SMED30008964

Overview
NameSMED30008964
Smed IDSMED30008964
Length (bp)1474
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30008964 (SMED30008964) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30008964 (SMED30008964) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30008964 (SMED30008964) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30008964 (SMED30008964) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30008964

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
protonephridiaSMED30008964SMESG000010167.1 dd_Smed_v4_8925_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30008964SMESG000010167.1 dd_Smed_v4_8925_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30008964SMESG000010167.1 dd_Smed_v4_8925_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30008964SMESG000010167.1 dd_Smed_v4_8925_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal-ventral muscle cellSMED30008964SMESG000010167.1 dd_Smed_v4_8925_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Category 3 cellSMED30008964SMESG000010167.1 dd_Smed_v4_8925_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30008964SMESG000010167.1 dd_Smed_v4_8925_0_1dd_Smed_v4PMID:30962434
Cote et al., 2019
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of SMED30008964 vs. Ensembl Zebrafish
Match: timp2a (TIMP metallopeptidase inhibitor 2a [Source:ZFIN;Acc:ZDB-GENE-030612-1])

HSP 1 Score: 51.9878 bits (123), Expect = 3.954e-7
Identity = 44/149 (29.53%), Postives = 67/149 (44.97%), Query Frame = 2
Query:  248 QINQMADICSCGLQVPQQKFCEHDFVFAGKRV-NRNVTPFNTPNGVMVSELIPYMGQIYRIRLRYNFKGVFVNYSKRRVFVTIYVLRGPICGVSDSISMIRKKNYVLSG-YQYKSLLVLTSCNWIQPLNSITSFQAIGLFSNLYQKYCD 688
            ++ ++A+ CSC    PQQ FC  D V   K V N+ V   N   G  +  +       Y I+    FKG       R + V        +CGV++ +    KK Y++SG  +    + +T C+ I P  S+++ Q   L S  YQ  CD
Sbjct:   18 RVGEIAEACSCSPVHPQQAFCNADVVIRAKVVGNKEVDSGNDIYGNPIKRI------QYEIKQIKMFKG-----PDRHIDVVFTAPSSAVCGVTN-LDTNGKKEYLISGKAEANGKMHVTLCDLIMPWESMSATQKKSL-SQRYQMGCD 153          
BLAST of SMED30008964 vs. Ensembl Zebrafish
Match: timp2a (TIMP metallopeptidase inhibitor 2a [Source:ZFIN;Acc:ZDB-GENE-030612-1])

HSP 1 Score: 51.2174 bits (121), Expect = 5.842e-7
Identity = 41/148 (27.70%), Postives = 70/148 (47.30%), Query Frame = 2
Query:  248 QINQMADICSCGLQVPQQKFCEHDFVFAGKRVNRNVTPFNTPNGVMVSELIPYMGQIYRIRLRYNFKGVFVNYSKRRVFVTIYVLRGPICGVSDSISMIRKKNYVLSG-YQYKSLLVLTSCNWIQPLNSITSFQAIGLFSNLYQKYCD 688
            ++ ++A+ CSC    PQQ FC  D V   K V +     ++ N +  + +     +I +I++   FKG       R + V        +CGV++ +    KK Y++SG  +    + +T C+ I P  S+++ Q   L S  YQ  CD
Sbjct:   18 RVGEIAEACSCSPVHPQQAFCNADVVIRAKVVGKK--EVDSGNDIYGNPIKRIQYEIKQIKM---FKG-----PDRHIDVVFTAPSSAVCGVTN-LDTNGKKEYLISGKAEANGKMHVTLCDLIMPWESMSATQKKSL-SQRYQMGCD 153          
BLAST of SMED30008964 vs. TrEMBL
Match: A0A087W1W5 (Uncharacterized protein OS=Echinococcus multilocularis OX=6211 GN=EmuJ_000232300 PE=4 SV=1)

