Meckelin

Overview
NameMeckelin
Smed IDSMED30008957
Length (bp)2997
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Meckelin (SMED30008957) t-SNE clustered cells

Violin plots show distribution of expression levels for Meckelin (SMED30008957) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Meckelin (SMED30008957) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Meckelin (SMED30008957) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30008957

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30008957SMESG000043913.1 SmedASXL_015295SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30008957SMESG000043913.1 dd_Smed_v4_7765_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30008957SMESG000043913.1 dd_Smed_v4_7765_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30008957SMESG000043913.1 dd_Smed_v6_7765_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30008957SMESG000043913.1 dd_Smed_v4_7765_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30008957SMESG000043913.1 dd_Smed_v4_7765_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Meckelin vs. Ensembl Human
Match: TMEM67 (transmembrane protein 67 [Source:HGNC Symbol;Acc:HGNC:28396])

HSP 1 Score: 481.871 bits (1239), Expect = 1.174e-153
Identity = 332/983 (33.77%), Postives = 494/983 (50.25%), Query Frame = 3
Query:  177 CSSTTYFSSVDFKCVSCSVNAKQSSDGFSCVCKDGYYFTKNGGGSQVLCQKCPLN-QIPSSNGWSCISCLNGVTGTSCSSCDSPNVAYSSDVLGNQFN-GNCTACATN---YRPVN---NQCQLCSNILSTNGNSSCSCALP---TGNACLTKS----LSNSSILTY--LGQSVTSGFLQANLMDSVAMCQVSME-SGCQNLANMCVMSVYNRQSAKSIDGTPCSLYAQV--QPSGSYTSGKTAGY----PWLYY-----TIPQTLTQLTVDHQY-VRGET----LQIVLATYDSAGQFLGIRNATKDSNLQLCDNSITKRKETFRFGTHYLESCSITISQLSNQTRYLPLFYDPYLSYTDSIGASQLYPIPIKIGQVISDSGTTPNLLFDQAAWILTRRLLLVDNFGAITAPFQTNRTASYITFASSMRLVVVKQSSGSFDITKDGSIYAPYLEVNXXXXXXXXXXXXA-NISFEVVYYNVSSYTTAFYYSLSVAMGILCALAGLYAILRAFFWCRRSGISGFEGLVLLKTLAHACASISNVFFIVIFGISLYFLLLFKNQNLFSIL--PPDDDSFFVAYLISAFLLKMLEIVHIFVAQCTVDIFLIDWERPKHQLAPKKIFERSKFDTATDNTGDQNLIQQEKGSQNNGVSIWRTYFIANEWNEIQTYRKTSLIFNLIIVLLFMEVIGFKNITTFDCFVNYSPSSDAYSAPNYRMFRFAVIVSIFGITAFIQWLFTVLIYERVIEDKLRNYVDLCSVANISIIVLAHRQFGYYIHGRSVHGSADVSLSEMYGALQKENAGSCAKRGLESDSMQQTYIMALPNNFRINLDSVY-----RPGGNRLLEDGRNM------QYLEVNKFLDRFINRTHDPRILFRFQDRKXXXXXXXXXXXXNSLEGRFYRDNGTSFGNVLFYGQELALVTFDILLFCVTDLILQNTVFDAFITWGLVTILKMIRNGCGAHNLANKTLVDRRFLI 2981
            C +  YF      CV C  N +Q + G SCVC  G+    N GG  ++C+KCP N +  + +GW+CISC + +T      C   ++    D+ G   +   C  C  N   +  VN   ++C  C      N + SC+C+ P   TG  C + +    L   S   Y  +G S+TS +    L  S A C V    + CQ L NMCVM++ N     + D   C L+  +    +G  T    + +    PWL+Y       PQ L+  ++   +  +GE     L+ V A+YD  G FL  +   +   LQLC ++ T+    + FGT Y ++C I IS++       P+FYD YL YTD      +  +P+ +   +  +    N   +   W+LTRR+ LVD          T      +    S+ + +V         T +G+IY P + +  + +      S +  +SF V Y          +    +A+G+L  LA L ++L+   W RR G    +   ++K L +    ++NVFFI+  G  LY+L+ FK Q   S+L   P  +  FV Y+  AF LK L+ +H  ++Q T+D+F IDWERPK            K   A +  G          S    VSIWRTYF+ANEWNEIQT RK + +F ++ VL F+EV+GFKN+   D   + S +  +Y AP   + R+AV  +++     IQ +F  + YER IEDK+R +VDLCS++NIS+ +L+H+ FGYYIHGRSVHG AD ++ EM   L++E    C++RGL  ++  QT+ +A+ N  R + D ++     + G  RLL    +        Y  +NKFL  FI+  H     F  +D+   E I   EF +   +  FY D G SF +VL+YG E  L+ FD+L FCV DL  QN +  +F+T+    I + IRN  G  NLA+KTLVD+RFLI
Sbjct:   39 CDNNQYFDISALSCVPCGANQRQDARGTSCVCLPGFQMISNNGGPAIICKKCPENMKGVTEDGWNCISCPSDLTAEGKCHCPIGHILVERDINGTLLSQATCELCDGNENSFMVVNALGDRCVRCEPTF-VNTSRSCACSEPNILTGGLCFSSTGNFPLRRISAARYGEVGMSLTSEWFAKYLQSSAAACWVYANLTSCQALGNMCVMNM-NSYDFATFDA--CGLFQFIFENTAGLSTVHSISFWRQNLPWLFYGDQLGLAPQVLSSTSLPTNFSFKGENQNTKLKFVAASYDIRGNFLKWQ-TLEGGVLQLCPDTETRLNAAYSFGTTYQQNCEIPISKILIDFP-TPIFYDVYLEYTDENQHQYILAVPV-LNLNLQHNKIFVNQDSNSGKWLLTRRIFLVDAVSGRENDLGTQPRVIRVATQISLSVHLVPN-------TINGNIYPPLITIAYSDIDIKDANSQSVKVSFSVTYEMDHGEA---HVQTDIALGVLGGLAVLASLLKTAGWKRRIGSPMIDLQTVVKFLVYYAGDLANVFFIITVGTGLYWLIFFKAQKSVSVLLPMPIQEERFVTYVGCAFALKALQFLHKLISQITIDVFFIDWERPK-----------GKVLKAVEGEGGVR-------SATVPVSIWRTYFVANEWNEIQTVRKINSLFQVLTVLFFLEVVGFKNLALMDSSSSLSRNPPSYIAPYSCILRYAVSAALWLAIGIIQVVFFAVFYERFIEDKIRQFVDLCSMSNISVFLLSHKCFGYYIHGRSVHGHADTNMEEMNMNLKREAENLCSQRGLVPNTDGQTFEIAISNQMRQHYDRIHETLIRKNGPARLLSSSASTFEQSIKAYHMMNKFLGSFIDHVHKEMDYF-IKDKLLLERILGMEFMEPMEKSIFYNDEGYSFSSVLYYGNEATLLIFDLLFFCVVDLACQNFILASFLTYLQQEIFRYIRNTVGQKNLASKTLVDQRFLI 985          
BLAST of Meckelin vs. Ensembl Human
Match: TMEM67 (transmembrane protein 67 [Source:HGNC Symbol;Acc:HGNC:28396])

HSP 1 Score: 481.1 bits (1237), Expect = 2.794e-153
Identity = 332/983 (33.77%), Postives = 494/983 (50.25%), Query Frame = 3
Query:  177 CSSTTYFSSVDFKCVSCSVNAKQSSDGFSCVCKDGYYFTKNGGGSQVLCQKCPLN-QIPSSNGWSCISCLNGVTGTSCSSCDSPNVAYSSDVLGNQFN-GNCTACATN---YRPVN---NQCQLCSNILSTNGNSSCSCALP---TGNACLTKS----LSNSSILTY--LGQSVTSGFLQANLMDSVAMCQVSME-SGCQNLANMCVMSVYNRQSAKSIDGTPCSLYAQV--QPSGSYTSGKTAGY----PWLYY-----TIPQTLTQLTVDHQY-VRGET----LQIVLATYDSAGQFLGIRNATKDSNLQLCDNSITKRKETFRFGTHYLESCSITISQLSNQTRYLPLFYDPYLSYTDSIGASQLYPIPIKIGQVISDSGTTPNLLFDQAAWILTRRLLLVDNFGAITAPFQTNRTASYITFASSMRLVVVKQSSGSFDITKDGSIYAPYLEVNXXXXXXXXXXXXA-NISFEVVYYNVSSYTTAFYYSLSVAMGILCALAGLYAILRAFFWCRRSGISGFEGLVLLKTLAHACASISNVFFIVIFGISLYFLLLFKNQNLFSIL--PPDDDSFFVAYLISAFLLKMLEIVHIFVAQCTVDIFLIDWERPKHQLAPKKIFERSKFDTATDNTGDQNLIQQEKGSQNNGVSIWRTYFIANEWNEIQTYRKTSLIFNLIIVLLFMEVIGFKNITTFDCFVNYSPSSDAYSAPNYRMFRFAVIVSIFGITAFIQWLFTVLIYERVIEDKLRNYVDLCSVANISIIVLAHRQFGYYIHGRSVHGSADVSLSEMYGALQKENAGSCAKRGLESDSMQQTYIMALPNNFRINLDSVY-----RPGGNRLLEDGRNM------QYLEVNKFLDRFINRTHDPRILFRFQDRKXXXXXXXXXXXXNSLEGRFYRDNGTSFGNVLFYGQELALVTFDILLFCVTDLILQNTVFDAFITWGLVTILKMIRNGCGAHNLANKTLVDRRFLI 2981
            C +  YF      CV C  N +Q + G SCVC  G+    N GG  ++C+KCP N +  + +GW+CISC + +T      C   ++    D+ G   +   C  C  N   +  VN   ++C  C      N + SC+C+ P   TG  C + +    L   S   Y  +G S+TS +    L  S A C V    + CQ L NMCVM++ N     + D   C L+  +    +G  T    + +    PWL+Y       PQ L+  ++   +  +GE     L+ V A+YD  G FL  +   +   LQLC ++ T+    + FGT Y ++C I IS++       P+FYD YL YTD      +  +P+ +   +  +    N   +   W+LTRR+ LVD          T      +    S+ + +V         T +G+IY P + +  + +      S +  +SF V Y          +    +A+G+L  LA L ++L+   W RR G    +   ++K L +    ++NVFFI+  G  LY+L+ FK Q   S+L   P  +  FV Y+  AF LK L+ +H  ++Q T+D+F IDWERPK            K   A +  G          S    VSIWRTYF+ANEWNEIQT RK + +F ++ VL F+EV+GFKN+   D   + S +  +Y AP   + R+AV  +++     IQ +F  + YER IEDK+R +VDLCS++NIS+ +L+H+ FGYYIHGRSVHG AD ++ EM   L++E    C++RGL  ++  QT+ +A+ N  R + D ++     + G  RLL    +        Y  +NKFL  FI+  H     F  +D+   E I   EF +   +  FY D G SF +VL+YG E  L+ FD+L FCV DL  QN +  +F+T+    I + IRN  G  NLA+KTLVD+RFLI
Sbjct:   49 CDNNQYFDISALSCVPCGANQRQDARGTSCVCLPGFQMISNNGGPAIICKKCPENMKGVTEDGWNCISCPSDLTAEGKCHCPIGHILVERDINGTLLSQATCELCDGNENSFMVVNALGDRCVRCEPTF-VNTSRSCACSEPNILTGGLCFSSTGNFPLRRISAARYGEVGMSLTSEWFAKYLQSSAAACWVYANLTSCQALGNMCVMNM-NSYDFATFDA--CGLFQFIFENTAGLSTVHSISFWRQNLPWLFYGDQLGLAPQVLSSTSLPTNFSFKGENQNTKLKFVAASYDIRGNFLKWQ-TLEGGVLQLCPDTETRLNAAYSFGTTYQQNCEIPISKILIDFP-TPIFYDVYLEYTDENQHQYILAVPV-LNLNLQHNKIFVNQDSNSGKWLLTRRIFLVDAVSGRENDLGTQPRVIRVATQISLSVHLVPN-------TINGNIYPPLITIAYSDIDIKDANSQSVKVSFSVTYEMDHGEA---HVQTDIALGVLGGLAVLASLLKTAGWKRRIGSPMIDLQTVVKFLVYYAGDLANVFFIITVGTGLYWLIFFKAQKSVSVLLPMPIQEERFVTYVGCAFALKALQFLHKLISQITIDVFFIDWERPK-----------GKVLKAVEGEGGVR-------SATVPVSIWRTYFVANEWNEIQTVRKINSLFQVLTVLFFLEVVGFKNLALMDSSSSLSRNPPSYIAPYSCILRYAVSAALWLAIGIIQVVFFAVFYERFIEDKIRQFVDLCSMSNISVFLLSHKCFGYYIHGRSVHGHADTNMEEMNMNLKREAENLCSQRGLVPNTDGQTFEIAISNQMRQHYDRIHETLIRKNGPARLLSSSASTFEQSIKAYHMMNKFLGSFIDHVHKEMDYF-IKDKLLLERILGMEFMEPMEKSIFYNDEGYSFSSVLYYGNEATLLIFDLLFFCVVDLACQNFILASFLTYLQQEIFRYIRNTVGQKNLASKTLVDQRFLI 995          
BLAST of Meckelin vs. Ensembl Human
Match: TMEM67 (transmembrane protein 67 [Source:HGNC Symbol;Acc:HGNC:28396])

HSP 1 Score: 418.698 bits (1075), Expect = 1.626e-130
Identity = 295/866 (34.06%), Postives = 440/866 (50.81%), Query Frame = 3
Query:  504 VNNQCQLCSNILSTNGNSSCSCALP---TGNACLTKS----LSNSSILTY--LGQSVTSGFLQANLMDSVAMCQVSME-SGCQNLANMCVMSVYNRQSAKSIDGTPCSLYAQV--QPSGSYTSGKTAGY----PWLYY-----TIPQTLTQLTVDHQY-VRGE----TLQIVLATYDSAGQFLGIRNATKDSNLQLCDNSITKRKETFRFGTHYLESCSITISQLSNQTRYLPLFYDPYLSYTDSIGASQLYPIPIKIGQVISDSGTTPNLLFDQAAWILTRRLLLVDNFGAITAPFQTNRTASYITFASSMRLVVVKQSSGSFDITKDGSIYAPYLEVNXXXXXXXXXXXXA-NISFEVVYYNVSSYTTAFYYSLSVAMGILCALAGLYAILRAFFWCRRSGISGFEGLVLLKTLAHACASISNVFFIVIFGISLYFLLLFKNQNLFSIL--PPDDDSFFVAYLISAFLLKMLEIVHIFVAQCTVDIFLIDWERPKHQLAPKKIFERSKFDTATDNTGDQNLIQQEKGSQNNGVSIWRTYFIANEWNEIQTYRKTSLIFNLIIVLLFMEVIGFKNITTFDCFVNYSPSSDAYSAPNYRMFRFAVIVSIFGITAFIQWLFTVLIYERVIEDKLRNYVDLCSVANISIIVLAHRQFGYYIHGRSVHGSADVSLSEMYGALQKENAGSCAKRGLESDSMQQTYIMALPNNFRINLDSVY-----RPGGNRLLEDGRNM------QYLEVNKFLDRFINRTHDPRILFRFQDRKXXXXXXXXXXXXNSLEGRFYRDNGTSFGNVLFYGQELALVTFDILLFCVTDLILQNTVFDAFITWGLVTILKMIRNGCGAHNLANKTLVDRRFLI 2981
            + ++C  C      N + SC+C+ P   TG  C + +    L   S   Y  +G S+TS +    L  S A C V    + CQ L NMCVM++ N     + D   C L+  +    +G  T    + +    PWL+Y       PQ L+  ++   +  +GE     L+ V A+YD  G FL  +   +   LQLC ++ T+    + FGT Y ++C I IS++       P+FYD YL YTD      +  +P+ +   +  +    N   +   W+LTRR+ LVD          T      +    S+ + +V         T +G+IY P + +  + +      S +  +SF V Y          +    +A+G+L  LA L ++L+   W RR G    +   ++K L +    ++NVFFI+  G  LY+L+ FK Q   S+L   P  +  FV Y+  AF LK L+ +H  ++Q T+D+F IDWERPK            K   A +  G          S    VSIWRTYF+ANEWNEIQT RK + +F ++ VL F+EV+GFKN+   D   + S +  +Y AP   + R+AV  +++     IQ +F  + YER IEDK+R +VDLCS++NIS+ +L+H+ FGYYIHGRSVHG AD ++ EM   L++E    C++RGL  ++  QT+ +A+ N  R + D ++     + G  RLL    +        Y  +NKFL  FI+  H     F  +D+   E I   EF +   +  FY D G SF +VL+YG E  L+ FD+L FCV DL  QN +  +F+T+    I + IRN  G  NLA+KTLVD+RFLI
Sbjct:   85 LGDRCVRCEPTF-VNTSRSCACSEPNILTGGLCFSSTGNFPLRRISAARYGEVGMSLTSEWFAKYLQSSAAACWVYANLTSCQALGNMCVMNM-NSYDFATFDA--CGLFQFIFENTAGLSTVHSISFWRQNLPWLFYGDQLGLAPQVLSSTSLPTNFSFKGENQNTKLKFVAASYDIRGNFLKWQ-TLEGGVLQLCPDTETRLNAAYSFGTTYQQNCEIPISKILIDFP-TPIFYDVYLEYTDENQHQYILAVPV-LNLNLQHNKIFVNQDSNSGKWLLTRRIFLVDAVSGRENDLGTQPRVIRVATQISLSVHLVPN-------TINGNIYPPLITIAYSDIDIKDANSQSVKVSFSVTYEMDHGEA---HVQTDIALGVLGGLAVLASLLKTAGWKRRIGSPMIDLQTVVKFLVYYAGDLANVFFIITVGTGLYWLIFFKAQKSVSVLLPMPIQEERFVTYVGCAFALKALQFLHKLISQITIDVFFIDWERPK-----------GKVLKAVEGEGGVR-------SATVPVSIWRTYFVANEWNEIQTVRKINSLFQVLTVLFFLEVVGFKNLALMDSSSSLSRNPPSYIAPYSCILRYAVSAALWLAIGIIQVVFFAVFYERFIEDKIRQFVDLCSMSNISVFLLSHKCFGYYIHGRSVHGHADTNMEEMNMNLKREAENLCSQRGLVPNTDGQTFEIAISNQMRQHYDRIHETLIRKNGPARLLSSSASTFEQSIKAYHMMNKFLGSFIDHVHKEMDYF-IKDKLLLERILGMEFMEPMEKSIFYNDEGYSFSSVLYYGNEATLLIFDLLFFCVVDLACQNFILASFLTYLQQEIFRYIRNTVGQKNLASKTLVDQRFLI 914          
BLAST of Meckelin vs. Ensembl Human
Match: TMEM67 (transmembrane protein 67 [Source:HGNC Symbol;Acc:HGNC:28396])

HSP 1 Score: 105.916 bits (263), Expect = 1.406e-23
Identity = 108/397 (27.20%), Postives = 173/397 (43.58%), Query Frame = 3
Query:  351 SSNGWSCISCLNGVTGTSCSSCDSPNVAYSSDVLGNQFN-GNCTACATN---YRPVN---NQCQLCSNILSTNGNSSCSCALP---TGNACLTKS----LSNSSILTY--LGQSVTSGFLQANLMDSVAMCQVSME-SGCQNLANMCVMSVYNRQSAKSIDGTPCSLYAQV--QPSGSYTSGKTAGY----PWLYY-----TIPQTLTQLTVDHQY-VRGET----LQIVLATYDSAGQFLGIRNATKDSNLQLCDNSITKRKETFRFGTHYLESCSITISQLSNQTRYLPLFYDPYLSYTDSIGASQLYPIPIKIGQVISDSGTTPNLLFDQAAWILTRRLLLVDNFGAITAPFQTNRTASYITFASSMRLVVVKQSSGSFDITKDGSIYAPYLEV 1442
            + +GW+CISC + +T      C   ++    D+ G   +   C  C  N   +  VN   ++C  C      N + SC+C+ P   TG  C + +    L   S   Y  +G S+TS +    L  S A C V    + CQ L NMCVM++ N     + D   C L+  +    +G  T    + +    PWL+Y       PQ L+  ++   +  +GE     L+ V A+YD  G FL  +   +   LQLC ++ T+    + FGT Y ++C I IS++       P+FYD YL YTD      +  +P+ +   +  +    N   +   W+LTRR+ LVD          T      +    S+ + +V         T +G+IY P + +
Sbjct:    5 TEDGWNCISCPSDLTAEGKCHCPIGHILVERDINGTLLSQATCELCDGNENSFMVVNALGDRCVRCEPTF-VNTSRSCACSEPNILTGGLCFSSTGNFPLRRISAARYGEVGMSLTSEWFAKYLQSSAAACWVYANLTSCQALGNMCVMNM-NSYDFATFDA--CGLFQFIFENTAGLSTVHSISFWRQNLPWLFYGDQLGLAPQVLSSTSLPTNFSFKGENQNTKLKFVAASYDIRGNFLKWQ-TLEGGVLQLCPDTETRLNAAYSFGTTYQQNCEIPISKILIDFP-TPIFYDVYLEYTDENQHQYILAVPV-LNLNLQHNKIFVNQDSNSGKWLLTRRIFLVDAVSGRENDLGTQPRVIRVATQISLSVHLVPN-------TINGNIYPPLITI 387          
BLAST of Meckelin vs. Ensembl Human
Match: TMEM67 (transmembrane protein 67 [Source:HGNC Symbol;Acc:HGNC:28396])

HSP 1 Score: 65.4698 bits (158), Expect = 1.706e-11
Identity = 32/94 (34.04%), Postives = 48/94 (51.06%), Query Frame = 3
Query:  177 CSSTTYFSSVDFKCVSCSVNAKQSSDGFSCVCKDGYYFTKNGGGSQVLCQKCPLN-QIPSSNGWSCISCLNGVTGTSCSSCDSPNVAYSSDVLG 455
            C +  YF      CV C  N +Q + G SCVC  G+    N GG  ++C+KCP N +  + +GW+CISC + +T      C   ++    D+ G
Sbjct:   47 CDNNQYFDISALSCVPCGANQRQDARGTSCVCLPGFQMISNNGGPAIICKKCPENMKGVTEDGWNCISCPSDLTAEGKCHCPIGHILVERDING 140          
BLAST of Meckelin vs. Ensembl Celegans
Match: mks-3 (MecKel-Gruber Syndrome (MKS) homolog [Source:UniProtKB/TrEMBL;Acc:Q20046])

