYCKPFINPALSRFCMNLTNINQCTIDSAKSFPDVLTEVEQWL--------------NKHHMFGKSFAVVCDCNADMAKFMRIQCEISNIEFPFWCKQWINIMKSFRQFYTVSTDVKLNMQKMLSSLGLEFEGRQHSGLNDAENILRITETMMHDGCFLRINEKLDPF 955
            Y+Y + +DFEATC E        + EIIEFP +L ++   +    FH Y  PF +P LS +C  LT I Q T+DS       +    +WL              NK ++ G   A V   + D    +  +C    I  P +  QWI++   +R +Y        N    LS +GL FEG+ HSG++DA+N+  +   M+ DG    I + L P+
Sbjct:    4 YSYVIAVDFEATCWEKQAPPEWREAEIIEFPAVLVNLKTGKIEAEFHQYILPFESPRLSAYCTELTGIQQKTVDSGMPLRTAIVMFNEWLRNEMRARNLTLPKMNKSNILGNC-AFVTWTDWDFGICLAKECSRKGIRKPAYFNQWIDVRAIYRSWYKYR---PCNFTDALSHVGLAFEGKAHSGIDDAKNLGALMCKMVRDGALFSITKDLTPY 214          
BLAST of 3'-5' exoribonuclease 1 vs. Ensembl Fly
Match: Snp (gene:FBgn0265192 transcript:FBtr0339101)

HSP 1 Score: 110.538 bits (275), Expect = 1.191e-27
Identity = 68/215 (31.63%), Postives = 101/215 (46.98%), Query Frame = 2
Query:  359 YAYFLIIDFEATCDEINGLN--FQHEIIEFPIILYDVILKRKVDVFHAYCKPFINPALSRFCMNLTNINQCTIDSAKSFPDVLTEVEQWL--------------NKHHMFGKSFAVVCDCNADMAKFMRIQCEISNIEFPFWCKQWINIMKSFRQFYTVSTDVKLNMQKMLSSLGLEFEGRQHSGLNDAENILRITETMMHDGCFLRINEKLDPF 955
            Y+Y + +DFEATC E        + EIIEFP +L ++   +    FH Y  PF +P LS +C  LT I Q T+DS       +    +WL              NK ++ G   A V   + D    +  +C    I  P +  QWI++   +R +Y        N    LS +GL FEG+ HSG++DA+N+  +   M+ DG    I + L P+
Sbjct:    4 YSYVIAVDFEATCWEKQAPPEWREAEIIEFPAVLVNLKTGKIEAEFHQYILPFESPRLSAYCTELTGIQQKTVDSGMPLRTAIVMFNEWLRNEMRARNLTLPKMNKSNILGNC-AFVTWTDWDFGICLAKECSRKGIRKPAYFNQWIDVRAIYRSWYKYR---PCNFTDALSHVGLAFEGKAHSGIDDAKNLGALMCKMVRDGALFSITKDLTPY 214          
BLAST of 3'-5' exoribonuclease 1 vs. Ensembl Fly
Match: Snp (gene:FBgn0265192 transcript:FBtr0339102)

HSP 1 Score: 110.538 bits (275), Expect = 1.191e-27
Identity = 68/215 (31.63%), Postives = 101/215 (46.98%), Query Frame = 2
Query:  359 YAYFLIIDFEATCDEINGLN--FQHEIIEFPIILYDVILKRKVDVFHAYCKPFINPALSRFCMNLTNINQCTIDSAKSFPDVLTEVEQWL--------------NKHHMFGKSFAVVCDCNADMAKFMRIQCEISNIEFPFWCKQWINIMKSFRQFYTVSTDVKLNMQKMLSSLGLEFEGRQHSGLNDAENILRITETMMHDGCFLRINEKLDPF 955
            Y+Y + +DFEATC E        + EIIEFP +L ++   +    FH Y  PF +P LS +C  LT I Q T+DS       +    +WL              NK ++ G   A V   + D    +  +C    I  P +  QWI++   +R +Y        N    LS +GL FEG+ HSG++DA+N+  +   M+ DG    I + L P+
Sbjct:    4 YSYVIAVDFEATCWEKQAPPEWREAEIIEFPAVLVNLKTGKIEAEFHQYILPFESPRLSAYCTELTGIQQKTVDSGMPLRTAIVMFNEWLRNEMRARNLTLPKMNKSNILGNC-AFVTWTDWDFGICLAKECSRKGIRKPAYFNQWIDVRAIYRSWYKYR---PCNFTDALSHVGLAFEGKAHSGIDDAKNLGALMCKMVRDGALFSITKDLTPY 214          
BLAST of 3'-5' exoribonuclease 1 vs. Ensembl Fly
Match: Snp (gene:FBgn0265192 transcript:FBtr0339099)

HSP 1 Score: 111.694 bits (278), Expect = 1.879e-27
Identity = 68/215 (31.63%), Postives = 101/215 (46.98%), Query Frame = 2
Query:  359 YAYFLIIDFEATCDEINGLN--FQHEIIEFPIILYDVILKRKVDVFHAYCKPFINPALSRFCMNLTNINQCTIDSAKSFPDVLTEVEQWL--------------NKHHMFGKSFAVVCDCNADMAKFMRIQCEISNIEFPFWCKQWINIMKSFRQFYTVSTDVKLNMQKMLSSLGLEFEGRQHSGLNDAENILRITETMMHDGCFLRINEKLDPF 955
            Y+Y + +DFEATC E        + EIIEFP +L ++   +    FH Y  PF +P LS +C  LT I Q T+DS       +    +WL              NK ++ G   A V   + D    +  +C    I  P +  QWI++   +R +Y        N    LS +GL FEG+ HSG++DA+N+  +   M+ DG    I + L P+
Sbjct:   62 YSYVIAVDFEATCWEKQAPPEWREAEIIEFPAVLVNLKTGKIEAEFHQYILPFESPRLSAYCTELTGIQQKTVDSGMPLRTAIVMFNEWLRNEMRARNLTLPKMNKSNILGNC-AFVTWTDWDFGICLAKECSRKGIRKPAYFNQWIDVRAIYRSWYKYR---PCNFTDALSHVGLAFEGKAHSGIDDAKNLGALMCKMVRDGALFSITKDLTPY 272          
BLAST of 3'-5' exoribonuclease 1 vs. Ensembl Zebrafish
Match: eri1 (exoribonuclease 1 [Source:ZFIN;Acc:ZDB-GENE-050522-39])

HSP 1 Score: 196.823 bits (499), Expect = 2.269e-58
Identity = 107/261 (41.00%), Postives = 152/261 (58.24%), Query Frame = 2
Query:  170 KQYALNTNRINKMPDEQLVGTLKYHGLNAKGSPEILRKRLKEFMKIQMNPDNNEISSQNDSKIYAYFLIIDFEATCDEINGLNFQHEIIEFPIILYDVILKRKVDVFHAYCKPFINPALSRFCMNLTNINQCTIDSAKSFPDVLTEVEQWLNKHHMFGK-SFAVVCDCNADMAKFMRIQCEISNIEFPFWCKQWINIMKSFRQFYTVS-TDVKLNMQKMLSSLGLEFEGRQHSGLNDAENILRITETMMHDGCFLRINEKL 946
            K+ AL    IN+M  E+L        L+ +G  ++LRKRLK + K Q    ++  +  N    + Y  ++DFEATC+E N  ++ HEIIEFP++L D      VD F  Y KP ++P LS FC+ LT I Q  +D AK+F  VL     WL +  +  K  +  + D + DM KF+  QC++S I +P + ++WINI KS+  FY V  T  KL    ML +LG+E++GR H GL+D+ NI RI   M+ DGC LR+NE L
Sbjct:   53 KEIALANGAINRMNREELRAKCTELKLDTRGVNDVLRKRLKSYYKKQ-KLMHSPAAEGNSDMYFDYICVVDFEATCEENNPPDYLHEIIEFPMVLIDTHTLEIVDSFQEYVKPVLHPQLSEFCVKLTGITQEMVDEAKTFHQVLKRAISWLQEKELGTKYKYMFLTDGSWDMGKFLHTQCKLSRIRYPQFARKWINIRKSYGNFYKVPRTQTKLIC--MLENLGMEYDGRPHCGLDDSRNIARIAIHMLKDGCQLRVNECL 310          
BLAST of 3'-5' exoribonuclease 1 vs. Ensembl Zebrafish
Match: eri1 (exoribonuclease 1 [Source:ZFIN;Acc:ZDB-GENE-050522-39])

HSP 1 Score: 196.823 bits (499), Expect = 2.269e-58
Identity = 107/261 (41.00%), Postives = 152/261 (58.24%), Query Frame = 2
Query:  170 KQYALNTNRINKMPDEQLVGTLKYHGLNAKGSPEILRKRLKEFMKIQMNPDNNEISSQNDSKIYAYFLIIDFEATCDEINGLNFQHEIIEFPIILYDVILKRKVDVFHAYCKPFINPALSRFCMNLTNINQCTIDSAKSFPDVLTEVEQWLNKHHMFGK-SFAVVCDCNADMAKFMRIQCEISNIEFPFWCKQWINIMKSFRQFYTVS-TDVKLNMQKMLSSLGLEFEGRQHSGLNDAENILRITETMMHDGCFLRINEKL 946
            K+ AL    IN+M  E+L        L+ +G  ++LRKRLK + K Q    ++  +  N    + Y  ++DFEATC+E N  ++ HEIIEFP++L D      VD F  Y KP ++P LS FC+ LT I Q  +D AK+F  VL     WL +  +  K  +  + D + DM KF+  QC++S I +P + ++WINI KS+  FY V  T  KL    ML +LG+E++GR H GL+D+ NI RI   M+ DGC LR+NE L
Sbjct:   53 KEIALANGAINRMNREELRAKCTELKLDTRGVNDVLRKRLKSYYKKQ-KLMHSPAAEGNSDMYFDYICVVDFEATCEENNPPDYLHEIIEFPMVLIDTHTLEIVDSFQEYVKPVLHPQLSEFCVKLTGITQEMVDEAKTFHQVLKRAISWLQEKELGTKYKYMFLTDGSWDMGKFLHTQCKLSRIRYPQFARKWINIRKSYGNFYKVPRTQTKLIC--MLENLGMEYDGRPHCGLDDSRNIARIAIHMLKDGCQLRVNECL 310          
BLAST of 3'-5' exoribonuclease 1 vs. Ensembl Zebrafish
Match: eri1 (exoribonuclease 1 [Source:ZFIN;Acc:ZDB-GENE-050522-39])