HSP 1 Score: 73.9442 bits (180), Expect = 1.023e-10
Identity = 50/211 (23.70%), Postives = 93/211 (44.08%), Query Frame = 2
Query:  224 HTESILSQQINQMADICSCGLQVPQQKFCEHDFVFAGKRVNRNVTPFNTPNGVMVSELIPYMGQIYRIRLRYNFKGVFVNYSKRRVFVTIYVLRGPICGVSDSISMIRKKNYVLSGYQYK---------------SLLVLTSCNWIQPLNSITSFQAIGLFSNLYQKYCDFSHKCQISVDYKSPT---FFDQ-ICKINQKYKDCYENYAIC 799
            ++ + + +  +     CSCGL + Q ++C+ DFV   +       PF    G   S   PY G    I++ ++ KG    + +    V IY ++G  CG+++++    K  Y+LSG++ +                + ++T C W Q +  +T  Q  GLF  +Y   C     C +   +  P+   + D+  C  + +   CY  ++IC
Sbjct:   43 YSSAFMKRAASLTGHYCSCGLPLLQSRYCKQDFVILAEVDVLESKPFYGLRGSHSSSGWPYSGASIPIKVLHSVKGSLRLHER----VDIYFIQGTSCGITNTMFPRHKGKYLLSGFRIEVPGCKDLGPSCHLPAKMYLVTRCGWSQEMEDLTVTQIAGLFLKMYS--CG-ERACSMQPSFTKPSGGLYLDKNTCYYDYQRSRCYSRFSIC 246          
BLAST of SMED30008964 vs. TrEMBL
Match: A0A068WJ48 (TIMP domain containing protein OS=Echinococcus granulosus OX=6210 GN=EgrG_000232300 PE=4 SV=1)

HSP 1 Score: 73.559 bits (179), Expect = 1.312e-10
Identity = 50/195 (25.64%), Postives = 87/195 (44.62%), Query Frame = 2
Query:  272 CSCGLQVPQQKFCEHDFVFAGKRVNRNVTPFNTPNGVMVSELIPYMGQIYRIRLRYNFKGVFVNYSKRRVFVTIYVLRGPICGVSDSISMIRKKNYVLSGYQYK---------------SLLVLTSCNWIQPLNSITSFQAIGLFSNLYQKYCDFSHKCQISVDYKSPT---FFDQ-ICKINQKYKDCYENYAIC 799
            CSCGL + Q ++C+ DFV   +       PF    G   S   PY G    I++ ++ KG    + +    V IY ++G  CG+++++    K  Y+LSG++ +                + ++T C W Q +  +T  Q  GLF  +Y   C     C +   +  P+   + D+  C  + +   CY  ++IC
Sbjct:   59 CSCGLPLLQSRYCKQDFVILAEVDVLESKPFYGLRGSHSSSGWPYSGASIPIKVLHSVKGSLRLHER----VDIYFIQGTSCGITNTMFPRHKGKYLLSGFRIEMPGCKDLGPSCHLPAMMYLVTRCGWSQEMEDLTVTQIAGLFLKMYS--CG-ERACSMQPSFTKPSGGLYLDKNTCYYDYRRSRCYSRFSIC 246          
BLAST of SMED30008964 vs. TrEMBL
Match: A0A158QSM0 (SWIM-type domain-containing protein OS=Mesocestoides corti OX=53468 GN=MCOS_LOCUS1035 PE=4 SV=1)

HSP 1 Score: 70.0922 bits (170), Expect = 2.249e-9
Identity = 69/277 (24.91%), Postives = 114/277 (41.16%), Query Frame = 2
Query:  200 STVIFLATHTESILSQQINQMADICSCGLQVPQQKFCEHDFVFAGKRVNRNVTPFNTPNGVMVSELIPYMGQIYRIRLRYNFKGVFVNYSKRRVFVTIYVLRGPICGVSDSISMIRKKNYVLSGY----------------QYKSLLVLTSCNWIQPLNSITSFQAIGLFSNLYQKYCDFSHKCQISVDY-----KSPTFFDQICKINQKYKDCYENYAICHWQS--NNKCAISTNLTDLSNQNRLIHLPNSLLKNLKKEKQKFQQLSSTH-FRYCV 958
            ST +  A    S+ +         C+CG  + Q KFC+HDFV   KR +     F   NG+  S    + G +  + + +  KG  +  +K   F   + ++G  CGV+  +       ++++G+                Q K L ++T C+  QPL S++  Q  GLF +LY   C      ++   +     +SPT F   C  +     CY  +A+C   S   N C         ++Q+ L  LP  L   +        Q++  H FR C+
Sbjct:   42 STALDFAADRSSLEAHMRQHTRSYCTCGEALLQSKFCKHDFVVVAKRKSPRTQRF---NGIHGSGPWHFAGTVITLSVEHVVKGS-LEVNKNADF---HFIQGSTCGVTPHMIPRENSTFLITGFHLRFPGCDKVHQDNCLQTKELFLVTRCSASQPLESLSITQVAGLFLDLYS--CSAGSCSELRPYFWEPLPQSPTPF--TCSYSYTALRCYTRFALCTKSSLTPNTCTFRAVNRIPTSQSVLAKLPPVLHPTIHGALAS--QVTDEHRFRACL 305          
BLAST of SMED30008964 vs. TrEMBL
Match: A0A0X3P7K5 (Uncharacterized protein OS=Schistocephalus solidus OX=70667 GN=TR152814 PE=4 SV=1)