HSP 1 Score: 318.546 bits (815), Expect = 7.359e-94
Identity = 270/967 (27.92%), Postives = 437/967 (45.19%), Query Frame = 3
Query:  177 CSSTTYFSSVDFKCVSCSVNAKQSSDGFSCVC-KDGYYFTKNGGGSQVLCQKCPLNQIPSSNGWSCISCLNGVTGTSCSSCDSPNVAYSSDVLGNQFNGN--CTACATN-YRPVNNQCQLCSNILSTNGNSSCSCALPTGNACLTKSLSNSSILTYLGQSVTSGFLQANLMDSVAMCQVSMESGCQNLANMCVMSVYNRQSAKSIDGTPCSLYAQVQPSGSYTSGKTAGYPW------LYYTIPQTL-TQLTVDHQYV--RGETLQIVLATYDSAGQFLGIRNATKDSNLQLCDNSITKRKETFRFGTHYLESCSITISQLSNQTRYLPLFYDPYLSYTDSIGASQLYPIPIKIGQVISDSGTTPNLL-FDQAAWILTRRLLLVDNFGAITAPFQTNRTASYITFASSMRLVVVKQSSGSFDITKDGSIYAPYLEVNXXXXXXXXXXXXANISFEVVYYNVSSYTTAFYYSLSVAMGILCALAGLYAILRAFFWCRRSGI-SGFEGLVLLKTLAHACASISNVFFIVIFGISLYFLLLFKNQN--LFSILPPDDDSFFVAYLISAFLLKMLEIVHIFVAQCTVDIFLIDWERPKHQLAPKKIFERSKFDTATDNTGDQNLIQQEKGSQNNGVSIWRTYFIANEWNEIQTYRKTSLIFNLIIVLLFMEVIGFKNITTFDCFVNYSPSSDAYSAP---NYRMFRFAVIVSIFGITAFIQWLFTVLIYERVIEDKLRNYVDLCSVANISIIVLAHRQFGYYIHGRSVHGSADVSLSEMYGALQKENAGSCAKRGLESDSMQQTYIMALPNNFRINLDSVYRPG--------GNRLLEDGRNM---QYLEVNKFLDRFINRTHDPRILFRFQDRKXXXXXXXXXXXXNSLEGRFYRDN-GTSFGNVLFYGQELALVTFDILLFCVTDLILQNTVFDAFITWGLVTILKMIRNGCGAHNLANKTLVDRRFLI 2981
            C+   YF+ ++ +C  C      S D  SC C K+     +NG      C++CP   + S +   C++C NG    +C  C S +     D  GN    +  C  CA+  YR  N  C  C         +SCS    T +  +   +   +     G  + S +++ +L     +C       C+ + NMCV+   N +S  S++   C L   +         K    PW      L  T    L  +  +DHQY+     + ++  A YD  G F G    ++D  L  CD+S+      F FG  Y + C I  +  ++      LF + YL ++D  G S+LYP+ I +   +  +G   N    D+  W+LTRR  L D++       + + ++  + FA+ + + VV Q        +DG I  PYL +     +     +    S E++Y+  SS    +   L +A+ I+  ++  ++ L ++ W RR G  S  +   +L       + + +VFF++   I+ +    +K+Q   L+++L  D + F   Y I++ +LK   ++    A    + F IDWER K +               TD  G        K ++   V +WRTY IANEWNE+Q YRKTSL   +I ++L ME    KN       V      DA+ +    +      AV + ++   A +Q L  VLI ER++ D   N+VDLCS++NIS++ L H  +GYYIHGRSVHG  D  +SEM   LQ+E    C  RGLE  S  QT+ + LPN FR   D ++           G+  +    N     + ++N FL +F++ +    I +  +DR   E + D E  D+S+ G F RD    ++     YG E A  +F+ L   V  L   +     F+ + +  ++++I      ++L   +LVD+RFL+
Sbjct:    5 CTRLQYFNRIELRCEICPNTTIPSDDMMSCKCSKNQIEIFRNGFVPT--CEECPEGTLSSPDQTGCLNCNNG----TCH-CPSQSTLIFRDASGNLLTNDAFCGNCASGFYRNDNGYCTKCE--------TSCSEMNSTNSDQVYTRIKLQN-----GVEMKSIYIENHLSTDAKLCSERNIQSCEAMVNMCVLQ--NFESGSSLNA--CGLLENI---------KRLFNPWQNTLDALATTDDSELENENVIDHQYLFRPDSSFELFFARYDVNGTFDGFF-TSEDIFLHFCDDSLNPFA-PFLFGRRYQKECKIRKATFTDPRLERKLF-EVYLKFSDEQGHSKLYPVHI-LNSAVRVNGQLLNFANKDRNRWVLTRRFYLFDDYS-----MKFDNSSKLMRFAAKIGINVVLQKE------RDGYINPPYLTIEYDDSTDEIFEN----SLEIIYHKDSS---GYDQKLIIALSIIIPMSLFWSALCSYSWGRRQGKPSAVDASSILYFFVCEVSILGDVFFVLFGFIACWTTFAYKSQTYVLYNMLSYDQEKFLFHYFIASLVLKFFGLLFTMGALVFQETFFIDWERQKLR--------------QTDEHGMPLSRDLHKSTEAEPVVVWRTYLIANEWNELQQYRKTSLALQVITMILLMEYFQVKNYA----LVEPEFERDAFDSSTTLSTLASSLAVTIFVYLSLALLQVLVRVLIVERIVTDPFHNFVDLCSLSNISVLSLTHSLYGYYIHGRSVHGKGDAGMSEMNEFLQRERNNLCGFRGLEPGSELQTFTVNLPNLFRSKYDEIFAVSKQTTSGVVGHEAITAKMNATVDAHSQMNSFLKKFVDHSI-TDIEYVVRDRPVLESVLDMEMSDSSITGTFTRDPVEIAYSRCFVYGNEWAWTSFECLTVTVFYLWSGSLYLAGFVVYVISHLIRLIFGYLSTNHLIKTSLVDQRFLV 897          
BLAST of Meckelin vs. Ensembl Fly
Match: CG15923 (gene:FBgn0038814 transcript:FBtr0113254)

HSP 1 Score: 132.494 bits (332), Expect = 4.939e-31
Identity = 109/413 (26.39%), Postives = 188/413 (45.52%), Query Frame = 3
Query: 1809 LISAFLLKMLEI-VHIFVAQCTVDIFLIDWERPKHQLAPKKIFERSKFDTATDNTGDQNLIQQEKGSQNNGVSIWRTYFIANEWNEIQTYRKTSLIFNLIIVLLFMEVIGFKNITTFDCFVNYSPSSDAYSAPNYRMFRFAVIVSIFGITAFIQWLFTVLIYERVIEDKLRNYVDLCSVANISIIVLAHRQFGYYIHGRSVHGSADVSLSEMYGALQKENAGSCAKRGLESDSMQQTYIMALPNNFRINLDSVYRPGGNRLLE----------------DGR----NMQYLEVNKFLDRFINRT-HDPRILFRFQDRKXXXXXXXXXXXXNSLEGRFYRDNGTSFGNVLFYGQELALVTFDILLFCVTDLILQNTVFDAFITWGLVTILKMIRNGCGAHNLANKTLVDRRFLI 2981
            L +AF+L+ L + +H++ +   +++FLIDWERP+     +++      D+++  +  +  + +      + VS WR  F AN W  +   +K S +  + +V     + G++ +  F          D +        R  +I + + +T  +Q    ++ ++  I + L+ ++DLCS+ANIS+  L    FGYYIHGRS HG AD  +S M   LQ+     C +RGL  DS +Q Y++  P N  I L+ +  P    L                  DG+    ++ Y  VN+F   FI+    D   + + +         + +       G FY D+  SF  VL  G  L +   ++LL     L+  N +  A     L  +L+ +       N++ KTL+D RFL+
Sbjct:  590 LNTAFVLQFLFLGIHLWRSS-QLELFLIDWERPRSSCEGQRL----NLDSSSLCSSVRTFVAE------SSVSAWRVLFTANAWIRLSVTQKYSTLGQVFVV-----IAGYQFLERFT-------KGDIF-------LRCCLIAAAYLLTYLLQ----IIGHQLFIANPLQKFIDLCSLANISLFSLTEPGFGYYIHGRSPHGFADTDMSSMILQLQRTQT-MCGRRGLLMDSDKQAYVILPPRNLHIYLERLLLPFQRSLTGTLSQTMLYQKDIVPSIDGQMERTSIAYASVNRFFCAFIDHAIKDMDYIIKEKSFVEQLLNCEIDNYITENRGTFYIDDSFSFSRVLLLGNHLHIFVLELLLVLSIFLMTSNLLIAAAGACALNILLRQVFRHWVRRNISRKTLIDERFLL 967          
BLAST of Meckelin vs. Ensembl Fly
Match: CG15923 (gene:FBgn0038814 transcript:FBtr0330028)

HSP 1 Score: 132.109 bits (331), Expect = 5.661e-31
Identity = 109/413 (26.39%), Postives = 188/413 (45.52%), Query Frame = 3
Query: 1809 LISAFLLKMLEI-VHIFVAQCTVDIFLIDWERPKHQLAPKKIFERSKFDTATDNTGDQNLIQQEKGSQNNGVSIWRTYFIANEWNEIQTYRKTSLIFNLIIVLLFMEVIGFKNITTFDCFVNYSPSSDAYSAPNYRMFRFAVIVSIFGITAFIQWLFTVLIYERVIEDKLRNYVDLCSVANISIIVLAHRQFGYYIHGRSVHGSADVSLSEMYGALQKENAGSCAKRGLESDSMQQTYIMALPNNFRINLDSVYRPGGNRLLE----------------DGR----NMQYLEVNKFLDRFINRT-HDPRILFRFQDRKXXXXXXXXXXXXNSLEGRFYRDNGTSFGNVLFYGQELALVTFDILLFCVTDLILQNTVFDAFITWGLVTILKMIRNGCGAHNLANKTLVDRRFLI 2981
            L +AF+L+ L + +H++ +   +++FLIDWERP+     +++      D+++  +  +  + +      + VS WR  F AN W  +   +K S +  + +V     + G++ +  F          D +        R  +I + + +T  +Q    ++ ++  I + L+ ++DLCS+ANIS+  L    FGYYIHGRS HG AD  +S M   LQ+     C +RGL  DS +Q Y++  P N  I L+ +  P    L                  DG+    ++ Y  VN+F   FI+    D   + + +         + +       G FY D+  SF  VL  G  L +   ++LL     L+  N +  A     L  +L+ +       N++ KTL+D RFL+
Sbjct:  590 LNTAFVLQFLFLGIHLWRSS-QLELFLIDWERPRSSCEGQRL----NLDSSSLCSSVRTFVAE------SSVSAWRVLFTANAWIRLSVTQKYSTLGQVFVV-----IAGYQFLERFT-------KGDIF-------LRCCLIAAAYLLTYLLQ----IIGHQLFIANPLQKFIDLCSLANISLFSLTEPGFGYYIHGRSPHGFADTDMSSMILQLQRTQT-MCGRRGLLMDSDKQAYVILPPRNLHIYLERLLLPFQRSLTGTLSQTMLYQKDIVPSIDGQMERTSIAYASVNRFFCAFIDHAIKDMDYIIKEKSFVEQLLNCEIDNYITENRGTFYIDDSFSFSRVLLLGNHLHIFVLELLLVLSIFLMTSNLLIAAAGACALNILLRQVFRHWVRRNISRKTLIDERFLL 967          
BLAST of Meckelin vs. Ensembl Zebrafish
Match: tmem67 (transmembrane protein 67 [Source:ZFIN;Acc:ZDB-GENE-080716-1])

HSP 1 Score: 470.7 bits (1210), Expect = 1.029e-149
Identity = 324/986 (32.86%), Postives = 490/986 (49.70%), Query Frame = 3
Query:  177 CSSTTYFSSVDFKCVSCSVNAKQSSDGFSCVCKDGYYFTKNGGGSQVLCQKCP-LNQIPSSNGWSCISCLNGVTGTSCSSCDSPNVAYSSDVLGNQF-NGNCTACATNYRPVN------NQCQLCSNILSTNGNSSCSCALP---TGNAC-----LTKSLSNSSILTYLGQSVTSGFLQANLMDSVAMCQV-SMESGCQNLANMCVMSVYNRQSAKSIDGTPCSLYAQV------QPSGSYTSGKTAGYPWLYYTIPQTLTQLTVDHQYV----------RGETLQIVLATYDSAGQFLGIRNATKDSNLQLCDNSITKRKETFRFGTHYLESCSITISQLSNQTRYL-PLFYDPYLSYTDSIGASQLYPIPIKIGQVISDSGTTPNLLFDQAAWILTRRLLLVDNFGAITAPFQTNRTASYITFASSMRLVVVKQSSGSFDI---TKDGSIYAPYLEVN-XXXXXXXXXXXXANISFEVVYYNVSSYTTAFYYSLSVAMGILCALAGLYAILRAFFWCRRSGISGFEGLVLLKTLAHACASISNVFFIVIFGISLYFLLLFKNQNLFSIL-P-PDDDSFFVAYLISAFLLKMLEIVHIFVAQCTVDIFLIDWERPKHQLAPKKIFERSKFDTATDNTGDQNLIQQEKGSQNNGVSIWRTYFIANEWNEIQTYRKTSLIFNLIIVLLFMEVIGFKNITTFDCFVNYSPSSDAYSAPNYRMFRFAVIVSIFGITAFIQWLFTVLIYERVIEDKLRNYVDLCSVANISIIVLAHRQFGYYIHGRSVHGSADVSLSEMYGALQKENAGSCAKRGLESDSMQQTYIMALPNNFRINLDSVYRP-----GGNRLLEDGRN------MQYLEVNKFLDRFINRTHDPRILFRFQDRKXXXXXXXXXXXXNSLEGRFYRDNGTSFGNVLFYGQELALVTFDILLFCVTDLILQNTVFDAFITWGLVTILKMIRNGCGAHNLANKTLVDRRFLI 2981
            C   +YF      CV C  N   S  G +C C+ G     + G S +LCQ+CP  +Q+ + +G+ CI C   V       C   +V    D  GN      C AC+      +      N+C+ C +    N + SC C       G  C     L  S+++S I + L   V S +  + +  S A C + S  + CQ+L NMCVM   N  S+ SI+   C LY  +      Q S    S      PWLYY     +    + ++ +          +   +++  A Y   G+FL   +  +  NLQLC ++ T+++  F+FGT Y +SC +++S+L   T Y  PLFYD +L   +S   ++L  +P+ +      +G   N   D + W LTRRL+LVD          ++     I  AS +++         F +   T+ G +Y P + V           T +  ++F V Y   +           +A+G+L  +A ++++L+   W RR      +   ++K L      ++NVFFI+  G  LY+L+ FK Q   S+L P P  +  FV Y+  AF LK ++ +H    Q +VD+F IDWERP           R K     + +G       E  SQ + VSIWRTYF+ANEWNEIQT RK +  F ++ VL F+EV+GF N+   D   N + S++ Y+ P   + R+ V  +++     IQ +F  + +ER +EDK+R +VDLCS++NIS+++L+HR FGYYIHGRSVHG AD ++ EM   L++E    C +RGL  +S  QT+ +++ N  R   D +  P     G +RL++   N        Y  +N+FL   I+  H   + +  +D+  FE +   EF +   +  FY D+  SF +VLFYG E  L+ FD L FCV DL  QN +  A +T+    I ++IRNG G  NLANKTLVD+RFLI
Sbjct:   39 CGVNSYFDISSLSCVKCGSNQVSSKSGLACECQAGSRVLVSNGVS-ILCQQCPDADQVVTQDGYECIRCPGTVGKDGKCQCPEGSVLVERDGNGNPLIEARCQACSATDPAFSAPDMKGNRCERCGDSF-INSSQSCVCGTSNTLAGGMCFPANSLPTSVASSVIFSQLTLPVQSAWFSSFMYSSAAACLLFSNRTACQSLGNMCVM---NMHSSSSINNDVCGLYNTIYRTTAAQGSSQDISYWRTNLPWLYYGDQPGMASQALQNEPLPVGFSFKGAQKNTNIELRAAVYSVRGEFLRWESVGR-GNLQLCPDTPTRQQSAFKFGTAYKQSCVLSVSEL--LTGYPEPLFYDVFLVIQNS-QDNRLLAVPL-LNANQQFNGQFVNQGSDMSKWFLTRRLMLVDTLSGREKSISSSPVV--IRVASDIKI--------GFQLVPNTQKGQVYPPLMSVAYSDIQIKDPSTQTVTVTFSVEY---TMNQEEARIKTDIALGVLGGVAVVHSLLKTASWKRRIASPLIDLETIMKFLVFYAGDLANVFFIITVGTGLYWLIFFKAQLFVSVLLPLPAQEERFVVYVGCAFALKTVQFLHKIFVQLSVDVFFIDWERP-----------RGKTTKHVEGSG-------ETKSQASPVSIWRTYFVANEWNEIQTIRKINPTFQVMAVLFFLEVVGFSNLALRDPSSNLNRSAEEYTPPYSLILRYGVATAMWLCIGLIQMIFFTVFHERFVEDKIRQFVDLCSISNISVLLLSHRCFGYYIHGRSVHGHADTNMDEMNTNLKREAENLCGQRGLLPNSDTQTFQISITNRLRAQYDRIIEPISRRRGPSRLVDATANPCEQSTKAYHTMNRFLGSVIDHAHR-EMDYIVKDKLLFERVIGMEFIEPLDKSIFYNDDSHSFADVLFYGNEGVLLIFDTLFFCVVDLGKQNFILAAVLTYLQQMIFRLIRNGLGRRNLANKTLVDKRFLI 982          
BLAST of Meckelin vs. Ensembl Xenopus
Match: sfxn5 (sideroflexin 5 [Source:Xenbase;Acc:XB-GENE-988100])

HSP 1 Score: 454.521 bits (1168), Expect = 2.478e-143
Identity = 326/998 (32.67%), Postives = 493/998 (49.40%), Query Frame = 3
Query:  177 CSSTTYFSSVDFKCVSCSVNAKQSSDGFSCVCKDGYYFTKNGGGSQVLCQKCPLNQIPSSNGWSCISCLNGVTGTSCSSCDSPNVAYSSDVLGNQF-NGNCTACA------TNYRPVNNQCQLCSNILSTNGNSSCSCALP---TGNACLTK--SLSNSSILTY----LGQSVTSGFLQANLMDSVAMCQV-SMESGCQNLANMCVMSVYNRQSAKSIDGTPCSLYAQVQPSGSYTSGKTAG-----------YPWLYYTIPQTLTQLTV------------DHQYVRGETLQIVLATYDSAGQFLGIRNATKDSNLQLCDNSITKRKETFRFGTHYLESCSITISQLSNQTRYLPLFYDPYLSYTDSIGASQLYPIPI-----KIGQVISDSGTTPNLLFDQAAWILTRRLLLVDNFG----AITAPFQTNRTASYITFASSMRLVVVKQSSGSFDITKDGSIYAPYLEVN-XXXXXXXXXXXXANISFEVVYYNVSSYTTAFYYSLSVAMGILCALAGLYAILRAFFWCRRSGISGFEGLVLLKTLAHACASISNVFFIVIFGISLYFLLLFKNQNLFSIL--PPDDDSFFVAYLISAFLLKMLEIVHIFVAQCTVDIFLIDWERPKHQLAPKKIFERSKFDTATDNTGDQNLIQQEKGSQNNGVSIWRTYFIANEWNEIQTYRKTSLIFNLIIVLLFMEVIGFKNITTFDCFVNYSPSSDAYSAPNYRMFRFAVIVSIFGITAFIQWLFTVLIYERVIEDKLRNYVDLCSVANISIIVLAHRQFGYYIHGRSVHGSADVSLSEMYGALQKENAGSCAKRGLESDSMQQTYIMALPNNFRINLDSVY-----RPGGNRLLE------DGRNMQYLEVNKFLDRFINRTHDPRILFRFQDRKXXXXXXXXXXXXNSLEGRFYRDNGTSFGNVLFYGQELALVTFDILLFCVTDLILQNTVFDAFITWGLVTILKMIRNGCGAHNLANKTLVDRRFLI 2981
            C    Y+   +  CV C  + + S  G SCVC  GY   +N  G    C++CP +   +++GWSCI C NG+       C   N+    DV G+      C  C       T    + N+C+ C + +  N ++SCSC  P   TG  C     S+ + ++LT     LG  + S +   +L  S A C + + ++ CQ L NMCVM++++  S  S D   C L+  +     +TS    G            PWL+Y     L   T+            + + V    LQ + A YD  G F+  + +     LQLC + + +    F FGT Y + C I++S+L  +    P+FYD YL+Y  +     L P+P+     +  ++  + G   N       W+LTRR+ LVD       ++  P +  R AS IT   S+RLV           T  G IY P + V        +  +    +SF V   N             VA+G+L  LA L+++L+   W RR G S  +   ++  L     ++++VFF+V  G   Y+L+LFK Q   S+L   P+++  FV+Y+  AF LK L++++      T+D+F IDWERPK +  P +   ++K   A                    VSIWR+YFIANEWNEIQT RK S +F +  VL F+E+ GFK +   D   + S +S  Y AP  R+ R+ V  +I+     +Q LF  +IYER +EDK+R +VDLCS++NIS+ +L+HR +GYYIHGRSVHG +D ++ EM   L++E    C++RGL+ +S  QT+ +++ +  R + D ++     R G +RL        D     Y  +NKFL  FI+      + +  +D+ F E +   EF +   +  FY D   SF +VLFYG E  L+ FD L FCV D+  QN V  A +T+    + +++ N  G  NLA+KT +D RFLI
Sbjct:   50 CGLQEYYEPSNLSCVRCQNSQRPSHWGTSCVCLVGY--KRNSTGD---CERCPESLGVTADGWSCIKCPNGLNSNGNCLCPPGNILVERDVNGSLLLEAECIDCDGTEPSFTAANTLGNRCERCHHTV-INRSNSCSCNQPNIMTGGICYNAAGSILSKALLTVHYSQLGLILRSEWFATHLQASAAACLMYTNQTSCQALGNMCVMNMHS-TSISSADA--CGLFQYI-----FTSTAGLGVIHSLSYWRTNLPWLFYGDQPGLASRTLVSSPVPTSYTFKESEEVENTKLQFLAAVYDVRGNFIKWQ-SLAGGLLQLCPDIVARIDAAFSFGTTYKQECRISVSKLL-RDHPEPVFYDVYLAYPGNEKQQNLLPVPVLNLNLQYHEMFVNQGDNIN------NWLLTRRIFLVDTISGRENSLADPPRLIRVASKITI--SIRLV---------PDTYKGIIYPPLMTVQYTDVQLQNPESQIVKVSFSV---NYEMRQLDSLKKTDVAIGVLGGLAVLWSLLKTAAWKRRIGSSFIDMQTVIHFLIFYAGALADVFFLVTVGTGFYWLILFKGQQYVSVLLPVPEEEYNFVSYVWCAFALKALQLLYKMTLLLTIDVFFIDWERPKARTQPSE--GKTKNSVAP-------------------VSIWRSYFIANEWNEIQTVRKISPLFQVFAVLFFLEIAGFKYLALMDPSSSLSRNSQDYMAPWSRILRYGVSTAIWLAIGCLQVLFFSVIYERYVEDKIRQFVDLCSMSNISVFILSHRCYGYYIHGRSVHGHSDTNMEEMNLNLKREAENLCSQRGLQPNSDIQTFQISISSRARTHFDQIHESLTKRHGPSRLFHTSLSTSDLNTRAYNSMNKFLSSFIDHAFK-EVDYFVKDKMFLERLLSMEFMEPMDKSIFYNDENHSFTDVLFYGNESTLLIFDTLFFCVVDVASQNFVLAAILTFLQQELFRLLCNAVGKKNLASKTQIDERFLI 989          
BLAST of Meckelin vs. Ensembl Xenopus
Match: sfxn5 (sideroflexin 5 [Source:Xenbase;Acc:XB-GENE-988100])