HSP 1 Score: 196.823 bits (499), Expect = 2.269e-58
Identity = 107/261 (41.00%), Postives = 152/261 (58.24%), Query Frame = 2
Query:  170 KQYALNTNRINKMPDEQLVGTLKYHGLNAKGSPEILRKRLKEFMKIQMNPDNNEISSQNDSKIYAYFLIIDFEATCDEINGLNFQHEIIEFPIILYDVILKRKVDVFHAYCKPFINPALSRFCMNLTNINQCTIDSAKSFPDVLTEVEQWLNKHHMFGK-SFAVVCDCNADMAKFMRIQCEISNIEFPFWCKQWINIMKSFRQFYTVS-TDVKLNMQKMLSSLGLEFEGRQHSGLNDAENILRITETMMHDGCFLRINEKL 946
            K+ AL    IN+M  E+L        L+ +G  ++LRKRLK + K Q    ++  +  N    + Y  ++DFEATC+E N  ++ HEIIEFP++L D      VD F  Y KP ++P LS FC+ LT I Q  +D AK+F  VL     WL +  +  K  +  + D + DM KF+  QC++S I +P + ++WINI KS+  FY V  T  KL    ML +LG+E++GR H GL+D+ NI RI   M+ DGC LR+NE L
Sbjct:   53 KEIALANGAINRMNREELRAKCTELKLDTRGVNDVLRKRLKSYYKKQ-KLMHSPAAEGNSDMYFDYICVVDFEATCEENNPPDYLHEIIEFPMVLIDTHTLEIVDSFQEYVKPVLHPQLSEFCVKLTGITQEMVDEAKTFHQVLKRAISWLQEKELGTKYKYMFLTDGSWDMGKFLHTQCKLSRIRYPQFARKWINIRKSYGNFYKVPRTQTKLIC--MLENLGMEYDGRPHCGLDDSRNIARIAIHMLKDGCQLRVNECL 310          
BLAST of 3'-5' exoribonuclease 1 vs. Ensembl Zebrafish
Match: eri1 (exoribonuclease 1 [Source:ZFIN;Acc:ZDB-GENE-050522-39])

HSP 1 Score: 67.0106 bits (162), Expect = 9.194e-13
Identity = 38/99 (38.38%), Postives = 59/99 (59.60%), Query Frame = 2
Query:  170 KQYALNTNRINKMPDEQLVGTLKYHGLNAKGSPEILRKRLKEFMKIQMNPDNNEISSQNDSKIY-AYFLIIDFEATCDEINGLNFQHEIIEFPIILYDV 463
            K+ AL    IN+M  E+L        L+ +G  ++LRKRLK + K Q     +  +++ +S +Y  Y  ++DFEATC+E N  ++ HEIIEFP++L D 
Sbjct:   53 KEIALANGAINRMNREELRAKCTELKLDTRGVNDVLRKRLKSYYKKQKL--MHSPAAEGNSDMYFDYICVVDFEATCEENNPPDYLHEIIEFPMVLIDT 149          
BLAST of 3'-5' exoribonuclease 1 vs. Ensembl Xenopus
Match: eri1 (exoribonuclease 1 [Source:NCBI gene;Acc:548900])

HSP 1 Score: 218.009 bits (554), Expect = 3.148e-66
Identity = 112/272 (41.18%), Postives = 164/272 (60.29%), Query Frame = 2
Query:  137 SNTANFKYNNSKQYALNTNRINKMPDEQLVGTLKYHGLNAKGSPEILRKRLKEFMKIQMNPDNNEISSQNDSKIYAYFLIIDFEATCDEINGLNFQHEIIEFPIILYDVILKRKVDVFHAYCKPFINPALSRFCMNLTNINQCTIDSAKSFPDVLTEVEQWLNKHHMFGK-SFAVVCDCNADMAKFMRIQCEISNIEFPFWCKQWINIMKSFRQFYTV-STDVKLNMQKMLSSLGLEFEGRQHSGLNDAENILRITETMMHDGCFLRINEKL 946
            S+ ++F     K+ A+    +N+M  ++L   L  H L+ +G  ++LRKRLK + K Q         S  D   Y Y  +IDFEATC+E N  ++ HEIIEFPI+L +       DVF  Y +P INP LS FC+NLT I Q  +D +  FPDVL  V  W+ +  +  K  +A++ D + DM+KF+ +QC +S +++P + K+WINI KS+  FY V  T  KL    ML  LG+ ++GR HSG++D++NI RI   M+ DGC LR+NE++
Sbjct:   50 SHASDFSDPVYKEIAIANGCVNRMTKDELKAKLAEHKLDTRGVKDVLRKRLKNYYKKQKLRHALHKDSNTDC-YYDYICVIDFEATCEEGNSTDYTHEIIEFPIVLLNTHTLEIEDVFQRYVRPEINPQLSEFCVNLTGITQDIVDKSDIFPDVLRSVVDWMREKELGTKYKYAILTDGSWDMSKFLNMQCRVSRLKYPRFAKKWINIRKSYGNFYKVPRTQTKLTT--MLEKLGMTYDGRLHSGVDDSKNIARIAAHMLQDGCELRVNERM 318          
BLAST of 3'-5' exoribonuclease 1 vs. Ensembl Xenopus
Match: ERI3 (ERI1 exoribonuclease family member 3 [Source:NCBI gene;Acc:100127672])

HSP 1 Score: 117.857 bits (294), Expect = 5.521e-29
Identity = 66/190 (34.74%), Postives = 99/190 (52.11%), Query Frame = 2
Query:  359 YAYFLIIDFEATCDEINGLNFQHEIIEFPIILYDVILKRKVDVFHAYCKPFINPALSRFCMNLTNINQCTIDSAKSFPDVLTEVEQWLNKHHMFG---KSFAVVCDCNADMAKFMRIQCEISNIEFPFWCKQWINIMKSFRQFYTVSTDVKLNMQKMLSSLGLEFEGRQHSGLNDAENILRITETMMHDG 919
            Y YFL++DFEATCD+        EIIEFPI+  +         FH Y +P ++P L+ FC  LT I Q  +D   +   VL  V++W+ K  +     KS  V C  + D+   +  QCE   ++   + KQWIN+ K++   + + T  K  +  M   + L+  GR HSG++D  NI  I +T+ H G
Sbjct:  127 YHYFLVLDFEATCDKPQ--IHPQEIIEFPILKLNGRTMEIESTFHTYVQPVVHPQLTPFCTELTGIIQDMVDGQPTLSQVLERVDEWMAKEGLLDPSVKSIFVTCG-DWDLKLMLPGQCEYLGLQVADYFKQWINLKKAYS--FAIGTWPKNGLLDMNKGMSLQHIGRPHSGIDDCRNIANIMKTLAHRG 311          
BLAST of 3'-5' exoribonuclease 1 vs. Ensembl Xenopus
Match: ERI2 (ERI1 exoribonuclease family member 2 [Source:NCBI gene;Acc:100144730])

HSP 1 Score: 116.701 bits (291), Expect = 3.006e-27
Identity = 68/226 (30.09%), Postives = 108/226 (47.79%), Query Frame = 2
Query:  320 DNNEISSQNDSKIYAYFLIIDFEATCDEINGLNFQHEIIEFPIILYDVILKRKVDVFHAYCKPFINPALSRFCMNLTNINQCTIDSAKSFPDVLTEVEQWLNK-HHMFGKSF---------------AVVCDCNADMAKFMRIQCEISNIEFPFWCKQWINIMKSFRQFYTVSTDVKLNMQKMLSSLGLEFEGRQHSGLNDAENILRITETMMHDGCFLRINEKLD 949
             +N IS     + + Y +IIDFE+TC + +G +   EIIEFP +L +V        FH Y +P  +P LS FC  LT I Q  +D+       L++   W+ K     G +F               A V   + D+   +  +C    ++ P     WI++  +++ FY         +   L  LG+EF GR+HSGL+D+ N  ++   M+ DGC ++I + LD
Sbjct:   24 SSNNISHPKARQFFEYLIIIDFESTCWK-DGKHSTQEIIEFPAVLLNVANGEIESEFHTYVQPQEHPILSEFCTELTGIKQLQVDNGVPLKICLSQFNSWIQKLQKEKGIAFVTAVPTHSAAEHKMCAFVTWSDWDLGVCLLYECRRKQMKKPDILNSWIDLRATYKLFYNRRPK---GLNGALQDLGIEFSGREHSGLDDSRNTAKLAWRMIRDGCVMKITKSLD 245          
BLAST of 3'-5' exoribonuclease 1 vs. Ensembl Xenopus
Match: ERI2 (ERI1 exoribonuclease family member 2 [Source:NCBI gene;Acc:100144730])

HSP 1 Score: 116.701 bits (291), Expect = 3.021e-27
Identity = 68/226 (30.09%), Postives = 108/226 (47.79%), Query Frame = 2
Query:  320 DNNEISSQNDSKIYAYFLIIDFEATCDEINGLNFQHEIIEFPIILYDVILKRKVDVFHAYCKPFINPALSRFCMNLTNINQCTIDSAKSFPDVLTEVEQWLNK-HHMFGKSF---------------AVVCDCNADMAKFMRIQCEISNIEFPFWCKQWINIMKSFRQFYTVSTDVKLNMQKMLSSLGLEFEGRQHSGLNDAENILRITETMMHDGCFLRINEKLD 949
             +N IS     + + Y +IIDFE+TC + +G +   EIIEFP +L +V        FH Y +P  +P LS FC  LT I Q  +D+       L++   W+ K     G +F               A V   + D+   +  +C    ++ P     WI++  +++ FY         +   L  LG+EF GR+HSGL+D+ N  ++   M+ DGC ++I + LD
Sbjct:   22 SSNNISHPKARQFFEYLIIIDFESTCWK-DGKHSTQEIIEFPAVLLNVANGEIESEFHTYVQPQEHPILSEFCTELTGIKQLQVDNGVPLKICLSQFNSWIQKLQKEKGIAFVTAVPTHSAAEHKMCAFVTWSDWDLGVCLLYECRRKQMKKPDILNSWIDLRATYKLFYNRRPK---GLNGALQDLGIEFSGREHSGLDDSRNTAKLAWRMIRDGCVMKITKSLD 243          
BLAST of 3'-5' exoribonuclease 1 vs. Ensembl Xenopus
Match: ERI2 (ERI1 exoribonuclease family member 2 [Source:NCBI gene;Acc:100144730])

HSP 1 Score: 116.701 bits (291), Expect = 3.377e-27
Identity = 68/226 (30.09%), Postives = 108/226 (47.79%), Query Frame = 2
Query:  320 DNNEISSQNDSKIYAYFLIIDFEATCDEINGLNFQHEIIEFPIILYDVILKRKVDVFHAYCKPFINPALSRFCMNLTNINQCTIDSAKSFPDVLTEVEQWLNK-HHMFGKSF---------------AVVCDCNADMAKFMRIQCEISNIEFPFWCKQWINIMKSFRQFYTVSTDVKLNMQKMLSSLGLEFEGRQHSGLNDAENILRITETMMHDGCFLRINEKLD 949
             +N IS     + + Y +IIDFE+TC + +G +   EIIEFP +L +V        FH Y +P  +P LS FC  LT I Q  +D+       L++   W+ K     G +F               A V   + D+   +  +C    ++ P     WI++  +++ FY         +   L  LG+EF GR+HSGL+D+ N  ++   M+ DGC ++I + LD
Sbjct:   18 SSNNISHPKARQFFEYLIIIDFESTCWK-DGKHSTQEIIEFPAVLLNVANGEIESEFHTYVQPQEHPILSEFCTELTGIKQLQVDNGVPLKICLSQFNSWIQKLQKEKGIAFVTAVPTHSAAEHKMCAFVTWSDWDLGVCLLYECRRKQMKKPDILNSWIDLRATYKLFYNRRPK---GLNGALQDLGIEFSGREHSGLDDSRNTAKLAWRMIRDGCVMKITKSLD 239          
BLAST of 3'-5' exoribonuclease 1 vs. Ensembl Mouse
Match: Eri1 (exoribonuclease 1 [Source:MGI Symbol;Acc:MGI:1914526])

