Serine/threonine kinase

Overview
NameSerine/threonine kinase
Smed IDSMED30008952
Length (bp)2864
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Serine/threonine kinase (SMED30008952) t-SNE clustered cells

Violin plots show distribution of expression levels for Serine/threonine kinase (SMED30008952) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Serine/threonine kinase (SMED30008952) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Serine/threonine kinase (SMED30008952) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30008952

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30008952h1SMcG0001612 Contig697GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30008952h1SMcG0005943 Contig697GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
Smed sexual biotypeSMED30008952h1SMcG0001612 Contig697GPL15192PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30008952h1SMcG0005943 Contig697GPL15192PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
protonephridiaSMED30008952h1SMcG0005943 dd_Smed_v4_489_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30008952h1SMcG0005943 dd_Smed_v4_489_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30008952h1SMcG0005943 dd_Smed_v4_489_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30008952h1SMcG0005943 dd_Smed_v4_489_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Serine/threonine kinase vs. Ensembl Human
Match: TAOK2 (TAO kinase 2 [Source:HGNC Symbol;Acc:HGNC:16835])

HSP 1 Score: 328.561 bits (841), Expect = 2.321e-96
Identity = 156/306 (50.98%), Postives = 220/306 (71.90%), Query Frame = 2
Query:  113 QLLCKDDPSTIFTNLKQIGCGSFGAVYYAQNXXXXXXXXXXXXXVDSKSQKDHWKDIKREICLLKQLNHVNCISFKGYYLKGNNPLIVMDYCLGSVSDIIEVFKKPLQEDEIGCVVVEVLKALNYLHKKNFIHRDIKASNILLTECGLVKLGDFGSSSFVNPANTFVGTPFWIAPEVIMAMESGLYDFKVDIWSLGITCIEMAEMEPPHFKTLNPMAAMYHIASNDSPCLLNPSLWSNEFVFLVVAFLKKSPDNRPSAENALQSKFCTIKRPPFILLKMIKNARNAVAAREKSD-KSDKMKKILLQ 1027
            +L  KDDP  +F++L++IG GSFGAVY+A++++  E++AIK++    K   + W+DI +E+  L++L H N I ++G YL+ +   +VM+YCLGS SD++EV KKPLQE EI  V    L+ L YLH  N IHRD+KA NILL+E GLVKLGDFGS+S + PAN+FVGTP+W+APEVI+AM+ G YD KVD+WSLGITCIE+AE +PP F  +N M+A+YHIA N+SP +L    WS  F   V + L+K P +RP++E  L+ +F   +RPP +++ +I+  ++AV  RE  + +  KMKKIL Q
Sbjct:   17 ELFFKDDPEKLFSDLREIGHGSFGAVYFARDVRNSEVVAIKKMSYSGKQSNEKWQDIIKEVRFLQKLRHPNTIQYRGCYLREHTAWLVMEYCLGSASDLLEVHKKPLQEVEIAAVTHGALQGLAYLHSHNMIHRDVKAGNILLSEPGLVKLGDFGSASIMAPANSFVGTPYWMAPEVILAMDEGQYDGKVDVWSLGITCIELAERKPPLF-NMNAMSALYHIAQNESP-VLQSGHWSEYFRNFVDSCLQKIPQDRPTSEVLLKHRFVLRERPPTVIMDLIQRTKDAV--RELDNLQYRKMKKILFQ 318          

HSP 2 Score: 103.605 bits (257), Expect = 8.093e-22
Identity = 114/442 (25.79%), Postives = 209/442 (47.29%), Query Frame = 2
Query: 1520 REQMNGLKRIRNQHKRSIQQLEEKHKNELETTKFSLSRELENVTSTFHKELEKLNKTNSLELDKNNKESRQKELNFVKNL--------------ETXXXXXXXXXXXXXXXENKNTGQYEV---------EINNVQKLGDA------------RTRKFKRDAIMNRHRLQLKQLDSTLKQEQSQLEQKNALLLQQHDKLVNLQLGHQESMHILRIDQMQKLQNIEIEAQTQYAQQQESFLKKKQAAEVKNFPKYLKVKEQENQKACRDILNIQKKQFKILKEDELRNSRKKHNGESEQQIVDRLKENERQKQVELKAQYDASLEKMKAQELNKLESRHIRETLELENKLQTEKEVLRSFHNSQNEETMKNYNQEHLNLKNQMLNKRNELEVGIQESNRLFSLKRIEMYSELTTYHAKELRNFDLETVQLGIDQILINSISSD 2740
            REQ++G KR+R QH++ +  LE + + E E     L RELE   + F  E EKL + +    +K  + ++ +E  F +++              +  + K  K   K    EN +T + E          ++   Q   +A            + R++KR  ++ RH L    L   L ++Q+Q + + ALLL+QH+    L+L   +++   R +  +     E+  Q +Y +++E  L++K AA+V+  PK LK KE + +K  ++   IQ +Q+K L+   L  + K  +    + ++ RLKE + +K   L  QYD S+ +M + +  +L+     E   L  +LQ E E+L ++ +     T   + +E   L+ ++  +R  LE  ++E        R E    L    A+E+  FD E+++LG   + +  I ++
Sbjct:  489 REQLSGYKRMRRQHQKQLLALESRLRGEREEHSARLQRELEAQRAGFGAEAEKLARRHQAIGEKEARAAQAEERKFQQHILGQQKKELAALLEAQKRTYKLRKEQLKEELQENPSTPKREKAEWLLRQKEQLQQCQAEEEAGLLRRQRQYFELQCRQYKRKMLLARHSLDQDLLREDLNKKQTQKDLECALLLRQHEATRELELRQLQAVQRTRAELTRLQHQTELGNQLEYNKRREQELRQKHAAQVRQQPKSLKSKELQIKKQFQETCKIQTRQYKALRAHLLETTPKAQH----KSLLKRLKEEQTRKLAILAEQYDQSISEMLSSQALRLDETQEAEFQALRQQLQQELELLNAYQSKIKIRTESQHERELRELEQRVALRRALLEQRVEEELLALQTGRSERIRSLLERQAREIEAFDAESMRLGFSSMALGGIPAE 926          
BLAST of Serine/threonine kinase vs. Ensembl Human
Match: TAOK3 (TAO kinase 3 [Source:HGNC Symbol;Acc:HGNC:18133])

HSP 1 Score: 323.168 bits (827), Expect = 1.556e-95
Identity = 160/309 (51.78%), Postives = 206/309 (66.67%), Query Frame = 2
Query:  104 EFDQLLCKDDPSTIFTNLKQIGCGSFGAVYYAQNXXXXXXXXXXXXXVDSKSQKDHWKDIKREICLLKQLNHVNCISFKGYYLKGNNPLIVMDYCLGSVSDIIEVFKKPLQEDEIGCVVVEVLKALNYLHKKNFIHRDIKASNILLTECGLVKLGDFGSSSFVNPANTFVGTPFWIAPEVIMAMESGLYDFKVDIWSLGITCIEMAEMEPPHFKTLNPMAAMYHIASNDSPCLLNPSLWSNEFVFLVVAFLKKSPDNRPSAENALQSKFCTIKRPPFILLKMIKNARNAVAAREKSD-KSDKMKKILLQ 1027
            E   L  KDDP  +F  L +IG GSFGAVY+A N  T E++AIK++    K   + W+DI +E+  L+QL H N I +KG YLK +   +VM+YCLGS SD++EV KKPLQE EI  +    L  L YLH    IHRDIKA NILLTE G VKL DFGS+S  +PAN+FVGTP+W+APEVI+AM+ G YD KVDIWSLGITCIE+AE +PP F  +N M+A+YHIA NDSP  L  + W++ F   V   L+K P  RP++   L+  F    RP  +L+ +I+  ++AV  RE  + +  KMKKIL Q
Sbjct:   10 EIADLFYKDDPEELFIGLHEIGHGSFGAVYFATNAHTSEVVAIKKMSYSGKQTHEKWQDILKEVKFLRQLKHPNTIEYKGCYLKEHTAWLVMEYCLGSASDLLEVHKKPLQEVEIAAITHGALHGLAYLHSHALIHRDIKAGNILLTEPGQVKLADFGSASMASPANSFVGTPYWMAPEVILAMDEGQYDGKVDIWSLGITCIELAERKPPLF-NMNAMSALYHIAQNDSPT-LQSNEWTDSFRRFVDYCLQKIPQERPTSAELLRHDFVRRDRPLRVLIDLIQRTKDAV--RELDNLQYRKMKKILFQ 314          

HSP 2 Score: 92.4337 bits (228), Expect = 1.956e-18
Identity = 110/435 (25.29%), Postives = 205/435 (47.13%), Query Frame = 2
Query: 1520 REQMNGLKRIRNQHKRSIQQLEEKHKNELETTKFSLSRE-----------LENVTSTFHKELEKLNKTNSLELDKNNK--------------ESRQKELNFVK-------NLETXXXXXXXXXXXXXXXENKNTGQYEVEIN--NVQKL-GDARTRKFKRDAIMNRHRLQLKQLDSTLKQEQSQLEQKNALLLQQHDKLVNLQLGHQESMHILRIDQMQKLQNIEIEAQTQYAQQQESFLKKKQAAEVKNFPKYLKVKEQENQKACRDILNIQKKQFKILKEDELRNSRKKHNGESEQQIVDRLKENERQKQVELKAQYDASLEKMKAQELNKLESRHIRETLELENKLQTEKEVLRSFHNSQNEETMKNYNQEHLNLKNQMLNKRNELEVGIQESNRLFSLKRIEMYSELTTYHAKELRNFDLETVQLGIDQIL 2719
            REQM+G KR+R QH++ +  LE K K E++  +  L +E           LE +       +EK  K  + +  K  +              ES++K+    K       N +  + K  K  + +   EN    Q E E +    Q+L  D   R FKR  ++ RH ++ + +   L ++++Q E ++A+L++  +    L+     ++  LR+D ++     E+E Q +Y +++E  L +K   E++  PK LK  E + +K  +D   +Q KQ+K LK  +L  + K  +    + I+  LK+ + +K   L  QY+ S+ +M A +  +L+     E   L  +LQ E E+L ++ +    +T   + +E   L+ ++  +R  LE  I+E       +R E    L     +E+  FD+E++++G   ++
Sbjct:  458 REQMSGYKRMRRQHQKQLIALENKLKAEMDEHRLKLQKEVETHANNSSIELEKLAKKQVAIIEKEAKVAAADEKKFQQQILAQQKKDLTTFLESQKKQYKICKEKIKEEMNEDHSTPKKEKQERISKHKENLQHTQAEEEAHLLTQQRLYYDKNCRFFKRKIMIKRHEVEQQNIREELNKKRTQKEMEHAMLIRHDESTRELEYRQLHTLQKLRMDLIRLQHQTELENQLEYNKRRERELHRKHVMELRQQPKNLKAMEMQIKKQFQDTCKVQTKQYKALKNHQLEVTPKNEH----KTILKTLKDEQTRKLAILAEQYEQSINEMMASQALRLDEAQEAECQALRLQLQQEMELLNAYQSKIKMQTEAQHERELQKLEQRVSLRRAHLEQKIEEELAALQKERSERIKNLLERQEREIETFDMESLRMGFGNLV 888          
BLAST of Serine/threonine kinase vs. Ensembl Human
Match: TAOK3 (TAO kinase 3 [Source:HGNC Symbol;Acc:HGNC:18133])

HSP 1 Score: 323.168 bits (827), Expect = 1.556e-95
Identity = 160/309 (51.78%), Postives = 206/309 (66.67%), Query Frame = 2
Query:  104 EFDQLLCKDDPSTIFTNLKQIGCGSFGAVYYAQNXXXXXXXXXXXXXVDSKSQKDHWKDIKREICLLKQLNHVNCISFKGYYLKGNNPLIVMDYCLGSVSDIIEVFKKPLQEDEIGCVVVEVLKALNYLHKKNFIHRDIKASNILLTECGLVKLGDFGSSSFVNPANTFVGTPFWIAPEVIMAMESGLYDFKVDIWSLGITCIEMAEMEPPHFKTLNPMAAMYHIASNDSPCLLNPSLWSNEFVFLVVAFLKKSPDNRPSAENALQSKFCTIKRPPFILLKMIKNARNAVAAREKSD-KSDKMKKILLQ 1027
            E   L  KDDP  +F  L +IG GSFGAVY+A N  T E++AIK++    K   + W+DI +E+  L+QL H N I +KG YLK +   +VM+YCLGS SD++EV KKPLQE EI  +    L  L YLH    IHRDIKA NILLTE G VKL DFGS+S  +PAN+FVGTP+W+APEVI+AM+ G YD KVDIWSLGITCIE+AE +PP F  +N M+A+YHIA NDSP  L  + W++ F   V   L+K P  RP++   L+  F    RP  +L+ +I+  ++AV  RE  + +  KMKKIL Q
Sbjct:   10 EIADLFYKDDPEELFIGLHEIGHGSFGAVYFATNAHTSEVVAIKKMSYSGKQTHEKWQDILKEVKFLRQLKHPNTIEYKGCYLKEHTAWLVMEYCLGSASDLLEVHKKPLQEVEIAAITHGALHGLAYLHSHALIHRDIKAGNILLTEPGQVKLADFGSASMASPANSFVGTPYWMAPEVILAMDEGQYDGKVDIWSLGITCIELAERKPPLF-NMNAMSALYHIAQNDSPT-LQSNEWTDSFRRFVDYCLQKIPQERPTSAELLRHDFVRRDRPLRVLIDLIQRTKDAV--RELDNLQYRKMKKILFQ 314          

HSP 2 Score: 92.4337 bits (228), Expect = 1.956e-18
Identity = 110/435 (25.29%), Postives = 205/435 (47.13%), Query Frame = 2
Query: 1520 REQMNGLKRIRNQHKRSIQQLEEKHKNELETTKFSLSRE-----------LENVTSTFHKELEKLNKTNSLELDKNNK--------------ESRQKELNFVK-------NLETXXXXXXXXXXXXXXXENKNTGQYEVEIN--NVQKL-GDARTRKFKRDAIMNRHRLQLKQLDSTLKQEQSQLEQKNALLLQQHDKLVNLQLGHQESMHILRIDQMQKLQNIEIEAQTQYAQQQESFLKKKQAAEVKNFPKYLKVKEQENQKACRDILNIQKKQFKILKEDELRNSRKKHNGESEQQIVDRLKENERQKQVELKAQYDASLEKMKAQELNKLESRHIRETLELENKLQTEKEVLRSFHNSQNEETMKNYNQEHLNLKNQMLNKRNELEVGIQESNRLFSLKRIEMYSELTTYHAKELRNFDLETVQLGIDQIL 2719
            REQM+G KR+R QH++ +  LE K K E++  +  L +E           LE +       +EK  K  + +  K  +              ES++K+    K       N +  + K  K  + +   EN    Q E E +    Q+L  D   R FKR  ++ RH ++ + +   L ++++Q E ++A+L++  +    L+     ++  LR+D ++     E+E Q +Y +++E  L +K   E++  PK LK  E + +K  +D   +Q KQ+K LK  +L  + K  +    + I+  LK+ + +K   L  QY+ S+ +M A +  +L+     E   L  +LQ E E+L ++ +    +T   + +E   L+ ++  +R  LE  I+E       +R E    L     +E+  FD+E++++G   ++
Sbjct:  458 REQMSGYKRMRRQHQKQLIALENKLKAEMDEHRLKLQKEVETHANNSSIELEKLAKKQVAIIEKEAKVAAADEKKFQQQILAQQKKDLTTFLESQKKQYKICKEKIKEEMNEDHSTPKKEKQERISKHKENLQHTQAEEEAHLLTQQRLYYDKNCRFFKRKIMIKRHEVEQQNIREELNKKRTQKEMEHAMLIRHDESTRELEYRQLHTLQKLRMDLIRLQHQTELENQLEYNKRRERELHRKHVMELRQQPKNLKAMEMQIKKQFQDTCKVQTKQYKALKNHQLEVTPKNEH----KTILKTLKDEQTRKLAILAEQYEQSINEMMASQALRLDEAQEAECQALRLQLQQEMELLNAYQSKIKMQTEAQHERELQKLEQRVSLRRAHLEQKIEEELAALQKERSERIKNLLERQEREIETFDMESLRMGFGNLV 888          
BLAST of Serine/threonine kinase vs. Ensembl Human
Match: TAOK1 (TAO kinase 1 [Source:HGNC Symbol;Acc:HGNC:29259])

HSP 1 Score: 316.235 bits (809), Expect = 2.269e-93
Identity = 155/309 (50.16%), Postives = 219/309 (70.87%), Query Frame = 2
Query:  104 EFDQLLCKDDPSTIFTNLKQIGCGSFGAVYYAQNXXXXXXXXXXXXXVDSKSQKDHWKDIKREICLLKQLNHVNCISFKGYYLKGNNPLIVMDYCLGSVSDIIEVFKKPLQEDEIGCVVVEVLKALNYLHKKNFIHRDIKASNILLTECGLVKLGDFGSSSFVNPANTFVGTPFWIAPEVIMAMESGLYDFKVDIWSLGITCIEMAEMEPPHFKTLNPMAAMYHIASNDSPCLLNPSLWSNEFVFLVVAFLKKSPDNRPSAENALQSKFCTIKRPPFILLKMIKNARNAVAAREKSD-KSDKMKKILLQ 1027
            E  +L  K+DP  +FT+L++IG GSFGAVY+A++++T E++AIK++    K   + W+DI +E+  L+++ H N I +KG YL+ +   +VM+YCLGS SD++EV KKPLQE EI  +    L+ L YLH    IHRDIKA NILLTE G VKL DFGS+S  +PAN+FVGTP+W+APEVI+AM+ G YD KVD+WSLGITCIE+AE +PP F  +N M+A+YHIA N+SP L + + WS+ F   V + L+K P +RP++E  L+  F   +RP  +L+ +I+  ++AV  RE  + +  KMKK+L Q
Sbjct:   14 EIAELFFKEDPEKLFTDLREIGHGSFGAVYFARDVRTNEVVAIKKMSYSGKQSTEKWQDIIKEVKFLQRIKHPNSIEYKGCYLREHTAWLVMEYCLGSASDLLEVHKKPLQEVEIAAITHGALQGLAYLHSHTMIHRDIKAGNILLTEPGQVKLADFGSASMASPANSFVGTPYWMAPEVILAMDEGQYDGKVDVWSLGITCIELAERKPPLF-NMNAMSALYHIAQNESPTLQS-NEWSDYFRNFVDSCLQKIPQDRPTSEELLKHIFVLRERPETVLIDLIQRTKDAV--RELDNLQYRKMKKLLFQ 318          

HSP 2 Score: 59.6918 bits (143), Expect = 2.776e-8
Identity = 56/213 (26.29%), Postives = 109/213 (51.17%), Query Frame = 2
Query: 2111 AQQQESFLKKKQAAEVKNFPKYLKVKEQENQKACRDILNIQKKQFKILKEDELRNSRKKHNGESEQQIVDRLKENERQKQVELKAQYDASLEKMKAQELNKLESRHIRETLELENKLQTEKEVLRSFHNSQNEETMKNYNQEHLNLKNQMLNKRNELEVGIQESNRLFSLKRIEMYSELTTYHAKELRNFDLETVQLGIDQILINSISSDYVS 2749
            +Q++E  L+K+Q  E K     L++K+Q      +D   IQ +Q+K L+   L  + K  +    + ++ RLKE + +K   L  QYD S+ +M + +  +L+     E   L+ +LQ E E+L ++ +    +    +++E   L+ ++  +R  LE  I+E       +R E    L    A+E+  FD E+++LG   ++++++S +  S
Sbjct:  554 SQKREYKLRKEQLKESKE----LQIKKQ-----FQDTCKIQTRQYKALRNHLLETTPKSEH----KAVLKRLKEEQTRKLAILAEQYDHSINEMLSTQALRLDEAQEAECQVLKMQLQQELELLNAYQSKIKMQAEAQHDRELRELEQRVSLRRALLEQKIEEEMLALQNERTERIRSLLERQAREIEAFDSESMRLGFSNMVLSNLSPEAFS 753          

HSP 3 Score: 52.7582 bits (125), Expect = 3.811e-6
Identity = 59/198 (29.80%), Postives = 106/198 (53.54%), Query Frame = 2
Query: 1520 REQMNGLKRIRNQHKRSIQQLEEKHKNELETTKFSLSRELENVTSTFHKELEKLNKTNSLELDKNNKESRQKELNFVKNLETXXXXXXXXXXXXXXXENKNTGQY-----EVEI-NNVQKLGDARTRKFK--RDAIM-----NRHRLQLKQLDSTLKQEQSQLEQKNALLLQQHDKLVNLQLGHQESMHILRIDQMQK 2074
            REQM+G KR+R QH++ +  LE K K E++  +  L ++LE   + F  E+EKL K +   ++K  K    +E  F ++++   KK++ +  ++ K E K   +      E++I    Q     +TR++K  R+ ++     + H+  LK+    LK+EQ+   +K A+L +Q+D  +N  L    S   LR+D+ Q+
Sbjct:  461 REQMSGYKRMRRQHQKQLMTLENKLKAEMDEHRLRLDKDLETQRNNFAAEMEKLIKKHQAAMEKEAKVMSNEEKKFQQHIQAQQKKELNSFLESQKREYKLRKEQLKESKELQIKKQFQDTCKIQTRQYKALRNHLLETTPKSEHKAVLKR----LKEEQT---RKLAILAEQYDHSINEML----STQALRLDEAQE 647          
BLAST of Serine/threonine kinase vs. Ensembl Human
Match: TAOK1 (TAO kinase 1 [Source:HGNC Symbol;Acc:HGNC:29259])

HSP 1 Score: 318.931 bits (816), Expect = 3.747e-93
Identity = 155/309 (50.16%), Postives = 218/309 (70.55%), Query Frame = 2
Query:  104 EFDQLLCKDDPSTIFTNLKQIGCGSFGAVYYAQNXXXXXXXXXXXXXVDSKSQKDHWKDIKREICLLKQLNHVNCISFKGYYLKGNNPLIVMDYCLGSVSDIIEVFKKPLQEDEIGCVVVEVLKALNYLHKKNFIHRDIKASNILLTECGLVKLGDFGSSSFVNPANTFVGTPFWIAPEVIMAMESGLYDFKVDIWSLGITCIEMAEMEPPHFKTLNPMAAMYHIASNDSPCLLNPSLWSNEFVFLVVAFLKKSPDNRPSAENALQSKFCTIKRPPFILLKMIKNARNAVAAREKSD-KSDKMKKILLQ 1027
            E  +L  K+DP  +FT+L++IG GSFGAVY+A++++T E++AIK++    K   + W+DI +E+  L+++ H N I +KG YL+ +   +VM+YCLGS SD++EV KKPLQE EI  +    L+ L YLH    IHRDIKA NILLTE G VKL DFGS+S  +PAN+FVGTP+W+APEVI+AM+ G YD KVD+WSLGITCIE+AE +PP F  +N M+A+YHIA N+SP  L  + WS+ F   V + L+K P +RP++E  L+  F   +RP  +L+ +I+  ++AV  RE  + +  KMKK+L Q
Sbjct:   14 EIAELFFKEDPEKLFTDLREIGHGSFGAVYFARDVRTNEVVAIKKMSYSGKQSTEKWQDIIKEVKFLQRIKHPNSIEYKGCYLREHTAWLVMEYCLGSASDLLEVHKKPLQEVEIAAITHGALQGLAYLHSHTMIHRDIKAGNILLTEPGQVKLADFGSASMASPANSFVGTPYWMAPEVILAMDEGQYDGKVDVWSLGITCIELAERKPPLF-NMNAMSALYHIAQNESPT-LQSNEWSDYFRNFVDSCLQKIPQDRPTSEELLKHIFVLRERPETVLIDLIQRTKDAV--RELDNLQYRKMKKLLFQ 318          

HSP 2 Score: 119.398 bits (298), Expect = 1.214e-26
Identity = 119/445 (26.74%), Postives = 220/445 (49.44%), Query Frame = 2
Query: 1520 REQMNGLKRIRNQHKRSIQQLEEKHKNELETTKFSLSRELENVTSTFHKELEKLNKTNSLELDKNNK--------------ESRQKELNFVKNLETXXXXXXXXXXXXXXXENKNTGQYEVE---------INNVQKLGDA------------RTRKFKRDAIMNRHRLQLKQLDSTLKQEQSQLEQKNALLLQQHDKLVNLQLGHQESMHILRIDQMQKLQNIEIEAQTQYAQQQESFLKKKQAAEVKNFPKYLKVKEQENQKACRDILNIQKKQFKILKEDELRNSRKKHNGESEQQIVDRLKENERQKQVELKAQYDASLEKMKAQELNKLESRHIRETLELENKLQTEKEVLRSFHNSQNEETMKNYNQEHLNLKNQMLNKRNELEVGIQESNRLFSLKRIEMYSELTTYHAKELRNFDLETVQLGIDQILINSISSDYVS 2749
            REQM+G KR+R QH++ +  LE K K E++  +  L ++LE   + F  E+EKL K +   ++K  K                ++KELN     +    K  K   K   +EN++T + E +         I + Q   +A              R+FKR  ++ RH L+   +   L + Q+Q + ++A+LL+QH+ +  L+  H  ++  +R + ++     E+  Q +Y +++E  L++K   EV+  PK LK KE + +K  +D   IQ +Q+K L+   L  + K  +    + ++ RLKE + +K   L  QYD S+ +M + +  +L+     E   L+ +LQ E E+L ++ +    +    +++E   L+ ++  +R  LE  I+E       +R E    L    A+E+  FD E+++LG   ++++++S +  S
Sbjct:  461 REQMSGYKRMRRQHQKQLMTLENKLKAEMDEHRLRLDKDLETQRNNFAAEMEKLIKKHQAAMEKEAKVMSNEEKKFQQHIQAQQKKELNSFLESQKREYKLRKEQLKEELNENQSTPKKEKQEWLSKQKENIQHFQAEEEANLLRRQRQYLELECRRFKRRMLLGRHNLEQDLVREELNKRQTQKDLEHAMLLRQHESMQELEFRHLNTIQKMRCELIRLQHQTELTNQLEYNKRRERELRRKHVMEVRQQPKSLKSKELQIKKQFQDTCKIQTRQYKALRNHLLETTPKSEH----KAVLKRLKEEQTRKLAILAEQYDHSINEMLSTQALRLDEAQEAECQVLKMQLQQELELLNAYQSKIKMQAEAQHDRELRELEQRVSLRRALLEQKIEEEMLALQNERTERIRSLLERQAREIEAFDSESMRLGFSNMVLSNLSPEAFS 901          
BLAST of Serine/threonine kinase vs. Ensembl Celegans
Match: kin-18 (Serine/threonine-protein kinase SULU [Source:UniProtKB/Swiss-Prot;Acc:P46549])