HSP 1 Score: 440.269 bits (1131), Expect = 2.592e-138
Identity = 323/983 (32.86%), Postives = 479/983 (48.73%), Query Frame = 3
Query:  177 CSSTTYFSSVDFKCVSCSVNAKQSSDGFSCVCKDGYYFTKNGGGSQVLCQKCPLNQIPSSNGWSCISCLNGVTGTSCSSCDSPNVAYSSDVLGNQF-NGNCTACA------TNYRPVNNQCQLCSNILSTNGNSSCSCALPTGNACLTKSLSNSSILTYLGQSVTSGFLQANLMDSVAMCQVSMESGCQNLANMCVMSVYNRQSAKSIDGTPCSLYAQVQPSGSYTSGKTAGY---------PWLYY-----TIPQTLTQLTVDHQYVRGET---LQIVLATYDSAGQFLGIRNATKDSNLQLCDNSITKRKETFRFGTHYLESCSITISQLSNQTRYLPLFYDPYLSYTDSIGASQLYPIPI-----KIGQVISDSGTTPNLLFDQAAWILTRRLLLVDNFG----AITAPFQTNRTASYITFASSMRLVVVKQSSGSFDITKDGSIYAPYLEVN-XXXXXXXXXXXXANISFEVVYYNVSSYTTAFYYSLSVAMGILCALAGLYAILRAFFWCRRSGISGFEGLVLLKTLAHACASISNVFFIVIFGISLYFLLLFKNQNLFSIL--PPDDDSFFVAYLISAFLLKMLEIVHIFVAQCTVDIFLIDWERPKHQLAPKKIFERSKFDTATDNTGDQNLIQQEKGSQNNGVSIWRTYFIANEWNEIQTYRKTSLIFNLIIVLLFMEVI-GFKNITTFDCFVNYSPSSDAYSAPNYRMFRFAVIVSIFGITAFIQWLFTVLIYERVIEDKLRNYVDLCSVANISIIVLAHRQFGYYIHGRSVHGSADVSLSEMYGALQKENAGSCAKRGLESDSMQQTYIMALPNNFRINLDSVY-----RPGGNRLLE------DGRNMQYLEVNKFLDRFINRTHDPRILFRFQDRKXXXXXXXXXXXXNSLEGRFYRDNGTSFGNVLFYGQELALVTFDILLFCVTDLILQNTVFDAFITWGLVTILKMIRNGCGAHNLANKTLVDRRFLI 2981
            C    Y+   +  CV C  + + S  G SCVC  GY   +N  G    C++CP +   +++GWSCI C NG+       C   N+    DV G+      C  C       T    + N+C+ C + +  N ++SCSC  P  N  + KS     ++ Y  Q+                        CQ L NMCVM++++  S  S D   C L+  +  S   T+G  + Y         PWL+Y        +TL    V   Y   E    LQ + A YD  G F+  + +     LQLC + + +    F FGT Y + C I++S+L  +    P+FYD YL+Y  +     L P+P+     +  ++  +     N       W+LTRR+ LVD       ++  P +  R AS IT   S+RLV           T  G IY P + V        +  +    +SF V   N             VA+G+L  LA L+++L+   W RR G S  +   ++  L     ++++VFF+V  G   Y+L+LFK Q   S+L   P+++  FV+Y+  AF LK L++++      T+D+F IDWERPK +  P      S+ D A                    VSIWR+YFIANEWNEIQT RK S +F +  VL F+EVI GFK +   D   + S +S  Y AP  R+ R+ V  +I+     +Q LF  +IYER +EDK+R +VDLCS++NIS+ +L+HR +GYYIHGRSVHG +D ++ EM   L++E    C++RGL+ +S  QT+ +++ +  R + D ++     R G +RL        D     Y  +NKFL  FI+      + +  +D+ F E +   EF +   +  FY D   SF +VLFYG E  L+ FD L FCV D+  QN V  A +T+    + +++ N  G  NLA+KT +D RFLI
Sbjct:   50 CGLQEYYEPSNLSCVRCQNSQRPSHWGTSCVCLVGY--KRNSTGD---CERCPESLGVTADGWSCIKCPNGLNSNGNCLCPPGNILVERDVNGSLLLEAECIDCDGTEPSFTAANTLGNRCERCHHTV-INRSNSCSCNQP--NIMVRKSFR---VIMYTNQT-----------------------SCQALGNMCVMNMHS-TSISSADA--CGLFQYIFTS---TAGLGSKYHVFYRRTNLPWLFYGDQPGLASRTLVSSPVPTSYTFKEKNTKLQFLAAVYDVRGNFIKWQ-SLAGGLLQLCPDIVARIDAAFSFGTTYKQECRISVSKLL-RDHPEPVFYDVYLAYPGNEKQQNLLPVPVLNLNLQYHEMFVNQDNINN-------WLLTRRIFLVDTISGRENSLADPPRLIRVASKITI--SIRLV---------PDTYKGIIYPPLMTVQYTDVQLQNPESQIVKVSFSV---NYEMRQLDSLKKTDVAIGVLGGLAVLWSLLKTAAWKRRIGSSFIDMQTVIHFLIFYAGALADVFFLVTVGTGFYWLILFKGQQYVSVLLPVPEEEYNFVSYVWCAFALKALQLLYKMTLLLTIDVFFIDWERPKARTQP------SEGDVAP-------------------VSIWRSYFIANEWNEIQTVRKISPLFQVFAVLFFLEVIAGFKYLALMDPSSSLSRNSQDYMAPWSRILRYGVSTAIWLAIGCLQVLFFSVIYERYVEDKIRQFVDLCSMSNISVFILSHRCYGYYIHGRSVHGHSDTNMEEMNLNLKREAENLCSQRGLQPNSDIQTFQISISSRARTHFDQIHESLTKRHGPSRLFHTSLSTSDLNTRAYNSMNKFLSSFIDHAFK-EVDYFVKDKMFLERLLSMEFMEPMDKSIFYNDENHSFTDVLFYGNESTLLIFDTLFFCVVDVASQNFVLAAILTFLQQELFRLLCNAVGKKNLASKTQIDERFLI 943          
BLAST of Meckelin vs. Ensembl Xenopus
Match: sfxn5 (sideroflexin 5 [Source:Xenbase;Acc:XB-GENE-988100])

HSP 1 Score: 366.696 bits (940), Expect = 1.571e-111
Identity = 290/903 (32.12%), Postives = 435/903 (48.17%), Query Frame = 3
Query:  414 CDSPNVAYSSDVLGNQF-NGNCTACA------TNYRPVNNQCQLCSNILSTNGNSSCSCALPTGNACLTKSLSNSSILTYLGQSVTSGFLQANLMDSVAMCQVSMESGCQNLANMCVMSVYNRQSAKSIDGTPCSLYAQVQPSGS------YTSGKTAGYPWLYY-----TIPQTLTQLTVDHQYVRGET---LQIVLATYDSAGQFLGIRNATKDSNLQLCDNSITKRKETF--RFGTHYLESCSITISQLSNQTRYLPLFYDPYLSYTDSIGASQLYPIPI-----KIGQVISDSGTTPNLLFDQAAWILTRRLLLVDNFG----AITAPFQTNRTASYITFASSMRLVVVKQSSGSFDITKDGSIYAPYLEVNXX-XXXXXXXXXXANISFEVVYYNVSSYTTAFYYSLSVAMGILCALAGLYAILRAFFWCRRSGISGFEGLVLLKTLAHACASISNVFFIVIFGISLYFLLLFKNQNLFSIL--PPDDDSFFVAYLISAFLLKMLEIVHIFVAQCTVDIFLIDWERPKHQLAPKKIFERSKFDTATDNTGDQNLIQQEKGSQNNGVSIWRTYFIANEWNEIQTYRKTSLIFNLIIVLLFMEVI-GFKNITTFDCFVNYSPSSDAYSAPNYRMFRFAVIVSIFGITAFIQWLFTVLIYERVIEDKLRNYVDLCSVANISIIVLAHRQFGYYIHGRSVHGSADVSLSEMYGALQKENAGSCAKRGLESDSMQQTYIMALPNNFRINLDSVY-----RPGGNRLLE------DGRNMQYLEVNKFLDRFINRTHDPRILFRFQDRKXXXXXXXXXXXXNSLEGRFYRDNGTSFGNVLFYGQELALVTFDILLFCVTDLILQNTVFDAFITWGLVTILKMIRNGCGAHNLANKTLVDRRFLI 2981
            C    +    DV G+      C  C       T    + N+C+ C + +  N ++SCSC  P  N  + KS     ++ Y  Q+                        CQ L NMCVM++++  S  S D   C L+  +  S +        S      PWL+Y        +TL    V   Y   E    LQ + A YD  G F+  + +     LQ+ + + T+    +    G      C I++S+L  +    P+FYD YL+Y  +     L P+P+     +  ++  + G   N       W+LTRR+ LVD       ++  P +  R AS IT   S+RLV           T  G IY P + V  T     +  +    +SF V   N             VA+G+L  LA L+++L+   W RR G S  +   ++  L     ++++VFF+V  G   Y+L+LFK Q   S+L   P+++  FV+Y+  AF LK L++++      T+D+F IDWERPK          R+ F   +  T +              VSIWR+YFIANEWNEIQT RK S +F +  VL F+EVI GFK +   D   + S +S  Y AP  R+ R+ V  +I+     +Q LF  +IYER +EDK+R +VDLCS++NIS+ +L+HR +GYYIHGRSVHG +D ++ EM   L++E    C++RGL+ +S  QT+ +++ +  R + D ++     R G +RL        D     Y  +NKFL  FI+      + +  +D+ F E +   EF +   +  FY D   SF +VLFYG E  L+ FD L FCV D+  QN V  A +T+    + +++ N  G  NLA+KT +D RFLI
Sbjct:   35 CTCHKITVERDVNGSLLLEAECIDCDGTEPSFTAANTLGNRCERCHHTV-INRSNSCSCNQP--NIMVRKSFR---VIMYTNQT-----------------------SCQALGNMCVMNMHS-TSISSADA--CGLFQYIFTSTAGLGVIHSLSYWRTNLPWLFYGDQPGLASRTLVSSPVPTSYTFKEKNTKLQFLAAVYDVRGNFIKWQ-SLAGGLLQIHNYTYTQSIFCYPCSLGHIIPLQCRISVSKLL-RDHPEPVFYDVYLAYPGNEKQQNLLPVPVLNLNLQYHEMFVNQGDNIN------NWLLTRRIFLVDTISGRENSLADPPRLIRVASKITI--SIRLV---------PDTYKGIIYPPLMTVQYTDVQLQNPESQIVKVSFSV---NYEMRQLDSLKKTDVAIGVLGGLAVLWSLLKTAAWKRRIGSSFIDMQTVIHFLIFYAGALADVFFLVTVGTGFYWLILFKGQQYVSVLLPVPEEEYNFVSYVWCAFALKALQLLYKMTLLLTIDVFFIDWERPK----------RTFFSFLSGKTKNSV----------APVSIWRSYFIANEWNEIQTVRKISPLFQVFAVLFFLEVIAGFKYLALMDPSSSLSRNSQDYMAPWSRILRYGVSTAIWLAIGCLQVLFFSVIYERYVEDKIRQFVDLCSMSNISVFILSHRCYGYYIHGRSVHGHSDTNMEEMNLNLKREAENLCSQRGLQPNSDIQTFQISISSRARTHFDQIHESLTKRHGPSRLFHTSLSTSDLNTRAYNSMNKFLSSFIDHAFK-EVDYFVKDKMFLERLLSMEFMEPMDKSIFYNDENHSFTDVLFYGNESTLLIFDTLFFCVVDVASQNFVLAAILTFLQQELFRLLCNAVGKKNLASKTQIDERFLI 862          
BLAST of Meckelin vs. Ensembl Xenopus
Match: ENSXETT00000046533.1 (meckelin-like [Source:NCBI gene;Acc:100485117])

HSP 1 Score: 209.149 bits (531), Expect = 1.371e-59
Identity = 138/335 (41.19%), Postives = 195/335 (58.21%), Query Frame = 3
Query: 2010 NNGVSIWRTYFIANEWNEIQTYRKTSLIFNLIIVLLFMEVIGFKNITTFDCFVNYSPSSDAYSAPNYRMFRFAVIVSIFGITAFIQWLFTVLIYERVIEDKLRNYVDLCSVANISIIVLAHRQFGYYIHGRSVHGSADVSLSEMYGALQKENAGSCAKRGLESDSMQQTYIMALPNNFRINLDSVYRP------GGNRLLEDGRNMQ-----YLEVNKFLDRFINRTHDPRILFRFQDRKXXXXXXXXXXXXNSLEGRFYRDNGTSFGNVLFYGQELALVTFDILLFCVTDLILQNTVFDAFITWGLVTILKMIRNGCGAHNLANKTLVDRRFLI 2981
             + +SIWRT  +ANEWNE+QTYRK S IF L  VLL +EV+G KNIT  D  ++ +P S  Y A    + RF +  S++     +Q LF ++IYER  EDK+R + DLCS++N+S+ +L HR +GYYIHGRSVHG ADVS+  M   L+KE    C  RGLE  S  QT+ + L +  R   + +  P      G   + E    MQ     Y  +N+FL  F++  +   + +  +D+ F E IFD EF+    +   Y D+G  F   LFYG EL L+ FD LLFC+ DL  QN V    IT+ + T++ ++R   G  N++ +T+V+  FLI
Sbjct:    7 KSNISIWRTILVANEWNEMQTYRKISPIFQLFSVLLLLEVVGLKNITAKDLNLDLNPPSGTYLASWSIILRFGIAASMWLAVGIVQVLFCIVIYERFFEDKMRQFTDLCSLSNVSVFILTHRCYGYYIHGRSVHGQADVSMETMLSNLKKEEENLCPLRGLEPSSDIQTFEVLLSDRVRDQYEKIMEPLLEAPRGQRGVNESNPLMQQRIKTYYTINRFLSSFLDHVYK-ELDYVVKDKLFLEHIFDMEFQQPMEKSIVYTDDGARFSRTLFYGNELVLLLFDTLLFCIIDLGTQNFVLATIITYVVQTLVVILRYQIGKKNVSRQTMVEENFLI 340          
BLAST of Meckelin vs. Ensembl Mouse
Match: Tmem67 (transmembrane protein 67 [Source:MGI Symbol;Acc:MGI:1923928])

HSP 1 Score: 494.197 bits (1271), Expect = 1.842e-158
Identity = 338/988 (34.21%), Postives = 500/988 (50.61%), Query Frame = 3
Query:  177 CSSTTYFSSVDFKCVSCSVNAKQSSDGFSCVCKDGYYFTKNGGGSQVLCQKCPLN-QIPSSNGWSCISCLNGVTGTSCSSCDSPNVAYSSDVLGNQF-NGNCTACA------TNYRPVNNQCQLCSNILSTNGNSSCSCALP---TGNACLT------KSLSNSSILTYLGQSVTSGFLQANLMDSVAMCQVSME-SGCQNLANMCVMSVYNRQSAKSIDGTPCSLYAQV-QPSGSYTSGKTAGY-----PWLYY-----TIPQTL--TQLTVDHQYVRGETLQIVLATYDSAGQFLGIRNATKDSNLQLCDNSITKRKETFRFGTHYLESCSITISQLSNQTRYLPLFYDPYLSYTDSIGASQLYPIPIKIGQVISDSGTTPNLLFDQAAWILTRRLLLVDNFGAITAPF----QTNRTASYITFASSMRLVVVKQSSGSFDITKDGSIYAPYLEVN-XXXXXXXXXXXXANISFEVVYY----NVSSYTTAFYYSLSVAMGILCALAGLYAILRAFFWCRRSGISGFEGLVLLKTLAHACASISNVFFIVIFGISLYFLLLFKNQNLFSIL--PPDDDSFFVAYLISAFLLKMLEIVHIFVAQCTVDIFLIDWERPKHQLAPKKIFERSKFDTATDNTGDQNLIQQEKGSQNNGVSIWRTYFIANEWNEIQTYRKTSLIFNLIIVLLFMEVIGFKNITTFDCFVNYSPSSDAYSAPNYRMFRFAVIVSIFGITAFIQWLFTVLIYERVIEDKLRNYVDLCSVANISIIVLAHRQFGYYIHGRSVHGSADVSLSEMYGALQKENAGSCAKRGLESDSMQQTYIMALPNNFRINLDSVY-----RPGGNRLL-EDGRNMQ-----YLEVNKFLDRFINRTHDPRILFRFQDRKXXXXXXXXXXXXNSLEGRFYRDNGTSFGNVLFYGQELALVTFDILLFCVTDLILQNTVFDAFITWGLVTILKMIRNGCGAHNLANKTLVDRRFLI 2981
            C    YF      C  C  N ++ + G SCVC  GY+   N GG  ++C+KCP N +  + +GW CISC +G+T      C + ++    +V G+      C  C       T    +  +C  C      N + SCSC+ P   TG  C +      + + +++    LG S+ S +    L  + A C      + CQ L NMCVM++ N   + ++D   C L+  + + +    S  +  +     PWL+Y       PQ L  T L  +  +     L+ V A+YD  G F+  +   +   LQLC ++  +    + FGT Y ++C I++S+L       P+FYD YL YTD      L+PIP+ +   +  +    N     + W+LTRR+ LVD             +  R A+ I+   S+RLV           TK+G+IY P L +        ++ + SA ISF V Y     + S +T        +A+G+L  LA L ++L+   W RR G    +   ++K L +    ++NVFFI+  G  LY+L+ FK Q   S+L   P  +  FV Y+  AF +K L+ +H F++Q ++DIF IDWERPK            K   A +  G          S    VSIWRTYF+ANEWNEIQT RK + +F ++  L F+EV+GFKN+   D   + S +   Y+AP  R+ R+AV  +I+ +   IQ +F    YER IEDK+R +VDLCS++N+S+ +L+HR FGYYIHGRSVHG AD ++ EM   L++E    C++RGL  ++  QT+ +A+ +  R + D ++     R G  RLL   G   +     Y  +NKFL  FI+  H     F  +D+   E I   EF +   +  FY D G SF +VL+YG E  L+ FD+L FCV DL  Q+ V  +F+T+    I + IRN  G  NLA KTLVD RFLI
Sbjct:   52 CDFNQYFDISALSCAPCGANQRRDALGTSCVCLPGYHMISNNGGPSIICKKCPENMKGVTKDGWDCISCPSGLTAEGKCHCPTGHILVERNVSGSLLAQATCELCDESENSFTKANALGTRCVRCEPTF-VNTSRSCSCSEPHTLTGGLCFSNTGNFHQRVISTARYGELGMSLNSEWFAKYLQATAAACWTHANLTSCQALGNMCVMNM-NSYDSTTLDA--CRLFHYIFESTAGLISVHSVPFWRQNLPWLFYGDQPGLAPQVLSTTPLPTNFSFKGQNQLKFVAASYDIRGNFIKWQ-PLEGGVLQLCPDTERRLDAAYAFGTTYQQNCEISLSKLLVDFSS-PVFYDVYLEYTDEEQHRYLWPIPV-LNLNLQHNKLFVNQDSSSSKWLLTRRIFLVDAVSGRENDLGNQPRVIRVATQISL--SIRLV---------PNTKNGNIYTPLLTIAYSDIDIKNAHSQSAKISFSVKYEMNQGDASVHT-------DIALGVLGGLAVLSSLLKTAGWKRRIGSPMIDLQTVMKFLLYYAGDLANVFFIITVGTGLYWLIFFKAQKSVSVLLPMPVQEERFVTYVGCAFAMKALQFLHKFISQISIDIFFIDWERPK-----------GKVLKAVEGEGGVR-------SATVPVSIWRTYFVANEWNEIQTVRKINPLFQVLTTLFFLEVVGFKNLALMDSSSSLSRNPSDYTAPYSRILRYAVATAIWLVIGIIQVVFFAAFYERFIEDKIRQFVDLCSMSNVSVFLLSHRCFGYYIHGRSVHGHADTNMEEMNMNLKREAENLCSQRGLVPNTDGQTFQIAVSSQMRQHYDRIHETLTRRNGPARLLSSSGSTFEQSIKAYHAMNKFLGSFIDHVHKEMDYF-IKDKLLLERILGMEFMEPMEKSIFYNDEGHSFSSVLYYGNEATLLIFDLLFFCVVDLACQDFVLASFLTYLQQEIFRFIRNTVGQKNLATKTLVDERFLI 995          
BLAST of Meckelin vs. Ensembl Mouse
Match: Tmem67 (transmembrane protein 67 [Source:MGI Symbol;Acc:MGI:1923928])