HSP 1 Score: 69.707 bits (169), Expect = 3.666e-9
Identity = 48/214 (22.43%), Postives = 90/214 (42.06%), Query Frame = 2
Query:  215 LATHTESILSQQINQMA-DICSCGLQVPQQKFCEHDFVFAGKRVNRNVTPFNTPNGVMVSELIPYMGQIYRIRLRYNFKGVFVNYSKRRVFVTIYVLRGPICGVSDSISMIRKKNYVLSGYQY---------------KSLLVLTSCNWIQPLNSITSFQAIGLFSNLYQKYCDFSHKCQI---SVDYKSPTFFDQICKINQKYKDCYENYAIC 799
            L T+T +     + Q     C+CG  + Q ++C+ DFV  G+   ++  PF       ++   P+ G I  + ++++ KG      +    + +Y   G +CGV++ +   R+ +Y++SG+                   + ++T C W  PL  +T  Q  GLF  +Y   CD    CQ    +    +       C+       C+  Y++C
Sbjct:   98 LGTNTTNFSKPDVRQATRPYCTCGDALLQARYCKQDFVIIGRPDKQHARPFYGLRATALNLKWPFSGTIIPLTVQHSLKGNLQTGQR----LEVYYAEGAMCGVTEDMLPTREGSYLISGFYITIPGCRSLGSRCHLPPEIYLVTRCGWTAPLQDLTITQMAGLFLGMYS--CD-EGTCQFVPSASGDAAAVGKHNFCRYIYSATPCFSRYSLC 304          
BLAST of SMED30008964 vs. TrEMBL
Match: A0A564XWW6 (Uncharacterized protein OS=Hymenolepis diminuta OX=6216 GN=WMSIL1_LOCUS658 PE=4 SV=1)

HSP 1 Score: 67.781 bits (164), Expect = 1.284e-8
Identity = 67/255 (26.27%), Postives = 100/255 (39.22%), Query Frame = 2
Query:  218 ATHTESILSQQINQMADICSCGLQVPQQKFCEHDFV-FAGKRVNRNVTPFNTPNGV---MVSELIPYMGQIYRIRLRYNFKGVFVNYSKRRVFVTIYVLRGPICGVSDSISMIRKKNYVLSGYQY-------------KSLLVLTSCNWIQPLNSITSFQAIGLFSNLYQKYCDFSHKCQISVDYKSPTFFDQ----ICKINQKYKDCYENYAICHWQS--NNK---CAISTNLTDLSNQNRLIHLPNSLLKNLK 904
            A  +   L   I      CSCG+ V Q +FC  DFV  A   V +    +  P+ V     S   PY G I  I++  + KG  +    +   + IY  +G  CGV D     R   Y+LSG++              + +  +T C W QP   +T  Q  GLF   Y   C    +C + +    P    Q    +C  + K   CY  Y +C   +  NN    C + +        N L H+P+   K ++
Sbjct:   50 ANDSRKDLQNMIAATRKYCSCGMFVLQSRFCHQDFVILAYVNVEKRRPYWGMPHIVDSNHSSPGFPYSGTIIPIKVIESIKGPLM----KNQHLNIYFTQGSYCGVLDDAFPRRSGKYILSGFRIEFPECKDISCHLPREIFAVTRCGWSQPAEDLTLTQIGGLFLKGYN--CG-KGECTMLLSILKPKNSTQVDRNVCYFDYKLPRCYSRYTMCVRVAGINNGPPYCTLRSIRRLSPTPNILRHIPSEFHKTIR 297          
BLAST of SMED30008964 vs. Ensembl Cavefish
Match: timp2b (metalloproteinase inhibitor 2-like [Source:NCBI gene;Acc:103028836])