HSP 1 Score: 210.69 bits (535), Expect = 1.465e-63
Identity = 117/281 (41.64%), Postives = 166/281 (59.07%), Query Frame = 2
Query:  116 ESDKYKY--SNTANFKYNNSKQYALNTNRINKMPDEQLVGTLKYHGLNAKGSPEILRKRLKEFMKIQMNPDNNEISSQNDSKIYAYFLIIDFEATCDEINGLNFQHEIIEFPIILYDVILKRKVDVFHAYCKPFINPALSRFCMNLTNINQCTIDSAKSFPDVLTEVEQWLNKHHMFGK-SFAVVCDCNADMAKFMRIQCEISNIEFPFWCKQWINIMKSFRQFYTV-STDVKLNMQKMLSSLGLEFEGRQHSGLNDAENILRITETMMHDGCFLRINEKL 946
            E+D  K+  SN ++F     K+ A+    IN+M  E+L   L    L  +G  ++L+KRLK + K Q        SS  DS  Y Y  IIDFEATC+E N   F HEIIEFP++L +       D F  Y +P +N  LS FC+ LT I Q  +D A +FP VL +V +W+    +  K  + ++ D + DM+KF+ IQC +S ++ P + K+WINI KS+  FY V  +  KL +  ML  LG++++GR HSGL+D++NI RI   M+ DGC LRINEK+
Sbjct:   43 ETDGSKFISSNGSDFSDPVYKEIAMTNGCINRMSKEELRAKLSEFKLETRGVKDVLKKRLKNYYKKQKLMLKE--SSAGDS-YYDYICIIDFEATCEEGNPAEFLHEIIEFPVVLLNTHTLEIEDTFQQYVRPEVNDQLSEFCIGLTGITQDQVDRADAFPQVLKKVIEWMKSKELGTKYKYCILTDGSWDMSKFLSIQCRLSRLKHPAFAKKWINIRKSYGNFYKVPRSQTKLTI--MLEKLGMDYDGRPHSGLDDSKNIARIAIRMLQDGCELRINEKI 318          
BLAST of 3'-5' exoribonuclease 1 vs. Ensembl Mouse
Match: Eri2 (exoribonuclease 2 [Source:MGI Symbol;Acc:MGI:1918401])

HSP 1 Score: 118.242 bits (295), Expect = 7.320e-30
Identity = 67/241 (27.80%), Postives = 109/241 (45.23%), Query Frame = 2
Query:  275 LRKRLKEFMKIQMNPDNNEISSQNDSKIYAYFLIIDFEATCDEINGLNFQHEIIEFPIILYDVILKRKVDVFHAYCKPFINPALSRFCMNLTNINQCTIDSAKSFPDVLTEVEQWLNK-HHMFGKSFAV---------------VCDCNADMAKFMRIQCEISNIEFPFWCKQWINIMKSFRQFYTVSTDVKLNMQKMLSSLGLEFEGRQHSGLNDAENILRITETMMHDGCFLRINEKLD 949
            L +RL    +  + P +         ++YAY +++DFE+TC      +   EIIEFP +L +         FHAY +P  +P LS FC  LT I Q  +D        L++  +W++K       SFA                V   + D+   +  +C    +  P +   WI++  ++R FY         +   L  +G+EF GR+HSGL+D+ N   +   M+ DGC ++I   L+
Sbjct:    6 LARRLGLIRRKSVTPASGNPGGSRLKQLYAYLIVVDFESTCWNDGKHHSSPEIIEFPAVLLNTATGEIESEFHAYVQPQEHPILSEFCTELTGIKQVQVDEGVPLKICLSQFCKWIHKLQQQQTISFAAGDSEPSTSEVKLCAFVTWSDWDLGVCLEYECRRKQLLKPVFLNSWIDLRATYRLFYKRKPK---GLSGALQEVGIEFSGREHSGLDDSRNTALLAWKMIRDGCLMKITRSLN 243          
BLAST of 3'-5' exoribonuclease 1 vs. Ensembl Mouse
Match: Eri2 (exoribonuclease 2 [Source:MGI Symbol;Acc:MGI:1918401])

HSP 1 Score: 116.701 bits (291), Expect = 3.173e-29
Identity = 67/241 (27.80%), Postives = 109/241 (45.23%), Query Frame = 2
Query:  275 LRKRLKEFMKIQMNPDNNEISSQNDSKIYAYFLIIDFEATCDEINGLNFQHEIIEFPIILYDVILKRKVDVFHAYCKPFINPALSRFCMNLTNINQCTIDSAKSFPDVLTEVEQWLNK-HHMFGKSFAV---------------VCDCNADMAKFMRIQCEISNIEFPFWCKQWINIMKSFRQFYTVSTDVKLNMQKMLSSLGLEFEGRQHSGLNDAENILRITETMMHDGCFLRINEKLD 949
            L +RL    +  + P +         ++YAY +++DFE+TC      +   EIIEFP +L +         FHAY +P  +P LS FC  LT I Q  +D        L++  +W++K       SFA                V   + D+   +  +C    +  P +   WI++  ++R FY         +   L  +G+EF GR+HSGL+D+ N   +   M+ DGC ++I   L+
Sbjct:    6 LARRLGLIRRKSVTPASGNPGGSRLKQLYAYLIVVDFESTCWNDGKHHSSPEIIEFPAVLLNTATGEIESEFHAYVQPQEHPILSEFCTELTGIKQVQVDEGVPLKICLSQFCKWIHKLQQQQTISFAAGDSEPSTSEVKLCAFVTWSDWDLGVCLEYECRRKQLLKPVFLNSWIDLRATYRLFYKRKPK---GLSGALQEVGIEFSGREHSGLDDSRNTALLAWKMIRDGCLMKITRSLN 243          
BLAST of 3'-5' exoribonuclease 1 vs. Ensembl Mouse
Match: Eri2 (exoribonuclease 2 [Source:MGI Symbol;Acc:MGI:1918401])

HSP 1 Score: 120.168 bits (300), Expect = 1.695e-28
Identity = 67/241 (27.80%), Postives = 109/241 (45.23%), Query Frame = 2
Query:  275 LRKRLKEFMKIQMNPDNNEISSQNDSKIYAYFLIIDFEATCDEINGLNFQHEIIEFPIILYDVILKRKVDVFHAYCKPFINPALSRFCMNLTNINQCTIDSAKSFPDVLTEVEQWLNK-HHMFGKSFAV---------------VCDCNADMAKFMRIQCEISNIEFPFWCKQWINIMKSFRQFYTVSTDVKLNMQKMLSSLGLEFEGRQHSGLNDAENILRITETMMHDGCFLRINEKLD 949
            L +RL    +  + P +         ++YAY +++DFE+TC      +   EIIEFP +L +         FHAY +P  +P LS FC  LT I Q  +D        L++  +W++K       SFA                V   + D+   +  +C    +  P +   WI++  ++R FY         +   L  +G+EF GR+HSGL+D+ N   +   M+ DGC ++I   L+
Sbjct:    6 LARRLGLIRRKSVTPASGNPGGSRLKQLYAYLIVVDFESTCWNDGKHHSSPEIIEFPAVLLNTATGEIESEFHAYVQPQEHPILSEFCTELTGIKQVQVDEGVPLKICLSQFCKWIHKLQQQQTISFAAGDSEPSTSEVKLCAFVTWSDWDLGVCLEYECRRKQLLKPVFLNSWIDLRATYRLFYKRKPK---GLSGALQEVGIEFSGREHSGLDDSRNTALLAWKMIRDGCLMKITRSLN 243          
BLAST of 3'-5' exoribonuclease 1 vs. Ensembl Mouse
Match: Eri3 (exoribonuclease 3 [Source:MGI Symbol;Acc:MGI:2153887])

HSP 1 Score: 112.464 bits (280), Expect = 4.494e-27
Identity = 66/198 (33.33%), Postives = 99/198 (50.00%), Query Frame = 2
Query:  359 YAYFLIIDFEATCDEINGLNFQHEIIEFPIILYDVILKRKVDVFHAYCKPFINPALSRFCMNLTNINQCTIDSAKSFPDVLTEVEQWLNKHHMFG---KSFAVVCDCNADMAKFMRIQCEISNIEFPFWCKQWINIMKSFRQFYTVSTDVKLNMQKMLSSLGLEFEGRQHSGLNDAENILRITETMMHDGCFLRINEK 943
            Y YFL++DFEATCD+        EIIEFPI+  +         FH Y +P ++P L+ FC  LT I Q  +D   S   VL  V++W+ K  +     KS  V C  + D+   +  QC    +    + KQWIN+ K++   + +    K  +  M   L L+  GR HSG++D +NI  I +T+ + G   +   K
Sbjct:  143 YHYFLVLDFEATCDKPQ--IHPQEIIEFPILKLNGRTMEIESTFHMYVQPVVHPQLTPFCTELTGIIQAMVDGQPSLQQVLERVDEWMAKEGLLDPNVKSIFVTCG-DWDLKVMLPGQCHYLGLPVADYFKQWINLKKAYS--FAMGCWPKNGLLDMNKGLSLQHIGRPHSGIDDCKNIANIMKTLAYRGFIFKQTSK 335          
BLAST of 3'-5' exoribonuclease 1 vs. UniProt/SwissProt
Match: sp|Q5FVR4|ERI1_RAT (3'-5' exoribonuclease 1 OS=Rattus norvegicus OX=10116 GN=Eri1 PE=2 SV=1)

HSP 1 Score: 214.927 bits (546), Expect = 2.010e-64
Identity = 115/281 (40.93%), Postives = 167/281 (59.43%), Query Frame = 2
Query:  116 ESDKYKYSNTANFKYNNSKQYALNTNRINKMPDEQLVGTLKYHGLNAKGSPEILRKRLKEFMKIQ--MNPDNNEISSQNDSKIYAYFLIIDFEATCDEINGLNFQHEIIEFPIILYDVILKRKVDVFHAYCKPFINPALSRFCMNLTNINQCTIDSAKSFPDVLTEVEQWLNKHHMFGK-SFAVVCDCNADMAKFMRIQCEISNIEFPFWCKQWINIMKSFRQFYTV-STDVKLNMQKMLSSLGLEFEGRQHSGLNDAENILRITETMMHDGCFLRINEKL 946
            +  K+  SN  +F     K+ A+    IN+M  E+L   L    L  +G  ++L+KRLK + K Q  M  ++N + S      Y Y  IIDFEATC+E N   F HEIIEFP++L +       D F  Y +P +N  LS FC+ LT I Q  +D A +FP VL +V +W+    +  K  + ++ D + DM+KF+ IQC++S +++P + K+WINI KS+  FY V  +  KL +  ML  LG++++GR HSGL+D++NI RI   M+ DGC LRINEKL
Sbjct:   45 DGSKFITSNGGDFSDPVYKEIAMTNGCINRMSKEELRAKLSEFKLETRGVKDVLKKRLKNYYKKQKLMLKESNAVDS-----YYDYICIIDFEATCEEGNPAEFLHEIIEFPVVLLNTHSLEIEDTFQQYVRPEVNSQLSEFCIGLTGITQDQVDRADAFPQVLKKVIEWMKSKELGTKYKYCILTDGSWDMSKFLNIQCQLSRLKYPSFAKKWINIRKSYGNFYKVPRSQTKLTI--MLEKLGMDYDGRPHSGLDDSKNIARIAVRMLQDGCELRINEKL 318          
BLAST of 3'-5' exoribonuclease 1 vs. UniProt/SwissProt
Match: sp|Q7TMF2|ERI1_MOUSE (3'-5' exoribonuclease 1 OS=Mus musculus OX=10090 GN=Eri1 PE=1 SV=2)