HSP 1 Score: 494.197 bits (1271), Expect = 1.064e-157
Identity = 338/988 (34.21%), Postives = 500/988 (50.61%), Query Frame = 3
Query:  177 CSSTTYFSSVDFKCVSCSVNAKQSSDGFSCVCKDGYYFTKNGGGSQVLCQKCPLN-QIPSSNGWSCISCLNGVTGTSCSSCDSPNVAYSSDVLGNQF-NGNCTACA------TNYRPVNNQCQLCSNILSTNGNSSCSCALP---TGNACLT------KSLSNSSILTYLGQSVTSGFLQANLMDSVAMCQVSME-SGCQNLANMCVMSVYNRQSAKSIDGTPCSLYAQV-QPSGSYTSGKTAGY-----PWLYY-----TIPQTL--TQLTVDHQYVRGETLQIVLATYDSAGQFLGIRNATKDSNLQLCDNSITKRKETFRFGTHYLESCSITISQLSNQTRYLPLFYDPYLSYTDSIGASQLYPIPIKIGQVISDSGTTPNLLFDQAAWILTRRLLLVDNFGAITAPF----QTNRTASYITFASSMRLVVVKQSSGSFDITKDGSIYAPYLEVN-XXXXXXXXXXXXANISFEVVYY----NVSSYTTAFYYSLSVAMGILCALAGLYAILRAFFWCRRSGISGFEGLVLLKTLAHACASISNVFFIVIFGISLYFLLLFKNQNLFSIL--PPDDDSFFVAYLISAFLLKMLEIVHIFVAQCTVDIFLIDWERPKHQLAPKKIFERSKFDTATDNTGDQNLIQQEKGSQNNGVSIWRTYFIANEWNEIQTYRKTSLIFNLIIVLLFMEVIGFKNITTFDCFVNYSPSSDAYSAPNYRMFRFAVIVSIFGITAFIQWLFTVLIYERVIEDKLRNYVDLCSVANISIIVLAHRQFGYYIHGRSVHGSADVSLSEMYGALQKENAGSCAKRGLESDSMQQTYIMALPNNFRINLDSVY-----RPGGNRLL-EDGRNMQ-----YLEVNKFLDRFINRTHDPRILFRFQDRKXXXXXXXXXXXXNSLEGRFYRDNGTSFGNVLFYGQELALVTFDILLFCVTDLILQNTVFDAFITWGLVTILKMIRNGCGAHNLANKTLVDRRFLI 2981
            C    YF      C  C  N ++ + G SCVC  GY+   N GG  ++C+KCP N +  + +GW CISC +G+T      C + ++    +V G+      C  C       T    +  +C  C      N + SCSC+ P   TG  C +      + + +++    LG S+ S +    L  + A C      + CQ L NMCVM++ N   + ++D   C L+  + + +    S  +  +     PWL+Y       PQ L  T L  +  +     L+ V A+YD  G F+  +   +   LQLC ++  +    + FGT Y ++C I++S+L       P+FYD YL YTD      L+PIP+ +   +  +    N     + W+LTRR+ LVD             +  R A+ I+   S+RLV           TK+G+IY P L +        ++ + SA ISF V Y     + S +T        +A+G+L  LA L ++L+   W RR G    +   ++K L +    ++NVFFI+  G  LY+L+ FK Q   S+L   P  +  FV Y+  AF +K L+ +H F++Q ++DIF IDWERPK            K   A +  G          S    VSIWRTYF+ANEWNEIQT RK + +F ++  L F+EV+GFKN+   D   + S +   Y+AP  R+ R+AV  +I+ +   IQ +F    YER IEDK+R +VDLCS++N+S+ +L+HR FGYYIHGRSVHG AD ++ EM   L++E    C++RGL  ++  QT+ +A+ +  R + D ++     R G  RLL   G   +     Y  +NKFL  FI+  H     F  +D+   E I   EF +   +  FY D G SF +VL+YG E  L+ FD+L FCV DL  Q+ V  +F+T+    I + IRN  G  NLA KTLVD RFLI
Sbjct:  118 CDFNQYFDISALSCAPCGANQRRDALGTSCVCLPGYHMISNNGGPSIICKKCPENMKGVTKDGWDCISCPSGLTAEGKCHCPTGHILVERNVSGSLLAQATCELCDESENSFTKANALGTRCVRCEPTF-VNTSRSCSCSEPHTLTGGLCFSNTGNFHQRVISTARYGELGMSLNSEWFAKYLQATAAACWTHANLTSCQALGNMCVMNM-NSYDSTTLDA--CRLFHYIFESTAGLISVHSVPFWRQNLPWLFYGDQPGLAPQVLSTTPLPTNFSFKGQNQLKFVAASYDIRGNFIKWQ-PLEGGVLQLCPDTERRLDAAYAFGTTYQQNCEISLSKLLVDFSS-PVFYDVYLEYTDEEQHRYLWPIPV-LNLNLQHNKLFVNQDSSSSKWLLTRRIFLVDAVSGRENDLGNQPRVIRVATQISL--SIRLV---------PNTKNGNIYTPLLTIAYSDIDIKNAHSQSAKISFSVKYEMNQGDASVHT-------DIALGVLGGLAVLSSLLKTAGWKRRIGSPMIDLQTVMKFLLYYAGDLANVFFIITVGTGLYWLIFFKAQKSVSVLLPMPVQEERFVTYVGCAFAMKALQFLHKFISQISIDIFFIDWERPK-----------GKVLKAVEGEGGVR-------SATVPVSIWRTYFVANEWNEIQTVRKINPLFQVLTTLFFLEVVGFKNLALMDSSSSLSRNPSDYTAPYSRILRYAVATAIWLVIGIIQVVFFAAFYERFIEDKIRQFVDLCSMSNVSVFLLSHRCFGYYIHGRSVHGHADTNMEEMNMNLKREAENLCSQRGLVPNTDGQTFQIAVSSQMRQHYDRIHETLTRRNGPARLLSSSGSTFEQSIKAYHAMNKFLGSFIDHVHKEMDYF-IKDKLLLERILGMEFMEPMEKSIFYNDEGHSFSSVLYYGNEATLLIFDLLFFCVVDLACQDFVLASFLTYLQQEIFRFIRNTVGQKNLATKTLVDERFLI 1061          
BLAST of Meckelin vs. Ensembl Mouse
Match: Tmem67 (transmembrane protein 67 [Source:MGI Symbol;Acc:MGI:1923928])

HSP 1 Score: 68.5514 bits (166), Expect = 1.706e-12
Identity = 43/142 (30.28%), Postives = 64/142 (45.07%), Query Frame = 3
Query:  177 CSSTTYFSSVDFKCVSCSVNAKQSSDGFSCVCKDGYYFTKNGGGSQVLCQKCPLN-QIPSSNGWSCISCLNGVTGTSCSSCDSPNVAYSSDVLGNQF-NGNCTACA------TNYRPVNNQCQLCSNILSTNGNSSCSCALP 578
            C    YF      C  C  N ++ + G SCVC  GY+   N GG  ++C+KCP N +  + +GW CISC +G+T      C + ++    +V G+      C  C       T    +  +C  C      N + SCSC+ P
Sbjct:   50 CDFNQYFDISALSCAPCGANQRRDALGTSCVCLPGYHMISNNGGPSIICKKCPENMKGVTKDGWDCISCPSGLTAEGKCHCPTGHILVERNVSGSLLAQATCELCDESENSFTKANALGTRCVRCEPTF-VNTSRSCSCSEP 190          
BLAST of Meckelin vs. UniProt/SwissProt
Match: sp|Q8BR76|MKS3_MOUSE (Meckelin OS=Mus musculus OX=10090 GN=Tmem67 PE=1 SV=2)

HSP 1 Score: 494.582 bits (1272), Expect = 8.868e-158
Identity = 338/988 (34.21%), Postives = 500/988 (50.61%), Query Frame = 3
Query:  177 CSSTTYFSSVDFKCVSCSVNAKQSSDGFSCVCKDGYYFTKNGGGSQVLCQKCPLN-QIPSSNGWSCISCLNGVTGTSCSSCDSPNVAYSSDVLGNQF-NGNCTACA------TNYRPVNNQCQLCSNILSTNGNSSCSCALP---TGNACLT------KSLSNSSILTYLGQSVTSGFLQANLMDSVAMCQVSME-SGCQNLANMCVMSVYNRQSAKSIDGTPCSLYAQV-QPSGSYTSGKTAGY-----PWLYY-----TIPQTL--TQLTVDHQYVRGETLQIVLATYDSAGQFLGIRNATKDSNLQLCDNSITKRKETFRFGTHYLESCSITISQLSNQTRYLPLFYDPYLSYTDSIGASQLYPIPIKIGQVISDSGTTPNLLFDQAAWILTRRLLLVDNFGAITAPF----QTNRTASYITFASSMRLVVVKQSSGSFDITKDGSIYAPYLEVN-XXXXXXXXXXXXANISFEVVYY----NVSSYTTAFYYSLSVAMGILCALAGLYAILRAFFWCRRSGISGFEGLVLLKTLAHACASISNVFFIVIFGISLYFLLLFKNQNLFSIL--PPDDDSFFVAYLISAFLLKMLEIVHIFVAQCTVDIFLIDWERPKHQLAPKKIFERSKFDTATDNTGDQNLIQQEKGSQNNGVSIWRTYFIANEWNEIQTYRKTSLIFNLIIVLLFMEVIGFKNITTFDCFVNYSPSSDAYSAPNYRMFRFAVIVSIFGITAFIQWLFTVLIYERVIEDKLRNYVDLCSVANISIIVLAHRQFGYYIHGRSVHGSADVSLSEMYGALQKENAGSCAKRGLESDSMQQTYIMALPNNFRINLDSVY-----RPGGNRLL-EDGRNMQ-----YLEVNKFLDRFINRTHDPRILFRFQDRKXXXXXXXXXXXXNSLEGRFYRDNGTSFGNVLFYGQELALVTFDILLFCVTDLILQNTVFDAFITWGLVTILKMIRNGCGAHNLANKTLVDRRFLI 2981
            C    YF      C  C  N ++ + G SCVC  GY+   N GG  ++C+KCP N +  + +GW CISC +G+T      C + ++    +V G+      C  C       T    +  +C  C      N + SCSC+ P   TG  C +      + + +++    LG S+ S +    L  + A C      + CQ L NMCVM++ N   + ++D   C L+  + + +    S  +  +     PWL+Y       PQ L  T L  +  +     L+ V A+YD  G F+  +   +   LQLC ++  +    + FGT Y ++C I++S+L       P+FYD YL YTD      L+PIP+ +   +  +    N     + W+LTRR+ LVD             +  R A+ I+   S+RLV           TK+G+IY P L +        ++ + SA ISF V Y     + S +T        +A+G+L  LA L ++L+   W RR G    +   ++K L +    ++NVFFI+  G  LY+L+ FK Q   S+L   P  +  FV Y+  AF +K L+ +H F++Q ++DIF IDWERPK            K   A +  G          S    VSIWRTYF+ANEWNEIQT RK + +F ++  L F+EV+GFKN+   D   + S +   Y+AP  R+ R+AV  +I+ +   IQ +F    YER IEDK+R +VDLCS++N+S+ +L+HR FGYYIHGRSVHG AD ++ EM   L++E    C++RGL  ++  QT+ +A+ +  R + D ++     R G  RLL   G   +     Y  +NKFL  FI+  H     F  +D+   E I   EF +   +  FY D G SF +VL+YG E  L+ FD+L FCV DL  Q+ V  +F+T+    I + IRN  G  NLA KTLVD RFLI
Sbjct:   49 CDFNQYFDISALSCAPCGANQRRDALGTSCVCLPGYHMISNNGGPSIICKKCPENMKGVTKDGWDCISCPSGLTAEGKCHCPTGHILVERNVSGSLLAQATCELCDESENSFTKANALGTRCVRCEPTF-VNTSRSCSCSEPHTLTGGLCFSNTGNFHQRVISTARYGELGMSLNSEWFAKYLQATAAACWTHANLTSCQALGNMCVMNM-NSYDSTTLDA--CRLFHYIFESTAGLISVHSVPFWRQNLPWLFYGDQPGLAPQVLSTTPLPTNFSFKGQNQLKFVAASYDIRGNFIKWQ-PLEGGVLQLCPDTERRLDAAYAFGTTYQQNCEISLSKLLVDFSS-PVFYDVYLEYTDEEQHRYLWPIPV-LNLNLQHNKLFVNQDSSSSKWLLTRRIFLVDAVSGRENDLGNQPRVIRVATQISL--SIRLV---------PNTKNGNIYTPLLTIAYSDIDIKNAHSQSAKISFSVKYEMNQGDASVHT-------DIALGVLGGLAVLSSLLKTAGWKRRVGSPMIDLQTVMKFLLYYAGDLANVFFIITVGTGLYWLIFFKAQKSVSVLLPMPVQEERFVTYVGCAFAMKALQFLHKFISQISIDIFFIDWERPK-----------GKVLKAVEGEGGVR-------SATVPVSIWRTYFVANEWNEIQTVRKINPLFQVLTTLFFLEVVGFKNLALMDSSSSLSRNPSDYTAPYSRILRYAVATAIWLVIGIIQVVFFAAFYERFIEDKIRQFVDLCSMSNVSVFLLSHRCFGYYIHGRSVHGHADTNMEEMNMNLKREAENLCSQRGLVPNTDGQTFQIAVSSQMRQHYDRIHETLTRRNGPARLLSSSGSTFEQSIKAYHAMNKFLGSFIDHVHKEMDYF-IKDKLLLERILGMEFMEPMEKSIFYNDEGHSFSSVLYYGNEATLLIFDLLFFCVVDLACQDFVLASFLTYLQQEIFRFIRNTVGQKNLATKTLVDERFLI 992          
BLAST of Meckelin vs. UniProt/SwissProt
Match: sp|P0C152|MKS3_RAT (Meckelin OS=Rattus norvegicus OX=10116 GN=Tmem67 PE=1 SV=1)

HSP 1 Score: 488.804 bits (1257), Expect = 1.642e-155
Identity = 340/984 (34.55%), Postives = 494/984 (50.20%), Query Frame = 3
Query:  177 CSSTTYFSSVDFKCVSCSVNAKQSSDGFSCVCKDGYYFTKNGGGSQVLCQKCPLN-QIPSSNGWSCISCLNGVTGTSCSSCDSPNVAYSSDVLGNQFN-GNCTACATNY----RP--VNNQCQLCSNILSTNGNSSCSCALP---TGNACLT------KSLSNSSILTYLGQSVTSGFLQANLMDSVAMCQV-SMESGCQNLANMCVMSVYNRQSAKSIDGTPCSLYAQVQPSGSYTSGKTA------GYPWLYYTIPQTL-------TQLTVDHQYVRGETLQIVLATYDSAGQFLGIRNATKDSNLQLCDNSITKRKETFRFGTHYLESCSITISQLSNQTRYLPLFYDPYLSYTDSIGASQLYPIPIKIGQVISDSGTTPNLLFDQAAWILTRRLLLVDNFGAITAPF----QTNRTASYITFASSMRLVVVKQSSGSFDITKDGSIYAPYLEVNXXXXXXXXXXXXA-NISFEVVYYNVSSYTTAFYYSLSVAMGILCALAGLYAILRAFFWCRRSGISGFEGLVLLKTLAHACASISNVFFIVIFGISLYFLLLFKNQNLFSIL--PPDDDSFFVAYLISAFLLKMLEIVHIFVAQCTVDIFLIDWERPKHQLAPKKIFERSKFDTATDNTGDQNLIQQEKGSQNNGVSIWRTYFIANEWNEIQTYRKTSLIFNLIIVLLFMEVIGFKNITTFDCFVNYSPSSDAYSAPNYRMFRFAVIVSIFGITAFIQWLFTVLIYERVIEDKLRNYVDLCSVANISIIVLAHRQFGYYIHGRSVHGSADVSLSEMYGALQKENAGSCAKRGLESDSMQQTYIMALPNNFRINLDSVY-----RPGGNRLL-EDGRNMQ-----YLEVNKFLDRFINRTHDPRILFRFQDRKXXXXXXXXXXXXNSLEGRFYRDNGTSFGNVLFYGQELALVTFDILLFCVTDLILQNTVFDAFITWGLVTILKMIRNGCGAHNLANKTLVDRRFLI 2981
            C    YF      C  C  N ++ + G SC+C  GY+   N GG  ++C+KCP N +  + +GW CISC NG+T      C S ++    +V G+  +   C  C  N     +P  +  +C  C      N + SCSC+ P   TG  C +      + L ++     LG S  S +    L  + A C   S  + CQ L NMCVM   N  S  S     C L+  V    +  +G  +        PWL+Y     L       T L  +  +     L+ V A+YD  G F+  +   K   LQLC ++  +    + FGT Y ++C I++S+L       P+FYD YL YTD +    L+ IP+ +   +  +    N     + W+LTRR+ LVD             +  R A+ I+   S+RLV           TK+G+IY P L +  + +   +  S +  ISF V Y    +   AF  +  +A+G+L  LA L ++L+   W RR G    +   ++K L +    ++NVFFI+  G  LY+L+ FK Q   S+L   P  +  FV Y+  AF +K L+ +H  ++Q T+DIF IDWERPK            K   A +  G          S    VSIWRTYF+ANEWNEIQT RK + +F ++  L F+EV+GFKN+   D   + S S   Y+AP  R+ R+AV  +I+ +   +Q +F    YER IEDK+R +VDLCS++N+S+ +L+HR FGYYIHGRSVHG AD ++ +M   L++E    C++RGL  ++  QT+ +A+ +  R + D ++     R G  RLL   G  ++     Y  +NKFL  FI+  H     F  +D+   E I   EF +   +  FY D   SF +VL+YG E  L+ FD+L FCV DL  QN V  +F+T+    I + IRN  G  NLA KTLVD RFLI
Sbjct:   49 CDLNQYFDISALSCAPCGANQRRDALGTSCICLPGYHMISNNGGPSIICKKCPENMKGVTKDGWDCISCPNGLTAEGKCHCPSGHILVERNVSGSLLSQATCELCDGNENSFTKPNALGTRCVRCEPTF-VNTSRSCSCSEPHISTGGLCFSNTGNFPQRLISTERYGELGMSSNSEWFTKYLQATAAACWTHSNLTSCQALGNMCVM---NMNSYDSTTFDACRLFHYVFEGAAGLTGVHSVPFWRQNLPWLFYGDQPGLASQVLSTTPLPTNFSFKGQNQLKFVAASYDIRGNFIRWQ-TVKGGVLQLCPDTERRLDAAYSFGTTYQQNCEISLSKLLADFPS-PVFYDIYLEYTDEVQHHYLWAIPV-LNLNLQHNKLFVNQDSSSSKWLLTRRIFLVDAVSGRENDLGNQPRVIRVATQISL--SIRLV---------PNTKNGNIYTPLLTIAYSDIDIKNAYSQSVKISFSVKYE--MNQGDAFVQT-DIALGVLGGLAVLSSLLKTAGWKRRIGSPMIDLQTVMKFLLYYAGDLANVFFIITVGTGLYWLIFFKAQKSVSVLLPMPVQEERFVTYVGCAFAMKALQFLHKLISQITIDIFFIDWERPK-----------GKVLKAVEGEGGVR-------SATVPVSIWRTYFVANEWNEIQTVRKINPLFQVLTTLFFLEVVGFKNLALMDPSSSLSRSLSDYAAPYSRILRYAVATTIWLVIGIVQVVFFAAFYERFIEDKIRQFVDLCSMSNVSVFLLSHRCFGYYIHGRSVHGHADTNMEDMNMNLRREAENLCSQRGLVPNTDGQTFQIAVSSQMRQHYDRIHETLTRRNGPARLLSSSGSTLEQSIKAYHAMNKFLGSFIDHVHKEMDYF-IKDKLLLEKILGMEFMEPLEKSIFYNDESHSFSSVLYYGNEATLLIFDLLFFCVVDLACQNFVLASFLTYLQQEIFRFIRNTVGQKNLATKTLVDERFLI 992          
BLAST of Meckelin vs. UniProt/SwissProt
Match: sp|Q5HYA8|MKS3_HUMAN (Meckelin OS=Homo sapiens OX=9606 GN=TMEM67 PE=1 SV=2)