HSP 1 Score: 53.1434 bits (126), Expect = 1.072e-7
Identity = 42/167 (25.15%), Postives = 75/167 (44.91%), Query Frame = 2
Query:  194 FFSTVIFLATHTESILSQQINQMADICSCGLQVPQQKFCEHDFVFAGKRVN-RNVTPFNTPNGVMVSELIPYMGQIYRIRLRYNFKGVFVNYSKRRVFVTIYVLRGPICGVSDSISMIRKKNYVLSG-YQYKSLLVLTSCNWIQPLNSITSFQAIGLFSNLYQKYCD 688
              S  +F A    +++  ++ ++A+ CSC    PQQ +C  D     K +  + V   N   G  + ++       Y I+    FKG      ++ +         P+CGV    S+ R+K Y+++G  +    + +T C++I+P  S+T  Q  G F   Y+  CD
Sbjct:    1 MLSKCVFSAPLLLALMVWRLGEVAEACSCSPTHPQQAYCTTDIAIRAKVIGQKEVVAGNDNYGNPIRKI------QYDIKQMKMFKG-----PQQEIKAIFTAPISPVCGV----SLEREKEYLITGKLESDGSVHITLCDFIEPWVSLTVAQKRG-FETRYETGCD 151          
BLAST of SMED30008964 vs. Ensembl Medaka
Match: timp-2b (tissue inhibitor of metalloproteinase-2b [Source:NCBI gene;Acc:100529200])

HSP 1 Score: 49.2914 bits (116), Expect = 2.190e-6
Identity = 49/191 (25.65%), Postives = 82/191 (42.93%), Query Frame = 2
Query:  182 ITLLFFSTVIFLATHTESILSQQINQMADICSCGLQVPQQKFCEHDFVFAGKRVNRNVTPFNTPNGVMVSELIPYMGQIYRIRLRYNFKGVFVNYSKRRVFVTIYVL-RGPICGVSDSISMIRKKNYVLSG-YQYKSLLVLTSCNWIQPLNSITSFQAIGLFSNLYQKY-----CDFSHKCQISVDYKSPT 733
            +T +  S ++ LA     +L  ++ ++A+ CSC    PQQ  C  D V   K V R     +  N +       Y   I RI  +Y+ K + +          +Y      +CGV  S+    KK Y+++G  +    + +T C++I   +++T+ Q      NL Q+Y     C  +H   I     SPT
Sbjct:    1 MTWMNNSCLVTLAV----LLLWRVEEIAEACSCSPAHPQQAVCNSDVVIRAKLVGRQ--EVDAGNDI-------YGNTIKRI--KYDVKQIKMFKGPSHDIDAVYTAPSSSLCGV--SMDTTGKKEYLITGKLETDGTMHVTLCDFIDQWDAMTATQK----KNLIQRYESSCDCKITHCTSIPCVLSSPT 170          
BLAST of SMED30008964 vs. Planmine SMEST
Match: SMESG000010167.1 (SMESG000010167.1)