HSP 1 Score: 211.46 bits (537), Expect = 4.873e-63
Identity = 117/281 (41.64%), Postives = 166/281 (59.07%), Query Frame = 2
Query:  116 ESDKYKY--SNTANFKYNNSKQYALNTNRINKMPDEQLVGTLKYHGLNAKGSPEILRKRLKEFMKIQMNPDNNEISSQNDSKIYAYFLIIDFEATCDEINGLNFQHEIIEFPIILYDVILKRKVDVFHAYCKPFINPALSRFCMNLTNINQCTIDSAKSFPDVLTEVEQWLNKHHMFGK-SFAVVCDCNADMAKFMRIQCEISNIEFPFWCKQWINIMKSFRQFYTV-STDVKLNMQKMLSSLGLEFEGRQHSGLNDAENILRITETMMHDGCFLRINEKL 946
            E+D  K+  SN ++F     K+ A+    IN+M  E+L   L    L  +G  ++L+KRLK + K Q        SS  DS  Y Y  IIDFEATC+E N   F HEIIEFP++L +       D F  Y +P +N  LS FC+ LT I Q  +D A +FP VL +V +W+    +  K  + ++ D + DM+KF+ IQC +S ++ P + K+WINI KS+  FY V  +  KL +  ML  LG++++GR HSGL+D++NI RI   M+ DGC LRINEK+
Sbjct:   43 ETDGSKFISSNGSDFSDPVYKEIAMTNGCINRMSKEELRAKLSEFKLETRGVKDVLKKRLKNYYKKQKLMLKE--SSAGDS-YYDYICIIDFEATCEEGNPAEFLHEIIEFPVVLLNTHTLEIEDTFQQYVRPEVNAQLSEFCIGLTGITQDQVDRADAFPQVLKKVIEWMKSKELGTKYKYCILTDGSWDMSKFLSIQCRLSRLKHPAFAKKWINIRKSYGNFYKVPRSQTKLTI--MLEKLGMDYDGRPHSGLDDSKNIARIAVRMLQDGCELRINEKI 318          
BLAST of 3'-5' exoribonuclease 1 vs. UniProt/SwissProt
Match: sp|Q8IV48|ERI1_HUMAN (3'-5' exoribonuclease 1 OS=Homo sapiens OX=9606 GN=ERI1 PE=1 SV=3)

HSP 1 Score: 204.912 bits (520), Expect = 1.605e-60
Identity = 113/281 (40.21%), Postives = 167/281 (59.43%), Query Frame = 2
Query:  116 ESDKYKYSNTANFKYNNSKQYALNTNRINKMPDEQLVGTLKYHGLNAKGSPEILRKRLKEFMKIQ--MNPDNNEISSQNDSKIYAYFLIIDFEATCDEINGLNFQHEIIEFPIILYDVILKRKVDVFHAYCKPFINPALSRFCMNLTNINQCTIDSAKSFPDVLTEVEQWLNKHHMFGK-SFAVVCDCNADMAKFMRIQCEISNIEFPFWCKQWINIMKSFRQFYTV-STDVKLNMQKMLSSLGLEFEGRQHSGLNDAENILRITETMMHDGCFLRINEKL 946
            +  K+  S+ ++F     K+ A+    IN+M  E+L   L    L  +G  ++L+KRLK + K Q  M  ++N   S      Y Y  IIDFEATC+E N   F HEIIEFP++L +       D F  Y +P IN  LS FC++LT I Q  +D A +FP VL +V  W+    +  K  ++++ D + DM+KF+ IQC++S +++P + K+WINI KS+  FY V  +  KL +  ML  LG++++GR H GL+D++NI RI   M+ DGC LRINEK+
Sbjct:   49 KGSKFITSSASDFSDPVYKEIAITNGCINRMSKEELRAKLSEFKLETRGVKDVLKKRLKNYYKKQKLMLKESNFADS-----YYDYICIIDFEATCEEGNPPEFVHEIIEFPVVLLNTHTLEIEDTFQQYVRPEINTQLSDFCISLTGITQDQVDRADTFPQVLKKVIDWMKLKELGTKYKYSLLTDGSWDMSKFLNIQCQLSRLKYPPFAKKWINIRKSYGNFYKVPRSQTKLTI--MLEKLGMDYDGRPHCGLDDSKNIARIAVRMLQDGCELRINEKM 322          
BLAST of 3'-5' exoribonuclease 1 vs. UniProt/SwissProt
Match: sp|O44406|ERI1_CAEEL (3'-5' exonuclease eri-1 OS=Caenorhabditis elegans OX=6239 GN=eri-1 PE=1 SV=2)

HSP 1 Score: 156.762 bits (395), Expect = 1.633e-40
Identity = 94/256 (36.72%), Postives = 141/256 (55.08%), Query Frame = 2
Query:  194 RINKMPDEQLVGTLKYHGLNAKGSPEILRKRLKEFMKIQMNPDNNEISSQND--SKIYAYFLIIDFEATCDEINGLNFQHEIIEFPIILYDVILKRKVDVFHAYCKPFINPALSRFCMNLTNINQCTIDSAKSFPDVLTEVEQWLNKHHMFGKS--FAVVCDCNADMAKFMRIQCEISNIEFPFWCKQWINIMKSFRQFYT--VSTDVKLNMQKMLSSLGLEFEGRQHSGLNDAENILRITETMMHDGCFLRINEK 943
            +++ M  EQL   L    ++  G+ + LRKR+ ++ + +    N ++    D  ++ + Y + IDFE TC EI   ++ HEIIE P +L DV   + +  F  Y +P  NP LS FCM  T I Q T+D+A  F + L  +  W+ K ++  K+  FA V D   DM KFM+ QC +SNI  P   + +INI K+F++ +   +  + K  ++ ML  L L F G +HSGL+DA NI  I   MM     LRIN+K
Sbjct:   91 QMDTMTAEQLKQALMKIKVSTGGNKKTLRKRVAQYYRKENALLNRKMEPNADKTARFFDYLIAIDFECTCVEI-IYDYPHEIIELPAVLIDVREMKIISEFRTYVRPVRNPKLSEFCMQFTKIAQETVDAAPYFREALQRLYTWMRKFNLGQKNSRFAFVTDGPHDMWKFMQFQCLLSNIRMPHMFRSFINIKKTFKEKFNGLIKGNGKSGIENMLERLDLSFVGNKHSGLDDATNIAAIAIQMMKLKIELRINQK 345          
BLAST of 3'-5' exoribonuclease 1 vs. UniProt/SwissProt
Match: sp|Q08I43|ERI1_SCHPO (3'-5' exonuclease eri1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eri1 PE=1 SV=1)

HSP 1 Score: 147.517 bits (371), Expect = 3.435e-39
Identity = 90/259 (34.75%), Postives = 139/259 (53.67%), Query Frame = 2
Query:  215 EQLVGTLKYHGLNAKGSPEILRKRLKEFMKIQMNPDNNE-----ISSQNDSKI-YAYFLIIDFEATCDEINGLNFQHEIIEFPIILYDVILKRKVDVFHAYCKPFINPALSRFCMNLTNINQCTIDSAKSFPDVLTEVEQWLNKH---------------------HMFGKSFAVVCDCNADMAKFMRIQCEISNIEFPFWCK-QWINIMKSFRQFYTVSTDVKLNMQKMLSSLGLEFEGRQHSGLNDAENILRITETM 907
            E++   L+  GL+  G+ E L++R K F + ++     +      S+ N++K    Y LI+D EATC+E  G +F++EIIE P +L+D+I K  +D FH+Y +P +NP LS +C +LT I QCT+D A  F DVL E+  +L KH                         K++A  CD   DMA F+  Q +   +  P W K  +++I   ++  Y V    + N+  ML   GL+FEG +H G++DA N+ RI + M
Sbjct:   26 EEIRIALQELGLSTNGNKEKLKRRWK-FREKRLEEKRKQERYQKFSTSNENKTCLRYLLIVDVEATCEEGCGFSFENEIIELPCLLFDLIEKSIIDEFHSYVRPSMNPTLSDYCKSLTGIQQCTVDKAPIFSDVLEELFIFLRKHSNILVPSVDEIEIIEPLKSVPRTQPKNWAWACDGPWDMASFLAKQFKYDKMPIPDWIKGPFVDIRSFYKDVYRVP---RTNINGMLEHWGLQFEGSEHRGIDDARNLSRIVKKM 280          
BLAST of 3'-5' exoribonuclease 1 vs. TrEMBL
Match: C1LG68 (Three prime histone mRNA exonuclease 1 OS=Schistosoma japonicum OX=6182 GN=Thex1 PE=2 SV=1)

HSP 1 Score: 241.891 bits (616), Expect = 1.260e-69
Identity = 113/218 (51.83%), Postives = 151/218 (69.27%), Query Frame = 2
Query:  359 YAYFLIIDFEATCDE----INGLNFQHEIIEFPIILYDVILKRKVDVFHAYCKPFINPALSRFCMNLTNINQCTIDSAKSFPDVLTEVEQWL-NKHHMFGKSFAVVCDCNADMAKFMRIQCEISNIEFPFWCKQWINIMKSFRQFYTVSTDVKLNMQKMLSSLGLEFEGRQHSGLNDAENILRITETMMHDGCFLRINEKLD-PFPPHFTASVGRNEA 994
            Y Y LIID EATC+     IN +++ HEIIEFPI+LY+  L++ V VFHAYCKP ++P LS FC +LT I Q  +D+A  F +VL +VE+WL  +H +  K  A+VCDC ADM+KFMRIQC ++NI  P WCK WIN+ KSFR FY   +  ++ +  ML  LGL F G++H GL+DA NILRI   ++ DGC LR+NE++D   PP F +S+ R+ A
Sbjct:  298 YDYLLIIDLEATCESKEKIINDIDYPHEIIEFPILLYNTRLRKCVSVFHAYCKPRLHPNLSEFCTDLTQIQQIQVDNALPFSNVLLQVEEWLLKRHKLTQKRCAIVCDCCADMSKFMRIQCRLANISLPNWCKIWINLSKSFRAFYKFPSRYRVTLNGMLHDLGLSFVGQRHRGLDDAVNILRIVRVLLSDGCSLRVNERIDMNRPPSFVSSIPRHVA 515          
BLAST of 3'-5' exoribonuclease 1 vs. TrEMBL
Match: C1LG67 (Three prime histone mRNA exonuclease 1 OS=Schistosoma japonicum OX=6182 GN=Thex1 PE=2 SV=1)