HSP 1 Score: 481.1 bits (1237), Expect = 1.342e-152
Identity = 332/983 (33.77%), Postives = 494/983 (50.25%), Query Frame = 3
Query:  177 CSSTTYFSSVDFKCVSCSVNAKQSSDGFSCVCKDGYYFTKNGGGSQVLCQKCPLN-QIPSSNGWSCISCLNGVTGTSCSSCDSPNVAYSSDVLGNQFN-GNCTACATN---YRPVN---NQCQLCSNILSTNGNSSCSCALP---TGNACLTKS----LSNSSILTY--LGQSVTSGFLQANLMDSVAMCQVSME-SGCQNLANMCVMSVYNRQSAKSIDGTPCSLYAQV--QPSGSYTSGKTAGY----PWLYY-----TIPQTLTQLTVDHQY-VRGET----LQIVLATYDSAGQFLGIRNATKDSNLQLCDNSITKRKETFRFGTHYLESCSITISQLSNQTRYLPLFYDPYLSYTDSIGASQLYPIPIKIGQVISDSGTTPNLLFDQAAWILTRRLLLVDNFGAITAPFQTNRTASYITFASSMRLVVVKQSSGSFDITKDGSIYAPYLEVNXXXXXXXXXXXXA-NISFEVVYYNVSSYTTAFYYSLSVAMGILCALAGLYAILRAFFWCRRSGISGFEGLVLLKTLAHACASISNVFFIVIFGISLYFLLLFKNQNLFSIL--PPDDDSFFVAYLISAFLLKMLEIVHIFVAQCTVDIFLIDWERPKHQLAPKKIFERSKFDTATDNTGDQNLIQQEKGSQNNGVSIWRTYFIANEWNEIQTYRKTSLIFNLIIVLLFMEVIGFKNITTFDCFVNYSPSSDAYSAPNYRMFRFAVIVSIFGITAFIQWLFTVLIYERVIEDKLRNYVDLCSVANISIIVLAHRQFGYYIHGRSVHGSADVSLSEMYGALQKENAGSCAKRGLESDSMQQTYIMALPNNFRINLDSVY-----RPGGNRLLEDGRNM------QYLEVNKFLDRFINRTHDPRILFRFQDRKXXXXXXXXXXXXNSLEGRFYRDNGTSFGNVLFYGQELALVTFDILLFCVTDLILQNTVFDAFITWGLVTILKMIRNGCGAHNLANKTLVDRRFLI 2981
            C +  YF      CV C  N +Q + G SCVC  G+    N GG  ++C+KCP N +  + +GW+CISC + +T      C   ++    D+ G   +   C  C  N   +  VN   ++C  C      N + SC+C+ P   TG  C + +    L   S   Y  +G S+TS +    L  S A C V    + CQ L NMCVM++ N     + D   C L+  +    +G  T    + +    PWL+Y       PQ L+  ++   +  +GE     L+ V A+YD  G FL  +   +   LQLC ++ T+    + FGT Y ++C I IS++       P+FYD YL YTD      +  +P+ +   +  +    N   +   W+LTRR+ LVD          T      +    S+ + +V         T +G+IY P + +  + +      S +  +SF V Y          +    +A+G+L  LA L ++L+   W RR G    +   ++K L +    ++NVFFI+  G  LY+L+ FK Q   S+L   P  +  FV Y+  AF LK L+ +H  ++Q T+D+F IDWERPK            K   A +  G          S    VSIWRTYF+ANEWNEIQT RK + +F ++ VL F+EV+GFKN+   D   + S +  +Y AP   + R+AV  +++     IQ +F  + YER IEDK+R +VDLCS++NIS+ +L+H+ FGYYIHGRSVHG AD ++ EM   L++E    C++RGL  ++  QT+ +A+ N  R + D ++     + G  RLL    +        Y  +NKFL  FI+  H     F  +D+   E I   EF +   +  FY D G SF +VL+YG E  L+ FD+L FCV DL  QN +  +F+T+    I + IRN  G  NLA+KTLVD+RFLI
Sbjct:   49 CDNNQYFDISALSCVPCGANQRQDARGTSCVCLPGFQMISNNGGPAIICKKCPENMKGVTEDGWNCISCPSDLTAEGKCHCPIGHILVERDINGTLLSQATCELCDGNENSFMVVNALGDRCVRCEPTF-VNTSRSCACSEPNILTGGLCFSSTGNFPLRRISAARYGEVGMSLTSEWFAKYLQSSAAACWVYANLTSCQALGNMCVMNM-NSYDFATFDA--CGLFQFIFENTAGLSTVHSISFWRQNLPWLFYGDQLGLAPQVLSSTSLPTNFSFKGENQNTKLKFVAASYDIRGNFLKWQ-TLEGGVLQLCPDTETRLNAAYSFGTTYQQNCEIPISKILIDFP-TPIFYDVYLEYTDENQHQYILAVPV-LNLNLQHNKIFVNQDSNSGKWLLTRRIFLVDAVSGRENDLGTQPRVIRVATQISLSVHLVPN-------TINGNIYPPLITIAYSDIDIKDANSQSVKVSFSVTYEMDHGEA---HVQTDIALGVLGGLAVLASLLKTAGWKRRIGSPMIDLQTVVKFLVYYAGDLANVFFIITVGTGLYWLIFFKAQKSVSVLLPMPIQEERFVTYVGCAFALKALQFLHKLISQITIDVFFIDWERPK-----------GKVLKAVEGEGGVR-------SATVPVSIWRTYFVANEWNEIQTVRKINSLFQVLTVLFFLEVVGFKNLALMDSSSSLSRNPPSYIAPYSCILRYAVSAALWLAIGIIQVVFFAVFYERFIEDKIRQFVDLCSMSNISVFLLSHKCFGYYIHGRSVHGHADTNMEEMNMNLKREAENLCSQRGLVPNTDGQTFEIAISNQMRQHYDRIHETLIRKNGPARLLSSSASTFEQSIKAYHMMNKFLGSFIDHVHKEMDYF-IKDKLLLERILGMEFMEPMEKSIFYNDEGYSFSSVLYYGNEATLLIFDLLFFCVVDLACQNFILASFLTYLQQEIFRYIRNTVGQKNLASKTLVDQRFLI 995          
BLAST of Meckelin vs. TrEMBL
Match: A0A3Q0KQZ3 (Uncharacterized protein OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 576.244 bits (1484), Expect = 0.000e+0
Identity = 361/1052 (34.32%), Postives = 532/1052 (50.57%), Query Frame = 3
Query:  180 SSTTYFSSVDFKCVSCSVN---AKQSSDGFSCVCKDGYYFTKNGGGSQVLCQKCPLNQIPSSNGWSCISCLNG---VTGTSCSSCDSPNVAYSSDVLGNQF-NGNCTACATNYRPVNNQCQLC---------------------------------SNILSTNGNSSCSCALPTGNACLTKSLSNSSILTYLGQSVTSGFLQANLMDSVAMCQVSME--SGCQNLANMCVMSVYNRQSAKSIDGTPCS----LYAQVQPSGSYTSGKTAGYPWLYYTIPQ---TLTQLTVDHQYVRGETLQIVLATYDSAGQFLGIRNATKDSNLQLCDNSITKRKETFRFGTHYLESCSITISQLSNQTRYLPLFYDPYLSYTDSIG-ASQLYPIPIKIGQVISDSGTTPNLLFD-------------------------QAAWILTRRLLLVDNFGAITAPFQTNRTASYITFASSMRLVVVKQSSGSFDITKDGSIYAPYLEV---NXXXXXXXXXXXXANISFEVVYYNVSSYTTAFYYSLSVAMGILCALAGLYAILRAFFWCRRSGISGFEGLVLLKTLAHACASISNVFFIVIFGISLYFLLLFKNQNLFSILPPDDDSFFVAYLISAFLLKMLEIVHIFVAQCTVDIFLIDWERPKHQLAPKKIFERS--------------KFDTATDNTGDQNLIQQEKGS---------------QNNGVSIWRTYFIANEWNEIQTYRKTSLIFNLIIVLLFMEVIGFKNITTFDCFVNYSPSSDAYSAPNYRMFRFAVIVSIFGITAFIQWLFTVLIYERVIEDKLRNYVDLCSVANISIIVLAHRQFGYYIHGRSVHGSADVSLSEMYGALQKENAGSCAKRGLESDSMQQTYIMALPNNFRINLDSVYRPGGNRLLEDGR-----------NMQYLEVNKFLDRFINRTHDPRILFRFQDRKXXXXXXXXXXXXNSLEGRFYRDNGTSFGNVLFYGQELALVTFDILLFCVTDLILQNTVFDAFITWGLVTILKMIRNGCGAHNLANKTLVDRRFLI 2981
            S+  YF+S +  C  CS N    KQS+DGFSC+C+ GY   KN GG+ V C +C   +  S +G  CI C  G       SCSSC S +V+   D  G+   +  C AC+ N  P NN C  C                                 + I ++N  S  S  +PTG+   T  L      +  G  ++S + +     + A C  +    + CQ LAN+C + +     + +   + CS    L +Q  P  S  +      PWLYY+  +    L    +   Y     LQI LA +   G+FLG ++A++   LQLC ++ ++ K  F+F T Y ++C + +  L +  +Y  +FYDPY+ + DS    SQL PIPI+   VI  SG  PN++                           Q  W LTRRL +VDNF   T+    ++    + +AS++ + V  Q     D   DG I+ P +++   N    +         I+F V Y +  +   AF  +L +AMG +  LA  YA++R + W RR+G+   + ++++K +  A  +ISN F IVI+ +S+YFL+ +K Q+++ I  P+ D F + Y+  AF LK ++++H+   QCT+DIFLIDWE PK       +   S              K++  +D T   NL+ + K                 ++ G+S+WR  ++ANEWNEIQTYRKTS +  +  VL+ M+VIG +N+ + D   N   +S  Y +P  R+FR A+I+SIF +   IQWLF++ ++ER   DKLR++ DLCSVAN+S+ + A   FGYYIHG S  G +DV L  +   L  EN G   KRG+  DS   TY MALP+  R   + +Y P  N  L   +           N  Y  +N++L RFI+R     + +R   RK FEDI DGEF+D + EG FY D+G SFG+ L+YG E  L TFD LLFC+ DL+ QN +  AF    + +I  ++R+  G  N A KTLVD RFLI
Sbjct:   35 SNAEYFNSANLVCKKCSQNLTFQKQSADGFSCICQSGYKTIKNFGGNNVECTQCKDGETVSEDGLFCIPCKAGSYMAATRSCSSCPSDSVSVYLDQSGSPLASQTCLACSNNTVPDNNTCVTCRTTIRMLRASSLPESCICPNSRVDGVCFPGITPTTIGTSNSASGSSPVVPTGSDTFTLVLPAGETSSQTG--ISSKYFETQARSATAFCSTAYNNITACQLLANLCTLQLNTLYESGTGSASTCSEFRRLTSQRTPINSDYTSWVKDMPWLYYSPTKGSTVLKDTKLKTIYSPNSNLQIYLAAFKINGEFLGFQDASQGGQLQLCKDTSSRMKAAFQFATTYRQTCELNVDDLFDNEKYPLVFYDPYIYFYDSTTQTSQLIPIPIRNTAVIDKSGNFPNVITSSDQNSLNEALALGNTASAVSIEAAIQDKWELTRRLFMVDNFSGKTSTI--SKVPQLVRYASNIEIKVTSQ-----DSVTDGQIFPPIIKIDYSNFYATNDYGKGKQVQITFSVTYSSSIAKQAAFDQALRIAMGCMSTLAACYAMIRTWIWSRRAGVLRLDAMLVIKLILFAAGNISNAFLIVIYFVSIYFLIFYKVQSVYLINLPNSDEFILIYIAIAFALKCIDLIHLIAVQCTMDIFLIDWEPPKFNRNINNVNPPSNTDIQSSSRSQSLGKYNIISDMT--DNLVVRSKKELRSSLQPSSIISDQMEDTGISVWRIIYVANEWNEIQTYRKTSCLITISCVLILMQVIGLENLASSDAKSNILLNSYEYHSPQSRIFRIALILSIFSVIGIIQWLFSITLWERCFSDKLRSFADLCSVANVSVFLFAQSNFGYYIHGHSPTGRSDVDLGGITQMLSIENEGIAPKRGITPDSNDHTYRMALPSGLRQTFNRLYTPLLNLTLNADKYGKHVSAQAITNEVYHNINRYLKRFISRDDPDGLRYRIVRRKAFEDIIDGEFDDTTFEGLFYIDDGNSFGDTLYYGNEWLLFTFDALLFCLVDLLSQNLILSAFFVILIGSIFTLLRDDLGRRNTARKTLVDERFLI 1075          
BLAST of Meckelin vs. TrEMBL
Match: A0A1I8I704 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 567.77 bits (1462), Expect = 0.000e+0
Identity = 355/1015 (34.98%), Postives = 539/1015 (53.10%), Query Frame = 3
Query:  174 ACSSTTYFSSVDFKCVSCSVNAKQSSDGFSCVCKDGYYFTKNGGGSQVLCQKCPLNQIPSSNGWSCISCL----NGVTGTSCSSCDSP-NVAYSSDVLGNQFNG-NCTAC--ATNYRPVNNQCQLCSNILSTNGNSSCSCALPTGNACLTKSLSNSSILTYLGQS-------------------VTSG------------------FLQANLMDSVAMCQ--VSMESGCQNLANMCVMSVYNRQSAKSIDGTPCSLYAQVQPSGSY----TSGKTAGYPWLYYTIPQTL-TQLTVDHQYVRGETLQIVLATYDSAGQFLGIRNATKDSNLQLCDNSITKRKETFRFGTHYLESCSITISQLSNQTRYLPLFYDPYLSYTDSIGASQLYPIPIKIGQVISDSGTTPNLLFDQAAWILTRRLLLVDNFGAITAPFQTNRTASYITFASSMRLVVVKQSSGSFDITKDGSIYAPYLEVNXXXXXXXXXXXXANIS--FEVVYYNVSSYTTAFYYSLSVAMGILCALAGLYAILRAFFWCRRSGISGFEGLVLLKTLAHACASISNVFFIVIFGISLYFLLLFKNQNLFSILPPDD--DSFFVAYLISAFLLKMLEIVHIFVAQCTVDIFLIDWERPKHQLAPKKIFERSKFDTATDNTGDQNLIQQEKGSQNNGVSIWRTYFIANEWNEIQTYRKTSLIFNLIIVLLFMEVIGFKNITTFDCFVNYSPSSDAYSAPNYRMFRFAVIVSIFGITAFIQWLFTVLIYERVIEDKLRNYVDLCSVANISIIVLAHRQFGYYIHGRSVHGSADVSLSEMYGALQKENAGSCAKRGLESDSMQQTYIMALPNNFRINLDSVYR---PGGNRLLEDGRNMQ------YLEVNKFLDRFINRTH-----------DPRILFRFQDRKXXXXXXXXXXXXNSL---EGRFYRDNGTSFGNVLFYGQELALVTFDILLFCVTDLILQNTVFDAFITWGLVTILKMIRNGCGAHNLANKTLVDRRFLI 2981
            +C++  YF S    C  C  N   S+DG SCVC+ G+  T N GG+ + C+ C  + +PS +GWSC++C        T   CS+C  P N      + G  ++   C AC  +T   P    C  C N+L     S+ +  LPT     T ++++S+  TY  QS                    TSG                  +L  +L  +  MC    S  + CQ LAN C + +Y + +  + +   C L+ +   + +      S   AG PWLY++ P +L T   V  Q+ R  T+    A Y   G F+G + A  +  +QLC NS  ++   + FGT Y  SCS+ +  L +Q +Y   F+D YL  T   G  QL+P+P+KI  + S S   PN   +   +ILTRR  LVDN GA++        AS++ +AS +++ +   S   +  + DG IY P + V  + V S+   +SA +S  F V Y+   S  T F+ +L + MG+LC +A LYAI R+  +  RSG   FE  ++L  +A AC++I+NVF IVI+G S+++  ++KNQN+F+   P +  ++  + Y+  A  LK++E++++ + Q  +DIF+IDWE+PK   +      R +                 K +    V+ WRT  IANEWNEIQT+RKT+  F L++VL FM  +GF+N  + D  ++    +D Y A N  +FRF + +S+F     IQWL+T+LI+ER IEDKLRN+VDLCS+ANIS+ + + R FGYYIHG S HG+ADV +S+++   +KE    C +RGL+ ++  QT++M LP NF    D++YR     G+    D +  Q      Y E+N FL RFI++              P   +  Q RK  ED+   E   N      G FY ++GTSFG+VLFYG EL+L+TFD+L++   DLI ++T  +  ITW +  ++  +R+  G  NL+ KT+ +R+FLI
Sbjct:   36 SCATGKYFDSTRLACRDCGANQTTSADGLSCVCRSGFRITSNYGGN-IACEICSGSTVPSKDGWSCVTCPASNPKDATTGYCSACPYPLNATAEYQINGVAYSTVTCVACTSSTFVAPDGAHCIPCPNVLKMK--SAINSGLPTPTCDCTGTITSSTGATYTLQSNGGICFAVTDSTDVTLPAVRTSGIQTTISKVSSDSTTANSIYLSTHLAAAYGMCASYYSNRTACQVLANACALILYRQTNIGTGNRDACVLFNEYFSTRTEIINSNSDWKAGLPWLYHSNPSSLLTSEGVTTQFTRLSTIAFQAAVYTQNGTFVGYK-ALTEGLIQLCPNSRNEQNSAYAFGTRYTSSCSLLVDDLFDQAKYPLQFFDIYLKITSDGGTEQLFPVPVKISDLRSQSNNFPNQGSNTNDYILTRRFFLVDNVGAVST---VGSRASFVRYASKIQIDITLLSKDIY--STDGRIYPPVITVEYSDVDSNLYGTSATVSATFNVAYF---SDLTTFWEALKITMGVLCGVAALYAIFRSIAYKSRSGGENFEATIILHFIAFACSAIANVFLIVIYGASVWYFSVYKNQNIFAFFIPTEAQENNLIVYIAVAGALKLIEVIYMIITQSHIDIFMIDWEKPKADSSQLGAIGRDEV----------------KSASRTEVTYWRTVLIANEWNEIQTHRKTNRTFTLLVVLFFMSALGFENYASGDPQLSRFVVTDEYRASNVTIFRFCLAMSVFIGVGGIQWLWTLLIHERFIEDKLRNFVDLCSIANISVFIRSPRSFGYYIHGESPHGTADVGVSQLHDQFEKEKQNDCGRRGLD-NTDNQTFMMRLPPNFVSVFDNLYRNLLNTGSVAGTDAKTQQVHSIKKYHEMNNFLTRFIHKKPMEESDGVGQGGKPIEGYGVQPRKCMEDVLGMELGGNDTLRDGGIFYSEDGTSFGDVLFYGNELSLMTFDLLVYSCVDLIFKSTPLNVIITWLIGELIDFLRSQLGEINLSKKTMTNRQFLI 1021          
BLAST of Meckelin vs. TrEMBL
Match: A0A267G4Y3 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig034046g3 PE=4 SV=1)

HSP 1 Score: 567 bits (1460), Expect = 0.000e+0
Identity = 356/1015 (35.07%), Postives = 538/1015 (53.00%), Query Frame = 3
Query:  174 ACSSTTYFSSVDFKCVSCSVNAKQSSDGFSCVCKDGYYFTKNGGGSQVLCQKCPLNQIPSSNGWSCISCL----NGVTGTSCSSCDSP-NVAYSSDVLGNQFNG-NCTAC--ATNYRPVNNQCQLCSNILSTNGNSSCSCALPTGNACLTKSLSNSSILTYLGQS-------------------VTSG------------------FLQANLMDSVAMCQ--VSMESGCQNLANMCVMSVYNRQSAKSIDGTPCSLYAQVQPSGSY----TSGKTAGYPWLYYTIPQTL-TQLTVDHQYVRGETLQIVLATYDSAGQFLGIRNATKDSNLQLCDNSITKRKETFRFGTHYLESCSITISQLSNQTRYLPLFYDPYLSYTDSIGASQLYPIPIKIGQVISDSGTTPNLLFDQAAWILTRRLLLVDNFGAITAPFQTNRTASYITFASSMRLVVVKQSSGSFDITKDGSIYAPYLEVNXXXXXXXXXXXXANIS--FEVVYYNVSSYTTAFYYSLSVAMGILCALAGLYAILRAFFWCRRSGISGFEGLVLLKTLAHACASISNVFFIVIFGISLYFLLLFKNQNLFSILPPDD--DSFFVAYLISAFLLKMLEIVHIFVAQCTVDIFLIDWERPKHQLAPKKIFERSKFDTATDNTGDQNLIQQEKGSQNNGVSIWRTYFIANEWNEIQTYRKTSLIFNLIIVLLFMEVIGFKNITTFDCFVNYSPSSDAYSAPNYRMFRFAVIVSIFGITAFIQWLFTVLIYERVIEDKLRNYVDLCSVANISIIVLAHRQFGYYIHGRSVHGSADVSLSEMYGALQKENAGSCAKRGLESDSMQQTYIMALPNNFRINLDSVYR---PGGNRLLEDGRNMQ------YLEVNKFLDRFINRTH-----------DPRILFRFQDRKXXXXXXXXXXXXNSL---EGRFYRDNGTSFGNVLFYGQELALVTFDILLFCVTDLILQNTVFDAFITWGLVTILKMIRNGCGAHNLANKTLVDRRFLI 2981
            +C++  YF S    C  C  N   S+DG SCVC+ G+  T N GG+ + C+ C  + +PS +GWSC++C        T   CS+C  P N      + G  ++   C AC  +T   P    C  C N+L     S+ +  LPT     T ++S+S+  TY  QS                    TSG                  +L  +L  +  MC    S  + CQ LAN C + +Y + +  + +   C L+ +   + +      S   AG PWLY++ P +L T   V  Q+ R  T+    A Y   G F+G + A  +  +QLC NS  ++   + FGT Y  SCS+ +  L +Q +Y   F+D YL  T   G  QL+P+P+KI  + S S   PN   +   +ILTRR  LVDN GA++        AS++ +AS +++ +   S   +  + DG IY P + V  + V S+   +SA +S  F V Y+   S  T F+ +L + MG+LC +A LYAI R+  +  RSG   FE  ++L  +A AC++I+NVF IVI+G S+++  ++KNQN+F+   P +  +   + Y+  A  LK++E++++ + Q  +DIF+IDWE+PK   +      R +                 K +    V+ WRT  IANEWNEIQT+RKT+  F L++VL FM  +GF+N  + D  ++    +D Y A N  +FRF + +S+F     IQWL+T+LI+ER IEDKLRN+VDLCS+ANIS+ + + R FGYYIHG S HG+ADV +S+++   +KE    C +RGL+ ++  QT++M LP NF    D++YR     G+    D +  Q      Y E+N FL RFI++              P   +  Q RK  ED+   E   N      G FY ++GTSFG+VLFYG EL+L+TFD+L++   DLI ++T  +  ITW +  ++  +R+  G  NL+ KT+ +R+FLI
Sbjct:   54 SCTTGKYFDSTRLACRDCGANQTTSADGLSCVCRSGFRITSNYGGN-IACEICSGSTVPSKDGWSCVTCPASNPKDATTGYCSACPYPLNATAEYQINGVAYSTVTCVACTSSTFVAPDGAHCIPCPNVLKMK--SAINSGLPTPTCDCTGTISSSTGATYTLQSNGGICFAVTDSTDVTLPAVRTSGIQTTISKVSSDSTTANSIYLSTHLAAAYGMCASYYSNRTACQVLANACALILYRQTNIGTGNRDACVLFNEYFSTRTEIINSNSDWKAGLPWLYHSNPSSLLTSEGVTTQFTRLSTIAFQAAVYTQNGTFVGYK-ALTEGLIQLCPNSRNEQNSAYAFGTRYTSSCSLLVDDLFDQAKYPLQFFDIYLKITSDGGTEQLFPVPVKISDLRSQSNNFPNQGSNTNDYILTRRFFLVDNVGAVST---VGSRASFVRYASKIQIDITLLSKDIY--STDGRIYPPVITVEYSDVDSNLYGTSATVSATFNVAYF---SDLTTFWEALKITMGVLCGVAALYAIFRSIAYKSRSGGENFEATIILHFIAFACSAIANVFLIVIYGASVWYFSVYKNQNIFAFFIPTEAQEINLIVYIAVAGALKLIEVIYMIITQSHIDIFMIDWEKPKADSSQLGAIGRDEV----------------KSASRTEVTYWRTVLIANEWNEIQTHRKTNRTFTLLVVLFFMSALGFENYASGDPQLSRFVVTDEYRASNVTIFRFCLAMSVFIGVGGIQWLWTLLIHERFIEDKLRNFVDLCSIANISVFIRSPRSFGYYIHGESPHGTADVGVSQLHDQFEKEKQNDCGRRGLD-NTDNQTFMMRLPPNFVSVFDNLYRNLLNTGSVAGTDAKTQQVHSIKKYHEMNNFLTRFIHKKPMEESDGAGQGGKPIEGYGVQPRKCMEDVLGMELGGNDTLRDGGIFYSEDGTSFGDVLFYGNELSLMTFDLLVYSCVDLIFKSTPLNVIITWLIGELIDFLRSQLGEINLSKKTMTNRQFLI 1039          
BLAST of Meckelin vs. TrEMBL
Match: A0A267H638 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig034046g2 PE=4 SV=1)