HSP 1 Score: 566.614 bits (1459), Expect = 0.000e+0
Identity = 290/292 (99.32%), Postives = 290/292 (99.32%), Query Frame = 2
Query:  107 MKLTICSFIIHPXXXXXXXXXXXXXITLLFFSTVIFLATHTESILSQQINQMADICSCGLQVPQQKFCEHDFVFAGKRVNRNVTPFNTPNGVMVSELIPYMGQIYRIRLRYNFKGVFVNYSKRRVFVTIYVLRGPICGVSDSISMIRKKNYVLSGYQYKSLLVLTSCNWIQPLNSITSFQAIGLFSNLYQKYCDFSHKCQISVDYKSPTFFDQICKINQKYKDCYENYAICHWQSNNKCAISTNLTDLSNQNRLIHLPNSLLKNLKKEKQKFQQLSSTHFRYCVISKMYSFP 982
            MKLTICSFIIHPSVSNLSYSISSWSITLLFFS VIFLATHTESILSQQINQMADICSCGLQVPQQKFCEHDFVFAGKRVNRNVTPFNTPNGVMVSELIPYMGQIYRIRLRYNFKGVFVNYSKRRVFVTIYVLRGPICGVSDSISMIRKKNYVLSGYQYKSLLVLTSCNWIQPLNSITSFQAIGLFSNLYQKYCDFSHKCQISVDYKSPTFFDQICKINQKYKDCYENYAICHWQSNNKCAISTNLTDLSNQNRLIHLP SLLKNLKKEKQKFQQLSSTHFRYCVISKMYSFP
Sbjct:    1 MKLTICSFIIHPSVSNLSYSISSWSITLLFFSIVIFLATHTESILSQQINQMADICSCGLQVPQQKFCEHDFVFAGKRVNRNVTPFNTPNGVMVSELIPYMGQIYRIRLRYNFKGVFVNYSKRRVFVTIYVLRGPICGVSDSISMIRKKNYVLSGYQYKSLLVLTSCNWIQPLNSITSFQAIGLFSNLYQKYCDFSHKCQISVDYKSPTFFDQICKINQKYKDCYENYAICHWQSNNKCAISTNLTDLSNQNRLIHLPKSLLKNLKKEKQKFQQLSSTHFRYCVISKMYSFP 292          
BLAST of SMED30008964 vs. Planmine SMEST
Match: SMESG000010167.1 (SMESG000010167.1)

HSP 1 Score: 498.434 bits (1282), Expect = 1.092e-177
Identity = 240/241 (99.59%), Postives = 240/241 (99.59%), Query Frame = 2
Query:  260 MADICSCGLQVPQQKFCEHDFVFAGKRVNRNVTPFNTPNGVMVSELIPYMGQIYRIRLRYNFKGVFVNYSKRRVFVTIYVLRGPICGVSDSISMIRKKNYVLSGYQYKSLLVLTSCNWIQPLNSITSFQAIGLFSNLYQKYCDFSHKCQISVDYKSPTFFDQICKINQKYKDCYENYAICHWQSNNKCAISTNLTDLSNQNRLIHLPNSLLKNLKKEKQKFQQLSSTHFRYCVISKMYSFP 982
            MADICSCGLQVPQQKFCEHDFVFAGKRVNRNVTPFNTPNGVMVSELIPYMGQIYRIRLRYNFKGVFVNYSKRRVFVTIYVLRGPICGVSDSISMIRKKNYVLSGYQYKSLLVLTSCNWIQPLNSITSFQAIGLFSNLYQKYCDFSHKCQISVDYKSPTFFDQICKINQKYKDCYENYAICHWQSNNKCAISTNLTDLSNQNRLIHLP SLLKNLKKEKQKFQQLSSTHFRYCVISKMYSFP
Sbjct:    1 MADICSCGLQVPQQKFCEHDFVFAGKRVNRNVTPFNTPNGVMVSELIPYMGQIYRIRLRYNFKGVFVNYSKRRVFVTIYVLRGPICGVSDSISMIRKKNYVLSGYQYKSLLVLTSCNWIQPLNSITSFQAIGLFSNLYQKYCDFSHKCQISVDYKSPTFFDQICKINQKYKDCYENYAICHWQSNNKCAISTNLTDLSNQNRLIHLPKSLLKNLKKEKQKFQQLSSTHFRYCVISKMYSFP 241          
BLAST of SMED30008964 vs. Planmine SMEST
Match: SMESG000023551.1 (SMESG000023551.1)