HSP 1 Score: 251.906 bits (642), Expect = 1.933e-75
Identity = 134/319 (42.01%), Postives = 199/319 (62.38%), Query Frame = 2
Query:  116 LLCKDDPSTIFTNLKQIGCGSFGAVYYAQNXXXXXXXXXXXXXVDSKSQKDHWKDIKREICLLKQLNHVNCISFKGYYLKGNNPLIVMDYCLGSVSDIIEVFKKPLQEDEIGCVVVEVLKALNYLHKKNFIHRDIKASNILLTECGLVKLGDFGSSSFVNPANTFVGTPFWIAPEVIMAMESGLYDFKVDIWSLGITCIEMAEMEPPHFKTLNPMAAMYHIASNDSPCL--LNPS---LWSNEFVFLVVAFLKKSPDNRPSAENALQSKFCTIKRPPFILLKMIKNARNAVAAREKSDKSDKMKKILLQSKTDNESPPE 1057
            L    DP   + +L++IG GSFGAVY+A + K ++ +AIK++    K   + W DI +E+  L  + H + + +K  +LK     +VM+YC+GS +DI++V +K ++E EI  +  + L AL YLH    IHRDIKA NILL++  +VKL DFGS+S V+PA TF+GTPF++APEVI+AM+ G Y  + DIWSLGITCIE+AE  PP F ++N M+A+YHIA ND P L  ++ S    WS EFV  +   L+K  + R SAE   +  F    RP   + ++I+  +N V   +   +  KM+K++   +T+ +   E
Sbjct:   20 LFSNKDPEQRYQDLREIGHGSFGAVYFAYDKKNEQTVAIKKMNFSGKQAVEKWNDILKEVSFLNTVVHPHIVDYKACFLKDTTCWLVMEYCIGSAADIVDVLRKGMREVEIAAICSQTLDALRYLHSLKRIHRDIKAGNILLSDHAIVKLADFGSASLVDPAQTFIGTPFFMAPEVILAMDEGHYTDRADIWSLGITCIELAERRPPLF-SMNAMSALYHIAQNDPPTLSPIDTSEQPEWSLEFVQFIDKCLRKPAEERMSAEECFRHPFIQRSRPSDTIQELIQRTKNMVLELDNF-QYKKMRKLMYLDETEGKEGSE 336          
BLAST of Serine/threonine kinase vs. Ensembl Celegans
Match: kin-18 (Serine/threonine-protein kinase SULU [Source:UniProtKB/Swiss-Prot;Acc:P46549])

HSP 1 Score: 251.906 bits (642), Expect = 1.933e-75
Identity = 134/319 (42.01%), Postives = 199/319 (62.38%), Query Frame = 2
Query:  116 LLCKDDPSTIFTNLKQIGCGSFGAVYYAQNXXXXXXXXXXXXXVDSKSQKDHWKDIKREICLLKQLNHVNCISFKGYYLKGNNPLIVMDYCLGSVSDIIEVFKKPLQEDEIGCVVVEVLKALNYLHKKNFIHRDIKASNILLTECGLVKLGDFGSSSFVNPANTFVGTPFWIAPEVIMAMESGLYDFKVDIWSLGITCIEMAEMEPPHFKTLNPMAAMYHIASNDSPCL--LNPS---LWSNEFVFLVVAFLKKSPDNRPSAENALQSKFCTIKRPPFILLKMIKNARNAVAAREKSDKSDKMKKILLQSKTDNESPPE 1057
            L    DP   + +L++IG GSFGAVY+A + K ++ +AIK++    K   + W DI +E+  L  + H + + +K  +LK     +VM+YC+GS +DI++V +K ++E EI  +  + L AL YLH    IHRDIKA NILL++  +VKL DFGS+S V+PA TF+GTPF++APEVI+AM+ G Y  + DIWSLGITCIE+AE  PP F ++N M+A+YHIA ND P L  ++ S    WS EFV  +   L+K  + R SAE   +  F    RP   + ++I+  +N V   +   +  KM+K++   +T+ +   E
Sbjct:   20 LFSNKDPEQRYQDLREIGHGSFGAVYFAYDKKNEQTVAIKKMNFSGKQAVEKWNDILKEVSFLNTVVHPHIVDYKACFLKDTTCWLVMEYCIGSAADIVDVLRKGMREVEIAAICSQTLDALRYLHSLKRIHRDIKAGNILLSDHAIVKLADFGSASLVDPAQTFIGTPFFMAPEVILAMDEGHYTDRADIWSLGITCIELAERRPPLF-SMNAMSALYHIAQNDPPTLSPIDTSEQPEWSLEFVQFIDKCLRKPAEERMSAEECFRHPFIQRSRPSDTIQELIQRTKNMVLELDNF-QYKKMRKLMYLDETEGKEGSE 336          
BLAST of Serine/threonine kinase vs. Ensembl Celegans
Match: kin-18 (Serine/threonine-protein kinase SULU [Source:UniProtKB/Swiss-Prot;Acc:P46549])

HSP 1 Score: 267.314 bits (682), Expect = 2.348e-75
Identity = 129/292 (44.18%), Postives = 185/292 (63.36%), Query Frame = 2
Query:  116 LLCKDDPSTIFTNLKQIGCGSFGAVYYAQNXXXXXXXXXXXXXVDSKSQKDHWKDIKREICLLKQLNHVNCISFKGYYLKGNNPLIVMDYCLGSVSDIIEVFKKPLQEDEIGCVVVEVLKALNYLHKKNFIHRDIKASNILLTECGLVKLGDFGSSSFVNPANTFVGTPFWIAPEVIMAMESGLYDFKVDIWSLGITCIEMAEMEPPHFKTLNPMAAMYHIASNDSPCLLNP------SLWSNEFVFLVVAFLKKSPDNRPSAENALQSKFCTIKRPPFILLKMIKNARNAV 973
            L    DP   + +L++IG GSFGAVY+A + K ++ +AIK++    K   + W DI +E+  L  + H + + +K  +LK     +VM+YC+GS +DI++V +K ++E EI  +  + L AL YLH    IHRDIKA NILL++  +VKL DFGS+S V+PA TF+GTPF++APEVI+AM+ G Y  + DIWSLGITCIE+AE  PP F ++N M+A+YHIA ND P  L+P        WS EFV  +   L+K  + R SAE   +  F    RP   + ++I+  +N V
Sbjct:   20 LFSNKDPEQRYQDLREIGHGSFGAVYFAYDKKNEQTVAIKKMNFSGKQAVEKWNDILKEVSFLNTVVHPHIVDYKACFLKDTTCWLVMEYCIGSAADIVDVLRKGMREVEIAAICSQTLDALRYLHSLKRIHRDIKAGNILLSDHAIVKLADFGSASLVDPAQTFIGTPFFMAPEVILAMDEGHYTDRADIWSLGITCIELAERRPPLF-SMNAMSALYHIAQNDPPT-LSPIDTSEQPEWSLEFVQFIDKCLRKPAEERMSAEECFRHPFIQRSRPSDTIQELIQRTKNMV 309          

HSP 2 Score: 94.3597 bits (233), Expect = 2.057e-19
Identity = 83/334 (24.85%), Postives = 167/334 (50.00%), Query Frame = 2
Query: 1523 EQMNGLKRIRNQHKRSIQQLEEKHKNELETTKFSLSRELENVTSTFHKELEKLNKTNSLELDKNNK--ESRQKELNFVKNLETXXXXXXXXXXXXXXXENKNTGQ-------------YEVEINNVQ----KLGDARTRKF---------------KRDAIMNRHRLQLKQLDSTLKQEQSQLEQKNALLLQQHDKLVNLQLGHQESMHILRIDQMQKLQNIEIEAQTQYAQQQESFLKKKQAAEVKNFPKYLKVKEQENQKACRDILNIQKKQFKILKEDELRNSRKKHNGESEQQIVDRLKENERQKQVELKAQYDASLEKMKAQELNKLES 2422
            EQM+  K +R  H + +QQ EE+   + E  +  + RELE +T+T+ KE  ++  + + ELDK  K  E  +K++   KN +   +  + + ++  + +     Q             YE  +  V+    ++ DAR   F               +R  + N H+L+ +  D  +  ++ Q++ ++ LL +QH+   +L++ H   +H ++   ++     E  +Q +Y Q+Q+  L+KK A + +  P+ LK++E + +K  R ++  Q +QFK+     ++   K    + ++++  RLK+++ QK   L +QY++ ++KM   +  KLES
Sbjct:  536 EQMSKYKHLRQAHHKELQQFEERCALDREQLRVKMDRELEQLTTTYSKEKMRVRCSQNNELDKRKKDIEDGEKKMKKTKNSQNQQQMKLYSAQQLKEYKYNKEAQKTRLRSLNMPRSTYENAMKEVKADLNRVKDARENDFDEKLRAELEDEIVRYRRQQLSNLHQLEEQLDDEDVNVQERQMDTRHGLLSKQHEMTRDLEIQHLNELHAMKKRHLETQHEAESASQNEYTQRQQDELRKKHAMQSRQQPRDLKIQEAQIRKQYRQVVKTQTRQFKLYLTQMVQVVPK----DEQKELTSRLKQDQMQKVALLASQYESQIKKMVQDKTVKLES 865          
BLAST of Serine/threonine kinase vs. Ensembl Celegans
Match: kin-18 (Serine/threonine-protein kinase SULU [Source:UniProtKB/Swiss-Prot;Acc:P46549])

HSP 1 Score: 267.314 bits (682), Expect = 2.348e-75
Identity = 129/292 (44.18%), Postives = 185/292 (63.36%), Query Frame = 2
Query:  116 LLCKDDPSTIFTNLKQIGCGSFGAVYYAQNXXXXXXXXXXXXXVDSKSQKDHWKDIKREICLLKQLNHVNCISFKGYYLKGNNPLIVMDYCLGSVSDIIEVFKKPLQEDEIGCVVVEVLKALNYLHKKNFIHRDIKASNILLTECGLVKLGDFGSSSFVNPANTFVGTPFWIAPEVIMAMESGLYDFKVDIWSLGITCIEMAEMEPPHFKTLNPMAAMYHIASNDSPCLLNP------SLWSNEFVFLVVAFLKKSPDNRPSAENALQSKFCTIKRPPFILLKMIKNARNAV 973
            L    DP   + +L++IG GSFGAVY+A + K ++ +AIK++    K   + W DI +E+  L  + H + + +K  +LK     +VM+YC+GS +DI++V +K ++E EI  +  + L AL YLH    IHRDIKA NILL++  +VKL DFGS+S V+PA TF+GTPF++APEVI+AM+ G Y  + DIWSLGITCIE+AE  PP F ++N M+A+YHIA ND P  L+P        WS EFV  +   L+K  + R SAE   +  F    RP   + ++I+  +N V
Sbjct:   20 LFSNKDPEQRYQDLREIGHGSFGAVYFAYDKKNEQTVAIKKMNFSGKQAVEKWNDILKEVSFLNTVVHPHIVDYKACFLKDTTCWLVMEYCIGSAADIVDVLRKGMREVEIAAICSQTLDALRYLHSLKRIHRDIKAGNILLSDHAIVKLADFGSASLVDPAQTFIGTPFFMAPEVILAMDEGHYTDRADIWSLGITCIELAERRPPLF-SMNAMSALYHIAQNDPPT-LSPIDTSEQPEWSLEFVQFIDKCLRKPAEERMSAEECFRHPFIQRSRPSDTIQELIQRTKNMV 309          

HSP 2 Score: 94.3597 bits (233), Expect = 2.057e-19
Identity = 83/334 (24.85%), Postives = 167/334 (50.00%), Query Frame = 2
Query: 1523 EQMNGLKRIRNQHKRSIQQLEEKHKNELETTKFSLSRELENVTSTFHKELEKLNKTNSLELDKNNK--ESRQKELNFVKNLETXXXXXXXXXXXXXXXENKNTGQ-------------YEVEINNVQ----KLGDARTRKF---------------KRDAIMNRHRLQLKQLDSTLKQEQSQLEQKNALLLQQHDKLVNLQLGHQESMHILRIDQMQKLQNIEIEAQTQYAQQQESFLKKKQAAEVKNFPKYLKVKEQENQKACRDILNIQKKQFKILKEDELRNSRKKHNGESEQQIVDRLKENERQKQVELKAQYDASLEKMKAQELNKLES 2422
            EQM+  K +R  H + +QQ EE+   + E  +  + RELE +T+T+ KE  ++  + + ELDK  K  E  +K++   KN +   +  + + ++  + +     Q             YE  +  V+    ++ DAR   F               +R  + N H+L+ +  D  +  ++ Q++ ++ LL +QH+   +L++ H   +H ++   ++     E  +Q +Y Q+Q+  L+KK A + +  P+ LK++E + +K  R ++  Q +QFK+     ++   K    + ++++  RLK+++ QK   L +QY++ ++KM   +  KLES
Sbjct:  536 EQMSKYKHLRQAHHKELQQFEERCALDREQLRVKMDRELEQLTTTYSKEKMRVRCSQNNELDKRKKDIEDGEKKMKKTKNSQNQQQMKLYSAQQLKEYKYNKEAQKTRLRSLNMPRSTYENAMKEVKADLNRVKDARENDFDEKLRAELEDEIVRYRRQQLSNLHQLEEQLDDEDVNVQERQMDTRHGLLSKQHEMTRDLEIQHLNELHAMKKRHLETQHEAESASQNEYTQRQQDELRKKHAMQSRQQPRDLKIQEAQIRKQYRQVVKTQTRQFKLYLTQMVQVVPK----DEQKELTSRLKQDQMQKVALLASQYESQIKKMVQDKTVKLES 865          
BLAST of Serine/threonine kinase vs. Ensembl Celegans
Match: gck-1 (Germinal center kinase 1 [Source:UniProtKB/Swiss-Prot;Acc:H2L099])

HSP 1 Score: 193.356 bits (490), Expect = 9.754e-52
Identity = 117/294 (39.80%), Postives = 166/294 (56.46%), Query Frame = 2
Query:   95 NMNEFDQLLCKDDPSTIFTNLKQIGCGSFGAVYYAQNXXXXXXXXXXXXXVDSKSQKDHWKDIKREICLLKQLNHVNCISFKGYYLKGNNPLIVMDYCLG-SVSDIIEVFKKPLQEDEIGCVVVEVLKALNYLHKKNFIHRDIKASNILLTECGLVKLGDFGSSS----FVNPANTFVGTPFWIAPEVIMAMESGLYDFKVDIWSLGITCIEMAEMEPPHFKTLNPMAAMYHIASNDSPCLLNPSLWSNEFVFLVVAFLKKSPDNRPSAENALQSKFCTIKRPPFILLKMIKNA 961
            +   F   + K DP  IFT  ++IG GSFG VY  + I  +    +    +D +  +D  +DI++EI +L Q +      + G +LKG+   I+M+Y  G S  D+ +  K  L E  I  ++ E+LK L YLH +  IHRDIKA+N+L++E G VK+ DFG +      V    TFVG+PFW+APE+I   +   YD+K DIWSLGIT IE+A  EPPH   L+PM  ++ I  N  P +L  S WS  F   V   L K P+NRPSA   L+ +F    +   IL+ +I+ A
Sbjct:    2 DFTNFGSEIEKLDPEVIFTKQERIGRGSFGEVY--KGIDNRTGRVVAIKIIDLEQAEDEIEDIQQEIQVLSQCDSQYVTKYFGSFLKGSKLWIIMEYLGGGSALDLTKSGK--LDESHIAVILREILKGLEYLHSERKIHRDIKAANVLVSEHGDVKVADFGVAGQLTETVKKRITFVGSPFWMAPELI---KQSSYDYKADIWSLGITAIELANGEPPH-SDLHPMRVLFLIPKNPPP-VLQGSQWSKPFKEFVEMCLNKDPENRPSASTLLKHQFIKRAKKNSILVDLIERA 286          
BLAST of Serine/threonine kinase vs. Ensembl Fly
Match: Tao (gene:FBgn0031030 transcript:FBtr0336691)

HSP 1 Score: 327.791 bits (839), Expect = 2.087e-96
Identity = 166/316 (52.53%), Postives = 215/316 (68.04%), Query Frame = 2
Query:  104 EFDQLLCKDDPSTIFTNLKQIGCGSFGAVYYAQNXXXXXXXXXXXXXVDSKSQKDHWKDIKREICLLKQLNHVNCISFKGYYLKGNNPLIVMDYCLGSVSDIIEVFKKPLQEDEIGCVVVEVLKALNYLHKKNFIHRDIKASNILLTECGLVKLGDFGSSSFVNPANTFVGTPFWIAPEVIMAMESGLYDFKVDIWSLGITCIEMAEMEPPHFKTLNPMAAMYHIASNDSPCLLNPSLWSNEFVFLVVAFLKKSPDNRPSAENALQSKFCTIKRPPFILLKMIKNARNAVAAREKSD-KSDKMKKILLQSKTDNES 1048
            E   L  K DP  IF +L++IG GSFGAVYYA+   T+EI+AIK++    K  ++ W+DI +EI  L+QLNH N I +KG YL+ +   +VM+YC+GS SDIIEV KKPL EDEI  + + VL  L+YLH    IHRDIKA NILLT+ G+VKL DFGS++   PAN+FVGTP+W+APEVI+AM+ G YD KVD+WSLGITCIE+AE +PP+F  +N M+A+YHIA N+SP L  P+ WS+ F   V   LKK P  RPS+   L   + T  R   +LL++I  AR   A RE  +    KMKKIL+    + ES
Sbjct:   13 EIADLFNKHDPEKIFEDLREIGHGSFGAVYYARCNLTREIVAIKKMSYTGKQSQEKWQDILKEIRFLRQLNHPNTIEYKGCYLRESTAWLVMEYCVGSASDIIEVHKKPLHEDEIAAICLGVLSGLSYLHSLGRIHRDIKAGNILLTDNGVVKLADFGSAAIKCPANSFVGTPYWMAPEVILAMDEGQYDGKVDVWSLGITCIELAERKPPYF-NMNAMSALYHIAQNESPTL--PNDWSDAFCSFVELCLKKMPAERPSSAKLLTHAYVTRPRSDTVLLELI--ARTKSAVRELDNLNYRKMKKILMVDTCETES 323          

HSP 2 Score: 126.716 bits (317), Expect = 3.219e-29
Identity = 114/447 (25.50%), Postives = 218/447 (48.77%), Query Frame = 2
Query: 1505 INEVWREQMNGLKRIRNQHKRSIQQLEEKHKNELETTKFSLSRELENVTSTFHKELEKLNKTNSLELDKNNKES-------------------------RQKEL-----NFVKNLETXXXXXXXXXXXXXXXENKNTGQYEVE-----INNVQKLGDARTRKFKRDAIMNRHRLQLKQLDSTLKQEQSQLEQKNALLLQQHDKLVNLQLGHQESMHILRIDQMQKLQNIEIEAQTQYAQQQESFLKKKQAAEVKNFPKYLKVKEQENQKACRDILNIQKKQFKILKEDELRNSRKKHNGESEQQIVDRLKENERQKQVELKAQYDASLEKMKAQELNKLESRHIRETLELENKLQTEKEVLRSFHNSQNEETMKNYNQEHLNLKNQMLNKRNELEVGIQESNRLFSLKRIEMYSELTTYHAKELRNFDLETVQLGIDQILINSISSD 2740
            + E   EQM+G KR+R +H+  + +LEEK K ++E  K +L +E + +   F ++L++L   +  ++++  K++                         R+KE       + + L        +      +S+  N  Q+E +     +   ++  +   RKFKR  ++ +H  + +QL   L +++ QL+Q +A+LL+ H+K   L+   Q+S+H LR +Q+ K  + E+  Q  Y  + +  L +K A E++  PK LK KE + +K  R+    Q KQ+K  K   L+ + K    E +++++ +LKE + +K   L  QY+ S+  M   +  KL+   + E      +L+ E E+L ++ N   ++  +  ++E   L+N++  +R  LE  +    + F+ +R E        H KEL  FD E++ LG   + +  +S +
Sbjct:  566 MQEEMHEQMSGYKRMRREHQAHLVKLEEKCKVDMEAHKTALDKEYDTLLHNFTRDLDRLETKHQQDVERRAKQTSAAEKKLHKEITLKQENDRKVYDLNRKKEYKANKERWKRELSMDESTPKRQRDLTLQSQKDNLKQHEAQEEQRMLQAQKQYIELEMRKFKRKRMIMQHEHEDQQLRDELGKKEQQLQQAHAMLLKHHEKTQELEYRQQKSVHQLREEQINKQHDTELHNQKDYMDRIKKELVRKHAVELRQQPKSLKQKELQIRKQFRETCKTQTKQYKRYKAQVLQTTPK----EQQKEVIKQLKEEKHRKLTLLGEQYEQSIADMFQSQSYKLDESQVIECQRTHEQLEYELEMLTAYQNKNKKQAQEQRDRERRELENRVSVRRGLLENKMDAELQQFNQERAERLRMKHEKHTKELEAFDNESIALGFSTLSLIEVSRE 1008          
BLAST of Serine/threonine kinase vs. Ensembl Fly
Match: Tao (gene:FBgn0031030 transcript:FBtr0303999)

HSP 1 Score: 323.939 bits (829), Expect = 5.478e-95
Identity = 165/316 (52.22%), Postives = 213/316 (67.41%), Query Frame = 2
Query:  104 EFDQLLCKDDPSTIFTNLKQIGCGSFGAVYYAQNXXXXXXXXXXXXXVDSKSQKDHWKDIKREICLLKQLNHVNCISFKGYYLKGNNPLIVMDYCLGSVSDIIEVFKKPLQEDEIGCVVVEVLKALNYLHKKNFIHRDIKASNILLTECGLVKLGDFGSSSFVNPANTFVGTPFWIAPEVIMAMESGLYDFKVDIWSLGITCIEMAEMEPPHFKTLNPMAAMYHIASNDSPCLLNPSLWSNEFVFLVVAFLKKSPDNRPSAENALQSKFCTIKRPPFILLKMIKNARNAVAAREKSD-KSDKMKKILLQSKTDNES 1048
            E   L  K DP  IF +L++IG GSFGAVYYA+   T+EI+AIK++    K  ++ W+DI +EI  L+QLNH N I +KG YL+ +   +VM+YC+GS SDIIEV KKPL EDEI  + + VL  L+YLH    IHRDIKA NILLT+ G+VKL DFGS++   PAN+FVGTP+W+APEVI+AM+ G YD KVD+WSLGITCIE+AE +PP+F  +N M+A+YHIA N+SP L     WS+ F   V   LKK P  RPS+   L   + T  R   +LL++I  AR   A RE  +    KMKKIL+    + ES
Sbjct:   13 EIADLFNKHDPEKIFEDLREIGHGSFGAVYYARCNLTREIVAIKKMSYTGKQSQEKWQDILKEIRFLRQLNHPNTIEYKGCYLRESTAWLVMEYCVGSASDIIEVHKKPLHEDEIAAICLGVLSGLSYLHSLGRIHRDIKAGNILLTDNGVVKLADFGSAAIKCPANSFVGTPYWMAPEVILAMDEGQYDGKVDVWSLGITCIELAERKPPYF-NMNAMSALYHIAQNESPTLPKND-WSDAFCSFVELCLKKMPAERPSSAKLLTHAYVTRPRSDTVLLELI--ARTKSAVRELDNLNYRKMKKILMVDTCETES 324          

HSP 2 Score: 126.716 bits (317), Expect = 3.250e-29
Identity = 114/447 (25.50%), Postives = 218/447 (48.77%), Query Frame = 2
Query: 1505 INEVWREQMNGLKRIRNQHKRSIQQLEEKHKNELETTKFSLSRELENVTSTFHKELEKLNKTNSLELDKNNKES-------------------------RQKEL-----NFVKNLETXXXXXXXXXXXXXXXENKNTGQYEVE-----INNVQKLGDARTRKFKRDAIMNRHRLQLKQLDSTLKQEQSQLEQKNALLLQQHDKLVNLQLGHQESMHILRIDQMQKLQNIEIEAQTQYAQQQESFLKKKQAAEVKNFPKYLKVKEQENQKACRDILNIQKKQFKILKEDELRNSRKKHNGESEQQIVDRLKENERQKQVELKAQYDASLEKMKAQELNKLESRHIRETLELENKLQTEKEVLRSFHNSQNEETMKNYNQEHLNLKNQMLNKRNELEVGIQESNRLFSLKRIEMYSELTTYHAKELRNFDLETVQLGIDQILINSISSD 2740
            + E   EQM+G KR+R +H+  + +LEEK K ++E  K +L +E + +   F ++L++L   +  ++++  K++                         R+KE       + + L        +      +S+  N  Q+E +     +   ++  +   RKFKR  ++ +H  + +QL   L +++ QL+Q +A+LL+ H+K   L+   Q+S+H LR +Q+ K  + E+  Q  Y  + +  L +K A E++  PK LK KE + +K  R+    Q KQ+K  K   L+ + K    E +++++ +LKE + +K   L  QY+ S+  M   +  KL+   + E      +L+ E E+L ++ N   ++  +  ++E   L+N++  +R  LE  +    + F+ +R E        H KEL  FD E++ LG   + +  +S +
Sbjct:  567 MQEEMHEQMSGYKRMRREHQAHLVKLEEKCKVDMEAHKTALDKEYDTLLHNFTRDLDRLETKHQQDVERRAKQTSAAEKKLHKEITLKQENDRKVYDLNRKKEYKANKERWKRELSMDESTPKRQRDLTLQSQKDNLKQHEAQEEQRMLQAQKQYIELEMRKFKRKRMIMQHEHEDQQLRDELGKKEQQLQQAHAMLLKHHEKTQELEYRQQKSVHQLREEQINKQHDTELHNQKDYMDRIKKELVRKHAVELRQQPKSLKQKELQIRKQFRETCKTQTKQYKRYKAQVLQTTPK----EQQKEVIKQLKEEKHRKLTLLGEQYEQSIADMFQSQSYKLDESQVIECQRTHEQLEYELEMLTAYQNKNKKQAQEQRDRERRELENRVSVRRGLLENKMDAELQQFNQERAERLRMKHEKHTKELEAFDNESIALGFSTLSLIEVSRE 1009          
BLAST of Serine/threonine kinase vs. Ensembl Fly
Match: Tao (gene:FBgn0031030 transcript:FBtr0074772)