HSP 1 Score: 567 bits (1460), Expect = 0.000e+0
Identity = 355/1015 (34.98%), Postives = 539/1015 (53.10%), Query Frame = 3
Query:  174 ACSSTTYFSSVDFKCVSCSVNAKQSSDGFSCVCKDGYYFTKNGGGSQVLCQKCPLNQIPSSNGWSCISCL----NGVTGTSCSSCDSP-NVAYSSDVLGNQFNG-NCTAC--ATNYRPVNNQCQLCSNILSTNGNSSCSCALPTGNACLTKSLSNSSILTYLGQS-------------------VTSG------------------FLQANLMDSVAMCQ--VSMESGCQNLANMCVMSVYNRQSAKSIDGTPCSLYAQVQPSGSY----TSGKTAGYPWLYYTIPQTL-TQLTVDHQYVRGETLQIVLATYDSAGQFLGIRNATKDSNLQLCDNSITKRKETFRFGTHYLESCSITISQLSNQTRYLPLFYDPYLSYTDSIGASQLYPIPIKIGQVISDSGTTPNLLFDQAAWILTRRLLLVDNFGAITAPFQTNRTASYITFASSMRLVVVKQSSGSFDITKDGSIYAPYLEVNXXXXXXXXXXXXANIS--FEVVYYNVSSYTTAFYYSLSVAMGILCALAGLYAILRAFFWCRRSGISGFEGLVLLKTLAHACASISNVFFIVIFGISLYFLLLFKNQNLFSILPPDD--DSFFVAYLISAFLLKMLEIVHIFVAQCTVDIFLIDWERPKHQLAPKKIFERSKFDTATDNTGDQNLIQQEKGSQNNGVSIWRTYFIANEWNEIQTYRKTSLIFNLIIVLLFMEVIGFKNITTFDCFVNYSPSSDAYSAPNYRMFRFAVIVSIFGITAFIQWLFTVLIYERVIEDKLRNYVDLCSVANISIIVLAHRQFGYYIHGRSVHGSADVSLSEMYGALQKENAGSCAKRGLESDSMQQTYIMALPNNFRINLDSVYR---PGGNRLLEDGRNMQ------YLEVNKFLDRFINRTH-----------DPRILFRFQDRKXXXXXXXXXXXXNSL---EGRFYRDNGTSFGNVLFYGQELALVTFDILLFCVTDLILQNTVFDAFITWGLVTILKMIRNGCGAHNLANKTLVDRRFLI 2981
            +C++  YF S    C  C  N   S+DG SCVC+ G+  T N GG+ + C+ C  + +PS +GWSC++C        T   CS+C  P N      + G  ++   C AC  +T   P    C  C N+L     S+ +  LPT     T ++++S+  TY  QS                    TSG                  +L  +L  +  MC    S  + CQ LAN C + +Y + +  + +   C L+ +   + +      S   AG PWLY++ P +L T   V  Q+ R  T+    A Y   G F+G + A  +  +QLC NS  ++   + FGT Y  SCS+ +  L +Q +Y   F+D YL  T   G  QL+P+P+KI  + S S   PN   +   +ILTRR  LVDN GA++        AS++ +AS +++ +   S   +  + DG IY P + V  + V S+   +SA +S  F V Y+   S  T F+ +L + MG+LC +A LYAI R+  +  RSG   FE  ++L  +A AC++I+NVF IVI+G S+++  ++KNQN+F+   P +  ++  + Y+  A  LK++E++++ + Q  +DIF+IDWE+PK   +      R +                 K +    V+ WRT  IANEWNEIQT+RKT+  F L++VL FM  +GF+N  + D  ++    +D Y A N  +FRF + +S+F     IQWL+T+LI+ER IEDKLRN+VDLCS+ANIS+ + + R FGYYIHG S HG+ADV +S+++   +KE    C +RGL+ ++  QT++M LP NF    D++YR     G+    D +  Q      Y E+N FL RFI++              P   +  Q RK  ED+   E   N      G FY ++GTSFG+VLFYG EL+L+TFD+L++   DLI ++T  +  ITW +  ++  +R+  G  NL+ KT+ +R+FLI
Sbjct:   54 SCATGKYFDSTRLACRDCGANQTTSADGLSCVCRSGFRITSNYGGN-IACEICSGSTVPSKDGWSCVTCPASNPKDATTGYCSACPYPLNATAEYQINGVAYSTVTCVACTSSTFVAPDGAHCIPCPNVLKMK--SAINSGLPTPTCDCTGTITSSTGATYTLQSNGGICFAVTDSTDVTLPAVRTSGIQTTISKVSSDSTTANSIYLSTHLAAAYGMCASYYSNRTACQVLANACALILYRQTNIGTGNRDACVLFNEYFSTRTEIINSNSDWKAGLPWLYHSNPSSLLTSEGVTTQFTRLSTIAFQAAVYTQNGTFVGYK-ALTEGLIQLCPNSRNEQNSAYAFGTRYTSSCSLLVDDLFDQAKYPLQFFDIYLKITSDGGTEQLFPVPVKISDLRSQSNNFPNQGSNTNDYILTRRFFLVDNVGAVST---VGSRASFVRYASKIQIDITLLSKDIY--STDGRIYPPVITVEYSDVDSNLYGTSATVSATFNVAYF---SDLTTFWEALKITMGVLCGVAALYAIFRSIAYKSRSGGENFEATIILHFIAFACSAIANVFLIVIYGASVWYFSVYKNQNIFAFFIPTEAQENNLIVYIAVAGALKLIEVIYMIITQSHIDIFMIDWEKPKADSSQLGAIGRDEV----------------KSASRTEVTYWRTVLIANEWNEIQTHRKTNRTFTLLVVLFFMSALGFENYASGDPQLSRFVVTDEYRASNVTIFRFCLAMSVFIGVGGIQWLWTLLIHERFIEDKLRNFVDLCSIANISVFIRSPRSFGYYIHGESPHGTADVGVSQLHDQFEKEKQNDCGRRGLD-NTDNQTFMMRLPPNFVSVFDNLYRNLLNTGSVAGTDAKTQQVHSIKKYHEMNNFLTRFIHKKPMEESDGVGQGGKPIEGYGVQPRKCMEDVLGMELGGNDTLRDGGIFYSEDGTSFGDVLFYGNELSLMTFDLLVYSCVDLIFKSTPLNVIITWLIGELIDFLRSQLGEINLSKKTMTNRQFLI 1039          
BLAST of Meckelin vs. TrEMBL
Match: A0A267H662 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig034046g1 PE=4 SV=1)

HSP 1 Score: 566.229 bits (1458), Expect = 0.000e+0
Identity = 355/1015 (34.98%), Postives = 538/1015 (53.00%), Query Frame = 3
Query:  174 ACSSTTYFSSVDFKCVSCSVNAKQSSDGFSCVCKDGYYFTKNGGGSQVLCQKCPLNQIPSSNGWSCISCL----NGVTGTSCSSCDSP-NVAYSSDVLGNQFNG-NCTAC--ATNYRPVNNQCQLCSNILSTNGNSSCSCALPTGNACLTKSLSNSSILTYLGQS-------------------VTSG------------------FLQANLMDSVAMCQ--VSMESGCQNLANMCVMSVYNRQSAKSIDGTPCSLYAQVQPSGSY----TSGKTAGYPWLYYTIPQTL-TQLTVDHQYVRGETLQIVLATYDSAGQFLGIRNATKDSNLQLCDNSITKRKETFRFGTHYLESCSITISQLSNQTRYLPLFYDPYLSYTDSIGASQLYPIPIKIGQVISDSGTTPNLLFDQAAWILTRRLLLVDNFGAITAPFQTNRTASYITFASSMRLVVVKQSSGSFDITKDGSIYAPYLEVNXXXXXXXXXXXXANIS--FEVVYYNVSSYTTAFYYSLSVAMGILCALAGLYAILRAFFWCRRSGISGFEGLVLLKTLAHACASISNVFFIVIFGISLYFLLLFKNQNLFSILPPDD--DSFFVAYLISAFLLKMLEIVHIFVAQCTVDIFLIDWERPKHQLAPKKIFERSKFDTATDNTGDQNLIQQEKGSQNNGVSIWRTYFIANEWNEIQTYRKTSLIFNLIIVLLFMEVIGFKNITTFDCFVNYSPSSDAYSAPNYRMFRFAVIVSIFGITAFIQWLFTVLIYERVIEDKLRNYVDLCSVANISIIVLAHRQFGYYIHGRSVHGSADVSLSEMYGALQKENAGSCAKRGLESDSMQQTYIMALPNNFRINLDSVYR---PGGNRLLEDGRNMQ------YLEVNKFLDRFINRTH-----------DPRILFRFQDRKXXXXXXXXXXXXNSL---EGRFYRDNGTSFGNVLFYGQELALVTFDILLFCVTDLILQNTVFDAFITWGLVTILKMIRNGCGAHNLANKTLVDRRFLI 2981
            +C++  YF S    C  C  N   S+DG SCVC+ G+  T N GG+ + C+ C  + +PS +GWSC++C        T   CS+C  P N      + G  ++   C AC  +T   P    C  C N+L     S+ +  LPT     T ++++S+  TY  QS                    TSG                  +L  +L  +  MC    S  + CQ LAN C + +Y + +  + +   C L+ +   + +      S   AG PWLY++ P +L T   V  Q+ R  T+    A Y   G F+G + A  +  +QLC NS  ++   + FGT Y  SCS+ +  L +Q +Y   F+D YL  T   G  QL+P+P+KI  + S S   PN   +   +ILTRR  LVDN GA++        AS++ +AS +++ +   S   +  + DG IY P + V  + V S+   +SA +S  F V Y+   S  T F+ +L + MG+LC +A LYAI R+  +  RSG   FE  ++L  +A AC++I+NVF IVI+G S+++  ++KNQN+F+   P +  +   + Y+  A  LK++E++++ + Q  +DIF+IDWE+PK   +      R +                 K +    V+ WRT  IANEWNEIQT+RKT+  F L++VL FM  +GF+N  + D  ++    +D Y A N  +FRF + +S+F     IQWL+T+LI+ER IEDKLRN+VDLCS+ANIS+ + + R FGYYIHG S HG+ADV +S+++   +KE    C +RGL+ ++  QT++M LP NF    D++YR     G+    D +  Q      Y E+N FL RFI++              P   +  Q RK  ED+   E   N      G FY ++GTSFG+VLFYG EL+L+TFD+L++   DLI ++T  +  ITW +  ++  +R+  G  NL+ KT+ +R+FLI
Sbjct:   54 SCATGKYFDSTRLACRDCGANQTTSADGLSCVCRSGFRITSNYGGN-IACEICSGSTVPSKDGWSCVTCPASNPKDATTGYCSACPYPLNATAEYQINGVAYSTVTCVACTSSTFVAPDGAHCIPCPNVLKMK--SAINSGLPTPTCDCTGTITSSTGATYTLQSNGGICFAVTDSTDVTLPAVRTSGIQTTISKVSSDSTTANSIYLSTHLAAAYGMCASYYSNRTACQVLANACALILYRQTNIGTGNRDACVLFNEYFSTRTEIINSNSDWKAGLPWLYHSNPSSLLTSEGVTTQFTRLSTIAFQAAVYTQNGTFVGYK-ALTEGLIQLCPNSRNEQNSAYAFGTRYTSSCSLLVDDLFDQAKYPLQFFDIYLKITSDGGTEQLFPVPVKISDLRSQSNNFPNQGSNTNDYILTRRFFLVDNVGAVST---VGSRASFVRYASKIQIDITLLSKDIY--STDGRIYPPVITVEYSDVDSNLYGTSATVSATFNVAYF---SDLTTFWEALKITMGVLCGVAALYAIFRSIAYKSRSGGENFEATIILHFIAFACSAIANVFLIVIYGASVWYFSVYKNQNIFAFFIPTEAQEINLIVYIAVAGALKLIEVIYMIITQSHIDIFMIDWEKPKADSSQLGAIGRDEV----------------KSASRTEVTYWRTVLIANEWNEIQTHRKTNRTFTLLVVLFFMSALGFENYASGDPQLSRFVVTDEYRASNVTIFRFCLAMSVFIGVGGIQWLWTLLIHERFIEDKLRNFVDLCSIANISVFIRSPRSFGYYIHGESPHGTADVGVSQLHDQFEKEKQNDCGRRGLD-NTDNQTFMMRLPPNFVSVFDNLYRNLLNTGSVAGTDAKTQQVHSIKKYHEMNNFLTRFIHKKPMEESDGVGQGGKPIEGYGVQPRKCMEDVLGMELGGNDTLRDGGIFYSEDGTSFGDVLFYGNELSLMTFDLLVYSCVDLIFKSTPLNVIITWLIGELIDFLRSQLGEINLSKKTMTNRQFLI 1039          
BLAST of Meckelin vs. Ensembl Cavefish
Match: tmem67 (transmembrane protein 67 [Source:NCBI gene;Acc:103025602])

HSP 1 Score: 431.024 bits (1107), Expect = 9.991e-135
Identity = 304/986 (30.83%), Postives = 479/986 (48.58%), Query Frame = 3
Query:  177 CSSTTYFSSVDFKCVSCSVNAKQSSDGFSCVCKDGYYFTKNGGGSQVLCQKCPLNQIP--SSNGWSCISCLNGVTGTSCSSCDSPNVAYSSDVLGNQF-NGNCTACATNYRPVN------NQCQLCSNILSTNGNSSCSCA---LPTGNAC-----LTKSLSNSSILTYLGQSVTSGFLQANLMDSVAMCQVSME-SGCQNLANMCVMSVYNRQSAKSIDGTPCSLYAQV-QPSGSYTSGKTAGY-----PWLYYTIPQTLTQLTVDHQYV----------RGETLQIVLATYDSAGQFLGIRNATKDSNLQLCDNSITKRKETFRFGTHYLESCSITISQL-SNQTRYLPLFYDPYLSYTDSIGASQLYPIPIKIGQVISDSGTTPNLLFDQAAWILTRRLLLVDNFGAITAPFQTNRTASYITFASSMRLVVVKQSSGSFDI---TKDGSIYAPYLEVN-XXXXXXXXXXXXANISFEVVYYNVSSYTTAFYYSLSVAMGILCALAGLYAILRAFFWCRRSGISGFEGLVLLKTLAHACASISNVFFIVIFGISLYFLLLFKNQNLFSIL-P-PDDDSFFVAYLISAFLLKMLEIVHIFVAQCTVDIFLIDWERPKHQLAPKKIFERSKFDTATDNTGDQNLIQQEKGSQNNGVSIWRTYFIANEWNEIQTYRKTSLIFNLIIVLLFMEVIGFKNITTFDCFVNYSPSSDAYSAPNYRMFRFAVIVSIFGITAFIQWLFTVLIYERVIEDKLRNYVDLCSVANISIIVLAHRQFGYYIHGRSVHGSADVSLSEMYGALQKENAGSCAKRGLESDSMQQTYIMALPNNFRINLDSVYRP-----GGNRLLEDGRN------MQYLEVNKFLDRFINRTHDPRILFRFQDRKXXXXXXXXXXXXNSLEGRFYRDNGTSFGNVLFYGQELALVTFDILLFCVTDLILQNTVFDAFITWGLVTILKMIRNGCGAHNLANKTLVDRRFL 2978
            C    YF      C  C  N      G SCVC+ G+    + G S V CQKCP +  P  S +G+ CI C + V       C    +    +V G+      C AC       +      N+C  C +    N   SC C    +P G  C     L  ++ ++     LG SV S +  + L  S A C +    + CQ L NMCV+   N  S  S     C LY  + + + +  + +   Y     PWLYY     L    +  + +          +   ++++ A Y   G+FL   N  +   LQLC +++T+++  + FGT Y ++C +++S L S Q+   PLF+D +L    + G  +L  +P+ +   +  +G   N   +   W LT+RL+L+D          +  T   I  AS++++         F +   T+ G +Y P + V+    + +   T +  +SF V Y    +          +A+G+L  +A ++++L+   W RR      +   +LK L      +++VFF++  G  LY+++ +K Q   S+L P P  +  FV Y+  AF LK +  +H    Q +VD+F IDWERP           R K   + + TG       E  +    VSIWRTYF+ANEWNEIQT RK S  F ++ VL F+EV+GF ++   D       S++AY+    R+ R+ +  +++    FIQ +F  + +ER +EDK+R +VDLCS++NIS+++ +H+ +GYYIHGRSVHG AD ++ EM   L++E    C +RGL  +S  QT+ +++ +  R   D +  P     G +RL++   N        Y  +N+FL   I+  H   + +  +D+  FE +   EF +   +  FY D+  SF +VLFYG E  L+ FD L FCV D+  Q+ V  + +T+    I ++IRN  G  NL  KTLVDRRFL
Sbjct:   40 CGPGGYFDISSLSCAKCGANQISGKSGLSCVCQTGFKVLTSNGRS-VTCQKCP-DSKPGVSQDGYECIQCPSAVGEDGKCQCPEGKILVERNVSGSLLQEAVCEACIGTEPDFSAPDAKGNRCVRCQDSF-INTTQSCVCGSPNIPAGGMCFPPEKLPGTVVSTVSFAQLGLSVPSAWFYSFLYSSAAACLLFTNLTACQALGNMCVL---NMHSTSSTGNDACGLYNTIYRATAAQGNSQNIPYWRTNLPWLYYGDQPGLASRVLQSEPLPVPFSFKGANKNTNIELLAAVYTVQGEFLRWEN-VRGGILQLCPDTVTRQQAAYTFGTAYKQNCVLSVSDLLSGQSE--PLFFDIFLVQQKTAGDRRLLAVPV-LNLNLQFNGQFVNQASNLNNWYLTQRLMLIDTLSGREKSLSS--TPRVIRVASNLKI--------RFQLVPNTEKGEVYPPLMSVSYSDILITDPATQTVAVSFSVEYEMDQNEARV---KTDIALGVLGGVAVVFSLLKTASWKRRISSPLIDVQTILKFLLIYAGDLASVFFVITVGTGLYWVIFYKAQQFVSVLLPLPVQEERFVTYVGCAFALKAVHFLHKLFEQLSVDVFFIDWERP-----------RGKSTKSVEVTG-------EGKTSAAPVSIWRTYFVANEWNEIQTIRKISPTFQIMAVLFFLEVVGFSSLALRDNSSELQRSAEAYTPAYSRILRYGIASTMWLCIGFIQLMFFSVFHERFVEDKIRQFVDLCSISNISVLLFSHQCYGYYIHGRSVHGHADTNMEEMNSNLKREAENLCGQRGLLPNSDIQTFEISITSRLRAQYDRILEPLSRRHGPSRLVDASANPFEQSTKAYHTMNRFLGSVIDHAHR-EMDYIVKDKLLFERLIGMEFIEPMDKSIFYNDDSYSFSDVLFYGNESTLLVFDTLFFCVVDIGSQSFVLASVLTYLQQMIFRVIRNVLGRRNLVTKTLVDRRFL 983          
BLAST of Meckelin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003947.1 (pep scaffold:Pmarinus_7.0:GL483273:9876:26016:-1 gene:ENSPMAG00000003616.1 transcript:ENSPMAT00000003947.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 265.774 bits (678), Expect = 1.857e-80
Identity = 153/412 (37.14%), Postives = 230/412 (55.83%), Query Frame = 3
Query: 1779 PDDDSFFVAYLISAFLLKMLEIVHIFVAQCTVDIFLIDWERPKHQLAPKKIFERSKFDTATDNTGDQNLIQQEKGSQNNGVSIWRTYFIANEWNEIQTYRKTSLIFNLIIVLLFMEVIGFKNITTFDCFVNYSPSSDAYSAPNYRMFRFAVIVSIFGITAFIQWLFTVLIYERVIEDKLRNYVDLCSVANISIIVLAHRQFGYYIHGRSVHGSADVSLSEMYGALQKENAGSCAKRGLESDSMQQTYIMALPNNFRINLDSVYRP-----GGNRLL-EDGRNMQ-----YLEVNKFLDRFINRTHDPRILFRFQDRKXXXXXXXXXXXXNSLEGRFYRDNGTSFGNVLFYGQELALVTFDILLFCVTDLILQNTVFDAFITWGLVTILKMIRNGCGAHNLANKTLVDRRFLI 2981
            P ++  F+ YL  AF LK ++ +H+   Q ++DIF  DWERPK +                         Q  + +   GVS+WRT+F+ANEWNE+QT RK S +  L  VLLF++V+GF+N+   D  V   P+ +A  A   R+ RF V  S++ +   +Q +F  +IYER +EDK+R +VDLCS++NISI++L +R FGYYIHGRSVHG AD ++ +M+  L+KE    C++RGL   +  QT+ +AL    R++ D + +P        R+    G  M+     Y  +N+FL  F++  H   + +  +D+   E +   EF++   +   Y D   SF NVL+YG E  L+  D+LLFC+ D+  Q+      IT+ +  + + IR      NL  KTLVD RFLI
Sbjct:    2 PSEERNFIIYLSCAFALKAVQFLHLIATQVSIDIFFFDWERPKGKAR-----------------------QGAEAASARGVSVWRTFFVANEWNELQTVRKLSPMLQLFAVLLFLKVVGFENLGLRDLGVTLLPAPNADEASWSRILRFGVASSVWLVVGAVQVIFNTIIYERFVEDKIRQFVDLCSMSNISILILENRCFGYYIHGRSVHGRADTNMEDMHANLKKEEENLCSQRGLVPGTELQTFEVALTQAARLHYDRILQPLAMMAAPPRMAGPQGGPMEQSMRAYQTMNRFLCSFVDHAHK-EVDYMIRDKLLLERLTGIEFQETFDKSFLYNDESHSFSNVLYYGHEATLLLLDMLLFCIIDMGTQDFTLATIITFVVQKLFRSIRESFSRRNLVKKTLVDERFLI 389          
BLAST of Meckelin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002958.1 (pep scaffold:Pmarinus_7.0:GL487132:14175:22754:1 gene:ENSPMAG00000002696.1 transcript:ENSPMAT00000002958.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 137.117 bits (344), Expect = 1.960e-35
Identity = 117/361 (32.41%), Postives = 182/361 (50.42%), Query Frame = 3
Query:  708 ESGCQNLANMCVMSVYNRQSAKSIDGTPCSLYAQVQPSGSYTSGKTAGY---PWLYYTIPQTLTQL-TVDHQYV---RGE-----TLQIVLATYDSAGQFLGIRNATKDSNLQLCDNSITKRKETFRFGTHYLESCSITISQLSNQTRY-LPLFYDPYLSYTDSIGASQLYPIPIKIGQVISDSGTTPNLLFDQAAWILTRRLLLVDNFGAITAPFQTNRTASYITFASSMRLVVVKQSSGSFDITKDGSIYAPYLEVNXXXXXXXXXXXXANISFEVVYYNVSSYTTAFYYSLSVAMGILCALAGLYAILRAFFWCRRSGISGFEGLVLLKTLAHACASISNVFFIVIFGISLYFLLLFK 1751
             + CQ L NMCVM  +    A  +    C+ +    PS     G    +   PW+YY      + L + D   V   RG       L++VL  YD  G+FLG ++A     LQLC  ++++    + FGT Y +SC  T+S+++ Q  +  P+FYDPYL +T   G   +Y +P+ +   +      PN   DQA W+L RR  LVD   A+T        ++ I +ASS+ + +   ++ +     + +IY P + V+ T  S +S  S   +SF VVY N+S           +A+G+L +LA  YA+++   W RR+G+   E   L+K       ++SNVFFIV FG  LY+L++FK
Sbjct:   23 RTACQVLGNMCVM--FMDVGALYVY---CANFFLTAPSLKQVHGIQTWFENRPWIYYMSDTAASVLASTDFPVVFSLRGSGCQESKLRLVLGMYDIRGKFLGYKSAA-GGLLQLCPGTLSRLDAAYTFGTAYAQSC--TLSRITLQELFPEPIFYDPYLQFTQG-GKEYMYALPV-LNSNLQRGDRAPNKQSDQAQWMLMRRFFLVD---ALT-------DSNTINYASSITISITMPTNNA-----NRTIYPPLITVDYTKFSKTSNDSL-KVSFSVVY-NMSQADAKL--QTEIALGVLGSLAVFYAMMQTTGWRRRAGLQMVEFSSLVKFFLILAGALSNVFFIVTFGTGLYWLIIFK 354          
BLAST of Meckelin vs. Ensembl Nematostella
Match: EDO36269 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJ35])