HSP 1 Score: 241.891 bits (616), Expect = 1.287e-69
Identity = 113/218 (51.83%), Postives = 151/218 (69.27%), Query Frame = 2
Query:  359 YAYFLIIDFEATCDE----INGLNFQHEIIEFPIILYDVILKRKVDVFHAYCKPFINPALSRFCMNLTNINQCTIDSAKSFPDVLTEVEQWL-NKHHMFGKSFAVVCDCNADMAKFMRIQCEISNIEFPFWCKQWINIMKSFRQFYTVSTDVKLNMQKMLSSLGLEFEGRQHSGLNDAENILRITETMMHDGCFLRINEKLD-PFPPHFTASVGRNEA 994
            Y Y LIID EATC+     IN +++ HEIIEFPI+LY+  L++ V VFHAYCKP ++P LS FC +LT I Q  +D+A  F +VL +VE+WL  +H +  K  A+VCDC ADM+KFMRIQC ++NI  P WCK WIN+ KSFR FY   +  ++ +  ML  LGL F G++H GL+DA NILRI   ++ DGC LR+NE++D   PP F +S+ R+ A
Sbjct:  298 YDYLLIIDLEATCESKEKIINDIDYPHEIIEFPILLYNTRLRKCVSVFHAYCKPRLHPNLSEFCTDLTQIQQIQVDNALPFSNVLLQVEEWLLKRHKLTQKRCAIVCDCCADMSKFMRIQCRLANISLPNWCKIWINLSKSFRAFYKFPSRYRVTLNGMLHDLGLSFVGQRHRGLDDAVNILRIVRVLLSDGCSLRVNERIDMNRPPSFVSSIPRHVA 515          
BLAST of 3'-5' exoribonuclease 1 vs. TrEMBL
Match: A0A430PY39 (3'-5' exoribonuclease 1 OS=Schistosoma bovis OX=6184 GN=DC041_0001388 PE=4 SV=1)

HSP 1 Score: 240.736 bits (613), Expect = 3.862e-69
Identity = 132/334 (39.52%), Postives = 183/334 (54.79%), Query Frame = 2
Query:  191 NRINKMPDEQLVGTLKYHGLNAKGSPEILRKRLKEF-------------MKIQMNPDNNE--------------------ISSQ------NDSK-----------------------IYAYFLIIDFEATCDE----INGLNFQHEIIEFPIILYDVILKRKVDVFHAYCKPFINPALSRFCMNLTNINQCTIDSAKSFPDVLTEVEQWLNKHHMFG-KSFAVVCDCNADMAKFMRIQCEISNIEFPFWCKQWINIMKSFRQFYTVSTDVKLNMQKMLSSLGLEFEGRQHSGLNDAENILRITETMMHDGCFLRINEKLD-PFPPHFTASVGRN 988
            +RI+ M  + L   L  H LN  GS  +L++RL+EF             ++IQ++ D+ +                    ++SQ      ND +                        Y Y LIID EATC+         ++ HEIIEFPI+LY   L++ V VFHAYCKP ++P LS FC +LT I Q  +D+A+ FP VL ++E+WL K H    K  A+VCDC+ADM+KFMRIQC ++NI  P W   WIN+ KSFR FY   +  ++ +  ML  LGL F G++H GL+DA NILRI   ++ DGC LR+NE++D   PP F +SV R+
Sbjct:  174 SRIHNMSVDNLRTCLYDHSLNQLGSTTVLKRRLQEFVRRARVAQSIDHNIEIQISDDDGDDNENRGFSYGGHDSVLGEVNLNSQITNNCGNDRRRLTNPSVTTTTKLLKPVILTPDTFYDYLLIIDLEATCESKEKITTDADYPHEIIEFPILLYSTRLRKCVSVFHAYCKPRLHPDLSEFCTDLTQIQQIQVDNAQPFPHVLLQIEEWLFKRHKLANKRCAIVCDCSADMSKFMRIQCRLANISIPSWANIWINLTKSFRAFYKFPSRYRITLSVMLHDLGLSFVGQRHRGLDDAINILRIVRVLLSDGCLLRVNERIDFDRPPSFVSSVPRH 507          
BLAST of 3'-5' exoribonuclease 1 vs. TrEMBL
Match: A0A183KC52 (Exonuclease domain-containing protein OS=Schistosoma curassoni OX=6186 GN=SCUD_LOCUS12591 PE=4 SV=1)

HSP 1 Score: 240.35 bits (612), Expect = 4.474e-69
Identity = 132/334 (39.52%), Postives = 183/334 (54.79%), Query Frame = 2
Query:  191 NRINKMPDEQLVGTLKYHGLNAKGSPEILRKRLKEF-------------MKIQMNPDNNE--------------------ISSQ------NDSK-----------------------IYAYFLIIDFEATCDE----INGLNFQHEIIEFPIILYDVILKRKVDVFHAYCKPFINPALSRFCMNLTNINQCTIDSAKSFPDVLTEVEQWLNKHHMFG-KSFAVVCDCNADMAKFMRIQCEISNIEFPFWCKQWINIMKSFRQFYTVSTDVKLNMQKMLSSLGLEFEGRQHSGLNDAENILRITETMMHDGCFLRINEKLD-PFPPHFTASVGRN 988
            +RI+ M  + L   L  H LN  GS  +L++RL+EF             ++IQ++ D+ +                    ++SQ      ND +                        Y Y LIID EATC+         ++ HEIIEFPI+LY   L++ V VFHAYCKP ++P LS FC +LT I Q  +D+A+ FP VL ++E+WL K H    K  A+VCDC+ADM+KFMRIQC ++NI  P W   WIN+ KSFR FY   +  ++ +  ML  LGL F G++H GL+DA NILRI   ++ DGC LR+NE++D   PP F +SV R+
Sbjct:  174 SRIHNMSVDNLRTCLYDHSLNQLGSTTVLKRRLQEFVRRARVAQSIDHNIEIQISDDDGDDNENSGFSYGGHDSVLGEVNLNSQLTNNCGNDRRRLTNPSVTTTTKLLKPVILTPDTFYDYLLIIDLEATCESKEKITTDADYPHEIIEFPILLYSTRLRKCVSVFHAYCKPRLHPDLSEFCTDLTQIQQIQVDNAQPFPHVLLQIEEWLFKRHKLANKRCAIVCDCSADMSKFMRIQCRLANISIPSWANIWINLTKSFRAFYKFPSRYRITLNVMLHDLGLSFVGQRHRGLDDAINILRIVRVLLSDGCLLRVNERIDFDRPPSFVSSVPRH 507          
BLAST of 3'-5' exoribonuclease 1 vs. TrEMBL
Match: A0A095C202 (3'-5' exoribonuclease 1 OS=Schistosoma haematobium OX=6185 GN=MS3_03900 PE=4 SV=1)

HSP 1 Score: 240.35 bits (612), Expect = 5.522e-69
Identity = 132/334 (39.52%), Postives = 183/334 (54.79%), Query Frame = 2
Query:  191 NRINKMPDEQLVGTLKYHGLNAKGSPEILRKRLKEF-------------MKIQMNPDNNE--------------------ISSQ------NDSK-----------------------IYAYFLIIDFEATCDE----INGLNFQHEIIEFPIILYDVILKRKVDVFHAYCKPFINPALSRFCMNLTNINQCTIDSAKSFPDVLTEVEQWLNKHHMFG-KSFAVVCDCNADMAKFMRIQCEISNIEFPFWCKQWINIMKSFRQFYTVSTDVKLNMQKMLSSLGLEFEGRQHSGLNDAENILRITETMMHDGCFLRINEKLD-PFPPHFTASVGRN 988
            +RI+ M  + L   L  H LN  GS  +L++RL+EF             ++IQ++ D+ +                    ++SQ      ND +                        Y Y LIID EATC+         ++ HEIIEFPI+LY   L++ V VFHAYCKP ++P LS FC +LT I Q  +D+A+ FP VL ++E+WL K H    K  A+VCDC+ADM+KFMRIQC ++NI  P W   WIN+ KSFR FY   +  ++ +  ML  LGL F G++H GL+DA NILRI   ++ DGC LR+NE++D   PP F +SV R+
Sbjct:  174 SRIHNMSVDNLRTCLYDHSLNQLGSTTVLKRRLQEFVRRARVVQSIDHNIEIQISDDDGDDNENSGFSYGGHDSVLGEVNLNSQITNNCGNDRRRLTNPSVTTTTKLLKPVILTPDTFYDYLLIIDLEATCESKEKITTDADYPHEIIEFPILLYSTRLRKCVSVFHAYCKPRLHPDLSEFCTDLTQIQQIQVDNAQPFPHVLLQIEEWLFKRHKLANKRCAIVCDCSADMSKFMRIQCRLANISIPSWANIWINLTKSFRAFYKFPSRYRITLNVMLHDLGLSFVGQRHRGLDDAINILRIVRVLLSDGCLLRVNERIDFDRPPSFVSSVPRH 507          
BLAST of 3'-5' exoribonuclease 1 vs. Ensembl Cavefish
Match: eri1 (exoribonuclease 1 [Source:NCBI gene;Acc:107197058])