HSP 1 Score: 323.939 bits (829), Expect = 5.478e-95
Identity = 165/316 (52.22%), Postives = 213/316 (67.41%), Query Frame = 2
Query:  104 EFDQLLCKDDPSTIFTNLKQIGCGSFGAVYYAQNXXXXXXXXXXXXXVDSKSQKDHWKDIKREICLLKQLNHVNCISFKGYYLKGNNPLIVMDYCLGSVSDIIEVFKKPLQEDEIGCVVVEVLKALNYLHKKNFIHRDIKASNILLTECGLVKLGDFGSSSFVNPANTFVGTPFWIAPEVIMAMESGLYDFKVDIWSLGITCIEMAEMEPPHFKTLNPMAAMYHIASNDSPCLLNPSLWSNEFVFLVVAFLKKSPDNRPSAENALQSKFCTIKRPPFILLKMIKNARNAVAAREKSD-KSDKMKKILLQSKTDNES 1048
            E   L  K DP  IF +L++IG GSFGAVYYA+   T+EI+AIK++    K  ++ W+DI +EI  L+QLNH N I +KG YL+ +   +VM+YC+GS SDIIEV KKPL EDEI  + + VL  L+YLH    IHRDIKA NILLT+ G+VKL DFGS++   PAN+FVGTP+W+APEVI+AM+ G YD KVD+WSLGITCIE+AE +PP+F  +N M+A+YHIA N+SP L     WS+ F   V   LKK P  RPS+   L   + T  R   +LL++I  AR   A RE  +    KMKKIL+    + ES
Sbjct:   13 EIADLFNKHDPEKIFEDLREIGHGSFGAVYYARCNLTREIVAIKKMSYTGKQSQEKWQDILKEIRFLRQLNHPNTIEYKGCYLRESTAWLVMEYCVGSASDIIEVHKKPLHEDEIAAICLGVLSGLSYLHSLGRIHRDIKAGNILLTDNGVVKLADFGSAAIKCPANSFVGTPYWMAPEVILAMDEGQYDGKVDVWSLGITCIELAERKPPYF-NMNAMSALYHIAQNESPTLPKND-WSDAFCSFVELCLKKMPAERPSSAKLLTHAYVTRPRSDTVLLELI--ARTKSAVRELDNLNYRKMKKILMVDTCETES 324          

HSP 2 Score: 126.716 bits (317), Expect = 3.250e-29
Identity = 114/447 (25.50%), Postives = 218/447 (48.77%), Query Frame = 2
Query: 1505 INEVWREQMNGLKRIRNQHKRSIQQLEEKHKNELETTKFSLSRELENVTSTFHKELEKLNKTNSLELDKNNKES-------------------------RQKEL-----NFVKNLETXXXXXXXXXXXXXXXENKNTGQYEVE-----INNVQKLGDARTRKFKRDAIMNRHRLQLKQLDSTLKQEQSQLEQKNALLLQQHDKLVNLQLGHQESMHILRIDQMQKLQNIEIEAQTQYAQQQESFLKKKQAAEVKNFPKYLKVKEQENQKACRDILNIQKKQFKILKEDELRNSRKKHNGESEQQIVDRLKENERQKQVELKAQYDASLEKMKAQELNKLESRHIRETLELENKLQTEKEVLRSFHNSQNEETMKNYNQEHLNLKNQMLNKRNELEVGIQESNRLFSLKRIEMYSELTTYHAKELRNFDLETVQLGIDQILINSISSD 2740
            + E   EQM+G KR+R +H+  + +LEEK K ++E  K +L +E + +   F ++L++L   +  ++++  K++                         R+KE       + + L        +      +S+  N  Q+E +     +   ++  +   RKFKR  ++ +H  + +QL   L +++ QL+Q +A+LL+ H+K   L+   Q+S+H LR +Q+ K  + E+  Q  Y  + +  L +K A E++  PK LK KE + +K  R+    Q KQ+K  K   L+ + K    E +++++ +LKE + +K   L  QY+ S+  M   +  KL+   + E      +L+ E E+L ++ N   ++  +  ++E   L+N++  +R  LE  +    + F+ +R E        H KEL  FD E++ LG   + +  +S +
Sbjct:  567 MQEEMHEQMSGYKRMRREHQAHLVKLEEKCKVDMEAHKTALDKEYDTLLHNFTRDLDRLETKHQQDVERRAKQTSAAEKKLHKEITLKQENDRKVYDLNRKKEYKANKERWKRELSMDESTPKRQRDLTLQSQKDNLKQHEAQEEQRMLQAQKQYIELEMRKFKRKRMIMQHEHEDQQLRDELGKKEQQLQQAHAMLLKHHEKTQELEYRQQKSVHQLREEQINKQHDTELHNQKDYMDRIKKELVRKHAVELRQQPKSLKQKELQIRKQFRETCKTQTKQYKRYKAQVLQTTPK----EQQKEVIKQLKEEKHRKLTLLGEQYEQSIADMFQSQSYKLDESQVIECQRTHEQLEYELEMLTAYQNKNKKQAQEQRDRERRELENRVSVRRGLLENKMDAELQQFNQERAERLRMKHEKHTKELEAFDNESIALGFSTLSLIEVSRE 1009          
BLAST of Serine/threonine kinase vs. Ensembl Fly
Match: Tao (gene:FBgn0031030 transcript:FBtr0074771)

HSP 1 Score: 323.939 bits (829), Expect = 5.478e-95
Identity = 165/316 (52.22%), Postives = 213/316 (67.41%), Query Frame = 2
Query:  104 EFDQLLCKDDPSTIFTNLKQIGCGSFGAVYYAQNXXXXXXXXXXXXXVDSKSQKDHWKDIKREICLLKQLNHVNCISFKGYYLKGNNPLIVMDYCLGSVSDIIEVFKKPLQEDEIGCVVVEVLKALNYLHKKNFIHRDIKASNILLTECGLVKLGDFGSSSFVNPANTFVGTPFWIAPEVIMAMESGLYDFKVDIWSLGITCIEMAEMEPPHFKTLNPMAAMYHIASNDSPCLLNPSLWSNEFVFLVVAFLKKSPDNRPSAENALQSKFCTIKRPPFILLKMIKNARNAVAAREKSD-KSDKMKKILLQSKTDNES 1048
            E   L  K DP  IF +L++IG GSFGAVYYA+   T+EI+AIK++    K  ++ W+DI +EI  L+QLNH N I +KG YL+ +   +VM+YC+GS SDIIEV KKPL EDEI  + + VL  L+YLH    IHRDIKA NILLT+ G+VKL DFGS++   PAN+FVGTP+W+APEVI+AM+ G YD KVD+WSLGITCIE+AE +PP+F  +N M+A+YHIA N+SP L     WS+ F   V   LKK P  RPS+   L   + T  R   +LL++I  AR   A RE  +    KMKKIL+    + ES
Sbjct:   13 EIADLFNKHDPEKIFEDLREIGHGSFGAVYYARCNLTREIVAIKKMSYTGKQSQEKWQDILKEIRFLRQLNHPNTIEYKGCYLRESTAWLVMEYCVGSASDIIEVHKKPLHEDEIAAICLGVLSGLSYLHSLGRIHRDIKAGNILLTDNGVVKLADFGSAAIKCPANSFVGTPYWMAPEVILAMDEGQYDGKVDVWSLGITCIELAERKPPYF-NMNAMSALYHIAQNESPTLPKND-WSDAFCSFVELCLKKMPAERPSSAKLLTHAYVTRPRSDTVLLELI--ARTKSAVRELDNLNYRKMKKILMVDTCETES 324          

HSP 2 Score: 126.716 bits (317), Expect = 3.250e-29
Identity = 114/447 (25.50%), Postives = 218/447 (48.77%), Query Frame = 2
Query: 1505 INEVWREQMNGLKRIRNQHKRSIQQLEEKHKNELETTKFSLSRELENVTSTFHKELEKLNKTNSLELDKNNKES-------------------------RQKEL-----NFVKNLETXXXXXXXXXXXXXXXENKNTGQYEVE-----INNVQKLGDARTRKFKRDAIMNRHRLQLKQLDSTLKQEQSQLEQKNALLLQQHDKLVNLQLGHQESMHILRIDQMQKLQNIEIEAQTQYAQQQESFLKKKQAAEVKNFPKYLKVKEQENQKACRDILNIQKKQFKILKEDELRNSRKKHNGESEQQIVDRLKENERQKQVELKAQYDASLEKMKAQELNKLESRHIRETLELENKLQTEKEVLRSFHNSQNEETMKNYNQEHLNLKNQMLNKRNELEVGIQESNRLFSLKRIEMYSELTTYHAKELRNFDLETVQLGIDQILINSISSD 2740
            + E   EQM+G KR+R +H+  + +LEEK K ++E  K +L +E + +   F ++L++L   +  ++++  K++                         R+KE       + + L        +      +S+  N  Q+E +     +   ++  +   RKFKR  ++ +H  + +QL   L +++ QL+Q +A+LL+ H+K   L+   Q+S+H LR +Q+ K  + E+  Q  Y  + +  L +K A E++  PK LK KE + +K  R+    Q KQ+K  K   L+ + K    E +++++ +LKE + +K   L  QY+ S+  M   +  KL+   + E      +L+ E E+L ++ N   ++  +  ++E   L+N++  +R  LE  +    + F+ +R E        H KEL  FD E++ LG   + +  +S +
Sbjct:  567 MQEEMHEQMSGYKRMRREHQAHLVKLEEKCKVDMEAHKTALDKEYDTLLHNFTRDLDRLETKHQQDVERRAKQTSAAEKKLHKEITLKQENDRKVYDLNRKKEYKANKERWKRELSMDESTPKRQRDLTLQSQKDNLKQHEAQEEQRMLQAQKQYIELEMRKFKRKRMIMQHEHEDQQLRDELGKKEQQLQQAHAMLLKHHEKTQELEYRQQKSVHQLREEQINKQHDTELHNQKDYMDRIKKELVRKHAVELRQQPKSLKQKELQIRKQFRETCKTQTKQYKRYKAQVLQTTPK----EQQKEVIKQLKEEKHRKLTLLGEQYEQSIADMFQSQSYKLDESQVIECQRTHEQLEYELEMLTAYQNKNKKQAQEQRDRERRELENRVSVRRGLLENKMDAELQQFNQERAERLRMKHEKHTKELEAFDNESIALGFSTLSLIEVSRE 1009          
BLAST of Serine/threonine kinase vs. Ensembl Fly
Match: Tao (gene:FBgn0031030 transcript:FBtr0336692)

HSP 1 Score: 306.22 bits (783), Expect = 3.147e-92
Identity = 165/316 (52.22%), Postives = 214/316 (67.72%), Query Frame = 2
Query:  104 EFDQLLCKDDPSTIFTNLKQIGCGSFGAVYYAQNXXXXXXXXXXXXXVDSKSQKDHWKDIKREICLLKQLNHVNCISFKGYYLKGNNPLIVMDYCLGSVSDIIEVFKKPLQEDEIGCVVVEVLKALNYLHKKNFIHRDIKASNILLTECGLVKLGDFGSSSFVNPANTFVGTPFWIAPEVIMAMESGLYDFKVDIWSLGITCIEMAEMEPPHFKTLNPMAAMYHIASNDSPCLLNPSLWSNEFVFLVVAFLKKSPDNRPSAENALQSKFCTIKRPPFILLKMIKNARNAVAAREKSD-KSDKMKKILLQSKTDNES 1048
            E   L  K DP  IF +L++IG GSFGAVYYA+   T+EI+AIK++    K  ++ W+DI +EI  L+QLNH N I +KG YL+ +   +VM+YC+GS SDIIEV KKPL EDEI  + + VL  L+YLH    IHRDIKA NILLT+ G+VKL DFGS++   PAN+FVGTP+W+APEVI+AM+ G YD KVD+WSLGITCIE+AE +PP+F  +N M+A+YHIA N+SP L   + WS+ F   V   LKK P  RPS+   L   + T  R   +LL++I  AR   A RE  +    KMKKIL+    + ES
Sbjct:   13 EIADLFNKHDPEKIFEDLREIGHGSFGAVYYARCNLTREIVAIKKMSYTGKQSQEKWQDILKEIRFLRQLNHPNTIEYKGCYLRESTAWLVMEYCVGSASDIIEVHKKPLHEDEIAAICLGVLSGLSYLHSLGRIHRDIKAGNILLTDNGVVKLADFGSAAIKCPANSFVGTPYWMAPEVILAMDEGQYDGKVDVWSLGITCIELAERKPPYF-NMNAMSALYHIAQNESPTLPK-NDWSDAFCSFVELCLKKMPAERPSSAKLLTHAYVTRPRSDTVLLELI--ARTKSAVRELDNLNYRKMKKILMVDTCETES 324          
BLAST of Serine/threonine kinase vs. Ensembl Zebrafish
Match: taok1a (TAO kinase 1a [Source:ZFIN;Acc:ZDB-GENE-130103-9])

HSP 1 Score: 409.838 bits (1052), Expect = 7.063e-127
Identity = 301/940 (32.02%), Postives = 489/940 (52.02%), Query Frame = 2
Query:  116 LLCKDDPSTIFTNLKQIGCGSFGAVYYAQNXXXXXXXXXXXXXVDSKSQKDHWKDIKREICLLKQLNHVNCISFKGYYLKGNNPLIVMDYCLGSVSDIIEVFKKPLQEDEIGCVVVEVLKALNYLHKKNFIHRDIKASNILLTECGLVKLGDFGSSSFVNPANTFVGTPFWIAPEVIMAMESGLYDFKVDIWSLGITCIEMAEMEPPHFKTLNPMAAMYHIASNDSPCLLNPSLWSNEFVFLVVAFLKKSPDNRPSAENALQSKFCTIKRPPFILLKMIKNARNAVAAREKSD-KSDKMKKILLQSKTDNESPPEMGRSPSFIEDEFXXXXXXXXXXXXXXXLDLFENLSSIEIPVNKKNRGDISNSSLKNINPMKIDQKLSHS-----QSDSVKLLSERNNVIPNSKSSGDISRKAGNENKVSKIIKQLQSIDVKSVENLHIISLKI---PLHRSSTSSESYEDKYKNPSDINEV------------------WREQMNGLKRIRNQHKRSIQQLEEKHKNELETTKFSLSRELENVTSTFHKELEKLNKTNSLELDKNNKESRQKELNFVKNLETXXXXXXXXXXXXXXXENK-NTGQYEVEIN-------------------NVQKLG---------------DARTRKFKRDAIMNRHRLQLKQLDSTLKQEQSQLEQKNALLLQQHDKLVNLQLGHQESMHILRIDQMQKLQNIEIEAQTQYAQQQESFLKKKQAAEVKNFPKYLKVKEQENQKACRDILNIQKKQFKILKEDELRNSRKKHNGESEQQIVDRLKENERQKQVELKAQYDASLEKMKAQELNKLESRHIRETLELENKLQTEKEVLRSFHNSQNEETMKNYNQEHLNLKNQMLNKRNELEVGIQESNRLFSLKRIEMYSELTTYHAKELRNFDLETVQLGIDQILINSISSDYVS 2749
            L  K+DP  +F++L++IG GSFGAVY+A++++T E++AIK++    K   + W+DI +E+  L+++ H N I +KG YL+ +   +VM+YCLGS SD++EV KKPLQE EI  +    L+ L YLH  N IHRDIKA NILLTE G VKL DFGS+S  +PAN+FVGTP+W+APEVI+AM+ G YD KVDIWSLGIT IE+AE +PP F  +N M+A+YHIA N+SP  L  S W++ F   V + L+K P +RP +E  L+  F   +RP  +L+ +I+  ++AV  RE  + +S KMKKIL Q                                          N  ++E+P ++    ++S  S      + I+  L HS      S SV  L +  +   ++KS  D+  K         II     I VK  E  +    ++   P    S  + +   +Y+N      +                   REQM+G KR+R QH++ +  LE K K E++  +  L +ELEN  ++F  E++KL K +   ++K+ K     E  F++++++  KK++ +  ++ K E K    Q + E+N                   N+Q                  +   R+FKR  ++ RH ++   +   L + Q+Q + ++A+LL+ H+ +  L+  H  ++  +R +Q++     E+  Q +Y +++E  L++K   EV+  PK LK KE + +K  +D   IQ +Q+K L+   L ++ K  +    + ++ RLKE + +K   L  QYD ++  M + +  +L+     E   L  +LQ E E+L ++ +    +T     +E   L+ ++  +R  LE  I+E       +R E    L    A+E+  FD E+++LG   +++ +IS + +S
Sbjct:   18 LFFKEDPERLFSDLREIGHGSFGAVYFARDVRTSEVVAIKKMSYSGKQSNEKWQDIIKEVKFLQRIKHPNSIEYKGCYLREHTAWLVMEYCLGSTSDLLEVHKKPLQEIEIAAITHGALQGLAYLHSHNMIHRDIKAGNILLTEPGQVKLADFGSASIASPANSFVGTPYWMAPEVILAMDEGQYDGKVDIWSLGITSIELAERKPPLF-NMNAMSALYHIAQNESPS-LQSSEWTDYFRNFVDSCLQKLPQDRPHSEELLKHAFVQRERPESVLIDLIQRTKDAV--RELDNLQSRKMKKILFQEA---------------------------------------HNGPAVEVPDDE----EVSYCSCTLCFVLSIETHLEHSVGRTGTSSSVNSLPDATDATDDNKSEVDLMEKD------QTIIPNSSIIHVKPEEESYQEETEVQKQPTEPQSPPAHTPRRQYRNREHFATIRTASLVTRQIQEHEQDSEVREQMSGYKRMRRQHQKHLLALENKLKGEMDEHRLKLDKELENQRNSFAAEMDKLIKKHQGTMEKDAKTFANDEKKFLQHIQSQQKKELNSFLESQKREYKLRKEQLKEELNENQSTPKKEKQEWLSKQKENIQHFQAEEEANLLRRQRQYLELECRRFKRRILIARHNVEQDLMREELNKRQTQKDLEHAMLLRHHESMQELEFRHLGTIQKMRAEQIRLQHQTELTNQLEYNKRRERELRRKHVMEVRQQPKSLKSKELQIKKQFQDACKIQTRQYKALRNHLLESTPKPEH----KTMLKRLKEEQTRKLAILAEQYDHTINNMLSTQALRLDEAQEAECQVLRMQLQQELELLNAYQSKIKMQTDAQQERERKELEQRVSLRRALLETKIEEEMLTLQNERTERIRSLLERQAREIEAFDSESMRLGFSNMVLANISPEGLS 900          
BLAST of Serine/threonine kinase vs. Ensembl Zebrafish
Match: taok3a (TAO kinase 3a [Source:ZFIN;Acc:ZDB-GENE-100921-50])

HSP 1 Score: 329.717 bits (844), Expect = 3.767e-98
Identity = 168/329 (51.06%), Postives = 219/329 (66.57%), Query Frame = 2
Query:  104 EFDQLLCKDDPSTIFTNLKQIGCGSFGAVYYAQNXXXXXXXXXXXXXVDSKSQKDHWKDIKREICLLKQLNHVNCISFKGYYLKGNNPLIVMDYCLGSVSDIIEVFKKPLQEDEIGCVVVEVLKALNYLHKKNFIHRDIKASNILLTECGLVKLGDFGSSSFVNPANTFVGTPFWIAPEVIMAMESGLYDFKVDIWSLGITCIEMAEMEPPHFKTLNPMAAMYHIASNDSPCLLNPSLWSNEFVFLVVAFLKKSPDNRPSAENALQSKFCTIKRPPFILLKMIKNARNAVAAREKSD-KSDKMKKILLQSKTDNESPPEMGRSPSFIED 1087
            EF  L  KDDP  +F +L +IG GSFGAVY+A+N  + E++AIK++  + K   + W+DI +E+  L+QL H N I +KG YLK N   +VM+YCLGS SD++EV KKPLQE EI  +    L  L YLH  N IHRD+KA NILLTE G VKL DFGS+S  +PAN+FVGTP+W+APEVI+AM+ G Y+ KVDIWSLGITCIE+AE +PP F  +N M+A+YHIA NDSP  L  + WS+ F   V   L K P +RPS+   L+ +F    RP  +L+ +I+  ++AV  RE  + +  KMKKIL Q K +      MG S    ED
Sbjct:   15 EFANLFFKDDPEEVFCDLHEIGHGSFGAVYFARNSYSNEVVAIKKMSYNGKQTTEKWQDIIKEVKFLEQLRHPNTIEYKGCYLKDNTAWLVMEYCLGSASDLLEVHKKPLQEVEIAAITHGALLGLAYLHSHNMIHRDVKAGNILLTEPGQVKLADFGSASIASPANSFVGTPYWMAPEVILAMDEGQYEGKVDIWSLGITCIELAERKPPLF-NMNAMSALYHIAQNDSPT-LQSNEWSDAFRSFVDYCLLKIPQDRPSSAELLRHEFVRRDRPLRVLIDLIQRTKDAV--RELDNLQYRKMKKILYQEKHNG----PMGESQEEEED 335          

HSP 2 Score: 113.62 bits (283), Expect = 4.130e-25
Identity = 114/434 (26.27%), Postives = 208/434 (47.93%), Query Frame = 2
Query: 1520 REQMNGLKRIRNQHKRSIQQLEEKHKNELETTKFSLSRELENVTSTFHKELEKLNKTNSLELDKNNK--------------ESRQKELNFVKNLETXXXXXXXXXXXXXXXENKNTG---------------QYEVEINNVQKLGDART------RKFKRDAIMNRHRLQLKQLDSTLKQEQSQLEQKNALLLQQHDKLVNLQLGHQESMHILRIDQMQKLQNIEIEAQTQYAQQQESFLKKKQAAEVKNFPKYLKVKEQENQKACRDILNIQKKQFKILKEDELRNSRKKHNGESEQQIVDRLKENERQKQVELKAQYDASLEKMKAQELNKLESRHIRETLELENKLQTEKEVLRSFHNSQNEETMKNYNQEHLNLKNQMLNKRNELEVGIQESNRLFSLKRIEMYSELTTYHAKELRNFDLETVQLGIDQI 2716
            REQM+G KR+R QH++ +  LE K K E++  +  L +ELE   +    ELEKL K ++++ DK  K                ++KEL    + +    K  K   K   SE+ +T                Q+       Q LG  R       R FKR  ++ RH  + +QL   L ++++Q E ++A+L++Q +    L+    +++  LR+D ++     E+E Q +Y  ++E  L +K   E++  PK LK  E + +K  +D   +Q KQ+K L+  +L  + K  +    + ++  LK+ + +K   L  QY+ S+ +M A +  +L+     E   L  +LQ E E+L ++ +    +T   + +E   L+ ++  +R  LE  I+E       +R +    L     +E+  FD+E++++G + +
Sbjct:  456 REQMSGYKRMRRQHQKQLIALENKLKAEMDEHRLKLQKELETHANNAFIELEKLAKKHAIQTDKEMKTLSADEKKFQQQIVAQQKKELTTFLDTQKKQYKLCKEKIKEEMSEDHSTPKKEKQERLSKHKENIQHSQAEEEAQLLGQQRAFYDRNCRAFKRKIMIKRHEFEQEQLREELNKKKTQKEMEHAMLIRQDESTQELEHRQLKTLQKLRMDLIRLQHQTELENQIEYNNRRERELHRKHVLELRQQPKNLKAMELQIKKQFQDTCKVQTKQYKALRHHQLEVTPKSEH----KTVLKALKDEQTRKLAILAEQYEQSINEMMASQALRLDEAQEAECQALRQQLQQEMELLNAYQSKIKIQTEAQHEREQQKLEQKVSLRRAHLEQKIEEELASLQKERTDRIKHLLDRQEREIDAFDMESLRMGFNNL 885          
BLAST of Serine/threonine kinase vs. Ensembl Zebrafish
Match: taok3a (TAO kinase 3a [Source:ZFIN;Acc:ZDB-GENE-100921-50])

HSP 1 Score: 329.717 bits (844), Expect = 4.191e-98
Identity = 168/329 (51.06%), Postives = 219/329 (66.57%), Query Frame = 2
Query:  104 EFDQLLCKDDPSTIFTNLKQIGCGSFGAVYYAQNXXXXXXXXXXXXXVDSKSQKDHWKDIKREICLLKQLNHVNCISFKGYYLKGNNPLIVMDYCLGSVSDIIEVFKKPLQEDEIGCVVVEVLKALNYLHKKNFIHRDIKASNILLTECGLVKLGDFGSSSFVNPANTFVGTPFWIAPEVIMAMESGLYDFKVDIWSLGITCIEMAEMEPPHFKTLNPMAAMYHIASNDSPCLLNPSLWSNEFVFLVVAFLKKSPDNRPSAENALQSKFCTIKRPPFILLKMIKNARNAVAAREKSD-KSDKMKKILLQSKTDNESPPEMGRSPSFIED 1087
            EF  L  KDDP  +F +L +IG GSFGAVY+A+N  + E++AIK++  + K   + W+DI +E+  L+QL H N I +KG YLK N   +VM+YCLGS SD++EV KKPLQE EI  +    L  L YLH  N IHRD+KA NILLTE G VKL DFGS+S  +PAN+FVGTP+W+APEVI+AM+ G Y+ KVDIWSLGITCIE+AE +PP F  +N M+A+YHIA NDSP  L  + WS+ F   V   L K P +RPS+   L+ +F    RP  +L+ +I+  ++AV  RE  + +  KMKKIL Q K +      MG S    ED
Sbjct:   15 EFANLFFKDDPEEVFCDLHEIGHGSFGAVYFARNSYSNEVVAIKKMSYNGKQTTEKWQDIIKEVKFLEQLRHPNTIEYKGCYLKDNTAWLVMEYCLGSASDLLEVHKKPLQEVEIAAITHGALLGLAYLHSHNMIHRDVKAGNILLTEPGQVKLADFGSASIASPANSFVGTPYWMAPEVILAMDEGQYEGKVDIWSLGITCIELAERKPPLF-NMNAMSALYHIAQNDSPT-LQSNEWSDAFRSFVDYCLLKIPQDRPSSAELLRHEFVRRDRPLRVLIDLIQRTKDAV--RELDNLQYRKMKKILYQEKHNG----PMGESQEEEED 335          
BLAST of Serine/threonine kinase vs. Ensembl Zebrafish
Match: taok2a (TAO kinase 2a [Source:ZFIN;Acc:ZDB-GENE-030131-9416])

HSP 1 Score: 322.013 bits (824), Expect = 1.587e-93
Identity = 155/310 (50.00%), Postives = 219/310 (70.65%), Query Frame = 2
Query:  101 NEFDQLLCKDDPSTIFTNLKQIGCGSFGAVYYAQNXXXXXXXXXXXXXVDSKSQKDHWKDIKREICLLKQLNHVNCISFKGYYLKGNNPLIVMDYCLGSVSDIIEVFKKPLQEDEIGCVVVEVLKALNYLHKKNFIHRDIKASNILLTECGLVKLGDFGSSSFVNPANTFVGTPFWIAPEVIMAMESGLYDFKVDIWSLGITCIEMAEMEPPHFKTLNPMAAMYHIASNDSPCLLNPSLWSNEFVFLVVAFLKKSPDNRPSAENALQSKFCTIKRPPFILLKMIKNARNAVAAREKSD-KSDKMKKILLQ 1027
            +E  +L  +DDP  +FT+L++IG GSFGAVY+A ++++ E++AIK++    K   + W+DI +E+  L++L H N I +KG YL+ +   +VM+YCLGS SD++EV KKPLQE EI  +    L+ L YLH  N IHRD+KA NILLTE G VKLGDFGS+S V+PAN+FVGTP+W+APEVI+AM+ G YD KVD+WSLGIT IE+AE +PP F  +N M+A+YHIA N+SP L + + WS+ F   V + L+K P +RP+++  L   F   +RP  +++ +I   ++AV  RE  + +  KMKKIL Q
Sbjct:   13 SEVSELFYRDDPEKLFTDLREIGHGSFGAVYFAHDVRSNEVVAIKKMSFSGKQSNEKWQDIIKEVKFLQKLRHPNTIEYKGCYLREHTAWLVMEYCLGSASDLLEVHKKPLQEMEIAAITHGALQGLAYLHSHNMIHRDVKAGNILLTEPGQVKLGDFGSASIVSPANSFVGTPYWMAPEVILAMDEGQYDGKVDVWSLGITSIELAERKPPLF-NMNAMSALYHIAQNESPVLAS-NHWSDYFRNFVDSCLQKIPQDRPTSDVLLNHHFLCRERPHSVVMDLITRTKDAV--RELDNLQYRKMKKILFQ 318          
BLAST of Serine/threonine kinase vs. Ensembl Zebrafish
Match: taok2a (TAO kinase 2a [Source:ZFIN;Acc:ZDB-GENE-030131-9416])