HSP 1 Score: 435.261 bits (1118), Expect = 9.833e-137
Identity = 315/999 (31.53%), Postives = 481/999 (48.15%), Query Frame = 3
Query:  177 CSSTTYFSSVDFKCVSCSVNAKQSSDGFSCVCKDGYYFTKNGGGSQVLCQKCP-----LNQIPSSNGWSCISCLNGV----TGTSCSSCDSPNVAYSSDVLGNQFNG-NCTACATNYRPVNN--QCQLC-SNILSTNGNSS-CSCA------LPTGNACLTKS--LSNSSILTYLG----QSVTSGFLQANLMDSVAMCQVSME-SGCQNLANMCVMSVYNRQ--SAKSIDGTPCSLYAQ-VQPSGSYTSGKT--------AGYPWLYYTIP-----QTLTQLTVDHQYVRGETLQIVLATYDSAGQFLGIRNATKDSNLQLCDNSITKRKETFRFGTHYLESCSITISQLSNQTRYLPLFYDPYLSYTDSIGASQLYPIPIKIGQVISDSGTTPNLLFDQAAWILTRRLLLVDNFGAITAPFQTNRTASYITFASSMRLVVVKQSSGSFDITKDGSIYAPYLEVN----XXXXXXXXXXXXANISFEVVYYNVSSYTTAFYYSLSVAMGILCALAGLYAILRAFFWCRRSGISGFEGLVLLKTLAHACASISNVFFIVIFGISLYFLLLFKNQNLFSILPP--DDDSFFVAYLISAFLLKMLEIVHIFVAQCTVDIFLIDWERPKHQLAPKKIFERSKFDTATDNTGDQNLIQQEKGSQNNGVSIWRTYFIANEWNEIQTYRKTSLIFNLIIVLLFMEVIGFKNITTFDCFVNYS--PSSDAYSAPNYRMFRFAVIVSIFGITAFIQWLFTVLIYERVIEDKLRNYVDLCSVANISIIVLAHRQFGYYIHGRSVHGSADVSLSEMYGALQKENAGSCAKRGLESDSMQQTYIMALPNNFRINLDSVYRPGGNRLLEDGRN-----------MQYLEVNKFLDRFINRTHDPRIL-FRFQDRKXXXXXXXXXXXXNSLE-GRFYRDNGTSFGNVLFYGQELALVTFDILLFCVTDLILQNTVFDAFITWGLVTILKMIRNGCGAHNLANKTLVDRRFLI 2981
            CSS  Y+     +CV C     QS D  SC C+ G+  TK+ GG  +LC+ C      +N+  S +GWSC+ C N V    T + C+ C     A    + G + +   C  C ++  PV+N   CQ C S+ L +N +S+ C C       L TG  CL  S  +  SS L  +     + + S F + NL  +VA+C+ +   + CQ L N+CV+  YN       S     C  +   V       +GKT           PWLYY          L +  +   +     L  +++     G F G+   T  S LQLC   ++K      F T Y  SCSI +  L  +  Y   FYD YL   D +    +Y +P+ + +    SG   N   DQ+ W L+RR  LV+N   I      +     I +A S+ + +  +SS       DG IY P++++          +    +S ++SF V Y   +            A+G L  LA ++A+++   W RR G    +   L+K L ++  + S ++F ++FG+SL +L+ FK Q++   L P    ++ F   LI AF  K+L++ H+  +Q ++DIF +DWERP+ ++            T  +  G       E   + + VSIWRT+F+ANEWNEIQT RK S    +   L F++V+GF+++ T D    ++  PS+  Y        RFAV+  ++ +   +QW +   I+ER   D L ++VDLC +AN+S+ ++ +  +GYYIHGRSVHG AD ++ EM   L++E    C KRGLE ++  QT+ + LP  FR   D V  P   R  +  R              Y  +N+FL  FI+  H  R L +  QD+   E I D E  +  L+    + D+G SF  VLFYG E  L+ F++L F   D    + +    +T+ ++T+L  IR+  G  NLA KT+VD RFLI
Sbjct:   32 CSSNQYYQFSSLRCVDCGSGQTQSDDKLSCNCRPGFKKTKSDGGPNLLCESCSTGSGGVNRTASLDGWSCVLCPNDVGFDVTNSKCNDCPIGTTAVDRLIDGTKLSQRQCLKCVSDTSPVSNGGDCQRCHSSYLVSNASSTVCDCPSSENQYLQTGGVCLATSSVIKASSELYTVNYDDVKKINSFFFEDNLRAAVALCKQNQNFTSCQLLGNLCVLLDYNLDLYDGSSSTTDACKEFLDIVDIRTEKVTGKTIRTIFDWPVDMPWLYYKTGIQDAVDVLNRRDITQAFSANGPLTFIISRTTLNGSFAGL--LTDTSELQLCQERLSKMASANSFATTYKSSCSIPVKFLMQKPMY---FYDVYLKVQDPL----MYAVPVLV-ENYKKSGVAVNANSDQSRWQLSRRFFLVEN---IIGRNTGSNKVEVIRYAESIEMSIRLRSS-------DGEIYPPFIKIKYNSVEVKDEAIVEKTSKDVSFSVTY---TMDLETIDRDTKTAIGCLSGLAAIFALVKVASWRRRHGSEAIDCSTLIKLLMYSFGTFSTMYFWILFGLSLQWLIFFKQQSVVYRLLPMGSQENLFRDLLIVAFTFKLLDLFHVIWSQISIDIFFMDWERPRGRI------------TQPNQAG-------ESAGEESPVSIWRTFFVANEWNEIQTMRKISPELQIFATLFFLKVVGFEHLATTDPISRFTVNPST-GYIGEYSATLRFAVLTMVYLVIEGVQWFYFAFIHERFFGDSLGDFVDLCCMANVSVFIMENTLYGYYIHGRSVHGRADTNMKEMNEQLKREEEDLCGKRGLEPNTENQTFEVGLPQKFRQQYDKVVEPLTARGQQAQRRNVPSGGVERSINAYAAMNRFLCGFID--HSLRDLDYLIQDKLLLERIIDMEVREQPLDKAVLFNDDGRSFNCVLFYGNEWTLLLFELLFFAFCDYFATDFILAGVLTYIVITVLAKIRDIFGRRNLAKKTMVDERFLI 985          
BLAST of Meckelin vs. Ensembl Medaka
Match: tmem67 (transmembrane protein 67 [Source:NCBI gene;Acc:101168892])

HSP 1 Score: 453.366 bits (1165), Expect = 3.876e-143
Identity = 320/989 (32.36%), Postives = 477/989 (48.23%), Query Frame = 3
Query:  174 ACSSTTYFSSVDFKCVSCSVNAKQSSDGFSCVCKDGYYFTKNGGGSQV--LCQKCPLNQIP-SSNGWSCISCLNGVTGTSCSSCDSPNVAYSSDVLGNQFN-GNCTAC---ATNYRPVNNQCQLCSNILSTNGNSSCSCALP---TGNACL-----TKSLSNSSILTYLGQSVTSGFLQANLMDSVAMCQV-SMESGCQNLANMCVMSVYNRQSAKSIDGTPCSLYAQVQPSGSYTSGKT------AGYPWLYYTIPQTLTQLTVDHQYV----------RGETLQIVLATYDSAGQFLGIRNATKDSNLQLCDNSITKRKETFRFGTHYLESCSITISQLSNQTRYLPLFYDPYLSYTDSIGASQLYPIPIKI------GQVISDSGTTPNLLFDQAAWILTRRLLLVDNFGAITAPFQTNRTASYITFASSMRLVVVKQSSGSFDITKDGSIYAPYLEVNXXXXXXXXXXXXA-NISFEVVYYNVSSYTTAFYYSLSVAMGILCALAGLYAILRAFFWCRRSGISGFEGLVLLKTLAHACASISNVFFIVIFGISLYFLLLFKNQNLFSIL-P-PDDDSFFVAYLISAFLLKMLEIVHIFVAQCTVDIFLIDWERPKHQLAPKKIFERSKFDTATDNTGDQNLIQQEKGSQNNGVSIWRTYFIANEWNEIQTYRKTSLIFNLIIVLLFMEVIGFKNITTFDCFVNYSPSSDAYSAPNYRMFRFAVIVSIFGITAFIQWLFTVLIYERVIEDKLRNYVDLCSVANISIIVLAHRQFGYYIHGRSVHGSADVSLSEMYGALQKENAGSCAKRGLESDSMQQTYIMALPNNFRINLDSV-----YRPGGNRLLE-DGRNMQYLE------VNKFLDRFINRTHDPRILFRFQDRKXXXXXXXXXXXXNSLEGRFYRDNGTSFGNVLFYGQELALVTFDILLFCVTDLILQNTVFDAFITWGLVTILKMIRNGCGAHNLANKTLVDRRFLI 2981
             C    +F      C  C  N ++SS G SC+C+ GY  TK+   ++V   C++CP ++   + +G+ CI C   +       C S N+    D+ G  F+  +C AC   +  +   N+    C    +T  N+ C+C  P    G  C      + +++ S     L  S+ S +   NL  S A C V S  + CQ L NMCVM   N  S   +    C L+  +  S +  S         A  PWLYY     L    + ++ V          +   +Q++ A Y+  G FL   +    +NLQLC     K+   F FGT Y E+C +++++L   T   PLFYD ++         +L P+P  +      GQ I + G+  N       W L+RR+ LVD          +      +  +  +R  +V +       T++G IY P + V+ T V      S    ++F V Y    S           A+G+L  LA LY+IL+   W RR      +   +LK L      ++NVFF V  G  LY+L+ +K Q   S+L P P  +  F  Y+  AF LK ++ ++  + Q TVD+FLIDWERP           RSK       T       +E   + + VSIWRTYF+ANEWNE+QT RK S  F ++ VL F+EV+GF N+   D +     S  AY+ P   + R+ +  +++     +Q +F  + YE  +EDK+R +VDLCSV+NIS+++ +HR FGYYIHGRSVHG AD ++ EM   L++E    C +RGL S++  QT+ ++  N  R+  D +      R   +RL++    N+  L+      +N FL   I+  H P + +  +D+   E +   EF +   +  FY D   SF +VLFYG E  L+ FD L FCV DL  QN V  A +T+    + + IRN  G  NL NKTLVD+RFLI
Sbjct:   41 GCGVNEFFDISSLSCAKCGANQRKSSSGLSCICQTGYK-TKHFSSNKVPFTCEQCPPDKPAVTKDGFGCIRCPGRLDDNGNCQCPSGNILVERDINGTFFDEASCEACIGDSPAFTAPNSNGDRCERCQATFSNTFCTCQSPNVQAGGLCFPPGSFSTNVNPSVSYAQLAFSIQSAWFVENLYSSAAACLVFSNLTACQALGNMCVM---NMHSFTGLSTDACGLFNTISRSKAALSSVQDISYWRANLPWLYYGDEPGLAGQVLQNKPVPLSFSFRGTKKNTDIQLLAAVYNVRGDFLRW-DPIGGNNLQLCPEQAFKQAAAFSFGTTYQETCELSVAELLT-THPEPLFYDVFMDLGGG-DNRKLLPLPTLVQNQQYNGQFI-NQGSMQN-------WYLSRRIFLVDTLSGREKTLSSLPKVIRVATSIKIRFQLVPR-------TQEGQIYPPLVSVSYTDVLIKEANSQTLPVTFSVEYEMDQSEART---KTDTALGVLGGLAALYSILKTVSWKRRIASPLIDMETMLKFLLFYAGDLANVFFAVTVGTGLYWLIFYKAQQFVSVLLPLPAQEEQFETYIGCAFALKAVQFLNKLILQVTVDVFLIDWERP-----------RSKASRTVPAT-------KETKQEPSPVSIWRTYFVANEWNELQTVRKISPTFQIMAVLFFLEVLGFSNLALRDPWSTLERSPAAYTPPYSLILRYGLAATLWICIGLLQVIFFTVFYEHFVEDKIRQFVDLCSVSNISVLLFSHRCFGYYIHGRSVHGHADTNMEEMNNNLKRERESLCGQRGLLSNTDIQTFQVSFTNRLRLQYDRIQDSLSRRNRPSRLIDASAANLSELQFKAYNTMNHFLASVIDHAH-PEMDYIVKDKLTLERVIGMEFLEPIDKSIFYNDERHSFSDVLFYGNEATLLIFDTLFFCVVDLGSQNFVLAAVLTYLQQAMFRFIRNTLGRRNLVNKTLVDQRFLI 985          
BLAST of Meckelin vs. Ensembl Medaka
Match: tmem67 (transmembrane protein 67 [Source:NCBI gene;Acc:101168892])

HSP 1 Score: 444.121 bits (1141), Expect = 5.749e-140
Identity = 314/978 (32.11%), Postives = 462/978 (47.24%), Query Frame = 3
Query:  174 ACSSTTYFSSVDFKCVSCSVNAKQSSDGFSCVCKDGYYFTKNGGGSQV--LCQKCPLNQIP-SSNGWSCISCLNGVTGTSCSSCDSPNVAYSSDVLGNQFN-GNCTAC---ATNYRPVNNQCQLCSNILSTNGNSSCSCALP---TGNACL-----TKSLSNSSILTYLGQSVTSGFLQANLMDSVAMCQV-SMESGCQNLANMCVMSVYNRQSAKSIDGTPCSLYAQVQPSGSYTSGKT------AGYPWLYYTIPQTLTQLTVDHQYV----------RGETLQIVLATYDSAGQFLGIRNATKDSNLQLCDNSITKRKETFRFGTHYLESCSITISQLSNQTRYLPLFYDPYLSYTDSIGASQLYPIPIKI------GQVISDSGTTPNLLFDQAAWILTRRLLLVDNFGAITAPFQTNRTASYITFASSMRLVVVKQSSGSFDITKDGSIYAPYLEVNXXXXXXXXXXXXA-NISFEVVYYNVSSYTTAFYYSLSVAMGILCALAGLYAILRAFFWCRRSGISGFEGLVLLKTLAHACASISNVFFIVIFGISLYFLLLFKNQNLFSIL-P-PDDDSFFVAYLISAFLLKMLEIVHIFVAQCTVDIFLIDWERPKHQLAPKKIFERSKFDTATDNTGDQNLIQQEKGSQNNGVSIWRTYFIANEWNEIQTYRKTSLIFNLIIVLLFMEVIGFKNITTFDCFVNYSPSSDAYSAPNYRMFRFAVIVSIFGITAFIQWLFTVLIYERVIEDKLRNYVDLCSVANISIIVLAHRQFGYYIHGRSVHGSADVSLSEMYGALQKENAGSCAKRGLESDSMQQTYIMALPNNFRINLDSVYRPGGNRLLEDGRNMQYLEVNKF-LDRFINRTHDPRILFRFQDRKXXXXXXXXXXXXNSLEGRFYRDNGTSFGNVLFYGQELALVTFDILLFCVTDLILQNTVFDAFITWGLVTILKMIRNGCGAHNLANKTLVDRRFLI 2981
             C    +F      C  C  N ++SS G SC+C+ GY  TK+   ++V   C++CP ++   + +G+ CI C   +       C S N+    D+ G  F+  +C AC   +  +   N+    C    +T  N+ C+C  P    G  C      + +++ S     L  S+ S +   NL  S A C V S  + CQ L NMCVM   N  S   +    C L+  +  S +  S         A  PWLYY     L    + ++ V          +   +Q++ A Y+  G FL   +    +NLQLC     K+   F FGT Y E+C +++++L   T   PLFYD ++         +L P+P  +      GQ I + G+  N       W L+RR+ LVD          +      +  +  +R  +V +       T++G IY P + V+ T V      S    ++F V Y    S           A+G+L  LA LY+IL+   W RR      +   +LK L      ++NVFF V  G  LY+L+ +K Q   S+L P P  +  F  Y+  AF LK ++ ++  + Q TVD+FLIDWERP           RSK       T       +E   + + VSIWRTYF+ANEWNE+QT RK S  F ++ VL F+EV+GF N+   D +     S  AY+ P   + R+ +  +++     +Q +F  + YE  +EDK+R +VDLCSV+NIS+++ +HR FGYYIHGRSVHG AD ++ EM   L++E    C +RGL S++  QT+ ++  N  R+  D +     + L      M Y+  +K  L+R I       I     D+                   FY D   SF +VLFYG E  L+ FD L FCV DL  QN V  A +T+    + + IRN  G  NL NKTLVD+RFLI
Sbjct:   41 GCGVNEFFDISSLSCAKCGANQRKSSSGLSCICQTGYK-TKHFSSNKVPFTCEQCPPDKPAVTKDGFGCIRCPGRLDDNGNCQCPSGNILVERDINGTFFDEASCEACIGDSPAFTAPNSNGDRCERCQATFSNTFCTCQSPNVQAGGLCFPPGSFSTNVNPSVSYAQLAFSIQSAWFVENLYSSAAACLVFSNLTACQALGNMCVM---NMHSFTGLSTDACGLFNTISRSKAALSSVQDISYWRANLPWLYYGDEPGLAGQVLQNKPVPLSFSFRGTKKNTDIQLLAAVYNVRGDFLRW-DPIGGNNLQLCPEQAFKQAAAFSFGTTYQETCELSVAELLT-THPEPLFYDVFMDLGGG-DNRKLLPLPTLVQNQQYNGQFI-NQGSMQN-------WYLSRRIFLVDTLSGREKTLSSLPKVIRVATSIKIRFQLVPR-------TQEGQIYPPLVSVSYTDVLIKEANSQTLPVTFSVEYEMDQSEART---KTDTALGVLGGLAALYSILKTVSWKRRIASPLIDMETMLKFLLFYAGDLANVFFAVTVGTGLYWLIFYKAQQFVSVLLPLPAQEEQFETYIGCAFALKAVQFLNKLILQVTVDVFLIDWERP-----------RSKASRTVPAT-------KETKQEPSPVSIWRTYFVANEWNELQTVRKISPTFQIMAVLFFLEVLGFSNLALRDPWSTLERSPAAYTPPYSLILRYGLAATLWICIGLLQVIFFTVFYEHFVEDKIRQFVDLCSVSNISVLLFSHRCFGYYIHGRSVHGHADTNMEEMNNNLKRERESLCGQRGLLSNTDIQTFQVSFTNRLRLQYDRIQ----DSLSRAHPEMDYIVKDKLTLERVIGMEFLEPI-----DKSI-----------------FYNDERHSFSDVLFYGNEATLLIFDTLFFCVVDLGSQNFVLAAVLTYLQQAMFRFIRNTLGRRNLVNKTLVDQRFLI 949          
BLAST of Meckelin vs. Ensembl Medaka
Match: tmem67 (transmembrane protein 67 [Source:NCBI gene;Acc:101168892])

HSP 1 Score: 416.387 bits (1069), Expect = 1.490e-129
Identity = 307/988 (31.07%), Postives = 461/988 (46.66%), Query Frame = 3
Query:  174 ACSSTTYFSSVDFKCVSCSVNAKQSSDGFSCVCKDGYYFTKNGGGSQV--LCQKCPLNQIP-SSNGWSCISCLNGVTGTSCSSCDSPNVAYSSDVLGNQFN-GNCTAC---ATNYRPVNNQCQLCSNILSTNGNSSCSCALP---TGNACL-----TKSLSNSSILTYLGQSVTSGFLQANLMDSVAMCQV-SMESGCQNLANMCVMSVYNRQSAKSIDGTPCSLYAQVQPSGSYTSGKT------AGYPWLYYTIPQTLTQLTVDHQYV----------RGETLQIVLATYDSAGQFLGIRNATKDSNLQLCDNSITKRKETFRFGTHYLESCSITISQLSNQTRYLPLFYDPYLSYTDSIGASQLYPIPIKI------GQVISDSGTTPNLLFDQAAWILTRRLLLVDNFGAITAPFQTNRTASYITFASSMRLVVVKQSSGSFDITKDGSIYAPYLEVNXXXXXXXXXXXXA-NISFEVVYYNVSSYTTAFYYSLSVAMGILCALAGLYAILRAFFWCRRSGISGFEGLVLLKTLAHACASISNVFFIVIFGISLYFLLLFKNQNLFSILP-PDDDSFFVAYLISAFLLKMLEIVHIFVAQCTVDIFLIDWERPKHQLAPKKIFERSKFDTATDNTGDQNLIQQEKGSQNNGVSIWRTYFIANEWNEIQTYRKTSLIFNLIIVLLFMEVIGFKNITTFDCFVNYSPSSDAYSAPNYRMFRFAVIVSIFGITAFIQWLFTVLIYERVIEDKLRNYVDLCSVANISIIVLAHRQFGYYIHGRSVHGSADVSLSEMYGALQKENAGSCAKRGLESDSMQQTYIMALPNNFRINLDSV-----YRPGGNRLLE-DGRNMQYLE------VNKFLDRFINRTHDPRILFRFQDRKXXXXXXXXXXXXNSLEGRFYRDNGTSFGNVLFYGQELALVTFDILLFCVTDLILQNTVFDAFITWGLVTILKMIRNGCGAHNLANKTLVDRRFLI 2981
             C    +F      C  C  N ++SS G SC+C+ GY  TK+   ++V   C++CP ++   + +G+ CI C   +       C S N+    D+ G  F+  +C AC   +  +   N+    C    +T  N+ C+C  P    G  C      + +++ S     L  S+ S +   NL  S A C V S  + CQ L NMCVM   N  S   +    C L+  +  S +  S         A  PWLYY     L    + ++ V          +   +Q++ A Y+  G FL   +    +NLQLC     K+   F FGT Y E+C +++++L   T   PLFYD ++         +L P+P  +      GQ I + G+  N       W L+RR+ LVD          +      +  +  +R  +V +       T++G IY P + V+ T V      S    ++F V Y    S           A+G+L  LA LY+IL+   W RR              +A     +    F+ +                  +LP P  +  F  Y+  AF LK ++ ++  + Q TVD+FLIDWERP           RSK       T       +E   + + VSIWRTYF+ANEWNE+QT RK S  F ++ VL F+EV+GF N+   D +     S  AY+ P   + R+ +  +++     +Q +F  + YE  +EDK+R +VDLCSV+NIS+++ +HR FGYYIHGRSVHG AD ++ EM   L++E    C +RGL S++  QT+ ++  N  R+  D +      R   +RL++    N+  L+      +N FL   I+  H P + +  +D+   E +   EF +   +  FY D   SF +VLFYG E  L+ FD L FCV DL  QN V  A +T+    + + IRN  G  NL NKTLVD+RFLI
Sbjct:   41 GCGVNEFFDISSLSCAKCGANQRKSSSGLSCICQTGYK-TKHFSSNKVPFTCEQCPPDKPAVTKDGFGCIRCPGRLDDNGNCQCPSGNILVERDINGTFFDEASCEACIGDSPAFTAPNSNGDRCERCQATFSNTFCTCQSPNVQAGGLCFPPGSFSTNVNPSVSYAQLAFSIQSAWFVENLYSSAAACLVFSNLTACQALGNMCVM---NMHSFTGLSTDACGLFNTISRSKAALSSVQDISYWRANLPWLYYGDEPGLAGQVLQNKPVPLSFSFRGTKKNTDIQLLAAVYNVRGDFLRW-DPIGGNNLQLCPEQAFKQAAAFSFGTTYQETCELSVAELLT-THPEPLFYDVFMDLGGG-DNRKLLPLPTLVQNQQYNGQFI-NQGSMQN-------WYLSRRIFLVDTLSGREKTLSSLPKVIRVATSIKIRFQLVPR-------TQEGQIYPPLVSVSYTDVLIKEANSQTLPVTFSVEYEMDQSEART---KTDTALGVLGGLAALYSILKTVSWKRR--------------IASPLIDMEAQQFVSV------------------LLPLPAQEEQFETYIGCAFALKAVQFLNKLILQVTVDVFLIDWERP-----------RSKASRTVPAT-------KETKQEPSPVSIWRTYFVANEWNELQTVRKISPTFQIMAVLFFLEVLGFSNLALRDPWSTLERSPAAYTPPYSLILRYGLAATLWICIGLLQVIFFTVFYEHFVEDKIRQFVDLCSVSNISVLLFSHRCFGYYIHGRSVHGHADTNMEEMNNNLKRERESLCGQRGLLSNTDIQTFQVSFTNRLRLQYDRIQDSLSRRNRPSRLIDASAANLSELQFKAYNTMNHFLASVIDHAH-PEMDYIVKDKLTLERVIGMEFLEPIDKSIFYNDERHSFSDVLFYGNEATLLIFDTLFFCVVDLGSQNFVLAAVLTYLQQAMFRFIRNTLGRRNLVNKTLVDQRFLI 952          
BLAST of Meckelin vs. Planmine SMEST
Match: SMESG000043913.1 (SMESG000043913.1)