HSP 1 Score: 203.371 bits (516), Expect = 6.931e-61
Identity = 107/261 (41.00%), Postives = 151/261 (57.85%), Query Frame = 2
Query:  170 KQYALNTNRINKMPDEQLVGTLKYHGLNAKGSPEILRKRLKEFMKIQMNPDNNEISSQNDSKIYAYFLIIDFEATCDEINGLNFQHEIIEFPIILYDVILKRKVDVFHAYCKPFINPALSRFCMNLTNINQCTIDSAKSFPDVLTEVEQWLNKHHMFGK-SFAVVCDCNADMAKFMRIQCEISNIEFPFWCKQWINIMKSFRQFYTVSTD-VKLNMQKMLSSLGLEFEGRQHSGLNDAENILRITETMMHDGCFLRINEKL 946
            K+ AL    IN+M  ++L        L+ +G  ++L KRLK + K Q        +       Y Y  ++DFEATC+E N  +F HEIIEFP++L D      VD F  Y KP +NP LS FC+ LT I Q  +D A +FP V   V  WL K  +  K  +A++ D + DM+KF+  QC +S I +P + ++WINI KS+  +Y V+ +  KLN   ML +LG+ +EGR H GL+D+ NI RI   M+ DGC LR+NE +
Sbjct:   58 KEIALTNGTINQMSKDELRAKCAELKLDTRGVKDVLNKRLKNYYKKQKL--KQAAAGAPADTYYDYICVVDFEATCEENNPSDFVHEIIEFPVVLLDTHTLEMVDYFQEYVKPELNPQLSDFCVELTGITQEMVDEADTFPKVFRRVVSWLQKKELGTKYKYALLTDGSWDMSKFLYTQCRLSRIRYPQFARKWINIRKSYGNYYKVARNQTKLNC--MLENLGMHYEGRPHCGLDDSRNIARIAIRMLKDGCQLRVNEHM 314          
BLAST of 3'-5' exoribonuclease 1 vs. Ensembl Cavefish
Match: ENSAMXT00000055132.1 (pep primary_assembly:Astyanax_mexicanus-2.0:12:268146:276992:-1 gene:ENSAMXG00000034298.1 transcript:ENSAMXT00000055132.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 115.546 bits (288), Expect = 6.245e-27
Identity = 71/246 (28.86%), Postives = 114/246 (46.34%), Query Frame = 2
Query:  272 ILRKRLKEFMKIQMNPDNNEISSQNDSKIYAYFLIIDFEATC-DEINGLNFQHEIIEFPIILYDVILKRKVDVFHAYCKPFINPALSRFCMNLTNINQCTIDSAKSFPDVLTEVEQWLNKHHMFGKSFAVVCDC----------------NADMAKFMRIQCEISNIEFPFWCKQWINIMKSFRQFYTVSTDVKLNMQKMLSSLGLEFEGRQHSGLNDAENILRITETMMHDGCFLRINEKLDPFP 958
            ++RKR  +    + NP           ++++Y ++IDFE+TC  E N  N+  EIIEFP +L +         FH+Y +P  +P LS FC  LT I Q  +++       L+   +WL       K    V D                 + D+   +  +C+   I  P     WI++  ++R FY+        +   L  LG++F GR+HSGL+DA N  R+   M+ DGC L++ + L+  P
Sbjct:   12 LIRKR-SQSSSAEKNPAGTN-------QLFSYLIVIDFESTCWREKN--NYGQEIIEFPAVLLNTSNGEIESEFHSYVQPQEHPILSEFCTELTGITQKQVEAGLPLRICLSRFTRWLQTLQQ-EKGVVYVTDSKNTPSSGQLCTFITWSDWDLGVCLLYECKRKQIVKPEALSSWIDLRATYRTFYSRKPK---GLNGALQDLGIQFSGREHSGLDDARNTARLAWRMVTDGCVLKVTKSLNRAP 243          
BLAST of 3'-5' exoribonuclease 1 vs. Ensembl Sea Lamprey
Match: eri1 (exoribonuclease 1 [Source:ZFIN;Acc:ZDB-GENE-050522-39])

HSP 1 Score: 192.971 bits (489), Expect = 1.906e-58
Identity = 97/253 (38.34%), Postives = 154/253 (60.87%), Query Frame = 2
Query:  197 INKMPDEQLVGTLKYHGLNAKGSPEILRKRLKEFMKIQMNPDNNEISSQNDSKIYAYFLIIDFEATCDEINGLNFQHEIIEFPIILYDVILKRKVDVFHAYCKPFINPALSRFCMNLTNINQCTIDSAKSFPDVLTEVEQWLNKHHMFGK-SFAVVCDCNADMAKFMRIQCEISNIEFPFWCKQWINIMKSFRQFYTVSTD--VKLNMQKMLSSLGLEFEGRQHSGLNDAENILRITETMMHDGCFLRINEKL 946
            + +M   +L   L    L+  G+ E+LR+RLK + +++        +S+ +   + Y  +IDFEATC E N  +F HEIIEFP++L +    +  D F  Y KPF+NP LS FC +LT I Q T+D+A  FP+V+  V  W+ +  +    ++A++ D + DMA+F+ IQC++S + +P + K+WIN+ K+F  F+   T    K + + ML  L L+ EGR HSGL+D+ NI R+  +++  GC LR+NE+L
Sbjct:    1 VVRMGRSELCNHLTRLSLDTSGTKEVLRQRLKSYCQLEHRRSILH-ASKLEPCAFNYICVIDFEATCQEHNPRDFPHEIIEFPVVLLNTSTLQIEDTFQEYVKPFLNPTLSNFCTSLTGITQETVDAADYFPEVIDRVVNWMRQKGLGTTYTYAILTDGSWDMARFLNIQCQLSQLPYPRFAKKWINVRKTFCYFFKRVTKNTKKRSSRTMLECLELQPEGRAHSGLDDSRNIARVAGSLLSRGCCLRLNERL 252          
BLAST of 3'-5' exoribonuclease 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003748.1 (pep scaffold:Pmarinus_7.0:GL479907:465:3435:-1 gene:ENSPMAG00000003429.1 transcript:ENSPMAT00000003748.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 63.1586 bits (152), Expect = 7.194e-13
Identity = 33/87 (37.93%), Postives = 46/87 (52.87%), Query Frame = 2
Query:  359 YAYFLIIDFEATCDEINGLNFQHEIIEFPIILYDVILKRKVDVFHAYCKPFINPALSRFCMNLTNINQCTIDSAKSFPDVLTEVEQW 619
            + +FL++DFEATCD+ +      EIIEFPI+  +         FH Y +P  +P LS FC  LT I Q  +D   +   VL    +W
Sbjct:    9 FHHFLVLDFEATCDK-DAPPRPQEIIEFPILRVNGKSMEVESTFHTYVRPTAHPELSAFCTELTGIVQDMVDGRPTLDQVLQCYTEW 94          
BLAST of 3'-5' exoribonuclease 1 vs. Ensembl Nematostella
Match: EDO48700 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RIG2])

HSP 1 Score: 197.208 bits (500), Expect = 7.639e-60
Identity = 108/276 (39.13%), Postives = 156/276 (56.52%), Query Frame = 2
Query:  119 SDKYKYSNTANFKYNNSKQYALNTNRINKMPDEQLVGTLKYHGLNAKGSPEILRKRLKEFMKIQMNPDNNEISSQNDSKIYAYFLIIDFEATCDEINGLNFQHEIIEFPIILYDVILKRKVDVFHAYCKPFINPALSRFCMNLTNINQCTIDSAKSFPDVLTEVEQWLNKHHMFGKS--FAVVCDCNADMAKFMRIQCEISNIEFPFWCKQWINIMKSFRQFYTVSTDVKLNMQKMLSSLGLEFEGRQHSGLNDAENILRITETMMHDGCFLRINE 940
            S + K     N+ +   K+ +L+   IN+M  E++   L   GL+++G  E+L++RLK  +K +            D    AY+ +IDFEATC++ N   +QHEIIEFP +L +         F  YCKP + P L++FC  LT I+Q T+D + +FP VL     WL K    G +  FAVV D   D+ +F+  QCEI NI  P W +++IN+ K +R FY     +K  + +ML +LGLEFEGR HSGL+D+ NI RI   M+ DG  L  N+
Sbjct:    5 SSEKKTEEGVNYDHPVYKEISLSNGMINRMKKEEVKDILVKLGLDSRGVKEVLQRRLKNHIKKEKLAKAKVQHCSVDRDGIAYYCVIDFEATCEKENPEGYQHEIIEFPAVLVNAKTLEIEGEFQQYCKPLLKPRLTKFCQELTGISQETVDKSDNFPQVLDNFHIWL-KERGIGTTHKFAVVTDGPWDIQRFLVTQCEICNINLPKWSRKYINLRKHYRNFYK----MKCKLSEMLENLGLEFEGRPHSGLDDSRNIARILIKMLKDGGDLSFND 275          
BLAST of 3'-5' exoribonuclease 1 vs. Ensembl Nematostella
Match: EDO36954 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SH41])

HSP 1 Score: 97.8265 bits (242), Expect = 1.936e-23
Identity = 58/216 (26.85%), Postives = 93/216 (43.06%), Query Frame = 2
Query:  359 YAYFLIIDFEATCDEINGLNFQHEIIEFPIILYDVILKRKVDVFHAYCKPFINPALSRFCMNLTNINQCTIDSAKSFPDVLTEVEQWLNKHHMF-------------------GKSFAVVCDCNADMAKFMRIQCEISNIEFPFWCKQWINIMKSFRQFYTVSTDVKLNMQKMLSSLGLEFEGRQHSGLNDAENILRITETMMHDGCFLRINEKLD 949
            + Y ++IDFE+TC +    N   EIIEFP ++        V  F  +  P  +  LS FC  LT I Q  +D+       L    +WL +                        K    V   + D+   ++ +C       P   + WI++  ++++FY+   D    +   L  LG+ F+GR+HSGL+DA N   +   M+ DGC + +   LD
Sbjct:    5 FDYLVVIDFESTCWKEKRRNSAPEIIEFPAVVVSTSTGEIVSEFRQFVSPTEHSRLSEFCTKLTGITQDQVDAGIPIGACLVLFSRWLKELQQLKGIRFMSDITRPNGRPIDQAKWAMSVTWSDWDIGICLKNECLRKRHLVPPELRSWIDLKATYKKFYSRKPD---GLAGALKDLGIRFDGREHSGLDDARNTAALAWRMVRDGCVISVTSSLD 217          
BLAST of 3'-5' exoribonuclease 1 vs. Ensembl Nematostella
Match: EDO45088 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RTT9])

HSP 1 Score: 79.337 bits (194), Expect = 1.243e-17
Identity = 56/187 (29.95%), Postives = 80/187 (42.78%), Query Frame = 2
Query:  335 SSQNDSKIYAYFLIIDFEATCDEINGLNFQHEIIEFPIILYDVILKRKVDVFHAYCKPFINPALSRFCMNLTNINQCTIDSAKSFPDVLTEVEQWLNKHHMFGKSFAVVCDCNADMAKFMRIQCEISNIEFPFWCKQWINIMKSFRQFYTVSTDVKLNMQKMLSSLGLEFEGRQHSGLNDAENILRI 895
            SS + S ++ Y+L++DFEATCD+ N    Q EIIEFP+   +    +    FH Y  P  +P L+ FC +LT I Q   D  +  PD+ T ++ + +   + GK                                                   K+ M  ML  LGLE  GR HSG++DA NI +I
Sbjct:    4 SSCSSSPVFDYYLVLDFEATCDDKNKPKPQ-EIIEFPVTKVNSRTLQTEAEFHQYVCPTAHPKLTTFCTDLTGITQ---DMVEGKPDLQTTLQVYSD---VMGKQ-------------------------------------------------SKIGMPGMLHGLGLELVGRHHSGIDDARNITKI 134          
BLAST of 3'-5' exoribonuclease 1 vs. Ensembl Medaka
Match: eri1 (exoribonuclease 1 [Source:NCBI gene;Acc:101171297])