HSP 1 Score: 322.013 bits (824), Expect = 1.587e-93
Identity = 155/310 (50.00%), Postives = 219/310 (70.65%), Query Frame = 2
Query:  101 NEFDQLLCKDDPSTIFTNLKQIGCGSFGAVYYAQNXXXXXXXXXXXXXVDSKSQKDHWKDIKREICLLKQLNHVNCISFKGYYLKGNNPLIVMDYCLGSVSDIIEVFKKPLQEDEIGCVVVEVLKALNYLHKKNFIHRDIKASNILLTECGLVKLGDFGSSSFVNPANTFVGTPFWIAPEVIMAMESGLYDFKVDIWSLGITCIEMAEMEPPHFKTLNPMAAMYHIASNDSPCLLNPSLWSNEFVFLVVAFLKKSPDNRPSAENALQSKFCTIKRPPFILLKMIKNARNAVAAREKSD-KSDKMKKILLQ 1027
            +E  +L  +DDP  +FT+L++IG GSFGAVY+A ++++ E++AIK++    K   + W+DI +E+  L++L H N I +KG YL+ +   +VM+YCLGS SD++EV KKPLQE EI  +    L+ L YLH  N IHRD+KA NILLTE G VKLGDFGS+S V+PAN+FVGTP+W+APEVI+AM+ G YD KVD+WSLGIT IE+AE +PP F  +N M+A+YHIA N+SP L + + WS+ F   V + L+K P +RP+++  L   F   +RP  +++ +I   ++AV  RE  + +  KMKKIL Q
Sbjct:   13 SEVSELFYRDDPEKLFTDLREIGHGSFGAVYFAHDVRSNEVVAIKKMSFSGKQSNEKWQDIIKEVKFLQKLRHPNTIEYKGCYLREHTAWLVMEYCLGSASDLLEVHKKPLQEMEIAAITHGALQGLAYLHSHNMIHRDVKAGNILLTEPGQVKLGDFGSASIVSPANSFVGTPYWMAPEVILAMDEGQYDGKVDVWSLGITSIELAERKPPLF-NMNAMSALYHIAQNESPVLAS-NHWSDYFRNFVDSCLQKIPQDRPTSDVLLNHHFLCRERPHSVVMDLITRTKDAV--RELDNLQYRKMKKILFQ 318          
BLAST of Serine/threonine kinase vs. Ensembl Xenopus
Match: cirbp (cold inducible RNA binding protein [Source:Xenbase;Acc:XB-GENE-492781])

HSP 1 Score: 327.405 bits (838), Expect = 2.129e-97
Identity = 160/305 (52.46%), Postives = 211/305 (69.18%), Query Frame = 2
Query:  116 LLCKDDPSTIFTNLKQIGCGSFGAVYYAQNXXXXXXXXXXXXXVDSKSQKDHWKDIKREICLLKQLNHVNCISFKGYYLKGNNPLIVMDYCLGSVSDIIEVFKKPLQEDEIGCVVVEVLKALNYLHKKNFIHRDIKASNILLTECGLVKLGDFGSSSFVNPANTFVGTPFWIAPEVIMAMESGLYDFKVDIWSLGITCIEMAEMEPPHFKTLNPMAAMYHIASNDSPCLLNPSLWSNEFVFLVVAFLKKSPDNRPSAENALQSKFCTIKRPPFILLKMIKNARNAVAAREKSD-KSDKMKKILLQ 1027
            L CK+DP  IF +L +IG GSFGAVY+A N  T E++AIK++    K   + W+DI +E+  L+QL H N I +KG YLK +   +VM+YCLGS SD++EV KKPLQE EI  +    L+ L YLH  N IHRDIKA NILLTE G VKL DFGS+S  +PAN+FVGTP+W+APEVI+AM+ G Y+ K+DIWSLGITCIE+AE +PP F  +N M+A+YHIA N+SP  L  + W++ F   V   L+K P  RP++   LQ  F   +RPP +L+ +I+  ++AV  RE  + +  KMKKIL Q
Sbjct:   21 LFCKEDPERIFVDLHEIGHGSFGAVYFATNSTTNEVVAIKKMSYSGKQMNEKWQDIVKEVKFLQQLQHPNTIEYKGCYLKDHTAWLVMEYCLGSASDLLEVHKKPLQEVEIAAITHGALQGLAYLHSHNMIHRDIKAGNILLTEPGQVKLADFGSASKSSPANSFVGTPYWMAPEVILAMDEGQYEGKIDIWSLGITCIELAERKPPLF-NMNAMSALYHIAQNESPT-LQSNEWTDSFKGFVDYCLQKIPQERPTSLELLQHDFVRRERPPRVLIDLIQRTKDAV--RELDNLQYRKMKKILFQ 321          

HSP 2 Score: 108.612 bits (270), Expect = 1.969e-23
Identity = 115/438 (26.26%), Postives = 208/438 (47.49%), Query Frame = 2
Query: 1520 REQMNGLKRIRNQHKRSIQQLEEKHKNELETTKFSLSRELENVTSTFHKELEKLNKTNSLELDKNNK-------------------------ESRQKELNFVK-------NLETXXXXXXXXXXXXXXXENKNTGQYEVEINNVQKLGDAR------TRKFKRDAIMNRHRLQLKQLDSTLKQEQSQLEQKNALLLQQHDKLVNLQLGHQESMHILRIDQMQKLQNIEIEAQTQYAQQQESFLKKKQAAEVKNFPKYLKVKEQENQKACRDILNIQKKQFKILKEDELRNSRKKHNGESEQQIVDRLKENERQKQVELKAQYDASLEKMKAQELNKLESRHIRETLELENKLQTEKEVLRSFHNSQNEETMKNYNQEHLNLKNQMLNKRNELEVGIQESNRLFSLKRIEMYSELTTYHAKELRNFDLETVQLGIDQIL 2719
            REQM+G KR+R QH++ +  LE K K E++  +  L +E+E   +    ELEKL+K   + ++K  K                         ES++K+    K       N +  + K  K  + +   EN    Q E E    Q L   R       R FKR  ++ RH ++ + +   L ++++Q E ++A+L++  +    L+    + +  LR+D ++     E+E Q +Y +++E  L +K   E++  PK LKV E + +K  +D   +Q KQ+K LK  +L  S K  +    + I+  LK+ + +K   L  QY+ S+ +M A +  +L+     E   L  +LQ E E+L ++ +    +T   + +E   L+ ++  +R  LE  I+E       +R E    L     +E+  FD+E++++G   ++
Sbjct:  423 REQMSGYKRMRRQHQKQLIALENKLKAEMDEHRLKLQKEVETHANNASIELEKLSKRQIVGMEKEAKVAAADERRFQQQIIAQQKKDLTSFLESQKKQYKICKEKIKEEMNEDHSTPKKEKQERISKHKENLQHTQAEEE---AQLLSQQRLYYEKNCRLFKRKIMIKRHEVEQQHIREELNKKRTQKEMEHAMLIRHDESTRELEYRQLQMLQKLRMDLIRLQHQTELENQLEYNKRRERELHRKHVMELRQQPKNLKVMEMQIKKQFQDTCKVQTKQYKALKNHQLEVSPKCEH----KTILKSLKDEQTRKLAILAEQYEQSINEMMASQALRLDEAQEAECQALRQQLQQEMELLNAYQSKIKMQTEAQHERELQKLEQRVSLRRAHLEQKIEEELAALQKERSERIKHLFERQEREIETFDMESLRMGFGNLV 853          
BLAST of Serine/threonine kinase vs. Ensembl Xenopus
Match: cirbp (cold inducible RNA binding protein [Source:Xenbase;Acc:XB-GENE-492781])

HSP 1 Score: 326.635 bits (836), Expect = 4.438e-97
Identity = 159/305 (52.13%), Postives = 211/305 (69.18%), Query Frame = 2
Query:  116 LLCKDDPSTIFTNLKQIGCGSFGAVYYAQNXXXXXXXXXXXXXVDSKSQKDHWKDIKREICLLKQLNHVNCISFKGYYLKGNNPLIVMDYCLGSVSDIIEVFKKPLQEDEIGCVVVEVLKALNYLHKKNFIHRDIKASNILLTECGLVKLGDFGSSSFVNPANTFVGTPFWIAPEVIMAMESGLYDFKVDIWSLGITCIEMAEMEPPHFKTLNPMAAMYHIASNDSPCLLNPSLWSNEFVFLVVAFLKKSPDNRPSAENALQSKFCTIKRPPFILLKMIKNARNAVAAREKSD-KSDKMKKILLQ 1027
            L CK+DP  IF +L +IG GSFGAVY+A N  T E++AIK++    K   + W+DI +E+  L+QL H N I +KG YLK +   +VM+YCLGS SD++EV KKPLQE EI  +    L+ L YLH  N IHRDIKA NILLTE G VKL DFGS+S  +PAN+FVGTP+W+APEVI+AM+ G Y+ K+DIWSLGITCIE+AE +PP F  +N M+A+YHIA N+SP  L  + W++ F   V   L+K P  RP++   L+  F   +RPP +L+ +I+  ++AV  RE  + +  KMKKIL Q
Sbjct:   23 LFCKEDPERIFVDLHEIGHGSFGAVYFATNSTTNEVVAIKKMSYSGKQMNEKWQDIVKEVKFLQQLQHPNTIEYKGCYLKDHTAWLVMEYCLGSASDLLEVHKKPLQEVEIAAITHGALQGLAYLHSHNMIHRDIKAGNILLTEPGQVKLADFGSASKSSPANSFVGTPYWMAPEVILAMDEGQYEGKIDIWSLGITCIELAERKPPLF-NMNAMSALYHIAQNESPT-LQSNEWTDSFKGFVDYCLQKIPQERPTSLELLRHDFVRRERPPRVLIDLIQRTKDAV--RELDNLQYRKMKKILFQ 323          

HSP 2 Score: 108.612 bits (270), Expect = 1.940e-23
Identity = 115/438 (26.26%), Postives = 208/438 (47.49%), Query Frame = 2
Query: 1520 REQMNGLKRIRNQHKRSIQQLEEKHKNELETTKFSLSRELENVTSTFHKELEKLNKTNSLELDKNNK-------------------------ESRQKELNFVK-------NLETXXXXXXXXXXXXXXXENKNTGQYEVEINNVQKLGDAR------TRKFKRDAIMNRHRLQLKQLDSTLKQEQSQLEQKNALLLQQHDKLVNLQLGHQESMHILRIDQMQKLQNIEIEAQTQYAQQQESFLKKKQAAEVKNFPKYLKVKEQENQKACRDILNIQKKQFKILKEDELRNSRKKHNGESEQQIVDRLKENERQKQVELKAQYDASLEKMKAQELNKLESRHIRETLELENKLQTEKEVLRSFHNSQNEETMKNYNQEHLNLKNQMLNKRNELEVGIQESNRLFSLKRIEMYSELTTYHAKELRNFDLETVQLGIDQIL 2719
            REQM+G KR+R QH++ +  LE K K E++  +  L +E+E   +    ELEKL+K   + ++K  K                         ES++K+    K       N +  + K  K  + +   EN    Q E E    Q L   R       R FKR  ++ RH ++ + +   L ++++Q E ++A+L++  +    L+    + +  LR+D ++     E+E Q +Y +++E  L +K   E++  PK LKV E + +K  +D   +Q KQ+K LK  +L  S K  +    + I+  LK+ + +K   L  QY+ S+ +M A +  +L+     E   L  +LQ E E+L ++ +    +T   + +E   L+ ++  +R  LE  I+E       +R E    L     +E+  FD+E++++G   ++
Sbjct:  425 REQMSGYKRMRRQHQKQLIALENKLKAEMDEHRLKLQKEVETHANNASIELEKLSKRQIVGMEKEAKVAAADERRFQQQIIAQQKKDLTSFLESQKKQYKICKEKIKEEMNEDHSTPKKEKQERISKHKENLQHTQAEEE---AQLLSQQRLYYEKNCRLFKRKIMIKRHEVEQQHIREELNKKRTQKEMEHAMLIRHDESTRELEYRQLQMLQKLRMDLIRLQHQTELENQLEYNKRRERELHRKHVMELRQQPKNLKVMEMQIKKQFQDTCKVQTKQYKALKNHQLEVSPKCEH----KTILKSLKDEQTRKLAILAEQYEQSINEMMASQALRLDEAQEAECQALRQQLQQEMELLNAYQSKIKMQTEAQHERELQKLEQRVSLRRAHLEQKIEEELAALQKERSERIKHLFERQEREIETFDMESLRMGFGNLV 855          
BLAST of Serine/threonine kinase vs. Ensembl Xenopus
Match: cirbp (cold inducible RNA binding protein [Source:Xenbase;Acc:XB-GENE-492781])

HSP 1 Score: 327.405 bits (838), Expect = 5.433e-97
Identity = 160/305 (52.46%), Postives = 211/305 (69.18%), Query Frame = 2
Query:  116 LLCKDDPSTIFTNLKQIGCGSFGAVYYAQNXXXXXXXXXXXXXVDSKSQKDHWKDIKREICLLKQLNHVNCISFKGYYLKGNNPLIVMDYCLGSVSDIIEVFKKPLQEDEIGCVVVEVLKALNYLHKKNFIHRDIKASNILLTECGLVKLGDFGSSSFVNPANTFVGTPFWIAPEVIMAMESGLYDFKVDIWSLGITCIEMAEMEPPHFKTLNPMAAMYHIASNDSPCLLNPSLWSNEFVFLVVAFLKKSPDNRPSAENALQSKFCTIKRPPFILLKMIKNARNAVAAREKSD-KSDKMKKILLQ 1027
            L CK+DP  IF +L +IG GSFGAVY+A N  T E++AIK++    K   + W+DI +E+  L+QL H N I +KG YLK +   +VM+YCLGS SD++EV KKPLQE EI  +    L+ L YLH  N IHRDIKA NILLTE G VKL DFGS+S  +PAN+FVGTP+W+APEVI+AM+ G Y+ K+DIWSLGITCIE+AE +PP F  +N M+A+YHIA N+SP  L  + W++ F   V   L+K P  RP++   LQ  F   +RPP +L+ +I+  ++AV  RE  + +  KMKKIL Q
Sbjct:   23 LFCKEDPERIFVDLHEIGHGSFGAVYFATNSTTNEVVAIKKMSYSGKQMNEKWQDIVKEVKFLQQLQHPNTIEYKGCYLKDHTAWLVMEYCLGSASDLLEVHKKPLQEVEIAAITHGALQGLAYLHSHNMIHRDIKAGNILLTEPGQVKLADFGSASKSSPANSFVGTPYWMAPEVILAMDEGQYEGKIDIWSLGITCIELAERKPPLF-NMNAMSALYHIAQNESPT-LQSNEWTDSFKGFVDYCLQKIPQERPTSLELLQHDFVRRERPPRVLIDLIQRTKDAV--RELDNLQYRKMKKILFQ 323          

HSP 2 Score: 109.768 bits (273), Expect = 9.549e-24
Identity = 115/438 (26.26%), Postives = 208/438 (47.49%), Query Frame = 2
Query: 1520 REQMNGLKRIRNQHKRSIQQLEEKHKNELETTKFSLSRELENVTSTFHKELEKLNKTNSLELDKNNK-------------------------ESRQKELNFVK-------NLETXXXXXXXXXXXXXXXENKNTGQYEVEINNVQKLGDAR------TRKFKRDAIMNRHRLQLKQLDSTLKQEQSQLEQKNALLLQQHDKLVNLQLGHQESMHILRIDQMQKLQNIEIEAQTQYAQQQESFLKKKQAAEVKNFPKYLKVKEQENQKACRDILNIQKKQFKILKEDELRNSRKKHNGESEQQIVDRLKENERQKQVELKAQYDASLEKMKAQELNKLESRHIRETLELENKLQTEKEVLRSFHNSQNEETMKNYNQEHLNLKNQMLNKRNELEVGIQESNRLFSLKRIEMYSELTTYHAKELRNFDLETVQLGIDQIL 2719
            REQM+G KR+R QH++ +  LE K K E++  +  L +E+E   +    ELEKL+K   + ++K  K                         ES++K+    K       N +  + K  K  + +   EN    Q E E    Q L   R       R FKR  ++ RH ++ + +   L ++++Q E ++A+L++  +    L+    + +  LR+D ++     E+E Q +Y +++E  L +K   E++  PK LKV E + +K  +D   +Q KQ+K LK  +L  S K  +    + I+  LK+ + +K   L  QY+ S+ +M A +  +L+     E   L  +LQ E E+L ++ +    +T   + +E   L+ ++  +R  LE  I+E       +R E    L     +E+  FD+E++++G   ++
Sbjct:  425 REQMSGYKRMRRQHQKQLIALENKLKAEMDEHRLKLQKEVETHANNASIELEKLSKRQIVGMEKEAKVAAADERRFQQQIIAQQKKDLTSFLESQKKQYKICKEKIKEEMNEDHSTPKKEKQERISKHKENLQHTQAEEE---AQLLSQQRLYYEKNCRLFKRKIMIKRHEVEQQHIREELNKKRTQKEMEHAMLIRHDESTRELEYRQLQMLQKLRMDLIRLQHQTELENQLEYNKRRERELHRKHVMELRQQPKNLKVMEMQIKKQFQDTCKVQTKQYKALKNHQLEVSPKCEH----KTILKSLKDEQTRKLAILAEQYEQSINEMMASQALRLDEAQEAECQALRQQLQQEMELLNAYQSKIKMQTEAQHERELQKLEQRVSLRRAHLEQKIEEELAALQKERSERIKHLFERQEREIETFDMESLRMGFGNLV 855          
BLAST of Serine/threonine kinase vs. Ensembl Xenopus
Match: cirbp (cold inducible RNA binding protein [Source:Xenbase;Acc:XB-GENE-492781])

HSP 1 Score: 326.635 bits (836), Expect = 1.050e-96
Identity = 159/305 (52.13%), Postives = 211/305 (69.18%), Query Frame = 2
Query:  116 LLCKDDPSTIFTNLKQIGCGSFGAVYYAQNXXXXXXXXXXXXXVDSKSQKDHWKDIKREICLLKQLNHVNCISFKGYYLKGNNPLIVMDYCLGSVSDIIEVFKKPLQEDEIGCVVVEVLKALNYLHKKNFIHRDIKASNILLTECGLVKLGDFGSSSFVNPANTFVGTPFWIAPEVIMAMESGLYDFKVDIWSLGITCIEMAEMEPPHFKTLNPMAAMYHIASNDSPCLLNPSLWSNEFVFLVVAFLKKSPDNRPSAENALQSKFCTIKRPPFILLKMIKNARNAVAAREKSD-KSDKMKKILLQ 1027
            L CK+DP  IF +L +IG GSFGAVY+A N  T E++AIK++    K   + W+DI +E+  L+QL H N I +KG YLK +   +VM+YCLGS SD++EV KKPLQE EI  +    L+ L YLH  N IHRDIKA NILLTE G VKL DFGS+S  +PAN+FVGTP+W+APEVI+AM+ G Y+ K+DIWSLGITCIE+AE +PP F  +N M+A+YHIA N+SP  L  + W++ F   V   L+K P  RP++   L+  F   +RPP +L+ +I+  ++AV  RE  + +  KMKKIL Q
Sbjct:   23 LFCKEDPERIFVDLHEIGHGSFGAVYFATNSTTNEVVAIKKMSYSGKQMNEKWQDIVKEVKFLQQLQHPNTIEYKGCYLKDHTAWLVMEYCLGSASDLLEVHKKPLQEVEIAAITHGALQGLAYLHSHNMIHRDIKAGNILLTEPGQVKLADFGSASKSSPANSFVGTPYWMAPEVILAMDEGQYEGKIDIWSLGITCIELAERKPPLF-NMNAMSALYHIAQNESPT-LQSNEWTDSFKGFVDYCLQKIPQERPTSLELLRHDFVRRERPPRVLIDLIQRTKDAV--RELDNLQYRKMKKILFQ 323          

HSP 2 Score: 108.227 bits (269), Expect = 2.527e-23
Identity = 115/438 (26.26%), Postives = 208/438 (47.49%), Query Frame = 2
Query: 1520 REQMNGLKRIRNQHKRSIQQLEEKHKNELETTKFSLSRELENVTSTFHKELEKLNKTNSLELDKNNK-------------------------ESRQKELNFVK-------NLETXXXXXXXXXXXXXXXENKNTGQYEVEINNVQKLGDAR------TRKFKRDAIMNRHRLQLKQLDSTLKQEQSQLEQKNALLLQQHDKLVNLQLGHQESMHILRIDQMQKLQNIEIEAQTQYAQQQESFLKKKQAAEVKNFPKYLKVKEQENQKACRDILNIQKKQFKILKEDELRNSRKKHNGESEQQIVDRLKENERQKQVELKAQYDASLEKMKAQELNKLESRHIRETLELENKLQTEKEVLRSFHNSQNEETMKNYNQEHLNLKNQMLNKRNELEVGIQESNRLFSLKRIEMYSELTTYHAKELRNFDLETVQLGIDQIL 2719
            REQM+G KR+R QH++ +  LE K K E++  +  L +E+E   +    ELEKL+K   + ++K  K                         ES++K+    K       N +  + K  K  + +   EN    Q E E    Q L   R       R FKR  ++ RH ++ + +   L ++++Q E ++A+L++  +    L+    + +  LR+D ++     E+E Q +Y +++E  L +K   E++  PK LKV E + +K  +D   +Q KQ+K LK  +L  S K  +    + I+  LK+ + +K   L  QY+ S+ +M A +  +L+     E   L  +LQ E E+L ++ +    +T   + +E   L+ ++  +R  LE  I+E       +R E    L     +E+  FD+E++++G   ++
Sbjct:  465 REQMSGYKRMRRQHQKQLIALENKLKAEMDEHRLKLQKEVETHANNASIELEKLSKRQIVGMEKEAKVAAADERRFQQQIIAQQKKDLTSFLESQKKQYKICKEKIKEEMNEDHSTPKKEKQERISKHKENLQHTQAEEE---AQLLSQQRLYYEKNCRLFKRKIMIKRHEVEQQHIREELNKKRTQKEMEHAMLIRHDESTRELEYRQLQMLQKLRMDLIRLQHQTELENQLEYNKRRERELHRKHVMELRQQPKNLKVMEMQIKKQFQDTCKVQTKQYKALKNHQLEVSPKCEH----KTILKSLKDEQTRKLAILAEQYEQSINEMMASQALRLDEAQEAECQALRQQLQQEMELLNAYQSKIKMQTEAQHERELQKLEQRVSLRRAHLEQKIEEELAALQKERSERIKHLFERQEREIETFDMESLRMGFGNLV 895          
BLAST of Serine/threonine kinase vs. Ensembl Xenopus
Match: cirbp (cold inducible RNA binding protein [Source:Xenbase;Acc:XB-GENE-492781])

HSP 1 Score: 326.635 bits (836), Expect = 1.214e-96
Identity = 159/305 (52.13%), Postives = 211/305 (69.18%), Query Frame = 2
Query:  116 LLCKDDPSTIFTNLKQIGCGSFGAVYYAQNXXXXXXXXXXXXXVDSKSQKDHWKDIKREICLLKQLNHVNCISFKGYYLKGNNPLIVMDYCLGSVSDIIEVFKKPLQEDEIGCVVVEVLKALNYLHKKNFIHRDIKASNILLTECGLVKLGDFGSSSFVNPANTFVGTPFWIAPEVIMAMESGLYDFKVDIWSLGITCIEMAEMEPPHFKTLNPMAAMYHIASNDSPCLLNPSLWSNEFVFLVVAFLKKSPDNRPSAENALQSKFCTIKRPPFILLKMIKNARNAVAAREKSD-KSDKMKKILLQ 1027
            L CK+DP  IF +L +IG GSFGAVY+A N  T E++AIK++    K   + W+DI +E+  L+QL H N I +KG YLK +   +VM+YCLGS SD++EV KKPLQE EI  +    L+ L YLH  N IHRDIKA NILLTE G VKL DFGS+S  +PAN+FVGTP+W+APEVI+AM+ G Y+ K+DIWSLGITCIE+AE +PP F  +N M+A+YHIA N+SP  L  + W++ F   V   L+K P  RP++   L+  F   +RPP +L+ +I+  ++AV  RE  + +  KMKKIL Q
Sbjct:   29 LFCKEDPERIFVDLHEIGHGSFGAVYFATNSTTNEVVAIKKMSYSGKQMNEKWQDIVKEVKFLQQLQHPNTIEYKGCYLKDHTAWLVMEYCLGSASDLLEVHKKPLQEVEIAAITHGALQGLAYLHSHNMIHRDIKAGNILLTEPGQVKLADFGSASKSSPANSFVGTPYWMAPEVILAMDEGQYEGKIDIWSLGITCIELAERKPPLF-NMNAMSALYHIAQNESPT-LQSNEWTDSFKGFVDYCLQKIPQERPTSLELLRHDFVRRERPPRVLIDLIQRTKDAV--RELDNLQYRKMKKILFQ 329          