HSP 1 Score: 70.4774 bits (171), Expect = 6.591e-14
Identity = 48/158 (30.38%), Postives = 79/158 (50.00%), Query Frame = 2
Query:  419 YRIRLRYNFKGVFVNYSKRRVFVTIYVLRGPICGVSDSISMIRKKNYVLSGYQYKSLLVLTSCNWIQPLNSITSFQAIGLFSNLYQKYCDFSHKCQISVDYKSPTFFDQICKINQKYKDCYENYAICH---WQSNNKCAISTNL----TDLSNQNRLI 871
            Y++++ YNFKG + + +K  V   I  + GP CG   S+ + R + Y+++GY +   +V+TSCN +  +N +   QAIGLF   Y  +C F ++C      K   F    C I  +   C + Y IC     ++  KC +   L    +DL    R++
Sbjct:   20 YKMKIMYNFKGFYSDLTKDNVKYYISFMYGP-CG--SSLQLKRHRLYLITGYIFNKQMVVTSCNKVISVNELNPLQAIGLFRQFYSNHCYFQNQC------KKKNF----CPIKLRSMSCLDKYGICAPTMSENEVKCELIQRLVIYHSDLRKMPRIL 164          
The following BLAST results are available for this feature:
BLAST of SMED30008964 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30008964 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30008964 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30008964 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
timp2a3.954e-729.53TIMP metallopeptidase inhibitor 2a [Source:ZFIN;Ac... [more]
timp2a5.842e-727.70TIMP metallopeptidase inhibitor 2a [Source:ZFIN;Ac... [more]
back to top
BLAST of SMED30008964 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30008964 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30008964 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30008964 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A087W1W51.023e-1023.70Uncharacterized protein OS=Echinococcus multilocul... [more]
A0A068WJ481.312e-1025.64TIMP domain containing protein OS=Echinococcus gra... [more]
A0A158QSM02.249e-924.91SWIM-type domain-containing protein OS=Mesocestoid... [more]
A0A0X3P7K53.666e-922.43Uncharacterized protein OS=Schistocephalus solidus... [more]
A0A564XWW61.284e-826.27Uncharacterized protein OS=Hymenolepis diminuta OX... [more]
back to top
BLAST of SMED30008964 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
timp2b1.072e-725.15metalloproteinase inhibitor 2-like [Source:NCBI ge... [more]
back to top
BLAST of SMED30008964 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30008964 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30008964 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30008964 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
timp-2b2.190e-625.65tissue inhibitor of metalloproteinase-2b [Source:N... [more]
back to top
BLAST of SMED30008964 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000010167.10.000e+099.32SMESG000010167.1[more]
SMESG000010167.11.092e-17799.59SMESG000010167.1[more]
SMESG000023551.16.591e-1430.38SMESG000023551.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30008964 ID=SMED30008964|Name=SMED30008964|organism=Schmidtea mediterranea sexual|type=transcript|length=1474bp
AATCTATATAAATCTTATATGCACACCATTCTGATTGGGTAAGAAAGCTT
ATTATCAAGACTATGGAGATCCAAATCCTGTCATTAACAAGAGTGGGTCT
CAAAACATGAAATTAACAATTTGTTCTTTTATTATTCATCCATCAGTCTC
GAATCTGTCATATTCCATATCTTCTTGGTCGATTACTTTATTGTTTTTTT
CAACTGTCATTTTTCTCGCAACCCATACCGAGTCCATTTTGAGTCAACAA
ATAAATCAAATGGCTGATATTTGTAGCTGTGGATTACAAGTGCCCCAACA
AAAGTTTTGTGAGCATGACTTTGTTTTCGCGGGTAAAAGAGTAAATCGTA
ACGTAACGCCATTTAATACCCCAAATGGCGTCATGGTTTCAGAACTGATA
CCCTACATGGGCCAGATCTATCGAATTCGACTCCGATATAATTTCAAAGG
AGTATTTGTCAATTATTCTAAAAGAAGAGTTTTCGTAACTATTTATGTCC
TCCGAGGTCCAATTTGTGGAGTTTCAGATAGCATCAGCATGATTCGAAAA
AAGAATTATGTTCTGAGTGGCTATCAGTACAAGTCGCTGCTCGTATTAAC
GTCTTGCAACTGGATCCAACCCCTGAACAGTATCACCAGTTTTCAAGCCA
TTGGACTGTTTTCAAACCTATATCAGAAATATTGCGATTTCAGCCATAAA
TGTCAAATTTCTGTTGATTATAAAAGTCCGACTTTTTTCGATCAGATCTG
CAAAATCAATCAAAAATACAAAGACTGCTATGAGAATTACGCAATTTGTC
ATTGGCAGTCTAACAATAAGTGCGCCATATCGACCAATTTGACTGATTTA
TCCAATCAAAATCGTTTAATCCACTTACCGAATTCTTTGTTGAAAAATTT
GAAGAAAGAAAAACAAAAATTTCAACAACTCAGCTCGACCCATTTCCGAT
ATTGCGTCATCAGCAAGATGTATAGTTTTCCTTAGAAATCAATAAAATTC
TCATTCGATAAAAATATAAACCGATAATTAAAACAATAAAAACACAAACA
TACACAAACACACAGAGAGAAATTTTTGGAATTTTCTTTTGAAATTTACA
ACAGACAAATTATCGAACATTAAATCCAAATAAATAAAGACGTCGCTCGA
TTTTGTTTTAATTCGTTTTGAGTTTGAATTCATTTTTCATCCGGTGTTAG
ATTTATCCGATTTGAAGAGTATAAAATCAAATCAAATCGAATATGACTGT
TTCAAACAAATAATTCGAATAAACGTTTTCTTTAATTTTTTGTTTATCGT
CTGTTGTATCTGTGCCACTCGATTATTTGTTGTGGATTTCTGTTGTCGGT
TTTCACAAATTTATTCTGCCTCATTTTCGATTAATTTCATTCATTTTGTT
GACTGTTTATTCATAGATTGTCATCTTTTCTCTTTTTATTGAAAAAAATA
AATGTTATTTTCATTCAAAAAAAA
back to top