HSP 1 Score: 211.46 bits (537), Expect = 4.446e-64
Identity = 106/268 (39.55%), Postives = 159/268 (59.33%), Query Frame = 2
Query:  146 ANFKYNNSKQYALNTNRINKMPDEQLVGTLKYHGLNAKGSPEILRKRLKEFMKIQMNPDNNEISSQNDSKIYAYFLIIDFEATCDEINGLNFQHEIIEFPIILYDVILKRKVDVFHAYCKPFINPALSRFCMNLTNINQCTIDSAKSFPDVLTEVEQWLNKHHMFGK-SFAVVCDCNADMAKFMRIQCEISNIEFPFWCKQWINIMKSFRQFYTVSTDVKLNMQKMLSSLGLEFEGRQHSGLNDAENILRITETMMHDGCFLRINEKL 946
            ++F +   K+ AL    IN+M   +L   L    L+ +G  ++++KRLK   + Q    +       D+  Y Y  ++DFEATC+E N  +F HEIIEFP++L +    + VD F +Y KP +NP LS FC+ LT I Q  +D A  FP VL  V +WL +  +  K  +A++ D + DM+KF+ IQC +S I +P + K+WINI KS+  FY +    +  +  ML  LG+++EGR H GL+D+ NI RI   M+ DGC LR+NE++
Sbjct:   50 SDFSHPVYKEIALANGHINRMSKRELQVKLSELKLDTRGVKDVMKKRLKSHYRKQKLMQSAAEGGPTDT-YYDYICVVDFEATCEEDNPSDFLHEIIEFPLVLINTHTLQIVDTFQSYVKPELNPKLSDFCVTLTGITQEMVDEADPFPQVLQRVVKWLQERDLGTKHKYAILTDGSWDMSKFLNIQCRVSRIRYPQFAKKWINIRKSYGNFYKLPRS-QTKLSTMLEKLGMKYEGRPHCGLDDSRNIARIAVRMLQDGCQLRVNERM 315          
BLAST of 3'-5' exoribonuclease 1 vs. Ensembl Medaka
Match: ENSORLT00000012267.2 (ERI1 exoribonuclease family member 2 [Source:NCBI gene;Acc:101155256])

HSP 1 Score: 119.783 bits (299), Expect = 1.784e-28
Identity = 70/244 (28.69%), Postives = 112/244 (45.90%), Query Frame = 2
Query:  317 PDNNEISSQNDSKIYAYFLIIDFEATCDEINGLNFQHEIIEFPIILYDVILKRKVDVFHAYCKPFINPALSRFCMNLTNINQCTIDSAKSFPDVLTEVEQWL------------NKHHMFGKSFAVVCDC------NADMAKFMRIQCEISNIEFPFWCKQWINIMKSFRQFYTVSTDVKLNMQKMLSSLGLEFEGRQHSGLNDAENILRITETMMHDGCFLRINEKLDPFPPHFTASVGRNEA 994
            P N      +  +I++Y ++IDFE+TC      + Q EIIEFP +L +         FH + +P  +P LS FC  LT I Q  +++       L+   +WL            NK      S +    C      + D+   ++ +C+   +  P     WI++  ++R +Y         +   L  LGL+F+GR+HSGL+DA N  R+   MM DGC ++I   LD    H  A+   ++A
Sbjct:   20 PANPRSHGNSKDQIFSYLIVIDFESTCWREKNTSSQ-EIIEFPAVLLNTSTGDIDSEFHTFVQPQEHPTLSEFCTELTGITQVQVEAGLPLQICLSRFTRWLQSLQLEMGFTFPNKQQGSSSSLSTQKLCTFLTWSDWDLGVCLQYECKRKQLHKPDVFNNWIDLRSTYRLWYNRKPK---GLNGALQDLGLQFDGREHSGLDDARNTARLAAKMMRDGCVMKITRSLDRVSAHPMAAFTSSDA 259          
BLAST of 3'-5' exoribonuclease 1 vs. Ensembl Medaka
Match: ENSORLT00000027993.1 (ERI1 exoribonuclease family member 2 [Source:NCBI gene;Acc:101155256])

HSP 1 Score: 119.013 bits (297), Expect = 3.431e-28
Identity = 69/236 (29.24%), Postives = 108/236 (45.76%), Query Frame = 2
Query:  353 KIYAYFLIIDFEATCDEINGLNFQHEIIEFPIILYDVILKRKVDVFHAYCKPFINPALSRFCMNLTNINQCTIDSAKSFPDVLTEVEQWL------------NKHHMFGKSFAVVCDC------NADMAKFMRIQCEISNIEFPFWCKQWINIMKSFRQFYTVSTDVKLNMQKMLSSLGLEFEGRQHSGLNDAENILRITETMMHDGCFLRINEKLDPFPPHFTASVGRNEAVCNN 1006
            +I++Y ++IDFE+TC      + Q EIIEFP +L +         FH + +P  +P LS FC  LT I Q  +++       L+   +WL            NK      S +    C      + D+   ++ +C+   +  P     WI++  ++R +Y         +   L  LGL+F+GR+HSGL+DA N  R+   MM DGC ++I   LD  P       G    + NN
Sbjct:   30 QIFSYLIVIDFESTCWREKNTSSQ-EIIEFPAVLLNTSTGDIDSEFHTFVQPQEHPTLSEFCTELTGITQVQVEAGLPLQICLSRFTRWLQSLQLEMGFTFPNKQQGSSSSLSTQKLCTFLTWSDWDLGVCLQYECKRKQLHKPDVFNNWIDLRSTYRLWYNRKPK---GLNGALQDLGLQFDGREHSGLDDARNTARLAAKMMRDGCVMKITRSLDRTPVVVKGVTGNATRLTNN 261          
BLAST of 3'-5' exoribonuclease 1 vs. Ensembl Medaka
Match: ENSORLT00000012264.2 (ERI1 exoribonuclease family member 2 [Source:NCBI gene;Acc:101155256])

HSP 1 Score: 118.242 bits (295), Expect = 3.542e-28
Identity = 68/232 (29.31%), Postives = 109/232 (46.98%), Query Frame = 2
Query:  353 KIYAYFLIIDFEATCDEINGLNFQHEIIEFPIILYDVILKRKVDVFHAYCKPFINPALSRFCMNLTNINQCTIDSAKSFPDVLTEVEQWL------------NKHHMFGKSFAVVCDC------NADMAKFMRIQCEISNIEFPFWCKQWINIMKSFRQFYTVSTDVKLNMQKMLSSLGLEFEGRQHSGLNDAENILRITETMMHDGCFLRINEKLDPFPPHFTASVGRNEA 994
            +I++Y ++IDFE+TC      + Q EIIEFP +L +         FH + +P  +P LS FC  LT I Q  +++       L+   +WL            NK      S +    C      + D+   ++ +C+   +  P     WI++  ++R +Y         +   L  LGL+F+GR+HSGL+DA N  R+   MM DGC ++I   LD    H  A+   ++A
Sbjct:   30 QIFSYLIVIDFESTCWREKNTSSQ-EIIEFPAVLLNTSTGDIDSEFHTFVQPQEHPTLSEFCTELTGITQVQVEAGLPLQICLSRFTRWLQSLQLEMGFTFPNKQQGSSSSLSTQKLCTFLTWSDWDLGVCLQYECKRKQLHKPDVFNNWIDLRSTYRLWYNRKPK---GLNGALQDLGLQFDGREHSGLDDARNTARLAAKMMRDGCVMKITRSLDRVSAHPMAAFTSSDA 257          
BLAST of 3'-5' exoribonuclease 1 vs. Planmine SMEST
Match: SMESG000016564.1 (SMESG000016564.1)