HSP 2 Score: 108.227 bits (269), Expect = 2.459e-23
Identity = 115/438 (26.26%), Postives = 208/438 (47.49%), Query Frame = 2
Query: 1520 REQMNGLKRIRNQHKRSIQQLEEKHKNELETTKFSLSRELENVTSTFHKELEKLNKTNSLELDKNNK-------------------------ESRQKELNFVK-------NLETXXXXXXXXXXXXXXXENKNTGQYEVEINNVQKLGDAR------TRKFKRDAIMNRHRLQLKQLDSTLKQEQSQLEQKNALLLQQHDKLVNLQLGHQESMHILRIDQMQKLQNIEIEAQTQYAQQQESFLKKKQAAEVKNFPKYLKVKEQENQKACRDILNIQKKQFKILKEDELRNSRKKHNGESEQQIVDRLKENERQKQVELKAQYDASLEKMKAQELNKLESRHIRETLELENKLQTEKEVLRSFHNSQNEETMKNYNQEHLNLKNQMLNKRNELEVGIQESNRLFSLKRIEMYSELTTYHAKELRNFDLETVQLGIDQIL 2719
            REQM+G KR+R QH++ +  LE K K E++  +  L +E+E   +    ELEKL+K   + ++K  K                         ES++K+    K       N +  + K  K  + +   EN    Q E E    Q L   R       R FKR  ++ RH ++ + +   L ++++Q E ++A+L++  +    L+    + +  LR+D ++     E+E Q +Y +++E  L +K   E++  PK LKV E + +K  +D   +Q KQ+K LK  +L  S K  +    + I+  LK+ + +K   L  QY+ S+ +M A +  +L+     E   L  +LQ E E+L ++ +    +T   + +E   L+ ++  +R  LE  I+E       +R E    L     +E+  FD+E++++G   ++
Sbjct:  471 REQMSGYKRMRRQHQKQLIALENKLKAEMDEHRLKLQKEVETHANNASIELEKLSKRQIVGMEKEAKVAAADERRFQQQIIAQQKKDLTSFLESQKKQYKICKEKIKEEMNEDHSTPKKEKQERISKHKENLQHTQAEEE---AQLLSQQRLYYEKNCRLFKRKIMIKRHEVEQQHIREELNKKRTQKEMEHAMLIRHDESTRELEYRQLQMLQKLRMDLIRLQHQTELENQLEYNKRRERELHRKHVMELRQQPKNLKVMEMQIKKQFQDTCKVQTKQYKALKNHQLEVSPKCEH----KTILKSLKDEQTRKLAILAEQYEQSINEMMASQALRLDEAQEAECQALRQQLQQEMELLNAYQSKIKMQTEAQHERELQKLEQRVSLRRAHLEQKIEEELAALQKERSERIKHLFERQEREIETFDMESLRMGFGNLV 901          
BLAST of Serine/threonine kinase vs. Ensembl Mouse
Match: Taok3 (TAO kinase 3 [Source:MGI Symbol;Acc:MGI:3041177])

HSP 1 Score: 327.791 bits (839), Expect = 2.589e-97
Identity = 161/309 (52.10%), Postives = 210/309 (67.96%), Query Frame = 2
Query:  104 EFDQLLCKDDPSTIFTNLKQIGCGSFGAVYYAQNXXXXXXXXXXXXXVDSKSQKDHWKDIKREICLLKQLNHVNCISFKGYYLKGNNPLIVMDYCLGSVSDIIEVFKKPLQEDEIGCVVVEVLKALNYLHKKNFIHRDIKASNILLTECGLVKLGDFGSSSFVNPANTFVGTPFWIAPEVIMAMESGLYDFKVDIWSLGITCIEMAEMEPPHFKTLNPMAAMYHIASNDSPCLLNPSLWSNEFVFLVVAFLKKSPDNRPSAENALQSKFCTIKRPPFILLKMIKNARNAVAAREKSD-KSDKMKKILLQ 1027
            E   L  KDDP  +F +L +IG GSFGAVY+A N  T E++A+K++    K   + W+DI +E+  L+QL H N I +KG YLK +   +VM+YCLGS SD++EV KKPLQE EI  +    L+ L YLH  + IHRDIKA NILLTE G VKL DFGS+S  +PAN+FVGTP+W+APEVI+AM+ G YD KVDIWSLGITCIE+AE +PP F  +N M+A+YHIA NDSP L +   W++ F   V   L K P  RP+A   L+  F   +RPP +L+ +I+  ++AV  RE  + +  KMKKIL Q
Sbjct:   10 EIADLFFKDDPEELFIDLHEIGHGSFGAVYFATNAHTNEVVAVKKMSYSGKQTHEKWQDILKEVKFLQQLKHPNTIEYKGCYLKEHTAWLVMEYCLGSASDLLEVHKKPLQEVEIAAITHGALQGLAYLHFHSLIHRDIKAGNILLTEPGQVKLADFGSASMASPANSFVGTPYWMAPEVILAMDEGQYDGKVDIWSLGITCIELAERKPPLF-NMNAMSALYHIAQNDSPTLQSRE-WTDSFRRFVDYCLHKIPQERPAAVELLRHDFIRRERPPKVLIDLIQRTKDAV--RELDNLQYRKMKKILFQ 314          

HSP 2 Score: 103.219 bits (256), Expect = 6.098e-22
Identity = 113/435 (25.98%), Postives = 206/435 (47.36%), Query Frame = 2
Query: 1520 REQMNGLKRIRNQHKRSIQQLEEKHKNELETTKFSLSRELENVTSTFHKELEKLNKTNSLELDKNNK-------------------------ESRQKELNFVK-------NLETXXXXXXXXXXXXXXXENKNTGQYEVEIN--NVQKLG-DARTRKFKRDAIMNRHRLQLKQLDSTLKQEQSQLEQKNALLLQQHDKLVNLQLGHQESMHILRIDQMQKLQNIEIEAQTQYAQQQESFLKKKQAAEVKNFPKYLKVKEQENQKACRDILNIQKKQFKILKEDELRNSRKKHNGESEQQIVDRLKENERQKQVELKAQYDASLEKMKAQELNKLESRHIRETLELENKLQTEKEVLRSFHNSQNEETMKNYNQEHLNLKNQMLNKRNELEVGIQESNRLFSLKRIEMYSELTTYHAKELRNFDLETVQLGIDQIL 2719
            REQM+G KR+R QH++ +  LE K K E++  +  L +E+E   +    ELEKL K     ++K  K                         ES++K+    K       N +  + K  K  + +   EN    Q E E +    Q+L  D   R FKR  ++ RH ++ + +   L ++++Q E ++A+L++  +    L+     ++  LR+D ++     E+E Q +Y +++E  L +K   E++  PK LK  E + +K  +D   +Q KQ+K LK  +L  + K  +    + I+  LK+ + +K   L  QY+ S+ +M A +  +L+     E   L  +LQ E E+L ++ +    +T   + +E   L+ ++  +R  LE  I+E       +R E    L     +E   FD+E++++G   ++
Sbjct:  458 REQMSGYKRMRRQHQKQLIALENKLKAEMDEHRLKLQKEVETHANNSSIELEKLAKKQVATIEKEAKVAAADEKKFQQQILAQQKKDLTTFLESQKKQYKICKEKIKEEMNEDHSTPKKEKQERISKHKENLQHTQAEEEAHLLTQQRLYYDRNCRFFKRKIMIKRHEVEQQNIREELNKKRTQKEMEHAMLIRHDESTRELEYRQLHTLQKLRMDLIRLQHQTELENQLEYNKRRERELHRKHVMELRQQPKNLKAMEMQIKKQFQDTCKVQTKQYKALKNHQLEVTPKNEH----KAILKTLKDEQTRKLAILAEQYEQSINEMMASQALRLDEAQEAECQALRLQLQQEMELLNAYQSKIKMQTEAQHERELQKLEQRVSLRRAHLEQKIEEELAALQKERSERIKTLLERQERETETFDMESLRMGFGNLV 888          
BLAST of Serine/threonine kinase vs. Ensembl Mouse
Match: Taok3 (TAO kinase 3 [Source:MGI Symbol;Acc:MGI:3041177])

HSP 1 Score: 327.791 bits (839), Expect = 2.589e-97
Identity = 161/309 (52.10%), Postives = 210/309 (67.96%), Query Frame = 2
Query:  104 EFDQLLCKDDPSTIFTNLKQIGCGSFGAVYYAQNXXXXXXXXXXXXXVDSKSQKDHWKDIKREICLLKQLNHVNCISFKGYYLKGNNPLIVMDYCLGSVSDIIEVFKKPLQEDEIGCVVVEVLKALNYLHKKNFIHRDIKASNILLTECGLVKLGDFGSSSFVNPANTFVGTPFWIAPEVIMAMESGLYDFKVDIWSLGITCIEMAEMEPPHFKTLNPMAAMYHIASNDSPCLLNPSLWSNEFVFLVVAFLKKSPDNRPSAENALQSKFCTIKRPPFILLKMIKNARNAVAAREKSD-KSDKMKKILLQ 1027
            E   L  KDDP  +F +L +IG GSFGAVY+A N  T E++A+K++    K   + W+DI +E+  L+QL H N I +KG YLK +   +VM+YCLGS SD++EV KKPLQE EI  +    L+ L YLH  + IHRDIKA NILLTE G VKL DFGS+S  +PAN+FVGTP+W+APEVI+AM+ G YD KVDIWSLGITCIE+AE +PP F  +N M+A+YHIA NDSP L +   W++ F   V   L K P  RP+A   L+  F   +RPP +L+ +I+  ++AV  RE  + +  KMKKIL Q
Sbjct:   10 EIADLFFKDDPEELFIDLHEIGHGSFGAVYFATNAHTNEVVAVKKMSYSGKQTHEKWQDILKEVKFLQQLKHPNTIEYKGCYLKEHTAWLVMEYCLGSASDLLEVHKKPLQEVEIAAITHGALQGLAYLHFHSLIHRDIKAGNILLTEPGQVKLADFGSASMASPANSFVGTPYWMAPEVILAMDEGQYDGKVDIWSLGITCIELAERKPPLF-NMNAMSALYHIAQNDSPTLQSRE-WTDSFRRFVDYCLHKIPQERPAAVELLRHDFIRRERPPKVLIDLIQRTKDAV--RELDNLQYRKMKKILFQ 314          

HSP 2 Score: 103.219 bits (256), Expect = 6.098e-22
Identity = 113/435 (25.98%), Postives = 206/435 (47.36%), Query Frame = 2
Query: 1520 REQMNGLKRIRNQHKRSIQQLEEKHKNELETTKFSLSRELENVTSTFHKELEKLNKTNSLELDKNNK-------------------------ESRQKELNFVK-------NLETXXXXXXXXXXXXXXXENKNTGQYEVEIN--NVQKLG-DARTRKFKRDAIMNRHRLQLKQLDSTLKQEQSQLEQKNALLLQQHDKLVNLQLGHQESMHILRIDQMQKLQNIEIEAQTQYAQQQESFLKKKQAAEVKNFPKYLKVKEQENQKACRDILNIQKKQFKILKEDELRNSRKKHNGESEQQIVDRLKENERQKQVELKAQYDASLEKMKAQELNKLESRHIRETLELENKLQTEKEVLRSFHNSQNEETMKNYNQEHLNLKNQMLNKRNELEVGIQESNRLFSLKRIEMYSELTTYHAKELRNFDLETVQLGIDQIL 2719
            REQM+G KR+R QH++ +  LE K K E++  +  L +E+E   +    ELEKL K     ++K  K                         ES++K+    K       N +  + K  K  + +   EN    Q E E +    Q+L  D   R FKR  ++ RH ++ + +   L ++++Q E ++A+L++  +    L+     ++  LR+D ++     E+E Q +Y +++E  L +K   E++  PK LK  E + +K  +D   +Q KQ+K LK  +L  + K  +    + I+  LK+ + +K   L  QY+ S+ +M A +  +L+     E   L  +LQ E E+L ++ +    +T   + +E   L+ ++  +R  LE  I+E       +R E    L     +E   FD+E++++G   ++
Sbjct:  458 REQMSGYKRMRRQHQKQLIALENKLKAEMDEHRLKLQKEVETHANNSSIELEKLAKKQVATIEKEAKVAAADEKKFQQQILAQQKKDLTTFLESQKKQYKICKEKIKEEMNEDHSTPKKEKQERISKHKENLQHTQAEEEAHLLTQQRLYYDRNCRFFKRKIMIKRHEVEQQNIREELNKKRTQKEMEHAMLIRHDESTRELEYRQLHTLQKLRMDLIRLQHQTELENQLEYNKRRERELHRKHVMELRQQPKNLKAMEMQIKKQFQDTCKVQTKQYKALKNHQLEVTPKNEH----KAILKTLKDEQTRKLAILAEQYEQSINEMMASQALRLDEAQEAECQALRLQLQQEMELLNAYQSKIKMQTEAQHERELQKLEQRVSLRRAHLEQKIEEELAALQKERSERIKTLLERQERETETFDMESLRMGFGNLV 888          
BLAST of Serine/threonine kinase vs. Ensembl Mouse
Match: Taok3 (TAO kinase 3 [Source:MGI Symbol;Acc:MGI:3041177])

HSP 1 Score: 327.791 bits (839), Expect = 2.589e-97
Identity = 161/309 (52.10%), Postives = 210/309 (67.96%), Query Frame = 2
Query:  104 EFDQLLCKDDPSTIFTNLKQIGCGSFGAVYYAQNXXXXXXXXXXXXXVDSKSQKDHWKDIKREICLLKQLNHVNCISFKGYYLKGNNPLIVMDYCLGSVSDIIEVFKKPLQEDEIGCVVVEVLKALNYLHKKNFIHRDIKASNILLTECGLVKLGDFGSSSFVNPANTFVGTPFWIAPEVIMAMESGLYDFKVDIWSLGITCIEMAEMEPPHFKTLNPMAAMYHIASNDSPCLLNPSLWSNEFVFLVVAFLKKSPDNRPSAENALQSKFCTIKRPPFILLKMIKNARNAVAAREKSD-KSDKMKKILLQ 1027
            E   L  KDDP  +F +L +IG GSFGAVY+A N  T E++A+K++    K   + W+DI +E+  L+QL H N I +KG YLK +   +VM+YCLGS SD++EV KKPLQE EI  +    L+ L YLH  + IHRDIKA NILLTE G VKL DFGS+S  +PAN+FVGTP+W+APEVI+AM+ G YD KVDIWSLGITCIE+AE +PP F  +N M+A+YHIA NDSP L +   W++ F   V   L K P  RP+A   L+  F   +RPP +L+ +I+  ++AV  RE  + +  KMKKIL Q
Sbjct:   10 EIADLFFKDDPEELFIDLHEIGHGSFGAVYFATNAHTNEVVAVKKMSYSGKQTHEKWQDILKEVKFLQQLKHPNTIEYKGCYLKEHTAWLVMEYCLGSASDLLEVHKKPLQEVEIAAITHGALQGLAYLHFHSLIHRDIKAGNILLTEPGQVKLADFGSASMASPANSFVGTPYWMAPEVILAMDEGQYDGKVDIWSLGITCIELAERKPPLF-NMNAMSALYHIAQNDSPTLQSRE-WTDSFRRFVDYCLHKIPQERPAAVELLRHDFIRRERPPKVLIDLIQRTKDAV--RELDNLQYRKMKKILFQ 314          

HSP 2 Score: 103.219 bits (256), Expect = 6.098e-22
Identity = 113/435 (25.98%), Postives = 206/435 (47.36%), Query Frame = 2
Query: 1520 REQMNGLKRIRNQHKRSIQQLEEKHKNELETTKFSLSRELENVTSTFHKELEKLNKTNSLELDKNNK-------------------------ESRQKELNFVK-------NLETXXXXXXXXXXXXXXXENKNTGQYEVEIN--NVQKLG-DARTRKFKRDAIMNRHRLQLKQLDSTLKQEQSQLEQKNALLLQQHDKLVNLQLGHQESMHILRIDQMQKLQNIEIEAQTQYAQQQESFLKKKQAAEVKNFPKYLKVKEQENQKACRDILNIQKKQFKILKEDELRNSRKKHNGESEQQIVDRLKENERQKQVELKAQYDASLEKMKAQELNKLESRHIRETLELENKLQTEKEVLRSFHNSQNEETMKNYNQEHLNLKNQMLNKRNELEVGIQESNRLFSLKRIEMYSELTTYHAKELRNFDLETVQLGIDQIL 2719
            REQM+G KR+R QH++ +  LE K K E++  +  L +E+E   +    ELEKL K     ++K  K                         ES++K+    K       N +  + K  K  + +   EN    Q E E +    Q+L  D   R FKR  ++ RH ++ + +   L ++++Q E ++A+L++  +    L+     ++  LR+D ++     E+E Q +Y +++E  L +K   E++  PK LK  E + +K  +D   +Q KQ+K LK  +L  + K  +    + I+  LK+ + +K   L  QY+ S+ +M A +  +L+     E   L  +LQ E E+L ++ +    +T   + +E   L+ ++  +R  LE  I+E       +R E    L     +E   FD+E++++G   ++
Sbjct:  458 REQMSGYKRMRRQHQKQLIALENKLKAEMDEHRLKLQKEVETHANNSSIELEKLAKKQVATIEKEAKVAAADEKKFQQQILAQQKKDLTTFLESQKKQYKICKEKIKEEMNEDHSTPKKEKQERISKHKENLQHTQAEEEAHLLTQQRLYYDRNCRFFKRKIMIKRHEVEQQNIREELNKKRTQKEMEHAMLIRHDESTRELEYRQLHTLQKLRMDLIRLQHQTELENQLEYNKRRERELHRKHVMELRQQPKNLKAMEMQIKKQFQDTCKVQTKQYKALKNHQLEVTPKNEH----KAILKTLKDEQTRKLAILAEQYEQSINEMMASQALRLDEAQEAECQALRLQLQQEMELLNAYQSKIKMQTEAQHERELQKLEQRVSLRRAHLEQKIEEELAALQKERSERIKTLLERQERETETFDMESLRMGFGNLV 888          
BLAST of Serine/threonine kinase vs. Ensembl Mouse
Match: Taok3 (TAO kinase 3 [Source:MGI Symbol;Acc:MGI:3041177])

HSP 1 Score: 318.161 bits (814), Expect = 3.159e-97
Identity = 161/309 (52.10%), Postives = 210/309 (67.96%), Query Frame = 2
Query:  104 EFDQLLCKDDPSTIFTNLKQIGCGSFGAVYYAQNXXXXXXXXXXXXXVDSKSQKDHWKDIKREICLLKQLNHVNCISFKGYYLKGNNPLIVMDYCLGSVSDIIEVFKKPLQEDEIGCVVVEVLKALNYLHKKNFIHRDIKASNILLTECGLVKLGDFGSSSFVNPANTFVGTPFWIAPEVIMAMESGLYDFKVDIWSLGITCIEMAEMEPPHFKTLNPMAAMYHIASNDSPCLLNPSLWSNEFVFLVVAFLKKSPDNRPSAENALQSKFCTIKRPPFILLKMIKNARNAVAAREKSD-KSDKMKKILLQ 1027
            E   L  KDDP  +F +L +IG GSFGAVY+A N  T E++A+K++    K   + W+DI +E+  L+QL H N I +KG YLK +   +VM+YCLGS SD++EV KKPLQE EI  +    L+ L YLH  + IHRDIKA NILLTE G VKL DFGS+S  +PAN+FVGTP+W+APEVI+AM+ G YD KVDIWSLGITCIE+AE +PP F  +N M+A+YHIA NDSP L +   W++ F   V   L K P  RP+A   L+  F   +RPP +L+ +I+  ++AV  RE  + +  KMKKIL Q
Sbjct:   10 EIADLFFKDDPEELFIDLHEIGHGSFGAVYFATNAHTNEVVAVKKMSYSGKQTHEKWQDILKEVKFLQQLKHPNTIEYKGCYLKEHTAWLVMEYCLGSASDLLEVHKKPLQEVEIAAITHGALQGLAYLHFHSLIHRDIKAGNILLTEPGQVKLADFGSASMASPANSFVGTPYWMAPEVILAMDEGQYDGKVDIWSLGITCIELAERKPPLF-NMNAMSALYHIAQNDSPTLQSRE-WTDSFRRFVDYCLHKIPQERPAAVELLRHDFIRRERPPKVLIDLIQRTKDAV--RELDNLQYRKMKKILFQ 314          
BLAST of Serine/threonine kinase vs. Ensembl Mouse
Match: Taok2 (TAO kinase 2 [Source:MGI Symbol;Acc:MGI:1915919])

HSP 1 Score: 328.561 bits (841), Expect = 1.822e-96
Identity = 156/306 (50.98%), Postives = 220/306 (71.90%), Query Frame = 2
Query:  113 QLLCKDDPSTIFTNLKQIGCGSFGAVYYAQNXXXXXXXXXXXXXVDSKSQKDHWKDIKREICLLKQLNHVNCISFKGYYLKGNNPLIVMDYCLGSVSDIIEVFKKPLQEDEIGCVVVEVLKALNYLHKKNFIHRDIKASNILLTECGLVKLGDFGSSSFVNPANTFVGTPFWIAPEVIMAMESGLYDFKVDIWSLGITCIEMAEMEPPHFKTLNPMAAMYHIASNDSPCLLNPSLWSNEFVFLVVAFLKKSPDNRPSAENALQSKFCTIKRPPFILLKMIKNARNAVAAREKSD-KSDKMKKILLQ 1027
            +L  KDDP  +F++L++IG GSFGAVY+A++++  E++AIK++    K   + W+DI +E+  L++L H N I ++G YL+ +   +VM+YCLGS SD++EV KKPLQE EI  V    L+ L YLH  N IHRD+KA NILL+E GLVKLGDFGS+S + PAN+FVGTP+W+APEVI+AM+ G YD KVD+WSLGITCIE+AE +PP F  +N M+A+YHIA N+SP L +   WS  F   V + L+K P +RP++E  L+ +F   +RPP +++ +I+  ++AV  RE  + +  KMKKIL Q
Sbjct:   17 ELFFKDDPEKLFSDLREIGHGSFGAVYFARDVRNSEVVAIKKMSYSGKQSNEKWQDIIKEVRFLQKLRHPNTIQYRGCYLREHTAWLVMEYCLGSASDLLEVHKKPLQEVEIAAVTHGALQGLAYLHSHNMIHRDVKAGNILLSEPGLVKLGDFGSASIMAPANSFVGTPYWMAPEVILAMDEGQYDGKVDVWSLGITCIELAERKPPLF-NMNAMSALYHIAQNESPALQS-GHWSEYFRNFVDSCLQKIPQDRPTSEVLLKHRFVLRERPPTVIMDLIQRTKDAV--RELDNLQYRKMKKILFQ 318          

HSP 2 Score: 103.99 bits (258), Expect = 4.429e-22
Identity = 114/442 (25.79%), Postives = 209/442 (47.29%), Query Frame = 2
Query: 1520 REQMNGLKRIRNQHKRSIQQLEEKHKNELETTKFSLSRELENVTSTFHKELEKLNKTNSLELDKNNKESRQKELNFVKNL--------------ETXXXXXXXXXXXXXXXENKNTGQYEV---------EINNVQKLGDA------------RTRKFKRDAIMNRHRLQLKQLDSTLKQEQSQLEQKNALLLQQHDKLVNLQLGHQESMHILRIDQMQKLQNIEIEAQTQYAQQQESFLKKKQAAEVKNFPKYLKVKEQENQKACRDILNIQKKQFKILKEDELRNSRKKHNGESEQQIVDRLKENERQKQVELKAQYDASLEKMKAQELNKLESRHIRETLELENKLQTEKEVLRSFHNSQNEETMKNYNQEHLNLKNQMLNKRNELEVGIQESNRLFSLKRIEMYSELTTYHAKELRNFDLETVQLGIDQILINSISSD 2740
            REQ++G KR+R QH++ +  LE + + E E     L RELE   + F  E EKL + +    +K  + ++ +E  F +++              +  + K  K   K    EN +T + E          ++   Q   +A            + R++KR  ++ RH L    L   L ++Q+Q + + ALLL+QH+    L+L   +++   R +  +     E+  Q +Y +++E  L++K AA+V+  PK LK KE + +K  ++   IQ +Q+K L+   L  + K  +    + ++ RLKE + +K   L  QYD S+ +M + +  +L+     E   L  +LQ E E+L ++ +     T   + +E   L+ ++  +R  LE  ++E        R E    L    A+E+  FD E+++LG   + +  I ++
Sbjct:  496 REQLSGYKRMRRQHQKQLLALESRLRGEREEHSGRLQRELEAQRAGFGTEAEKLARRHQAIGEKEARAAQAEERKFQQHILGQQKKELAALLEAQKRTYKLRKEQLKEELQENPSTPKREKAEWLLRQKEQLQQCQAEEEAGLLRRQRQYFELQCRQYKRKMLLARHSLDQDLLREDLNKKQTQKDLECALLLRQHEATRELELRQLQAVQRTRAELTRLQHQTELGNQLEYNKRREQELRQKHAAQVRQQPKSLKSKELQIKKQFQETCKIQTRQYKALRAHLLETTPKAQH----KSLLKRLKEEQTRKLAILAEQYDQSISEMLSSQALRLDETQEAEFQALRQQLQQELELLNAYQSKIKIRTESQHERELRELEQRVALRRALLEQRVEEELLALQTGRSERIRSLLERQAREIEAFDAESMRLGFSSMALGGIPAE 933          
BLAST of Serine/threonine kinase vs. UniProt/SwissProt
Match: sp|Q9I9E0|TAOK3_CHICK (Serine/threonine-protein kinase TAO3 OS=Gallus gallus OX=9031 GN=TAOK3 PE=2 SV=2)

HSP 1 Score: 330.102 bits (845), Expect = 2.293e-97
Identity = 163/309 (52.75%), Postives = 210/309 (67.96%), Query Frame = 2
Query:  104 EFDQLLCKDDPSTIFTNLKQIGCGSFGAVYYAQNXXXXXXXXXXXXXVDSKSQKDHWKDIKREICLLKQLNHVNCISFKGYYLKGNNPLIVMDYCLGSVSDIIEVFKKPLQEDEIGCVVVEVLKALNYLHKKNFIHRDIKASNILLTECGLVKLGDFGSSSFVNPANTFVGTPFWIAPEVIMAMESGLYDFKVDIWSLGITCIEMAEMEPPHFKTLNPMAAMYHIASNDSPCLLNPSLWSNEFVFLVVAFLKKSPDNRPSAENALQSKFCTIKRPPFILLKMIKNARNAVAAREKSD-KSDKMKKILLQ 1027
            E   L  KDDP  IF  L +IG GSFGAVY+A N  T E++A+K++    K   + W+DI +E+  L+QL H N I +KG YLK +   +VM+YCLGS SD++EV KKPLQE EI  +    L+ L YLH    IHRDIKA NILLTE G VKL DFGS+S V+PAN+FVGTP+W+APEVI+AM+ G YD KVD+WSLGITCIE+AE +PP F  +N M+A+YHIA NDSP  L  + WS+ F   V   L+K P  RPS+ + L+  F    RPP +L+ +I+  ++AV  RE  + +  KMKKIL Q
Sbjct:   10 EIADLFYKDDPEEIFVGLHEIGHGSFGAVYFATNSHTNEVVAVKKMSYSGKQTNEKWQDIIKEVKFLQQLKHPNTIEYKGCYLKEHTAWLVMEYCLGSASDMLEVHKKPLQEVEIAAITHGALQGLAYLHSHCKIHRDIKAGNILLTEPGQVKLADFGSASIVSPANSFVGTPYWMAPEVILAMDEGQYDGKVDVWSLGITCIELAERKPPLF-NMNAMSALYHIAQNDSPT-LQSNEWSDSFRGFVDYCLQKIPQERPSSADLLRHDFVRRDRPPRVLIDLIQRTKDAV--RELDNLQYRKMKKILFQ 314          