HSP 1 Score: 1890.55 bits (4896), Expect = 0.000e+0
Identity = 946/947 (99.89%), Postives = 946/947 (99.89%), Query Frame = 3
Query:  141 KCQTNIANVLGACSSTTYFSSVDFKCVSCSVNAKQSSDGFSCVCKDGYYFTKNGGGSQVLCQKCPLNQIPSSNGWSCISCLNGVTGTSCSSCDSPNVAYSSDVLGNQFNGNCTACATNYRPVNNQCQLCSNILSTNGNSSCSCALPTGNACLTKSLSNSSILTYLGQSVTSGFLQANLMDSVAMCQVSMESGCQNLANMCVMSVYNRQSAKSIDGTPCSLYAQVQPSGSYTSGKTAGYPWLYYTIPQTLTQLTVDHQYVRGETLQIVLATYDSAGQFLGIRNATKDSNLQLCDNSITKRKETFRFGTHYLESCSITISQLSNQTRYLPLFYDPYLSYTDSIGASQLYPIPIKIGQVISDSGTTPNLLFDQAAWILTRRLLLVDNFGAITAPFQTNRTASYITFASSMRLVVVKQSSGSFDITKDGSIYAPYLEVNXXXXXXXXXXXXANISFEVVYYNVSSYTTAFYYSLSVAMGILCALAGLYAILRAFFWCRRSGISGFEGLVLLKTLAHACASISNVFFIVIFGISLYFLLLFKNQNLFSILPPDDDSFFVAYLISAFLLKMLEIVHIFVAQCTVDIFLIDWERPKHQLAPKKIFERSKFDTATDNTGDQNLIQQEKGSQNNGVSIWRTYFIANEWNEIQTYRKTSLIFNLIIVLLFMEVIGFKNITTFDCFVNYSPSSDAYSAPNYRMFRFAVIVSIFGITAFIQWLFTVLIYERVIEDKLRNYVDLCSVANISIIVLAHRQFGYYIHGRSVHGSADVSLSEMYGALQKENAGSCAKRGLESDSMQQTYIMALPNNFRINLDSVYRPGGNRLLEDGRNMQYLEVNKFLDRFINRTHDPRILFRFQDRKXXXXXXXXXXXXNSLEGRFYRDNGTSFGNVLFYGQELALVTFDILLFCVTDLILQNTVFDAFITWGLVTILKMIRNGCGAHNLANKTLVDRRFLI 2981
            KCQTNIANVLGACSSTTYFSSVDFKCVSCSVNAKQSSDGFSCVCKDGYYFTKNGGGSQVLCQKCPLNQIPSSNGWSCISCLNGVTGTSCSSCDSPNVAYSSDVLGNQFNGNCTACATNYRPVNNQCQLCSNILSTNGNSSCSCALPTGNACLTKSLSNSSILTYLGQSVTSGFLQANLMDSVAMCQVSMESGCQNLANMCVMSVYNRQSAKSIDGTPCSLYAQVQPSGSYTSGKTAGYPWLYYTIPQTLTQLTVDHQYVRGETLQIVLATYDSAGQFLGIRNATKDSNLQLCDNSITKRKETFRFGTHYLESCSITISQLSNQTRYLPLFYDPYLSYTDS GASQLYPIPIKIGQVISDSGTTPNLLFDQAAWILTRRLLLVDNFGAITAPFQTNRTASYITFASSMRLVVVKQSSGSFDITKDGSIYAPYLEVNLTTVSSSSLTSSANISFEVVYYNVSSYTTAFYYSLSVAMGILCALAGLYAILRAFFWCRRSGISGFEGLVLLKTLAHACASISNVFFIVIFGISLYFLLLFKNQNLFSILPPDDDSFFVAYLISAFLLKMLEIVHIFVAQCTVDIFLIDWERPKHQLAPKKIFERSKFDTATDNTGDQNLIQQEKGSQNNGVSIWRTYFIANEWNEIQTYRKTSLIFNLIIVLLFMEVIGFKNITTFDCFVNYSPSSDAYSAPNYRMFRFAVIVSIFGITAFIQWLFTVLIYERVIEDKLRNYVDLCSVANISIIVLAHRQFGYYIHGRSVHGSADVSLSEMYGALQKENAGSCAKRGLESDSMQQTYIMALPNNFRINLDSVYRPGGNRLLEDGRNMQYLEVNKFLDRFINRTHDPRILFRFQDRKFFEDIFDGEFEDNSLEGRFYRDNGTSFGNVLFYGQELALVTFDILLFCVTDLILQNTVFDAFITWGLVTILKMIRNGCGAHNLANKTLVDRRFLI
Sbjct:   16 KCQTNIANVLGACSSTTYFSSVDFKCVSCSVNAKQSSDGFSCVCKDGYYFTKNGGGSQVLCQKCPLNQIPSSNGWSCISCLNGVTGTSCSSCDSPNVAYSSDVLGNQFNGNCTACATNYRPVNNQCQLCSNILSTNGNSSCSCALPTGNACLTKSLSNSSILTYLGQSVTSGFLQANLMDSVAMCQVSMESGCQNLANMCVMSVYNRQSAKSIDGTPCSLYAQVQPSGSYTSGKTAGYPWLYYTIPQTLTQLTVDHQYVRGETLQIVLATYDSAGQFLGIRNATKDSNLQLCDNSITKRKETFRFGTHYLESCSITISQLSNQTRYLPLFYDPYLSYTDSTGASQLYPIPIKIGQVISDSGTTPNLLFDQAAWILTRRLLLVDNFGAITAPFQTNRTASYITFASSMRLVVVKQSSGSFDITKDGSIYAPYLEVNLTTVSSSSLTSSANISFEVVYYNVSSYTTAFYYSLSVAMGILCALAGLYAILRAFFWCRRSGISGFEGLVLLKTLAHACASISNVFFIVIFGISLYFLLLFKNQNLFSILPPDDDSFFVAYLISAFLLKMLEIVHIFVAQCTVDIFLIDWERPKHQLAPKKIFERSKFDTATDNTGDQNLIQQEKGSQNNGVSIWRTYFIANEWNEIQTYRKTSLIFNLIIVLLFMEVIGFKNITTFDCFVNYSPSSDAYSAPNYRMFRFAVIVSIFGITAFIQWLFTVLIYERVIEDKLRNYVDLCSVANISIIVLAHRQFGYYIHGRSVHGSADVSLSEMYGALQKENAGSCAKRGLESDSMQQTYIMALPNNFRINLDSVYRPGGNRLLEDGRNMQYLEVNKFLDRFINRTHDPRILFRFQDRKFFEDIFDGEFEDNSLEGRFYRDNGTSFGNVLFYGQELALVTFDILLFCVTDLILQNTVFDAFITWGLVTILKMIRNGCGAHNLANKTLVDRRFLI 962          
The following BLAST results are available for this feature:
BLAST of Meckelin vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TMEM671.174e-15333.77transmembrane protein 67 [Source:HGNC Symbol;Acc:H... [more]
TMEM672.794e-15333.77transmembrane protein 67 [Source:HGNC Symbol;Acc:H... [more]
TMEM671.626e-13034.06transmembrane protein 67 [Source:HGNC Symbol;Acc:H... [more]
TMEM671.406e-2327.20transmembrane protein 67 [Source:HGNC Symbol;Acc:H... [more]
TMEM671.706e-1134.04transmembrane protein 67 [Source:HGNC Symbol;Acc:H... [more]
back to top
BLAST of Meckelin vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
mks-37.359e-9427.92MecKel-Gruber Syndrome (MKS) homolog [Source:UniP... [more]
back to top
BLAST of Meckelin vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
CG159234.939e-3126.39gene:FBgn0038814 transcript:FBtr0113254[more]
CG159235.661e-3126.39gene:FBgn0038814 transcript:FBtr0330028[more]
back to top
BLAST of Meckelin vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
tmem671.029e-14932.86transmembrane protein 67 [Source:ZFIN;Acc:ZDB-GENE... [more]
back to top
BLAST of Meckelin vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 4
Match NameE-valueIdentityDescription
sfxn52.478e-14332.67sideroflexin 5 [Source:Xenbase;Acc:XB-GENE-988100][more]
sfxn52.592e-13832.86sideroflexin 5 [Source:Xenbase;Acc:XB-GENE-988100][more]
sfxn51.571e-11132.12sideroflexin 5 [Source:Xenbase;Acc:XB-GENE-988100][more]
ENSXETT00000046533.11.371e-5941.19meckelin-like [Source:NCBI gene;Acc:100485117][more]
back to top
BLAST of Meckelin vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Tmem671.842e-15834.21transmembrane protein 67 [Source:MGI Symbol;Acc:MG... [more]
Tmem671.064e-15734.21transmembrane protein 67 [Source:MGI Symbol;Acc:MG... [more]
Tmem671.706e-1230.28transmembrane protein 67 [Source:MGI Symbol;Acc:MG... [more]
back to top
BLAST of Meckelin vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 3
Match NameE-valueIdentityDescription
sp|Q8BR76|MKS3_MOUSE8.868e-15834.21Meckelin OS=Mus musculus OX=10090 GN=Tmem67 PE=1 S... [more]
sp|P0C152|MKS3_RAT1.642e-15534.55Meckelin OS=Rattus norvegicus OX=10116 GN=Tmem67 P... [more]
sp|Q5HYA8|MKS3_HUMAN1.342e-15233.77Meckelin OS=Homo sapiens OX=9606 GN=TMEM67 PE=1 SV... [more]
back to top
BLAST of Meckelin vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3Q0KQZ30.000e+034.32Uncharacterized protein OS=Schistosoma mansoni OX=... [more]
A0A1I8I7040.000e+034.98Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267G4Y30.000e+035.07Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
A0A267H6380.000e+034.98Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
A0A267H6620.000e+034.98Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
back to top
BLAST of Meckelin vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
tmem679.991e-13530.83transmembrane protein 67 [Source:NCBI gene;Acc:103... [more]
back to top
BLAST of Meckelin vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSPMAT00000003947.11.857e-8037.14pep scaffold:Pmarinus_7.0:GL483273:9876:26016:-1 g... [more]
ENSPMAT00000002958.11.960e-3532.41pep scaffold:Pmarinus_7.0:GL487132:14175:22754:1 g... [more]
back to top
BLAST of Meckelin vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Meckelin vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO362699.833e-13731.53Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Meckelin vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
tmem673.876e-14332.36transmembrane protein 67 [Source:NCBI gene;Acc:101... [more]
tmem675.749e-14032.11transmembrane protein 67 [Source:NCBI gene;Acc:101... [more]
tmem671.490e-12931.07transmembrane protein 67 [Source:NCBI gene;Acc:101... [more]
back to top
BLAST of Meckelin vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000043913.10.000e+099.89SMESG000043913.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30008957 ID=SMED30008957|Name=Meckelin|organism=Schmidtea mediterranea sexual|type=transcript|length=2997bp
TGTTAAGTGTAATTAATAACAACAATCGTTGTTTAAATTTAATTTCATAT
AAAAGTTTTATGAAATATACATTTATTTAAGCACTTATAAACTTAATGAT
TCACTTTATATTTCTTATTTTGAATTTAAGTATTTTCATAAAATGTCAAA
CTAATATTGCCAATGTCTTGGGAGCTTGCTCTTCAACCACTTATTTTTCA
TCAGTAGATTTCAAATGTGTTTCATGCAGTGTAAATGCAAAGCAAAGTTC
TGATGGTTTTTCCTGCGTCTGTAAAGATGGATATTATTTTACAAAAAATG
GCGGTGGATCTCAAGTGCTTTGTCAGAAATGCCCATTAAATCAAATTCCA
TCTTCTAATGGCTGGTCTTGTATAAGTTGCTTAAACGGAGTGACTGGTAC
GTCATGCTCCTCATGTGACAGTCCGAATGTTGCTTATAGCAGTGATGTGC
TTGGTAATCAATTTAATGGAAATTGTACTGCATGTGCAACTAATTATCGC
CCAGTAAATAATCAATGTCAATTGTGCTCAAATATCCTCAGCACCAATGG
CAATTCTAGCTGCAGTTGCGCACTCCCAACTGGCAATGCTTGCTTGACAA
AAAGCTTATCAAATTCATCAATTTTAACTTATTTGGGACAATCTGTGACA
TCAGGATTCTTGCAAGCTAATTTGATGGATAGTGTTGCAATGTGCCAAGT
CTCAATGGAATCCGGGTGTCAGAACCTGGCAAATATGTGTGTCATGTCTG
TGTATAACAGGCAGTCTGCTAAAAGTATTGATGGAACCCCGTGTTCATTA
TATGCTCAAGTACAGCCCAGTGGATCATACACCTCTGGCAAGACAGCTGG
TTATCCATGGCTTTATTATACAATACCGCAGACTCTTACTCAATTGACCG
TTGACCATCAATATGTCAGAGGAGAAACGCTTCAAATAGTCCTTGCTACT
TATGACAGTGCTGGTCAGTTCTTAGGAATCCGCAACGCTACTAAAGACTC
AAACCTCCAATTATGCGATAATTCTATCACGAAAAGGAAAGAAACGTTTC
GATTTGGCACTCATTATCTTGAATCTTGTTCAATTACAATTTCCCAATTG
TCCAACCAAACTCGTTATCTTCCTCTATTCTATGATCCCTATCTCAGCTA
CACTGATTCTATTGGAGCATCACAACTCTATCCGATCCCAATCAAAATAG
GGCAAGTCATAAGTGACAGCGGCACTACTCCAAACCTACTTTTTGACCAA
GCCGCTTGGATTCTGACTAGGAGATTGCTCTTGGTGGACAATTTCGGAGC
GATTACAGCTCCGTTCCAGACAAATAGAACTGCCAGCTATATAACATTTG
CCAGTTCAATGAGATTGGTAGTGGTTAAGCAATCCTCCGGCAGTTTCGAC
ATAACAAAAGATGGATCTATTTACGCTCCATATTTGGAAGTGAACCTAAC
AACGGTTTCATCGTCGAGTTTAACGAGCTCAGCCAATATCTCATTCGAAG
TTGTATACTATAACGTTTCGAGTTACACAACGGCATTCTATTACAGTCTA
AGTGTTGCTATGGGAATTTTATGCGCCCTTGCTGGCCTCTATGCTATTTT
GCGGGCCTTTTTCTGGTGTCGCCGATCAGGAATATCGGGATTCGAGGGCT
TGGTGTTGCTGAAAACTCTCGCACATGCTTGTGCATCGATTTCCAATGTT
TTCTTCATCGTCATATTCGGAATCAGTCTCTATTTCCTTCTATTATTCAA
GAATCAAAACCTTTTCAGCATCCTTCCACCGGATGATGATAGTTTTTTCG
TGGCTTACCTCATCTCTGCTTTCCTACTAAAAATGCTGGAAATTGTTCAC
ATTTTTGTTGCCCAATGCACCGTTGATATCTTTCTGATCGATTGGGAACG
CCCGAAGCATCAGTTAGCACCAAAGAAAATATTCGAGAGATCGAAATTCG
ATACTGCAACAGACAACACGGGAGATCAGAATCTCATTCAGCAGGAGAAA
GGGTCACAAAACAATGGCGTATCAATCTGGCGGACATATTTTATCGCCAA
CGAATGGAATGAAATTCAAACTTATCGCAAAACGTCCTTGATATTCAATC
TGATCATTGTGCTGTTATTCATGGAAGTCATTGGATTCAAAAATATCACA
ACATTTGATTGCTTCGTCAATTACTCGCCTTCATCCGATGCCTATAGCGC
TCCTAATTATAGGATGTTTCGATTCGCGGTCATTGTATCAATCTTTGGCA
TTACAGCTTTCATTCAATGGTTATTCACGGTGCTGATTTACGAAAGAGTA
ATAGAGGACAAATTGCGAAACTATGTTGATTTATGTTCCGTTGCTAACAT
ATCCATTATTGTCCTGGCCCACAGACAATTTGGGTATTATATACATGGGC
GTAGCGTGCATGGTTCCGCAGATGTATCGCTTTCTGAAATGTATGGTGCA
CTACAGAAAGAAAATGCTGGCAGTTGCGCAAAACGAGGCTTGGAAAGTGA
TTCGATGCAACAAACCTACATTATGGCTCTTCCTAACAATTTTCGAATAA
ATCTGGATAGTGTTTATCGCCCTGGCGGAAATAGGTTATTAGAAGATGGT
AGAAACATGCAATATTTAGAAGTGAATAAATTTCTCGACAGATTTATTAA
TAGGACTCATGATCCTCGAATTCTTTTTCGATTTCAAGATAGAAAATTTT
TTGAAGATATTTTTGATGGTGAGTTTGAGGATAATTCTTTAGAAGGAAGA
TTTTATCGGGATAATGGGACATCGTTTGGAAATGTTCTATTCTATGGCCA
GGAATTAGCTCTTGTCACATTCGACATTTTGTTGTTTTGTGTCACAGATT
TGATCTTGCAAAATACAGTATTTGATGCCTTTATAACCTGGGGTTTAGTC
ACTATCCTGAAAATGATTCGAAACGGCTGTGGAGCACACAATTTAGCAAA
CAAGACCTTGGTTGACCGTCGGTTTTTGATATGAACAGATCGGAAGA
back to top

protein sequence of SMED30008957-orf-1

>SMED30008957-orf-1 ID=SMED30008957-orf-1|Name=SMED30008957-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=963bp
MIHFIFLILNLSIFIKCQTNIANVLGACSSTTYFSSVDFKCVSCSVNAKQ
SSDGFSCVCKDGYYFTKNGGGSQVLCQKCPLNQIPSSNGWSCISCLNGVT
GTSCSSCDSPNVAYSSDVLGNQFNGNCTACATNYRPVNNQCQLCSNILST
NGNSSCSCALPTGNACLTKSLSNSSILTYLGQSVTSGFLQANLMDSVAMC
QVSMESGCQNLANMCVMSVYNRQSAKSIDGTPCSLYAQVQPSGSYTSGKT
AGYPWLYYTIPQTLTQLTVDHQYVRGETLQIVLATYDSAGQFLGIRNATK
DSNLQLCDNSITKRKETFRFGTHYLESCSITISQLSNQTRYLPLFYDPYL
SYTDSIGASQLYPIPIKIGQVISDSGTTPNLLFDQAAWILTRRLLLVDNF
GAITAPFQTNRTASYITFASSMRLVVVKQSSGSFDITKDGSIYAPYLEVN
LTTVSSSSLTSSANISFEVVYYNVSSYTTAFYYSLSVAMGILCALAGLYA
ILRAFFWCRRSGISGFEGLVLLKTLAHACASISNVFFIVIFGISLYFLLL
FKNQNLFSILPPDDDSFFVAYLISAFLLKMLEIVHIFVAQCTVDIFLIDW
ERPKHQLAPKKIFERSKFDTATDNTGDQNLIQQEKGSQNNGVSIWRTYFI
ANEWNEIQTYRKTSLIFNLIIVLLFMEVIGFKNITTFDCFVNYSPSSDAY
SAPNYRMFRFAVIVSIFGITAFIQWLFTVLIYERVIEDKLRNYVDLCSVA
NISIIVLAHRQFGYYIHGRSVHGSADVSLSEMYGALQKENAGSCAKRGLE
SDSMQQTYIMALPNNFRINLDSVYRPGGNRLLEDGRNMQYLEVNKFLDRF
INRTHDPRILFRFQDRKFFEDIFDGEFEDNSLEGRFYRDNGTSFGNVLFY
GQELALVTFDILLFCVTDLILQNTVFDAFITWGLVTILKMIRNGCGAHNL
ANKTLVDRRFLI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR019170Meckelin
Vocabulary: cellular component
TermDefinition
GO:0036038MKS complex
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: biological process
TermDefinition
GO:0010826negative regulation of centrosome duplication
GO:0042384cilium assembly
GO:0060271cilium morphogenesis
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR019170MeckelinPFAMPF09773Meckelincoord: 139..962
e-value: 2.8E-211
score: 703.9
IPR019170MeckelinPANTHERPTHR21274UNCHARACTERIZEDcoord: 31..962
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..17
score: 0.786
NoneNo IPR availableTMHMMTMhelixcoord: 566..588
NoneNo IPR availableTMHMMTMhelixcoord: 665..687
NoneNo IPR availableTMHMMTMhelixcoord: 480..502
NoneNo IPR availableTMHMMTMhelixcoord: 710..732
NoneNo IPR availableTMHMMTMhelixcoord: 532..551