HSP 1 Score: 776.163 bits (2003), Expect = 0.000e+0
Identity = 387/387 (100.00%), Postives = 387/387 (100.00%), Query Frame = 2
Query:   53 MNQYPXXXXXXXXXXXXXXKFESDKYKYSNTANFKYNNSKQYALNTNRINKMPDEQLVGTLKYHGLNAKGSPEILRKRLKEFMKIQMNPDNNEISSQNDSKIYAYFLIIDFEATCDEINGLNFQHEIIEFPIILYDVILKRKVDVFHAYCKPFINPALSRFCMNLTNINQCTIDSAKSFPDVLTEVEQWLNKHHMFGKSFAVVCDCNADMAKFMRIQCEISNIEFPFWCKQWINIMKSFRQFYTVSTDVKLNMQKMLSSLGLEFEGRQHSGLNDAENILRITETMMHDGCFLRINEKLDPFPPHFTASVGRNEAVCNNYGLNNQRIDISNKTAISANPFTSVTESMNPLNFADLSICTDDNSSQPLVNSDYGFNNLGQMNYYNENCL 1213
            MNQYPSTSQTNTDQTSNNSKFESDKYKYSNTANFKYNNSKQYALNTNRINKMPDEQLVGTLKYHGLNAKGSPEILRKRLKEFMKIQMNPDNNEISSQNDSKIYAYFLIIDFEATCDEINGLNFQHEIIEFPIILYDVILKRKVDVFHAYCKPFINPALSRFCMNLTNINQCTIDSAKSFPDVLTEVEQWLNKHHMFGKSFAVVCDCNADMAKFMRIQCEISNIEFPFWCKQWINIMKSFRQFYTVSTDVKLNMQKMLSSLGLEFEGRQHSGLNDAENILRITETMMHDGCFLRINEKLDPFPPHFTASVGRNEAVCNNYGLNNQRIDISNKTAISANPFTSVTESMNPLNFADLSICTDDNSSQPLVNSDYGFNNLGQMNYYNENCL
Sbjct:    1 MNQYPSTSQTNTDQTSNNSKFESDKYKYSNTANFKYNNSKQYALNTNRINKMPDEQLVGTLKYHGLNAKGSPEILRKRLKEFMKIQMNPDNNEISSQNDSKIYAYFLIIDFEATCDEINGLNFQHEIIEFPIILYDVILKRKVDVFHAYCKPFINPALSRFCMNLTNINQCTIDSAKSFPDVLTEVEQWLNKHHMFGKSFAVVCDCNADMAKFMRIQCEISNIEFPFWCKQWINIMKSFRQFYTVSTDVKLNMQKMLSSLGLEFEGRQHSGLNDAENILRITETMMHDGCFLRINEKLDPFPPHFTASVGRNEAVCNNYGLNNQRIDISNKTAISANPFTSVTESMNPLNFADLSICTDDNSSQPLVNSDYGFNNLGQMNYYNENCL 387          
The following BLAST results are available for this feature:
BLAST of 3'-5' exoribonuclease 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ERI13.342e-6140.21exoribonuclease 1 [Source:HGNC Symbol;Acc:HGNC:239... [more]
ERI13.342e-6140.21exoribonuclease 1 [Source:HGNC Symbol;Acc:HGNC:239... [more]
ERI26.884e-2926.29ERI1 exoribonuclease family member 2 [Source:HGNC ... [more]
ERI29.635e-2924.23ERI1 exoribonuclease family member 2 [Source:HGNC ... [more]
ERI28.453e-2826.64ERI1 exoribonuclease family member 2 [Source:HGNC ... [more]
back to top
BLAST of 3'-5' exoribonuclease 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
eri-12.177e-4236.583'-5' exonuclease eri-1 [Source:UniProtKB/Swiss-P... [more]
eri-11.284e-4136.723'-5' exonuclease eri-1 [Source:UniProtKB/Swiss-P... [more]
M02B7.21.516e-2833.01pep chromosome:WBcel235:IV:3803581:3804949:1 gene:... [more]
R02D3.82.346e-2531.50pep chromosome:WBcel235:IV:255966:257199:-1 gene:W... [more]
crn-48.728e-2533.67Cell death-related nuclease 4 [Source:UniProtKB/S... [more]
back to top
BLAST of 3'-5' exoribonuclease 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Snp1.191e-2731.63gene:FBgn0265192 transcript:FBtr0339100[more]
Snp1.191e-2731.63gene:FBgn0265192 transcript:FBtr0339101[more]
Snp1.191e-2731.63gene:FBgn0265192 transcript:FBtr0339102[more]
Snp1.879e-2731.63gene:FBgn0265192 transcript:FBtr0339099[more]
back to top
BLAST of 3'-5' exoribonuclease 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
eri12.269e-5841.00exoribonuclease 1 [Source:ZFIN;Acc:ZDB-GENE-050522... [more]
eri12.269e-5841.00exoribonuclease 1 [Source:ZFIN;Acc:ZDB-GENE-050522... [more]
eri12.269e-5841.00exoribonuclease 1 [Source:ZFIN;Acc:ZDB-GENE-050522... [more]
eri19.194e-1338.38exoribonuclease 1 [Source:ZFIN;Acc:ZDB-GENE-050522... [more]
back to top
BLAST of 3'-5' exoribonuclease 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
eri13.148e-6641.18exoribonuclease 1 [Source:NCBI gene;Acc:548900][more]
ERI35.521e-2934.74ERI1 exoribonuclease family member 3 [Source:NCBI ... [more]
ERI23.006e-2730.09ERI1 exoribonuclease family member 2 [Source:NCBI ... [more]
ERI23.021e-2730.09ERI1 exoribonuclease family member 2 [Source:NCBI ... [more]
ERI23.377e-2730.09ERI1 exoribonuclease family member 2 [Source:NCBI ... [more]
back to top
BLAST of 3'-5' exoribonuclease 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Eri11.465e-6341.64exoribonuclease 1 [Source:MGI Symbol;Acc:MGI:19145... [more]
Eri27.320e-3027.80exoribonuclease 2 [Source:MGI Symbol;Acc:MGI:19184... [more]
Eri23.173e-2927.80exoribonuclease 2 [Source:MGI Symbol;Acc:MGI:19184... [more]
Eri21.695e-2827.80exoribonuclease 2 [Source:MGI Symbol;Acc:MGI:19184... [more]
Eri34.494e-2733.33exoribonuclease 3 [Source:MGI Symbol;Acc:MGI:21538... [more]
back to top
BLAST of 3'-5' exoribonuclease 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5FVR4|ERI1_RAT2.010e-6440.933'-5' exoribonuclease 1 OS=Rattus norvegicus OX=10... [more]
sp|Q7TMF2|ERI1_MOUSE4.873e-6341.643'-5' exoribonuclease 1 OS=Mus musculus OX=10090 G... [more]
sp|Q8IV48|ERI1_HUMAN1.605e-6040.213'-5' exoribonuclease 1 OS=Homo sapiens OX=9606 GN... [more]
sp|O44406|ERI1_CAEEL1.633e-4036.723'-5' exonuclease eri-1 OS=Caenorhabditis elegans ... [more]
sp|Q08I43|ERI1_SCHPO3.435e-3934.753'-5' exonuclease eri1 OS=Schizosaccharomyces pomb... [more]
back to top
BLAST of 3'-5' exoribonuclease 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
C1LG681.260e-6951.83Three prime histone mRNA exonuclease 1 OS=Schistos... [more]
C1LG671.287e-6951.83Three prime histone mRNA exonuclease 1 OS=Schistos... [more]
A0A430PY393.862e-6939.523'-5' exoribonuclease 1 OS=Schistosoma bovis OX=61... [more]
A0A183KC524.474e-6939.52Exonuclease domain-containing protein OS=Schistoso... [more]
A0A095C2025.522e-6939.523'-5' exoribonuclease 1 OS=Schistosoma haematobium... [more]
back to top
BLAST of 3'-5' exoribonuclease 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
eri16.931e-6141.00exoribonuclease 1 [Source:NCBI gene;Acc:107197058][more]
ENSAMXT00000055132.16.245e-2728.86pep primary_assembly:Astyanax_mexicanus-2.0:12:268... [more]
back to top
BLAST of 3'-5' exoribonuclease 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
eri11.906e-5838.34exoribonuclease 1 [Source:ZFIN;Acc:ZDB-GENE-050522... [more]
ENSPMAT00000003748.17.194e-1337.93pep scaffold:Pmarinus_7.0:GL479907:465:3435:-1 gen... [more]
back to top
BLAST of 3'-5' exoribonuclease 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of 3'-5' exoribonuclease 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO487007.639e-6039.13Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO369541.936e-2326.85Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO450881.243e-1729.95Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of 3'-5' exoribonuclease 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 4
Match NameE-valueIdentityDescription
eri14.446e-6439.55exoribonuclease 1 [Source:NCBI gene;Acc:101171297][more]
ENSORLT00000012267.21.784e-2828.69ERI1 exoribonuclease family member 2 [Source:NCBI ... [more]
ENSORLT00000027993.13.431e-2829.24ERI1 exoribonuclease family member 2 [Source:NCBI ... [more]
ENSORLT00000012264.23.542e-2829.31ERI1 exoribonuclease family member 2 [Source:NCBI ... [more]
back to top
BLAST of 3'-5' exoribonuclease 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000016564.10.000e+0100.00SMESG000016564.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30008965 ID=SMED30008965|Name=3'-5' exoribonuclease 1|organism=Schmidtea mediterranea sexual|type=transcript|length=1429bp
ATTAACTAAAAGCTATTCTTAAATTTGTTCTTAGCAGCGAGATAGTGTTA
TAATGAATCAGTATCCAAGCACATCTCAAACAAATACTGATCAAACTAGT
AATAATAGTAAATTTGAATCTGATAAATATAAATATTCGAACACTGCTAA
TTTTAAATATAATAACAGTAAACAGTATGCTTTAAATACGAATAGGATTA
ATAAAATGCCGGACGAACAATTAGTTGGAACTTTGAAGTATCACGGGTTA
AATGCAAAAGGAAGTCCAGAAATATTAAGGAAGCGACTTAAAGAATTCAT
GAAAATACAAATGAATCCAGATAATAATGAAATTTCCAGTCAGAACGATT
CAAAAATATATGCATATTTTCTTATTATTGATTTTGAAGCTACTTGTGAT
GAAATAAATGGTTTGAATTTCCAACATGAAATCATTGAATTTCCTATTAT
ACTATATGATGTTATTTTAAAACGCAAAGTTGATGTTTTTCACGCATATT
GTAAGCCATTTATCAATCCAGCTTTATCTCGGTTTTGTATGAATTTGACA
AATATCAATCAATGCACAATAGATAGTGCCAAATCGTTTCCTGATGTTTT
AACAGAAGTTGAGCAATGGCTTAATAAGCACCATATGTTTGGAAAATCAT
TTGCTGTTGTTTGTGATTGTAATGCTGATATGGCTAAATTTATGAGAATT
CAATGTGAAATTAGTAACATTGAATTTCCTTTTTGGTGCAAGCAGTGGAT
AAATATTATGAAAAGCTTTCGTCAGTTTTATACAGTTTCAACTGATGTCA
AGTTAAACATGCAAAAAATGTTGAGCAGTTTAGGATTAGAATTCGAAGGC
CGACAACATAGTGGTTTAAATGATGCAGAAAATATTTTGAGAATTACTGA
AACTATGATGCACGATGGATGCTTTTTAAGAATCAACGAAAAACTTGATC
CTTTTCCACCTCATTTCACAGCTTCTGTTGGTCGTAACGAAGCTGTATGC
AACAATTATGGATTAAACAACCAGAGAATTGACATTTCCAATAAAACTGC
AATTTCTGCTAATCCATTCACATCAGTTACTGAATCAATGAATCCTCTTA
ACTTTGCCGATTTAAGCATTTGTACCGATGATAATTCAAGTCAGCCTTTG
GTCAATAGCGATTATGGTTTCAATAACTTAGGACAGATGAATTATTATAA
TGAAAATTGCTTATAAAACTCTATTGAAATGTTTTCTATTTATTATAAAA
AGCAATTTCTCCTTTCTTTCTCTGTATCACACACTCAGTATCAAACATGG
TGTCTTTCTGCTGCATGGTATTTATTAATTGAGAATCGGTGAATATAAAA
TTTTTAATATGTTAATTTAATTTTATATATCTAATGAATATTTGATCTAA
AATAATGATTAGTGATTTGATTTTATCCG
back to top

protein sequence of SMED30008965-orf-1

>SMED30008965-orf-1 ID=SMED30008965-orf-1|Name=SMED30008965-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=388bp
MNQYPSTSQTNTDQTSNNSKFESDKYKYSNTANFKYNNSKQYALNTNRIN
KMPDEQLVGTLKYHGLNAKGSPEILRKRLKEFMKIQMNPDNNEISSQNDS
KIYAYFLIIDFEATCDEINGLNFQHEIIEFPIILYDVILKRKVDVFHAYC
KPFINPALSRFCMNLTNINQCTIDSAKSFPDVLTEVEQWLNKHHMFGKSF
AVVCDCNADMAKFMRIQCEISNIEFPFWCKQWINIMKSFRQFYTVSTDVK
LNMQKMLSSLGLEFEGRQHSGLNDAENILRITETMMHDGCFLRINEKLDP
FPPHFTASVGRNEAVCNNYGLNNQRIDISNKTAISANPFTSVTESMNPLN
FADLSICTDDNSSQPLVNSDYGFNNLGQMNYYNENCL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0002089reproductive organ
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036361SAP_dom_sf
IPR036397RNaseH_sf
IPR013520Exonuclease_RNaseT/DNA_pol3
IPR012337RNaseH-like_sf
Vocabulary: molecular function
TermDefinition
GO:0003676nucleic acid binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR013520Exonuclease, RNase T/DNA polymerase IIISMARTSM00479exoiiienduscoord: 105..291
e-value: 7.4E-23
score: 91.9
IPR013520Exonuclease, RNase T/DNA polymerase IIIPFAMPF00929RNase_Tcoord: 107..281
e-value: 1.3E-26
score: 94.1
IPR036361SAP domain superfamilyGENE3DG3DSA:1.10.720.30coord: 24..93
e-value: 2.1E-7
score: 32.5
IPR036397Ribonuclease H superfamilyGENE3DG3DSA:3.30.420.10coord: 94..327
e-value: 9.0E-69
score: 233.4
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..23
NoneNo IPR availablePANTHERPTHR230443'-5' EXONUCLEASE ERI1-RELATEDcoord: 14..306
NoneNo IPR availablePANTHERPTHR23044:SF273'-5' EXORIBONUCLEASE 1coord: 14..306
NoneNo IPR availableCDDcd06133ERI-1_3'hExo_likecoord: 106..286
e-value: 1.85358E-62
score: 196.287
IPR012337Ribonuclease H-like superfamilySUPERFAMILYSSF53098Ribonuclease H-likecoord: 104..296