HSP 2 Score: 99.7525 bits (247), Expect = 6.415e-20
Identity = 116/443 (26.19%), Postives = 211/443 (47.63%), Query Frame = 2
Query: 1520 REQMNGLKRIRNQHKRSIQQLEEKHKNELETTKFSLSRELENVTSTFHKELEKLNK-----------TNSLELDKNNK--------------ESRQKELNFVK-------NLETXXXXXXXXXXXXXXXENKNTGQYEVEIN--NVQKL-GDARTRKFKRDAIMNRHRLQLKQLDSTLKQEQSQLEQKNALLLQQHDKLVNLQLGHQESMHILRIDQMQKLQNIEIEAQTQYAQQQESFLKKKQAAEVKNFPKYLKVKEQENQKACRDILNIQKKQFKILKEDELRNSRKKHNGESEQQIVDRLKENERQKQVELKAQYDASLEKMKAQELNKLESRHIRETLELENKLQTEKEVLRSFHNSQNEETMKNYNQEHLNLKNQMLNKRNELEVGIQESNRLFSLKRIEMYSELTTYHAKELRNFDLETVQLGIDQILINSISSDY 2743
            REQM+G KR+R QH++ +  LE K K E++  +  L +E+E   +    ELEKL K           T + +  K  +              ES++K+    K       N +  + K  K  + +   EN    Q E E +  + Q+L  D   R FKR  ++ RH L+ + +   L ++++Q E ++A+L++  +    L+     ++  LR+D ++     E+E Q +Y +++E  L +K   E++  PK LK  E + +K  +D   +Q KQ+K LK  +L  + K  +    + I+  LK+ + +K   L  QY+ S+ +M A +  + +     E   L  +LQ E E+L ++ +    +T   + +E   L+ ++  +R  LE  I+E       +R E    L     +E+  FD+E++++G      N ++ DY
Sbjct:  458 REQMSGYKRMRRQHQKQLIALENKLKAEMDEHRLKLQKEVETHANNSSIELEKLAKKQVAVMEKEAKTAAADEKKFQQQILAQQKKDMATFLESQKKQYKLCKEKIKEEMNEDHSTPKKEKQERISKHKENLQHTQAEEEAHLLSQQRLYYDKNCRFFKRKTMIKRHELEQQNIREELNKKRTQKEMEHAMLIRHDESTRELEYRQLHTLQKLRMDLIRLQHQTELENQLEYNKRRERELHRKHFMELRQQPKNLKAMEMQIKKQFQDTCKVQTKQYKALKNHQLEVTPKSEH----KTILKSLKDEQTRKLAILAEQYEQSINEMMASQALRRDEAQEAECQALRLQLQQEMELLNAYQSKIKMQTEAQHERELQKLEQRVSLRRAHLEQKIEEELAALQKERSERIKFLLERQEREIETFDMESLRMGFG----NLVTLDY 892          
BLAST of Serine/threonine kinase vs. UniProt/SwissProt
Match: sp|Q8BYC6|TAOK3_MOUSE (Serine/threonine-protein kinase TAO3 OS=Mus musculus OX=10090 GN=Taok3 PE=1 SV=2)

HSP 1 Score: 327.791 bits (839), Expect = 1.811e-96
Identity = 161/309 (52.10%), Postives = 210/309 (67.96%), Query Frame = 2
Query:  104 EFDQLLCKDDPSTIFTNLKQIGCGSFGAVYYAQNXXXXXXXXXXXXXVDSKSQKDHWKDIKREICLLKQLNHVNCISFKGYYLKGNNPLIVMDYCLGSVSDIIEVFKKPLQEDEIGCVVVEVLKALNYLHKKNFIHRDIKASNILLTECGLVKLGDFGSSSFVNPANTFVGTPFWIAPEVIMAMESGLYDFKVDIWSLGITCIEMAEMEPPHFKTLNPMAAMYHIASNDSPCLLNPSLWSNEFVFLVVAFLKKSPDNRPSAENALQSKFCTIKRPPFILLKMIKNARNAVAAREKSD-KSDKMKKILLQ 1027
            E   L  KDDP  +F +L +IG GSFGAVY+A N  T E++A+K++    K   + W+DI +E+  L+QL H N I +KG YLK +   +VM+YCLGS SD++EV KKPLQE EI  +    L+ L YLH  + IHRDIKA NILLTE G VKL DFGS+S  +PAN+FVGTP+W+APEVI+AM+ G YD KVDIWSLGITCIE+AE +PP F  +N M+A+YHIA NDSP L +   W++ F   V   L K P  RP+A   L+  F   +RPP +L+ +I+  ++AV  RE  + +  KMKKIL Q
Sbjct:   10 EIADLFFKDDPEELFIDLHEIGHGSFGAVYFATNAHTNEVVAVKKMSYSGKQTHEKWQDILKEVKFLQQLKHPNTIEYKGCYLKEHTAWLVMEYCLGSASDLLEVHKKPLQEVEIAAITHGALQGLAYLHFHSLIHRDIKAGNILLTEPGQVKLADFGSASMASPANSFVGTPYWMAPEVILAMDEGQYDGKVDIWSLGITCIELAERKPPLF-NMNAMSALYHIAQNDSPTLQSRE-WTDSFRRFVDYCLHKIPQERPAAVELLRHDFIRRERPPKVLIDLIQRTKDAV--RELDNLQYRKMKKILFQ 314          

HSP 2 Score: 103.219 bits (256), Expect = 4.265e-21
Identity = 113/435 (25.98%), Postives = 206/435 (47.36%), Query Frame = 2
Query: 1520 REQMNGLKRIRNQHKRSIQQLEEKHKNELETTKFSLSRELENVTSTFHKELEKLNKTNSLELDKNNK-------------------------ESRQKELNFVK-------NLETXXXXXXXXXXXXXXXENKNTGQYEVEIN--NVQKLG-DARTRKFKRDAIMNRHRLQLKQLDSTLKQEQSQLEQKNALLLQQHDKLVNLQLGHQESMHILRIDQMQKLQNIEIEAQTQYAQQQESFLKKKQAAEVKNFPKYLKVKEQENQKACRDILNIQKKQFKILKEDELRNSRKKHNGESEQQIVDRLKENERQKQVELKAQYDASLEKMKAQELNKLESRHIRETLELENKLQTEKEVLRSFHNSQNEETMKNYNQEHLNLKNQMLNKRNELEVGIQESNRLFSLKRIEMYSELTTYHAKELRNFDLETVQLGIDQIL 2719
            REQM+G KR+R QH++ +  LE K K E++  +  L +E+E   +    ELEKL K     ++K  K                         ES++K+    K       N +  + K  K  + +   EN    Q E E +    Q+L  D   R FKR  ++ RH ++ + +   L ++++Q E ++A+L++  +    L+     ++  LR+D ++     E+E Q +Y +++E  L +K   E++  PK LK  E + +K  +D   +Q KQ+K LK  +L  + K  +    + I+  LK+ + +K   L  QY+ S+ +M A +  +L+     E   L  +LQ E E+L ++ +    +T   + +E   L+ ++  +R  LE  I+E       +R E    L     +E   FD+E++++G   ++
Sbjct:  458 REQMSGYKRMRRQHQKQLIALENKLKAEMDEHRLKLQKEVETHANNSSIELEKLAKKQVATIEKEAKVAAADEKKFQQQILAQQKKDLTTFLESQKKQYKICKEKIKEEMNEDHSTPKKEKQERISKHKENLQHTQAEEEAHLLTQQRLYYDRNCRFFKRKIMIKRHEVEQQNIREELNKKRTQKEMEHAMLIRHDESTRELEYRQLHTLQKLRMDLIRLQHQTELENQLEYNKRRERELHRKHVMELRQQPKNLKAMEMQIKKQFQDTCKVQTKQYKALKNHQLEVTPKNEH----KAILKTLKDEQTRKLAILAEQYEQSINEMMASQALRLDEAQEAECQALRLQLQQEMELLNAYQSKIKMQTEAQHERELQKLEQRVSLRRAHLEQKIEEELAALQKERSERIKTLLERQERETETFDMESLRMGFGNLV 888          
BLAST of Serine/threonine kinase vs. UniProt/SwissProt
Match: sp|Q53UA7|TAOK3_RAT (Serine/threonine-protein kinase TAO3 OS=Rattus norvegicus OX=10116 GN=Taok3 PE=1 SV=1)

HSP 1 Score: 327.405 bits (838), Expect = 2.748e-96
Identity = 161/309 (52.10%), Postives = 211/309 (68.28%), Query Frame = 2
Query:  104 EFDQLLCKDDPSTIFTNLKQIGCGSFGAVYYAQNXXXXXXXXXXXXXVDSKSQKDHWKDIKREICLLKQLNHVNCISFKGYYLKGNNPLIVMDYCLGSVSDIIEVFKKPLQEDEIGCVVVEVLKALNYLHKKNFIHRDIKASNILLTECGLVKLGDFGSSSFVNPANTFVGTPFWIAPEVIMAMESGLYDFKVDIWSLGITCIEMAEMEPPHFKTLNPMAAMYHIASNDSPCLLNPSLWSNEFVFLVVAFLKKSPDNRPSAENALQSKFCTIKRPPFILLKMIKNARNAVAAREKSD-KSDKMKKILLQ 1027
            E  +L  K+DP  +F +L +IG GSFGAVY+A N  T E++AIK++    K   + W+DI +E+  L+QL H N I +KG YLK +   +VM+YCLGS SD++EV KKPLQE EI  +    L+ L YLH  + IHRDIKA NILLTE G VKL DFGS+S  +PAN+FVGTP+W+APEVI+AM+ G YD KVDIWSLGITCIE+AE +PP F  +N M+A+YHIA NDSP L +   W++ F   V   L K P  RP+A   L+  F   +RPP +L+ +I+  ++AV  RE  + +  KMKKIL Q
Sbjct:   10 EIAELFFKEDPEELFIDLHEIGHGSFGAVYFATNAHTNEVVAIKKMSYSGKQTHEKWQDILKEVRFLQQLKHPNTIEYKGCYLKEHTAWLVMEYCLGSASDLLEVHKKPLQEVEIAAITHGALQGLAYLHFHSLIHRDIKAGNILLTEPGQVKLADFGSASMASPANSFVGTPYWMAPEVILAMDEGQYDGKVDIWSLGITCIELAERKPPLF-NMNAMSALYHIAQNDSPTLQSRE-WTDSFRRFVDYCLHKIPQERPAAAELLRHDFIRRERPPRVLIDLIQRTKDAV--RELDNLQYRKMKKILFQ 314          

HSP 2 Score: 104.375 bits (259), Expect = 2.241e-21
Identity = 114/435 (26.21%), Postives = 205/435 (47.13%), Query Frame = 2
Query: 1520 REQMNGLKRIRNQHKRSIQQLEEKHKNELETTKFSLSRELENVTSTFHKELEKLNKTNSLELDKNNK-------------------------ESRQKELNFVK-------NLETXXXXXXXXXXXXXXXENKNTGQYEVEIN--NVQKLG-DARTRKFKRDAIMNRHRLQLKQLDSTLKQEQSQLEQKNALLLQQHDKLVNLQLGHQESMHILRIDQMQKLQNIEIEAQTQYAQQQESFLKKKQAAEVKNFPKYLKVKEQENQKACRDILNIQKKQFKILKEDELRNSRKKHNGESEQQIVDRLKENERQKQVELKAQYDASLEKMKAQELNKLESRHIRETLELENKLQTEKEVLRSFHNSQNEETMKNYNQEHLNLKNQMLNKRNELEVGIQESNRLFSLKRIEMYSELTTYHAKELRNFDLETVQLGIDQIL 2719
            REQM+G KR+R QH++ +  LE K K E++  +  L +E+E   +    ELEKL K     ++K  K                         ES++K+    K       N +  + K  K  + +   EN    Q E E +    Q+L  D   R FKR  +  RH ++ + +   L ++++Q E ++A+L++  +    L+     ++  LR+D ++     E+E Q +Y +++E  L +K   E++  PK LK  E + +K  +D   +Q KQ+K LK  +L  + K  +    + I+  LKE + +K   L  QY+ S+ +M A +  +L+     E   L  +LQ E E+L ++ +    +T   + +E   L+ ++  +R  LE  I+E       +R E    L     +E   FD+E++++G   ++
Sbjct:  458 REQMSGYKRMRRQHQKQLIALENKLKAEMDEHRLKLQKEVETHANNSSIELEKLAKKQVATIEKEAKVAAADEKKFQQQILAQQKKDLTTFLESQKKQYKICKEKIKEEMNEDHSTPKKEKQERISKHKENLQHTQAEEEAHLLTQQRLYYDRNCRCFKRKIMTKRHEVEQQNIREELNKKRTQKEMEHAMLIRHDESTRELEYRQLHTLQKLRMDLIRLQHQTELENQLEYNKRRERELHRKHVMELRQQPKNLKAMEMQIKKQFQDTCKVQTKQYKALKNHQLEVTPKNEH----KAILKTLKEEQTRKLAILAEQYEQSINEMMASQALRLDEAQEAECQALRLQLQQEMELLNAYQSKIKMQTEAQHERELQKLEQRVSLRRAHLEQKIEEELAALQKERSERIKTLLERQERETETFDMESLRMGFGNLV 888          
BLAST of Serine/threonine kinase vs. UniProt/SwissProt
Match: sp|Q6DD27|TAOK3_XENLA (Serine/threonine-protein kinase TAO3 OS=Xenopus laevis OX=8355 GN=taok3 PE=2 SV=1)

HSP 1 Score: 323.939 bits (829), Expect = 3.717e-95
Identity = 159/305 (52.13%), Postives = 210/305 (68.85%), Query Frame = 2
Query:  116 LLCKDDPSTIFTNLKQIGCGSFGAVYYAQNXXXXXXXXXXXXXVDSKSQKDHWKDIKREICLLKQLNHVNCISFKGYYLKGNNPLIVMDYCLGSVSDIIEVFKKPLQEDEIGCVVVEVLKALNYLHKKNFIHRDIKASNILLTECGLVKLGDFGSSSFVNPANTFVGTPFWIAPEVIMAMESGLYDFKVDIWSLGITCIEMAEMEPPHFKTLNPMAAMYHIASNDSPCLLNPSLWSNEFVFLVVAFLKKSPDNRPSAENALQSKFCTIKRPPFILLKMIKNARNAVAAREKSD-KSDKMKKILLQ 1027
            L CK+DP  IF +L +IG GSFGAVY+A N  T EI+A+K++    K   + W+DI +E+  L+QL H N I +KG YLK +   +VM+YCLGS SD++EV KKPLQE EI  +    L+ L YLH  N IHRDIKA NILLTE G VKL DFGS+S  +PAN+FVGTP+W+APEVI+AM+ G YD K+DIWSLGITCIE+AE +PP F  +N M+A+YHIA N+SP  L  + W++ F   V   L+K P  RP++   L+  F   +RP  +L+ +I+  ++AV  RE  + +  KMKKIL Q
Sbjct:   14 LFCKEDPERIFVDLHEIGHGSFGAVYFATNSTTNEIVAVKKMSYSGKQMNEKWQDIIKEVKFLQQLKHPNTIEYKGCYLKDHTAWLVMEYCLGSASDLLEVHKKPLQEVEIAAITHGALQGLAYLHSHNMIHRDIKAGNILLTEPGQVKLADFGSASKSSPANSFVGTPYWMAPEVILAMDEGQYDGKIDIWSLGITCIELAERKPPLF-NMNAMSALYHIAQNESPT-LQSNEWTDSFKGFVDYCLQKLPQERPASLELLRHDFVWRERPARVLIDLIQRTKDAV--RELDNLQYRKMKKILFQ 314          

HSP 2 Score: 111.694 bits (278), Expect = 9.960e-24
Identity = 116/435 (26.67%), Postives = 211/435 (48.51%), Query Frame = 2
Query: 1520 REQMNGLKRIRNQHKRSIQQLEEKHKNELETTKFSLSRELENVTSTFHKELEKLNKTNSLELDKNNK-------------------------ESRQKELNFVK-------NLETXXXXXXXXXXXXXXXENKNTGQYEVEIN--NVQKLG-DARTRKFKRDAIMNRHRLQLKQLDSTLKQEQSQLEQKNALLLQQHDKLVNLQLGHQESMHILRIDQMQKLQNIEIEAQTQYAQQQESFLKKKQAAEVKNFPKYLKVKEQENQKACRDILNIQKKQFKILKEDELRNSRKKHNGESEQQIVDRLKENERQKQVELKAQYDASLEKMKAQELNKLESRHIRETLELENKLQTEKEVLRSFHNSQNEETMKNYNQEHLNLKNQMLNKRNELEVGIQESNRLFSLKRIEMYSELTTYHAKELRNFDLETVQLGIDQIL 2719
            REQM+G KR+R QH++ +  LE K K E++  +  L +E+E   +    ELEKL+K   + +DK  K                         ES++K+    K       N +  + K  K  + +   EN    Q E E    + Q+L  +   R FKR  ++ RH ++ + +   L ++++Q E ++A+L++Q +    L+    + +  LR+D ++     E+E Q +Y +++E  L +K   E++  PK LKV E + +K  +D   +Q KQ+K LK  +L  S K  +    + I+  LK+ + +K   L  QY+ S+ +M A +  +L+     E   L  +LQ E E+L ++ +    +T   + +E   L+ ++  +R  LE  I+E       +R E    L     +E+  FD+E++++G   ++
Sbjct:  456 REQMSGYKRMRRQHQKQLIALENKLKAEMDEHRLKLQKEVETHANNASIELEKLSKRQFVGMDKEAKVAAADERRFQQQIIAQQKKDLTSFLESQKKQYKICKEKIKEELNEDHSTPKKEKQERISKHKENLQHTQAEEEAQLLSQQRLYYEKNCRLFKRKIMIKRHEVEQQHIREELNKKRTQKEMEHAMLIRQDESTRELEYRQLQMLQKLRMDLIRLQHQTELENQLEYNKRRERELHRKHVMELRQQPKNLKVMEMQIKKQFQDTCKVQTKQYKALKNHQLEVSPKCEH----KTILKSLKDEQTRKLAILAEQYEQSINEMMASQALRLDEAQEAECQALRQQLQQEMELLNAYQSKIKMQTEAQHERELQKLEQRVSLRRAHLEQKIEEELVALQKERSERIKHLFERQEREIETFDMESLRMGFGNLV 886          
BLAST of Serine/threonine kinase vs. UniProt/SwissProt
Match: sp|Q9H2K8|TAOK3_HUMAN (Serine/threonine-protein kinase TAO3 OS=Homo sapiens OX=9606 GN=TAOK3 PE=1 SV=2)

HSP 1 Score: 323.168 bits (827), Expect = 7.475e-95
Identity = 160/309 (51.78%), Postives = 206/309 (66.67%), Query Frame = 2
Query:  104 EFDQLLCKDDPSTIFTNLKQIGCGSFGAVYYAQNXXXXXXXXXXXXXVDSKSQKDHWKDIKREICLLKQLNHVNCISFKGYYLKGNNPLIVMDYCLGSVSDIIEVFKKPLQEDEIGCVVVEVLKALNYLHKKNFIHRDIKASNILLTECGLVKLGDFGSSSFVNPANTFVGTPFWIAPEVIMAMESGLYDFKVDIWSLGITCIEMAEMEPPHFKTLNPMAAMYHIASNDSPCLLNPSLWSNEFVFLVVAFLKKSPDNRPSAENALQSKFCTIKRPPFILLKMIKNARNAVAAREKSD-KSDKMKKILLQ 1027
            E   L  KDDP  +F  L +IG GSFGAVY+A N  T E++AIK++    K   + W+DI +E+  L+QL H N I +KG YLK +   +VM+YCLGS SD++EV KKPLQE EI  +    L  L YLH    IHRDIKA NILLTE G VKL DFGS+S  +PAN+FVGTP+W+APEVI+AM+ G YD KVDIWSLGITCIE+AE +PP F  +N M+A+YHIA NDSP  L  + W++ F   V   L+K P  RP++   L+  F    RP  +L+ +I+  ++AV  RE  + +  KMKKIL Q
Sbjct:   10 EIADLFYKDDPEELFIGLHEIGHGSFGAVYFATNAHTSEVVAIKKMSYSGKQTHEKWQDILKEVKFLRQLKHPNTIEYKGCYLKEHTAWLVMEYCLGSASDLLEVHKKPLQEVEIAAITHGALHGLAYLHSHALIHRDIKAGNILLTEPGQVKLADFGSASMASPANSFVGTPYWMAPEVILAMDEGQYDGKVDIWSLGITCIELAERKPPLF-NMNAMSALYHIAQNDSPT-LQSNEWTDSFRRFVDYCLQKIPQERPTSAELLRHDFVRRDRPLRVLIDLIQRTKDAV--RELDNLQYRKMKKILFQ 314          

HSP 2 Score: 92.4337 bits (228), Expect = 9.391e-18
Identity = 110/435 (25.29%), Postives = 205/435 (47.13%), Query Frame = 2
Query: 1520 REQMNGLKRIRNQHKRSIQQLEEKHKNELETTKFSLSRE-----------LENVTSTFHKELEKLNKTNSLELDKNNK--------------ESRQKELNFVK-------NLETXXXXXXXXXXXXXXXENKNTGQYEVEIN--NVQKL-GDARTRKFKRDAIMNRHRLQLKQLDSTLKQEQSQLEQKNALLLQQHDKLVNLQLGHQESMHILRIDQMQKLQNIEIEAQTQYAQQQESFLKKKQAAEVKNFPKYLKVKEQENQKACRDILNIQKKQFKILKEDELRNSRKKHNGESEQQIVDRLKENERQKQVELKAQYDASLEKMKAQELNKLESRHIRETLELENKLQTEKEVLRSFHNSQNEETMKNYNQEHLNLKNQMLNKRNELEVGIQESNRLFSLKRIEMYSELTTYHAKELRNFDLETVQLGIDQIL 2719
            REQM+G KR+R QH++ +  LE K K E++  +  L +E           LE +       +EK  K  + +  K  +              ES++K+    K       N +  + K  K  + +   EN    Q E E +    Q+L  D   R FKR  ++ RH ++ + +   L ++++Q E ++A+L++  +    L+     ++  LR+D ++     E+E Q +Y +++E  L +K   E++  PK LK  E + +K  +D   +Q KQ+K LK  +L  + K  +    + I+  LK+ + +K   L  QY+ S+ +M A +  +L+     E   L  +LQ E E+L ++ +    +T   + +E   L+ ++  +R  LE  I+E       +R E    L     +E+  FD+E++++G   ++
Sbjct:  458 REQMSGYKRMRRQHQKQLIALENKLKAEMDEHRLKLQKEVETHANNSSIELEKLAKKQVAIIEKEAKVAAADEKKFQQQILAQQKKDLTTFLESQKKQYKICKEKIKEEMNEDHSTPKKEKQERISKHKENLQHTQAEEEAHLLTQQRLYYDKNCRFFKRKIMIKRHEVEQQNIREELNKKRTQKEMEHAMLIRHDESTRELEYRQLHTLQKLRMDLIRLQHQTELENQLEYNKRRERELHRKHVMELRQQPKNLKAMEMQIKKQFQDTCKVQTKQYKALKNHQLEVTPKNEH----KTILKTLKDEQTRKLAILAEQYEQSINEMMASQALRLDEAQEAECQALRLQLQQEMELLNAYQSKIKMQTEAQHERELQKLEQRVSLRRAHLEQKIEEELAALQKERSERIKNLLERQEREIETFDMESLRMGFGNLV 888          
BLAST of Serine/threonine kinase vs. TrEMBL
Match: A0A1S3H272 (serine/threonine-protein kinase TAO1 OS=Lingula unguis OX=7574 GN=LOC106151411 PE=4 SV=1)

HSP 1 Score: 463.766 bits (1192), Expect = 6.050e-145
Identity = 324/907 (35.72%), Postives = 490/907 (54.02%), Query Frame = 2
Query:  104 EFDQLLCKDDPSTIFTNLKQIGCGSFGAVYYAQNXXXXXXXXXXXXXVDSKSQKDHWKDIKREICLLKQLNHVNCISFKGYYLKGNNPLIVMDYCLGSVSDIIEVFKKPLQEDEIGCVVVEVLKALNYLHKKNFIHRDIKASNILLTECGLVKLGDFGSSSFVNPANTFVGTPFWIAPEVIMAMESGLYDFKVDIWSLGITCIEMAEMEPPHFKTLNPMAAMYHIASNDSPCLLNPSLWSNEFVFLVVAFLKKSPDNRPSAENALQSKFCTIKRPPFILLKMIKNARNAVAAREKSD-KSDKMKKILLQSKTDNESPPEMGRSPSFIEDEFXXXXXXXXXXXXXXXLDLFENLSSIEIPVNKKNRGDISNSSLKNINPMKIDQKLSHSQSDSVKLLSERNNVIPNSKSSGDISRKAGNENKVSKIIKQLQSIDVKSVENLHIISLKIPLHRSSTSSESYEDKYKNPSDINEVWREQMNGLKRIRNQHKRSIQQLEEKHKNELETTKFSLSRELENVTSTFHKELEKLNKTNSLELDKNNKESRQKELNFVKNLETXXXXXXXXXXXXXXXENK-NTGQYEVEIN-------------------------------NVQKLG-DARTRKFKRDAIMNRHRLQLKQLDSTLKQEQSQLEQKNALLLQQHDKLVNLQLGHQESMHILRIDQMQKLQNIEIEAQTQYAQQQESFLKKKQAAEVKNFPKYLKVKEQENQKACRDILNIQKKQFKILKEDELRNSRKKHNGESEQQIVDRLKENERQKQVELKAQYDASLEKMKAQELNKLESRHIRETLELENKLQTEKEVLRSFHNSQNEETMKNYNQEHLNLKNQMLNKRNELEVGIQESNRLFSLKRIEMYSELTTYHAKELRNFDLETVQLGIDQILI 2722
            E   L   DDP  +F +L++IG GSFGAVYYA++  TKE++A+K++    K   + W+DI +E+  LK+L H + I +KG YLK +   +VM+YC+GS SDI+EV KKPL+EDEIG +  E L  L+YLH    IHRD+KA NILLT+ G+VKL DFGS+S V PAN+FVGTP+W+APEVI+AM+ G YD KVD+WSLGITCIE+AE +PP F  +N M+A+YHIA NDSP  L+   WS EF   V + L KSP  RP+ E   +  F T  RPP +L  +I+  +NAV  RE  + +  +MKKIL+    D E     G   +  E+                  D+ E+ SSI          D S+S   +IN  +   +   S S S        N +P + +  D    + +  +      +  S  V+   N   I     L++     E+ E +++N        REQM+G KR+R QH++ +QQ+E K K E+E  K  L +E E +  T  KELEKL   +  ELD+  + ++  E    KN+    + D+K   +  K + K N  Q + +I+                               N QK+  +   RKF+R  ++  H L+ + L   + + Q+QLE  + +LL+ H+   +L+     ++H LR DQM+K    E+  Q +Y  + E  LKKK A EVK  P+ LK KEQ+ +K   D + IQ++Q+K LK+  L+ + K      ++Q++ +LKE + +K  +L  QY+ S+ +M  Q+  KL+   I E  EL+++L  E E+L ++ +    +    + +E   L+ ++  +R  LE  ++E    F  +R E   +L    A+E+  FDL+T  +G++ I I
Sbjct:   14 EVAALFATDDPEKLFLDLREIGHGSFGAVYYARHEPTKEVVAVKKMSYSGKQSNEKWQDIIKEVRFLKELKHDHTIDYKGCYLKEHTAWLVMEYCVGSASDILEVHKKPLREDEIGAICKECLLGLSYLHSLGRIHRDVKAGNILLTDAGIVKLADFGSASIVCPANSFVGTPYWMAPEVILAMDEGQYDGKVDVWSLGITCIELAERKPPLF-NMNAMSALYHIAQNDSPS-LSGGEWSEEFRVFVDSCLLKSPTERPTTEELQEHPFITSNRPPNVLTDLIERTKNAV--RELDNLQYRRMKKILM---ADTEERSVNGPISTITEESS----------------DIQEDDSSI---------CDNSSSRANSINSTQSISEEISSHSGS-------QNSLPGAGAGDDHEVTSLHRPRTKSSRSRATSGSVERSNNFATIRTTHILNK-----EAKEHEHENE------LREQMSGYKRMRRQHQKILQQVESKFKVEMEDHKQKLDKEYETLIQTLTKELEKLRSKHLGELDRRTRHNQNAEKKLWKNITQQQETDMKMFVQQQKKDYKLNKEQIKKQIDDGTPKKVREENIRTHKETLQQQQQQEEGKLINQQKVVLEKEIRKFRRRKLLQYHTLEQELLREEISRRQAQLEFSHQMLLRHHESTQDLEYKQMAAVHRLRDDQMRKQHQTELANQREYNGRMERELKKKHALEVKQQPRSLKQKEQQIRKQFNDTIKIQQRQYKALKDQILQTTPKN----EQKQVIKKLKEEQMRKIAQLGEQYENSIAEMLQQQNIKLDECQISEANELKHRLDQELELLMAYQSKIKMQLEAQHQREKKQLEERVSLRRALLEQKMEEDINQFQAERSERVRKLHERQAQEIEEFDLQTTTMGLNAIEI 866          
BLAST of Serine/threonine kinase vs. TrEMBL
Match: A0A1S3HQM6 (serine/threonine-protein kinase TAO1 isoform X1 OS=Lingula unguis OX=7574 GN=LOC106156572 PE=4 SV=1)