protein sequence of SMED30008964-orf-1

>SMED30008964-orf-1 ID=SMED30008964-orf-1|Name=SMED30008964-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=293bp
MKLTICSFIIHPSVSNLSYSISSWSITLLFFSTVIFLATHTESILSQQIN
QMADICSCGLQVPQQKFCEHDFVFAGKRVNRNVTPFNTPNGVMVSELIPY
MGQIYRIRLRYNFKGVFVNYSKRRVFVTIYVLRGPICGVSDSISMIRKKN
YVLSGYQYKSLLVLTSCNWIQPLNSITSFQAIGLFSNLYQKYCDFSHKCQ
ISVDYKSPTFFDQICKINQKYKDCYENYAICHWQSNNKCAISTNLTDLSN
QNRLIHLPNSLLKNLKKEKQKFQQLSSTHFRYCVISKMYSFP*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000035Category 3 cell
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0002028dorsal-ventral muscle cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR027465TIMP_C
IPR001820TIMP
IPR001134Netrin_domain
IPR008993TIMP-like_OB-fold
Vocabulary: molecular function
TermDefinition
GO:0008191metalloendopeptidase inhibitor activity
GO:0005515protein binding
GO:0004857enzyme inhibitor activity
GO:0030414peptidase inhibitor activity
GO:0046872metal ion binding
Vocabulary: cellular component
TermDefinition
GO:0005576extracellular region
GO:0005578proteinaceous extracellular matrix
Vocabulary: biological process
TermDefinition
GO:0010466negative regulation of peptidase activity
GO:0010951negative regulation of endopeptidase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001820Protease inhibitor I35 (TIMP)SMARTSM00206NTR_2coord: 56..233
e-value: 7.1E-4
score: -50.8
IPR001820Protease inhibitor I35 (TIMP)PFAMPF00965TIMPcoord: 55..240
e-value: 6.4E-16
score: 58.7
IPR001820Protease inhibitor I35 (TIMP)PANTHERPTHR11844METALLOPROTEASE INHIBITORcoord: 28..241
IPR008993Tissue inhibitor of metalloproteinases-like, OB-foldGENE3DG3DSA:2.40.50.120coord: 71..175
e-value: 1.4E-17
score: 66.1
IPR008993Tissue inhibitor of metalloproteinases-like, OB-foldSUPERFAMILYSSF50242TIMP-likecoord: 56..240
IPR027465Proteinase inhibitor I35b (TIMP), C-terminalGENE3DG3DSA:3.90.370.10coord: 56..240
e-value: 1.4E-17
score: 66.1
NoneNo IPR availablePANTHERPTHR11844:SF25TISSUE INHIBITOR OF METALLOPROTEINASEcoord: 28..241
NoneNo IPR availableTMHMMTMhelixcoord: 17..39
IPR001134Netrin domainPROSITEPS50189NTRcoord: 56..193
score: 9.246