HSP 1 Score: 463.766 bits (1192), Expect = 6.378e-145
Identity = 323/907 (35.61%), Postives = 488/907 (53.80%), Query Frame = 2
Query:  104 EFDQLLCKDDPSTIFTNLKQIGCGSFGAVYYAQNXXXXXXXXXXXXXVDSKSQKDHWKDIKREICLLKQLNHVNCISFKGYYLKGNNPLIVMDYCLGSVSDIIEVFKKPLQEDEIGCVVVEVLKALNYLHKKNFIHRDIKASNILLTECGLVKLGDFGSSSFVNPANTFVGTPFWIAPEVIMAMESGLYDFKVDIWSLGITCIEMAEMEPPHFKTLNPMAAMYHIASNDSPCLLNPSLWSNEFVFLVVAFLKKSPDNRPSAENALQSKFCTIKRPPFILLKMIKNARNAVAAREKSD-KSDKMKKILLQSKTDNESPPEMGRSPSFIEDEFXXXXXXXXXXXXXXXLDLFENLSSIEIPVNKKNRGDISNSSLKNINPMKIDQKLSHSQSDSVKLLSERNNVIPNSKSSGDISRKAGNENKVSKIIKQLQSIDVKSVENLHIISLKIPLHRSSTSSESYEDKYKNPSDINEVWREQMNGLKRIRNQHKRSIQQLEEKHKNELETTKFSLSRELENVTSTFHKELEKLNKTNSLELDKNNKESRQKELNFVKNL-----------------------ETXXXXXXXXXXXXXXXENKNTGQYEVE----------INNVQKLGDARTRKFKRDAIMNRHRLQLKQLDSTLKQEQSQLEQKNALLLQQHDKLVNLQLGHQESMHILRIDQMQKLQNIEIEAQTQYAQQQESFLKKKQAAEVKNFPKYLKVKEQENQKACRDILNIQKKQFKILKEDELRNSRKKHNGESEQQIVDRLKENERQKQVELKAQYDASLEKMKAQELNKLESRHIRETLELENKLQTEKEVLRSFHNSQNEETMKNYNQEHLNLKNQMLNKRNELEVGIQESNRLFSLKRIEMYSELTTYHAKELRNFDLETVQLGIDQILI 2722
            E   L   DDP  +F +L++IG GSFGAVYYA++  TKE++A+K++    K   + W+DI +E+  LK+L H + I +KG YLK +   +VM+YC+GS SDI+EV KKPL+EDEIG +  E L  L+YLH    IHRD+KA NILLT+ G+VKL DFGS+S V PAN+FVGTP+W+APEVI+AM+ G YD KVD+WSLGITCIE+AE +PP F  +N M+A+YHIA NDSP  L+   WS EF   V + L KSP  RP+ E   +  F T  RPP +L  +I+  +NAV  RE  + +  +MKKIL+    D E     G   +  E+                  D+ E+ SSI          D S+S   +IN  +   +   S S S        N +P + +  D    + +  +      +  S  V+   N   I     L++     E+ E +++N        REQM+G KR+R QH++ +QQ+E K K E+E  K  L +E E +  T  KELEKL   +  ELD+  + ++  E    KN+                       E I K+      K  + EN  T +  ++          IN  + + +   RKF+R  ++  H L+ + L   + + Q+QLE  + +LL+ H+   +L+     ++H LR DQM+K    E+  Q +Y  + E  LKKK A EVK  P+ LK KEQ+ +K   D + IQ++Q+K LK+  L+ + K      ++Q++ +LKE + +K  +L  QY+ S+ +M  Q+  KL+   I E  EL+++L  E E+L ++ +    +    + +E   L+ ++  +R  LE  ++E    F  +R E   +L    A+E+  FDL+T  +G++ I I
Sbjct:   14 EVAALFATDDPEKLFLDLREIGHGSFGAVYYARHEPTKEVVAVKKMSYSGKQSNEKWQDIIKEVRFLKELKHDHTIDYKGCYLKEHTAWLVMEYCVGSASDILEVHKKPLREDEIGAICKECLLGLSYLHSLGRIHRDVKAGNILLTDAGIVKLADFGSASIVCPANSFVGTPYWMAPEVILAMDEGQYDGKVDVWSLGITCIELAERKPPLF-NMNAMSALYHIAQNDSPS-LSGGEWSEEFRVFVDSCLLKSPTERPTTEELQEHPFITSNRPPNVLTDLIERTKNAV--RELDNLQYRRMKKILM---ADTEERSVNGPISTITEESS----------------DIQEDDSSI---------CDNSSSRANSINSTQSISEEISSHSGS-------QNSLPGAGAGDDHEVTSLHRPRTKSSRSRATSGSVERSNNFATIRTTHILNK-----EAKEHEHENE------LREQMSGYKRMRRQHQKILQQVESKFKVEMEDHKQKLDKEYETLIQTLTKELEKLRSKHLGELDRRTRHNQNAEKKLWKNITQQQETDMKMFVQQQKKDYKLNKEQIKKQIDDGTPKKVREENIRTHKETLQQQQQQEEGKLINQQKVILEKEIRKFRRRKLLQYHTLEQELLREEISRRQAQLEFSHQMLLRHHESTQDLEYKQMAAVHRLRDDQMRKQHQTELANQREYNGRMERELKKKHALEVKQQPRSLKQKEQQIRKQFNDTIKIQQRQYKALKDQILQTTPKN----EQKQVIKKLKEEQMRKIAQLGEQYENSIAEMLQQQNIKLDECQISEANELKHRLDQELELLMAYQSKIKMQLEAQHQREKKQLEERVSLRRALLEQKMEEDINQFQAERSERVRKLHERQAQEIEEFDLQTTTMGLNAIEI 866          
BLAST of Serine/threonine kinase vs. TrEMBL
Match: T1KQT5 (Protein kinase domain-containing protein OS=Tetranychus urticae OX=32264 GN=107366362 PE=4 SV=1)

HSP 1 Score: 446.817 bits (1148), Expect = 9.909e-139
Identity = 321/933 (34.41%), Postives = 503/933 (53.91%), Query Frame = 2
Query:  104 EFDQLLCKDDPSTIFTNLKQIGCGSFGAVYYAQNXXXXXXXXXXXXXVDSKSQKDHWKDIKREICLLKQLNHVNCISFKGYYLKGNNPLIVMDYCLGSVSDIIEVFKKPLQEDEIGCVVVEVLKALNYLHKKNFIHRDIKASNILLTECGLVKLGDFGSSSFVNPANTFVGTPFWIAPEVIMAMESGLYDFKVDIWSLGITCIEMAEMEPPHFKTLNPMAAMYHIASNDSPCLLNPSLWSNEFVFLVVAFLKKSPDNRPSAENALQSKFCTIKRPPFILLKMIKNARNAVAAREKSD-KSDKMKKILLQSKTDNESPPEMGRSPSFIEDEFXXXXXXXXXXXXXXXLDLFENLSSIEIPVNKKNRGDISNSSLKNIN---PMKIDQKLSHSQSDSVKLLSERNNVIPNSKSSGDISRKAGNENKVSKIIKQLQSIDVKSVENLHIISLKIPLHRSSTSSESYEDKYKNPSDINEVWREQMNGLKRIRNQHKRSIQQLEEKHKNELETTKFSLSRELENVTSTFHKELEKLNKTNSLELDKNNKESRQKELNFVKNLETXXXXXXXXXXXXXXXENKNTGQ-YEVEI-NNVQKLGD-------------------------ARTRKFKRDAIMNRHRLQLKQLDSTLKQEQSQLEQKNALLLQQHDKLVNLQLGHQESMHILRIDQMQKLQNIEIEAQTQYAQQQESFLKKKQAAEVKNFPKYLKVKEQENQKACRDILNIQKKQFKILKEDELRNSRKKHNGESEQQIVDRLKENERQKQVELKAQYDASLEKMKAQELNKLESRHIRETLELENKLQTEKEVLRSFHNSQNEETMKNYNQEHLNLKNQMLNKRNELEVGIQESNRLFSLKRIEMYSELTTYHAKELRNFDLETVQLGIDQILI----NSISSDYVSVK*MLNYSYYFPIISF 2797
            E   L  K+DP   FT+L++IG GSFGAVYYA+     E++AIK++    K   + W+DI +E+  L  LNH NCI +KG YLK +   +VM+YCLGS SDIIEV KKPL+E+EI  +  + L+ L YLH    IHRD+KA NILLTE G VKL DFGSSS   PAN+FVG+P+W+APEVI+AM+ G YD KVD+WSLGITCIE+AE +PP+F  +N M+A+YHIA NDSP L + S WS+ F   V + L+K+P +RP++   L+  + T  R   ++  +I   R   A RE  +    +MKKIL+    +N+   E+ R+ S IE +                 D   + S      ++++ G IS  S  + N   P+  +    H +S S +            +SS ++SR + + +  S    +L + +  ++    I+S +I  H                 + N+++ EQ++G KR+R QH+++I QLE K + ELE  K  L +E E++ + F K+LEKL   +  EL K +K +   E    K ++   +++ K + +  K+ENK   +  E+E  NN + L                           +  RKF+R  ++  H L+   L   L + Q QLE+ +A+LL+ ++  V L+   Q ++H LR DQ++K    E+  Q +Y Q++ S L KK A E+K  PK LK KE + ++  R+    Q +Q+K+ K   L ++ K    E ++ ++ +LKE + +K   L  QY+ S+ +M  ++  +L+     E  +L++ LQ E E+L +F +    +T    N+E   L+ ++ ++R  LE  ++     F  +R E    LT   A+E++ FD ET +LG++ + I     S+  D      ML+ ++     SF
Sbjct:   11 EIASLFDKEDPEKYFTDLREIGHGSFGAVYYARCTVNNEVVAIKKMSFTGKQSAEKWQDIIKEVKFLVNLNHKNCIEYKGCYLKDHTAWLVMEYCLGSASDIIEVHKKPLKEEEIAAICHDALQGLEYLHSLGRIHRDVKAGNILLTEDGTVKLADFGSSSMTCPANSFVGSPYWMAPEVILAMDEGQYDGKVDVWSLGITCIELAERKPPYF-NMNAMSALYHIAQNDSPSLSSHSEWSDIFRNFVDSCLQKNPYDRPTSSQMLKHGYITRTRSGTVIYDLIN--RTKAAVRELDNLNYRRMKKILM---IENQ---ELERAGSEIEGDSTED-------------DQLGDSSKSNSIASQQSEG-ISTGSHSSSNCSLPINFENNDLHKRSLSTR-----------RQSSSNMSRISPSNSSASLNSTELGANNFATLRTTSIVSRQIKEH----------------EEENQMY-EQLSGYKRMRRQHQKAILQLEVKCRQELEEHKTKLEKEYESLLTQFSKDLEKLQNKHQKELQKKSKHNLDCENRLSKAIKQQQEEERKRLLQQQKNENKYIKEKLELEFANNPESLKKHKESLQRAQASNLRSLEQSQLEHFRSEIRKFQRRKLVQYHELERDLLREELNKRQHQLEEAHAMLLRHYEISVELEYRQQRAIHQLRDDQIRKRHQTELANQQEYNQRRLSELSKKHALELKQQPKSLKQKELQIRRQFRETCKTQTRQYKVWKAHVLASTPK----EEQKNVIKKLKEEQMRKLAILGEQYEQSIAEMLQKQSIRLDESQETEARQLKDHLQQELELLIAFQSKIRMQTEAQRNREKRELEERVSHRRALLEQKMELEKHRFQEERNERQRLLTERQAQEIQTFDEETARLGLNSLAIVEASESLRDDSSVTGSMLSLAHSNSASSF 888          
BLAST of Serine/threonine kinase vs. TrEMBL
Match: A0A1V9WY18 (Serine/threonine-protein kinase TAO1-like OS=Tropilaelaps mercedesae OX=418985 GN=BIW11_14373 PE=4 SV=1)

HSP 1 Score: 434.491 bits (1116), Expect = 7.649e-133
Identity = 313/926 (33.80%), Postives = 482/926 (52.05%), Query Frame = 2
Query:  113 QLLCKDDPSTIFTNLKQIGCGSFGAVYYAQNXXXXXXXXXXXXXVDSKSQKDHWKDIKREICLLKQLNHVNCISFKGYYLKGNNPLIVMDYCLGSVSDIIEVFKKPLQEDEIGCVVVEVLKALNYLHKKNFIHRDIKASNILLTECGLVKLGDFGSSSFVNPANTFVGTPFWIAPEVIMAMESGLYDFKVDIWSLGITCIEMAEMEPPHFKTLNPMAAMYHIASNDSPCLLNPSLWSNEFVFLVVAFLKKSPDNRPSAENALQSKFCTIKRPPFILLKMIKNARNAVAAREKSD-KSDKMKKILLQSKTDNE-------SPPEMGRSPSFI---EDEFXXXXXXXXXXXXXXXLDLFENLSSIEIPVNKKNRGDISNS-SLKNINPMKIDQK--LSHS---QSDSVKLLSERNNVIPNSKSSGDISRKAGNENKVSKIIKQLQSIDVKSVENLHIISLKIPLHRSSTSSESYEDKYKNPSDINEVWREQMNGLKRIRNQHKRSIQQLEEKHKNELETTKFSLSRELENVTSTFHKELEKLNKTNSLELDKNNKESRQKELNFVKNLETXXXXXXXXXXXXXXXENKNTGQ-----YEVEINNVQKLG--DARTRKFKRDAIMN------------------RHRLQLKQLDSTLKQEQSQLEQKNALLLQQHDKLVNLQLGHQESMHILRIDQMQKLQNIEIEAQTQYAQQQESFLKKKQAAEVKNFPKYLKVKEQENQKACRDILNIQKKQFKILKEDELRNS-RKKHNGESEQQIVDRLKENERQKQVELKAQYDASLEKMKAQELNKLESRHIRETLELENKLQTEKEVLRSFHNSQNEETMKNYNQEHLNLKNQMLNK----RNELEVGIQESNRLFSLKRIEMYSE--------------LTTYHAKELRNFDLETVQLGI 2707
            +L  + DP  +F +L++IG GSFGAVYYA+N  T E++AIK++    K   + W+DI +E+  L QL H N I ++G YLK +   +VM+YCLGS SDIIEV KKPL+E+EI  +  + L  L+YLH    IHRD+KA NILLTE G VKL DFGS+S   PAN+FVGTP+W+APEVI+AM+ G YD KVD+WSLGITCIE+AE +PP+F  +N M+A+YHIA NDSP L     WS +F   V+  L+K P  RP+A   L+  F T  RP   L+++I   R   A RE  +    KMKKIL+   T  E       S    G S S +   ED  +S+     S T+   LD          P   +  GD S S SL +     +     + HS   QS S    +   +V   S     + R+ G+   +   +   +  +  ++    I++ +I  H+   S                    QM G KR+++QH +++  LE K   E++  K  L +E E++  TF KELEKL      EL+K  K +   E   VK ++    ++ K  ++  KS  K+  +     Y+ E   V K G  + + ++  R  I                     H L+ +QL + L++ + QLEQ +A+LL+ H+    L+L  Q ++H LR D +++    E+  Q QY+ ++E  L KK AAEVK  PK L+  E + +K  R+    Q +Q+K  K   + ++ R++H     +++V RLK+ + +K   L  QY+ S+ +M  ++  +L+     E  +L+  LQ E+E+L +F + +        N+E   L++++ N+    + + E+ +Q++    S+ +++M SE              L+     +L  FD E+ Q+G 
Sbjct:   56 ELFDRQDPDKVFVDLREIGHGSFGAVYYARNAITNEVVAIKKMTFSGKQSAEKWQDILKEVRFLCQLKHENTIDYRGCYLKEHTAWLVMEYCLGSASDIIEVHKKPLKEEEIAAICQDALSGLDYLHAAGRIHRDVKAGNILLTEAGRVKLADFGSASMACPANSFVGTPYWMAPEVILAMDEGQYDGKVDVWSLGITCIELAERKPPYF-NMNAMSALYHIAQNDSPQLSTSMEWSGDFREFVIDCLRKEPQQRPTAAALLKHPFVTRPRPGRALMELI--LRTKAAVRELDNINYRKMKKILMVDGTSGEANGDNGCSAAGNGHSQSALTHDEDSAVSRDGKTFSVTTTNRLD----------PPRSQEDGDASKSNSLTSTQSSNVSAGSCVGHSGQRQSASNSSSASLGSVAETSAGQSPLGRRRGSRGSLVGTVN--RQDNFATIRTTSIVTRQIKEHQEQESE------------------LQMRGYKRMQDQHHKALVALEAKCLQEMDEHKARLDKEYESLLMTFAKELEKLQLKQQQELEKKLKSNVTNEKRLVKAIQAKQDEESKKFQQLQKSAYKSEKERYKQRYDGEELKVHKAGLHETQNQELTRLTITQADSLKREIRCYRRRRLVLAHGLEQEQLRAELERREGQLEQAHAVLLRHHEATQRLELNQQRAVHQLRADHLRRQHETEMSLQKQYSTRREHELHKKHAAEVKQQPKSLRQNELQIRKQFRETCKTQTRQYKAWKSQLMASTPRERH-----KELVKRLKDEQVRKLALLGEQYEQSIAEMLQKQSIRLDEAQSAELHQLQQDLQIEQELLLAFQSKKKIMAESQRNKERQELEDRIHNRLRTIQAKAEITVQQTTFSPSVLQLQMESERKQFATERLSREHLLSKRQVADLEKFDFESSQMGF 943          
BLAST of Serine/threonine kinase vs. TrEMBL
Match: A0A226E3V9 (Serine/threonine-protein kinase TAO1 OS=Folsomia candida OX=158441 GN=Fcan01_12404 PE=4 SV=1)

HSP 1 Score: 418.698 bits (1075), Expect = 1.852e-127
Identity = 308/918 (33.55%), Postives = 479/918 (52.18%), Query Frame = 2
Query:  104 EFDQLLCKDDPSTIFTNLKQIGCGSFGAVYYAQNXXXXXXXXXXXXXVDSKSQKDHWKDIKREICLLKQLNHVNCISFKGYYLKGNNPLIVMDYCLGSVSDIIEVFKKPLQEDEIGCVVVEVLKALNYLHKKNFIHRDIKASNILLTECGLVKLGDFGSSSFVNPANTFVGTPFWIAPEVIMAMESGLYDFKVDIWSLGITCIEMAEMEPPHFKTLNPMAAMYHIASNDSPCLLNP-SLWSNEFVFLVVAFLKKSPDNRPSAENALQSKFCTIKRPPFILLKMIKNARNAVAAREKSD-KSDKMKKILLQSKTDNESPPEMGRSPSFIEDEFXXXXXXXXXXXXXXXLDLFENLSSIEIPVNKKNRGDISNSSLKNINPMKIDQKLSHSQSDSVKLLSERNNVIPNSKSSGDISRKAGNENKVSKIIKQLQSI--DVKSVENLHIISLKIPLHRSSTSSESYEDKYKNPSDINEVWREQMNGLKRIRNQHKRSIQQLEEKHKNELETTKFSLSRELENVTSTFHKELEKLNKTNSLELDKNNKESRQKELNFVKNLETXXXXXXXXXXXXXXXENK-NTGQYEVEIN----------------------------------NVQKLGDARTRKFKRDAIMNRHRLQLKQLDSTLKQEQSQLEQKNALLLQQHDKLVNLQLGHQESMHILRIDQMQKLQNIEIEAQTQYAQQQESFLKKKQAAEVKNFPKYLKVKEQENQKACRDILNIQKKQFKILKEDELRNSRKKHNGESEQQIVDRLKENERQKQVELKAQYDASLEKMKAQELNKLESRHIRETLELENKLQTEKEVLRSFHNSQNEETMKNYNQEHLNLKNQMLNKRNELEVGIQESNRLFSLKRIEMYSELTTYHAKELRNFDLETVQLGIDQILINSISSD 2740
            E  +L  +DDP  IF +L++IG GSFGAVY+A+N +TKEI+AIK++    K   D W+DI +EI  L+QL H N I +KG YLK +   +VM+YCLGS SDIIEV K+PL+EDEI  +   VL+ L +LH    IHRD+KA NILLTE G VKL DFGS+S   PAN+FVGTP+W+APEVI+AM+ G YD KVD+WSLGITCIE+AE +PP+F  +N M+A+YHIA NDSP L    S WS+ F   V   LKK+P  R ++   L   F T  +   +L  +I  +R   A R+  +    KMKKIL+    + +S                                L E   S +IP    ++ + S +S ++I  + +      S ++S+ ++ E ++  PN  S   I R   N    +     ++ +  +  ++    I++ +   H         ED Y+  S    + RE           H+ ++ +LEEK + E+E  +  L  E EN+   F KELEKL   +  ELD+  K++   E    K +    +++ K+ + + + E K N  +++ E++                                  N +   D   RKF+R  ++  H+L+   L   L + Q QLEQ + +L++QH+    L+   Q ++H LR DQ++KL + E++ Q +Y ++ E  LKKK A E+K  PK LK KE + +K  RD   IQ  Q+K LK   L+ + K    E ++ ++ +LKE +R+K   L  QY+ S+ +M  ++  +L+     E  +L+ KL+ E E+L ++ +    +     ++E   L  ++  +R+ LE  ++E  + F+ +R E    L     +EL  FD E+ + G   + +   S +
Sbjct:   66 EISELFVRDDPDKIFEDLREIGHGSFGAVYFARNKETKEIVAIKKMSYTGKQSLDKWQDILKEIRFLRQLKHANTIDYKGCYLKEHTAWLVMEYCLGSASDIIEVHKRPLKEDEISAICEGVLRGLVHLHALGRIHRDVKAGNILLTENGTVKLADFGSASIQCPANSFVGTPYWMAPEVILAMDEGQYDGKVDVWSLGITCIELAERKPPYF-NMNAMSALYHIAQNDSPMLQTAVSNWSDTFKKFVELCLKKNPMERLASHKLLMHPFITRPKSSHVLTDLI--SRTKAAVRDLDNLNYRKMKKILMADSCETDS-------------------------------QLGEGDGSEDIPGGDSSKSN-SITSEQSIQSVGVSASSQSSSTNSIPIMHEHDD--PNHFSPISI-RPPRNRTSYASYTSSMERVPNNFATIRTTSIVTKQQKEHMQ-------EDMYEQMSGYKRMRRE-----------HQSALLKLEEKCRLEMENHRKMLDSEYENLLQQFSKELEKLQARHQQELDRKLKQNCSAEKRLTKEITARQEQERKSFELHKRKEYKQNKERWKRELSQDESTPKRQREATLQSQKDNLKYQEQQEEQRMLRNQKDYLDLEVRKFRRRKLIAYHQLEQDLLREELNKRQQQLEQAHNVLIKQHELTQELEYSQQRAVHQLREDQVRKLHHSELQNQHEYMKRAEVELKKKHALELKQQPKSLKQKEVQIRKQFRDTCKIQTVQYKALKIQILQTTPK----EEQKVVIKKLKEEQRRKLALLGEQYEQSIAEMLQKQSIRLDESQEVEAQQLKEKLERELEILIAYQSKNKMQAEAQRDRERKELSERVSIRRSLLEQKMREELQQFASERAERIRLLQERQMRELEQFDEESTRRGFSALALTEPSRE 923          
BLAST of Serine/threonine kinase vs. Ensembl Cavefish
Match: taok1b (TAO kinase 1 [Source:NCBI gene;Acc:103030718])

HSP 1 Score: 321.627 bits (823), Expect = 4.642e-94
Identity = 155/309 (50.16%), Postives = 217/309 (70.23%), Query Frame = 2
Query:  104 EFDQLLCKDDPSTIFTNLKQIGCGSFGAVYYAQNXXXXXXXXXXXXXVDSKSQKDHWKDIKREICLLKQLNHVNCISFKGYYLKGNNPLIVMDYCLGSVSDIIEVFKKPLQEDEIGCVVVEVLKALNYLHKKNFIHRDIKASNILLTECGLVKLGDFGSSSFVNPANTFVGTPFWIAPEVIMAMESGLYDFKVDIWSLGITCIEMAEMEPPHFKTLNPMAAMYHIASNDSPCLLNPSLWSNEFVFLVVAFLKKSPDNRPSAENALQSKFCTIKRPPFILLKMIKNARNAVAAREKSD-KSDKMKKILLQ 1027
            E  +L  K+DP  +F++L++IG GSFGAVY+A++++T E++AIK++    K   + W+DI +E+  L+++ H N I +KG YL+ +   + M+YCLGS SD++EV KKPLQE EI  +    L+ L YLH  N IHRDIKA NILLTE G VKL DFGS+S  +PAN+FVGTP+W+APEVI+AM+ G YD KVD+WSLGITCIE+AE +PP F  +N M+A+YHIA N+SP  L  S W++ F   V + L+K P +RP +++ LQ  F   +RP  +L+ +I   ++AV  RE  + +  KMKKIL Q
Sbjct:   14 EISELFFKEDPEKLFSDLREIGHGSFGAVYFARDVRTSEVVAIKKMSYSGKQSNEKWQDIIKEVKFLQRIQHPNSIEYKGCYLREHTAWLAMEYCLGSASDLLEVHKKPLQEIEIAAITHGALQGLAYLHSHNMIHRDIKAGNILLTEPGQVKLADFGSASIASPANSFVGTPYWMAPEVILAMDEGQYDGKVDVWSLGITCIELAERKPPLF-NMNAMSALYHIAQNESPT-LQSSEWTDYFRNFVDSCLQKIPQDRPHSDDLLQHAFVQRERPDTVLIDLILRTKDAV--RELDNLQYRKMKKILFQ 318          

HSP 2 Score: 117.087 bits (292), Expect = 2.901e-26
Identity = 124/458 (27.07%), Postives = 223/458 (48.69%), Query Frame = 2
Query: 1520 REQMNGLKRIRNQHKRSIQQLEEKHKNELETTKFSLSRELENVTSTFHKELEKLNKTNSLELDKNNK-------------------------ESRQKELNFVK-------NLETXXXXXXXXXXXXXXXENKNTGQYEVEINNVQK---LGDARTRKFKRDAIMNRHRLQLKQLDSTLKQEQSQLEQKNALLLQQHDKLVNLQLGHQESMHILRIDQMQKLQNIEIEAQTQYAQQQESFLKKKQAAEVKNFPKYLKVKEQENQKACRDILNIQKKQFKILKEDELRNSRKKHNGESEQQIVDRLKENERQKQVELKAQYDASLEKMKAQELNKLESRHIRETLELENKLQTEKEVLRSFHNSQNEETMKNYNQEHLNLKNQMLNKRNELEVGIQESNRLFSLKRIEMYSELTTYHAKELRNFDLETVQLGI-DQILINSISSDYVSVK*MLNYSYYFP 2785
            REQM+G KR+R QH++ +  LE K K E++  +  L +ELE   ++F  E+EKL K +   ++K+ K                         ES+++E    K       N    + K  K    + + EN    Q E E N +++     +   R+FKR  ++ RH ++   +   L + Q+Q + ++A+LL+ H+ +  L++    ++H +R + ++     E+  Q +Y +++E  L++K   EV+  PK LK KE + +K  +D   IQ +Q+K L+   L  + K       + ++ RLKE + +K   L  QYD S+  M + +  +L+     E   L+ +LQ E E+L ++ +    +T   +++E   L+ ++  +R  LE  I+E       +R E    L    A+E+  FD E+++LG  + +L N  SSD         +S+ FP
Sbjct:  461 REQMSGYKRMRRQHQKHLMALENKLKAEMDEHRLRLDKELETQRNSFAAEIEKLVKKHQAAMEKDAKSFANDEKKFQQHIQVQQKKELSSFIESQKREYKLRKEQLKEELNENQSTPKKEKQEWLSKQKENFQHFQAEEEANLLRRQRQYLELECRRFKRRILIARHNVEQDLVREELNKRQTQKDLEHAMLLRHHESMQELEVRQLGTIHKMRTELIRLQHQTELTNQLEYNKRRERELRRKHVMEVRQQPKSLKSKELQIKKQFQDTCKIQTRQYKALRNHLLETTPKS----DHKAVLKRLKEEQTRKLAILAEQYDHSINDMLSTQALRLDEAQEEECQVLKMQLQQELELLNAYQSKIKMQTDAQHDRERKELEQRVSLRRALLEQKIEEEMLALQNERSERIRSLLERQAREIEAFDSESMRLGFSNMVLSNLASSD--------GHSHSFP 906          
BLAST of Serine/threonine kinase vs. Ensembl Cavefish
Match: taok1b (TAO kinase 1 [Source:NCBI gene;Acc:103030718])

HSP 1 Score: 321.242 bits (822), Expect = 7.518e-94
Identity = 155/309 (50.16%), Postives = 217/309 (70.23%), Query Frame = 2
Query:  104 EFDQLLCKDDPSTIFTNLKQIGCGSFGAVYYAQNXXXXXXXXXXXXXVDSKSQKDHWKDIKREICLLKQLNHVNCISFKGYYLKGNNPLIVMDYCLGSVSDIIEVFKKPLQEDEIGCVVVEVLKALNYLHKKNFIHRDIKASNILLTECGLVKLGDFGSSSFVNPANTFVGTPFWIAPEVIMAMESGLYDFKVDIWSLGITCIEMAEMEPPHFKTLNPMAAMYHIASNDSPCLLNPSLWSNEFVFLVVAFLKKSPDNRPSAENALQSKFCTIKRPPFILLKMIKNARNAVAAREKSD-KSDKMKKILLQ 1027
            E  +L  K+DP  +F++L++IG GSFGAVY+A++++T E++AIK++    K   + W+DI +E+  L+++ H N I +KG YL+ +   + M+YCLGS SD++EV KKPLQE EI  +    L+ L YLH  N IHRDIKA NILLTE G VKL DFGS+S  +PAN+FVGTP+W+APEVI+AM+ G YD KVD+WSLGITCIE+AE +PP F  +N M+A+YHIA N+SP  L  S W++ F   V + L+K P +RP +++ LQ  F   +RP  +L+ +I   ++AV  RE  + +  KMKKIL Q
Sbjct:   14 EISELFFKEDPEKLFSDLREIGHGSFGAVYFARDVRTSEVVAIKKMSYSGKQSNEKWQDIIKEVKFLQRIQHPNSIEYKGCYLREHTAWLAMEYCLGSASDLLEVHKKPLQEIEIAAITHGALQGLAYLHSHNMIHRDIKAGNILLTEPGQVKLADFGSASIASPANSFVGTPYWMAPEVILAMDEGQYDGKVDVWSLGITCIELAERKPPLF-NMNAMSALYHIAQNESPT-LQSSEWTDYFRNFVDSCLQKIPQDRPHSDDLLQHAFVQRERPDTVLIDLILRTKDAV--RELDNLQYRKMKKILFQ 318          

HSP 2 Score: 117.472 bits (293), Expect = 2.690e-26
Identity = 124/458 (27.07%), Postives = 223/458 (48.69%), Query Frame = 2
Query: 1520 REQMNGLKRIRNQHKRSIQQLEEKHKNELETTKFSLSRELENVTSTFHKELEKLNKTNSLELDKNNK-------------------------ESRQKELNFVK-------NLETXXXXXXXXXXXXXXXENKNTGQYEVEINNVQK---LGDARTRKFKRDAIMNRHRLQLKQLDSTLKQEQSQLEQKNALLLQQHDKLVNLQLGHQESMHILRIDQMQKLQNIEIEAQTQYAQQQESFLKKKQAAEVKNFPKYLKVKEQENQKACRDILNIQKKQFKILKEDELRNSRKKHNGESEQQIVDRLKENERQKQVELKAQYDASLEKMKAQELNKLESRHIRETLELENKLQTEKEVLRSFHNSQNEETMKNYNQEHLNLKNQMLNKRNELEVGIQESNRLFSLKRIEMYSELTTYHAKELRNFDLETVQLGI-DQILINSISSDYVSVK*MLNYSYYFP 2785
            REQM+G KR+R QH++ +  LE K K E++  +  L +ELE   ++F  E+EKL K +   ++K+ K                         ES+++E    K       N    + K  K    + + EN    Q E E N +++     +   R+FKR  ++ RH ++   +   L + Q+Q + ++A+LL+ H+ +  L++    ++H +R + ++     E+  Q +Y +++E  L++K   EV+  PK LK KE + +K  +D   IQ +Q+K L+   L  + K       + ++ RLKE + +K   L  QYD S+  M + +  +L+     E   L+ +LQ E E+L ++ +    +T   +++E   L+ ++  +R  LE  I+E       +R E    L    A+E+  FD E+++LG  + +L N  SSD         +S+ FP
Sbjct:  461 REQMSGYKRMRRQHQKHLMALENKLKAEMDEHRLRLDKELETQRNSFAAEIEKLVKKHQAAMEKDAKSFANDEKKFQQHIQVQQKKELSSFIESQKREYKLRKEQLKEELNENQSTPKKEKQEWLSKQKENFQHFQAEEEANLLRRQRQYLELECRRFKRRILIARHNVEQDLVREELNKRQTQKDLEHAMLLRHHESMQELEVRQLGTIHKMRTELIRLQHQTELTNQLEYNKRRERELRRKHVMEVRQQPKSLKSKELQIKKQFQDTCKIQTRQYKALRNHLLETTPKS----DHKAVLKRLKEEQTRKLAILAEQYDHSINDMLSTQALRLDEAQEEECQVLKMQLQQELELLNAYQSKIKMQTDAQHDRERKELEQRVSLRRALLEQKIEEEMLALQNERSERIRSLLERQAREIEAFDSESMRLGFSNMVLSNLASSD--------GHSHSFP 906          
BLAST of Serine/threonine kinase vs. Ensembl Cavefish
Match: taok1a (serine/threonine-protein kinase TAO1-like [Source:NCBI gene;Acc:103025376])

HSP 1 Score: 319.701 bits (818), Expect = 1.398e-93
Identity = 157/304 (51.64%), Postives = 215/304 (70.72%), Query Frame = 2
Query:  116 LLCKDDPSTIFTNLKQIGCGSFGAVYYAQNXXXXXXXXXXXXXVDSKSQKDHWKDIKREICLLKQLNHVNCISFKGYYLKGNNPLIVMDYCLGSVSDIIEVFKKPLQEDEIGCVVVEVLKALNYLHKKNFIHRDIKASNILLTECGLVKLGDFGSSSFVNPANTFVGTPFWIAPEVIMAMESGLYDFKVDIWSLGITCIEMAEMEPPHFKTLNPMAAMYHIASNDSPCLLNPSLWSNEFVFLVVAFLKKSPDNRPSAENALQSKFCTIKRPPFILLKMIKNARNAVAAREKSD-KSDKMKKILL 1024
            L  K+DP  +F +L++IG GSFGAVY+A++++T E++AIK++    K   + W+DI +E+  L+++ H N I +KG YL+ +   +VM+YCLGS SD++EV KKPLQE EI  +    L+ L YLH  N IHRDIKA NILLTE GLVKL DFGS+S  +PAN+FVGTP+W+APEVI+AM+ G YD KVDIWSLGITCIE+AE +PP F  +N M+A+YHIA N+SP  L  S W++ F   V + L+K P +RP+ E  LQ  F   +R   +L ++I+  ++AV  RE  + +S KMKKIL 
Sbjct:   18 LFFKEDPEKLFIDLREIGHGSFGAVYFARDVRTSEVVAIKKMSYSGKQTNEKWQDIIKEVKFLQRIKHPNSIEYKGCYLREHTAWLVMEYCLGSASDVLEVHKKPLQELEIAAITHGALQGLAYLHSHNMIHRDIKAGNILLTEPGLVKLADFGSASIASPANSFVGTPYWMAPEVILAMDEGQYDGKVDIWSLGITCIELAERKPPLF-NMNAMSALYHIAQNESPT-LQSSEWTDYFRNFVDSCLQKLPQDRPTCEELLQHAFVLRERAESVLNELIQRTKDAV--RELDNLQSRKMKKILF 317          

HSP 2 Score: 120.939 bits (302), Expect = 2.208e-27
Identity = 120/445 (26.97%), Postives = 224/445 (50.34%), Query Frame = 2
Query: 1520 REQMNGLKRIRNQHKRSIQQLEEKHKNELETTKFSLSRELENVTSTFHKELEKLNKTNSLELDKNNKESRQKELNFVKNLETXXXXXXXXXXXXXXXENK-NTGQYEVEIN-------------------NVQKLG---------------DARTRKFKRDAIMNRHRLQLKQLDSTLKQEQSQLEQKNALLLQQHDKLVNLQLGHQESMHILRIDQMQKLQNIEIEAQTQYAQQQESFLKKKQAAEVKNFPKYLKVKEQENQKACRDILNIQKKQFKILKEDELRNSRKKHNGESEQQIVDRLKENERQKQVELKAQYDASLEKMKAQELNKLESRHIRETLELENKLQTEKEVLRSFHNSQNEETMKNYNQEHLNLKNQMLNKRNELEVGIQESNRLFSLKRIEMYSELTTYHAKELRNFDLETVQLGIDQILINSISSDYVS 2749
            REQM+G KR+R QH++ +  LE K K+E++  +  L +ELE+  S+F  E++KL K +   ++K+ K     E  F +++++  KK++ +  ++ K E K    Q + E+N                   N+Q                  D   R+FKR  ++ RH ++       L + Q+Q + ++A+LL+ H+ +  L+  H  ++  +R + ++     E+  Q +Y +++E  L++K   EV+  PK LK KE + +K  ++   IQ +Q+KIL+   L N+ K  +    + ++ RLKE + +K   L  QYD S+  M + +  +L+     E   L  +LQ E E+L ++ +    +T    ++E   L+ ++  +R  LE  I+E       +R E    L    A+E+  FD E+++LG   +++ +IS + +S
Sbjct:  462 REQMSGYKRMRRQHQKQLLALENKLKSEMDEHRLKLDKELESQRSSFSSEMDKLIKKHQAAMEKDAKTFANDEKKFQQHIQSQQKKELSSFLESQKREYKMRKEQLKEELNENQSTPKKEKQEWLSKQKENIQHFQAEEEANLLRRQRQYLDLECRRFKRRILIARHNVEQDLAREELNKRQTQKDLEHAMLLRHHESMQELEFRHLNTIQKMRAELIRLQHQTELNNQMEYNKRRERELRRKHVMEVRQQPKSLKSKELQIKKQFQETCKIQTRQYKILRNQLLDNTPKSDH----KTMLKRLKEEQTRKLAILAEQYDHSINDMLSTQALRLDEAQEAECQVLRMQLQQELELLNAYQSKIKMQTEAQQDRERKELEQRVSLRRALLEQKIEEEMLALQNERSERIRSLLERQAREIEAFDSESLRLGFSNMVLANISPEGLS 902          
BLAST of Serine/threonine kinase vs. Ensembl Cavefish
Match: taok1a (serine/threonine-protein kinase TAO1-like [Source:NCBI gene;Acc:103025376])

HSP 1 Score: 319.316 bits (817), Expect = 2.503e-93
Identity = 157/304 (51.64%), Postives = 215/304 (70.72%), Query Frame = 2
Query:  116 LLCKDDPSTIFTNLKQIGCGSFGAVYYAQNXXXXXXXXXXXXXVDSKSQKDHWKDIKREICLLKQLNHVNCISFKGYYLKGNNPLIVMDYCLGSVSDIIEVFKKPLQEDEIGCVVVEVLKALNYLHKKNFIHRDIKASNILLTECGLVKLGDFGSSSFVNPANTFVGTPFWIAPEVIMAMESGLYDFKVDIWSLGITCIEMAEMEPPHFKTLNPMAAMYHIASNDSPCLLNPSLWSNEFVFLVVAFLKKSPDNRPSAENALQSKFCTIKRPPFILLKMIKNARNAVAAREKSD-KSDKMKKILL 1024
            L  K+DP  +F +L++IG GSFGAVY+A++++T E++AIK++    K   + W+DI +E+  L+++ H N I +KG YL+ +   +VM+YCLGS SD++EV KKPLQE EI  +    L+ L YLH  N IHRDIKA NILLTE GLVKL DFGS+S  +PAN+FVGTP+W+APEVI+AM+ G YD KVDIWSLGITCIE+AE +PP F  +N M+A+YHIA N+SP  L  S W++ F   V + L+K P +RP+ E  LQ  F   +R   +L ++I+  ++AV  RE  + +S KMKKIL 
Sbjct:   18 LFFKEDPEKLFIDLREIGHGSFGAVYFARDVRTSEVVAIKKMSYSGKQTNEKWQDIIKEVKFLQRIKHPNSIEYKGCYLREHTAWLVMEYCLGSASDVLEVHKKPLQELEIAAITHGALQGLAYLHSHNMIHRDIKAGNILLTEPGLVKLADFGSASIASPANSFVGTPYWMAPEVILAMDEGQYDGKVDIWSLGITCIELAERKPPLF-NMNAMSALYHIAQNESPT-LQSSEWTDYFRNFVDSCLQKLPQDRPTCEELLQHAFVLRERAESVLNELIQRTKDAV--RELDNLQSRKMKKILF 317          

HSP 2 Score: 120.939 bits (302), Expect = 1.800e-27
Identity = 120/445 (26.97%), Postives = 224/445 (50.34%), Query Frame = 2
Query: 1520 REQMNGLKRIRNQHKRSIQQLEEKHKNELETTKFSLSRELENVTSTFHKELEKLNKTNSLELDKNNKESRQKELNFVKNLETXXXXXXXXXXXXXXXENK-NTGQYEVEIN-------------------NVQKLG---------------DARTRKFKRDAIMNRHRLQLKQLDSTLKQEQSQLEQKNALLLQQHDKLVNLQLGHQESMHILRIDQMQKLQNIEIEAQTQYAQQQESFLKKKQAAEVKNFPKYLKVKEQENQKACRDILNIQKKQFKILKEDELRNSRKKHNGESEQQIVDRLKENERQKQVELKAQYDASLEKMKAQELNKLESRHIRETLELENKLQTEKEVLRSFHNSQNEETMKNYNQEHLNLKNQMLNKRNELEVGIQESNRLFSLKRIEMYSELTTYHAKELRNFDLETVQLGIDQILINSISSDYVS 2749
            REQM+G KR+R QH++ +  LE K K+E++  +  L +ELE+  S+F  E++KL K +   ++K+ K     E  F +++++  KK++ +  ++ K E K    Q + E+N                   N+Q                  D   R+FKR  ++ RH ++       L + Q+Q + ++A+LL+ H+ +  L+  H  ++  +R + ++     E+  Q +Y +++E  L++K   EV+  PK LK KE + +K  ++   IQ +Q+KIL+   L N+ K  +    + ++ RLKE + +K   L  QYD S+  M + +  +L+     E   L  +LQ E E+L ++ +    +T    ++E   L+ ++  +R  LE  I+E       +R E    L    A+E+  FD E+++LG   +++ +IS + +S
Sbjct:  464 REQMSGYKRMRRQHQKQLLALENKLKSEMDEHRLKLDKELESQRSSFSSEMDKLIKKHQAAMEKDAKTFANDEKKFQQHIQSQQKKELSSFLESQKREYKMRKEQLKEELNENQSTPKKEKQEWLSKQKENIQHFQAEEEANLLRRQRQYLDLECRRFKRRILIARHNVEQDLAREELNKRQTQKDLEHAMLLRHHESMQELEFRHLNTIQKMRAELIRLQHQTELNNQMEYNKRRERELRRKHVMEVRQQPKSLKSKELQIKKQFQETCKIQTRQYKILRNQLLDNTPKSDH----KTMLKRLKEEQTRKLAILAEQYDHSINDMLSTQALRLDEAQEAECQVLRMQLQQELELLNAYQSKIKMQTEAQQDRERKELEQRVSLRRALLEQKIEEEMLALQNERSERIRSLLERQAREIEAFDSESLRLGFSNMVLANISPEGLS 904          
BLAST of Serine/threonine kinase vs. Ensembl Cavefish
Match: taok2a (serine/threonine-protein kinase TAO2-like [Source:NCBI gene;Acc:103028598])

HSP 1 Score: 321.242 bits (822), Expect = 3.111e-93
Identity = 155/305 (50.82%), Postives = 217/305 (71.15%), Query Frame = 2
Query:  116 LLCKDDPSTIFTNLKQIGCGSFGAVYYAQNXXXXXXXXXXXXXVDSKSQKDHWKDIKREICLLKQLNHVNCISFKGYYLKGNNPLIVMDYCLGSVSDIIEVFKKPLQEDEIGCVVVEVLKALNYLHKKNFIHRDIKASNILLTECGLVKLGDFGSSSFVNPANTFVGTPFWIAPEVIMAMESGLYDFKVDIWSLGITCIEMAEMEPPHFKTLNPMAAMYHIASNDSPCLLNPSLWSNEFVFLVVAFLKKSPDNRPSAENALQSKFCTIKRPPFILLKMIKNARNAVAAREKSD-KSDKMKKILLQ 1027
            L  KDDP  +F +L++IG GSFGAVY+A+++++ E++AIK++    K   + W+DI +E+  L++L H N I +KG YL+ +   +VM+YCLGS SD++EV KKPLQE EI  +    L+ L YLH  N IHRD+KA NILLTE G VKLGDFGS+S V PAN+FVGTP+W+APEVI+AM+ G YD KVD+WSLGITCIE+AE +PP F  +N M+A+YHIA N+SP L + + WS+ F   V + L+K P +RP+++  L  +F   +RP  +++ +I   ++AV  RE  + +  KMKKIL Q
Sbjct:   18 LFYKDDPEKLFADLREIGHGSFGAVYFARDVRSNEVVAIKKMSYSGKQSNEKWQDIIKEVKFLQKLRHPNTIEYKGCYLREHTAWLVMEYCLGSASDLLEVHKKPLQEVEIAAITHGALQGLAYLHSHNMIHRDVKAGNILLTEPGQVKLGDFGSASIVAPANSFVGTPYWMAPEVILAMDEGQYDGKVDVWSLGITCIELAERKPPLF-NMNAMSALYHIAQNESPVLAS-NHWSDYFRNFVDSCLQKIPQDRPTSDVLLNHRFLCRERPLSVVMDLIARTKDAV--RELDNLQYRKMKKILFQ 318          

HSP 2 Score: 111.694 bits (278), Expect = 1.757e-24
Identity = 120/451 (26.61%), Postives = 214/451 (47.45%), Query Frame = 2
Query: 1520 REQMNGLKRIRNQHKRSIQQLEEKHKNELETTKFSLSRELENVTSTFHKELEKLNKTNSLELDKNNKES--------------RQKELNFVKNLETXXXXXXXXXXXXXXXENKNTGQYEVE---------INNVQKLGDA------------RTRKFKRDAIMNRHRLQLKQLDSTLKQEQSQLEQKNALLLQQHDKLVNLQLGHQESMHILRIDQMQKLQNIEIEAQTQYAQQQESFLKKKQAAEVKNFPKYLKVKEQENQKACRDILNIQKKQFKILKEDELRNSRKKHNGESEQQIVDRLKENERQKQVELKAQYDASLEKM-KAQELNKLESRHIRETLELEN-----KLQTEKEVLRSFHNSQNEETMKNYNQEHLNLKNQMLNKRNELEVGIQESNRLFSLKRIEMYSELTTYHAKELRNFDLETVQLGIDQILINSISSDYVS 2749
            REQM G KR+R QH++ +  LE K K E++  +  L +ELE+  + F  E +KL+K +   L+K  K +              ++KEL  +   +    +  K   K   +EN++T + E +         +  +Q   +A            + R++KR  ++ RH L+   L   L + Q+Q + + A+LL+ H+    L+      +   R D ++     E+  Q  Y +++E  L++K   EV+  PK LK KE + ++  +D   IQ +Q+K L+   L  + K  +    + ++ RLKE + +K   L  QYD S+  M   Q ++KL    + ET E E      +LQ E E+L ++ +     T   +++E  +L+ ++  +R  LE  I+E       +R E    L    A+E+  FD E+++LG   + +  I ++  S
Sbjct:  468 REQMTGYKRMRRQHQKQLLALENKLKTEMDEHQLRLDKELESQRNNFGSEADKLSKKHQAILEKETKAALTEEKKFQQHILGQQKKELTGLLESQKRQYRQRKEQLKEELNENQSTPKREKQEWLVRQKECLQQIQAEEEAGLLRRQRQYYELQCRQYKRKMLLARHNLEQDLLREELNKRQTQKDLECAMLLRHHESTQELEFRQLGLVQHTRADLIRTQHQSELANQMDYNKRREQELRQKHNMEVRQQPKSLKTKELQIKRQFQDTCKIQTRQYKALRNHLLETTPKSEH----KAVLKRLKEEQTRKLAILAEQYDHSINDMLSTQAVSKLR---LDETQEAEYQVLRMQLQQELELLNAYQSKIKMHTDTQHDREVKDLEQRVSIRRALLEQRIEEEMLSLQNERSERIRTLLERQAREIEAFDSESMRLGFSNMALTGIPAEAYS 911          
BLAST of Serine/threonine kinase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002959.1 (pep scaffold:Pmarinus_7.0:GL476671:15807:33413:-1 gene:ENSPMAG00000002691.1 transcript:ENSPMAT00000002959.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 319.316 bits (817), Expect = 2.062e-94
Identity = 157/316 (49.68%), Postives = 216/316 (68.35%), Query Frame = 2
Query:  104 EFDQLLCKDDPSTIFTNLKQIGCGSFGAVYYAQNXXXXXXXXXXXXXVDSKSQKDHWKDIKREICLLKQLNHVNCISFKGYYLKGNNPLIVMDYCLGSVSDIIEVFKKPLQEDEIGCVVVEVLKALNYLHKKNFIHRDIKASNILLTECGLVKLGDFGSSSFVNPANTFVGTPFWIAPEVIMAMESGLYDFKVDIWSLGITCIEMAEMEPPHFKTLNPMAAMYHIASNDSPCLLNPSLWSNEFVFLVVAFLKKSPDNRPSAENALQSKFCTIKRPPFILLKMIKNARNAVAAREKSD-KSDKMKKILLQSKTDNES 1048
            E  +L  K+DP  +F +LK+IG GSFGAVY+A+NI T E++AIK++    K   + W+DI +E+  L +L H N I +KG YL+ +   ++M+YCLGS SD++EV KKPLQE EI  +    L+ L +LH    IHRD+KA NILLTE G VKL DFGS+S   PAN+FVGTP+W+APEVI+AM+ G YD KVD+WSLGITCIE+AE +PP F  +N M+A+YHIA NDSP L +P  WS+ F   V + L+K+  +RP++   L+  F    RP  +L++MI+  ++AV  RE  + +  KMKK+L Q   +  S
Sbjct:   14 EVAELFFKEDPEKLFCDLKEIGHGSFGAVYFARNIHTSEVVAIKKMSYSGKQSNEKWQDIIKEVKFLTKLKHPNIIEYKGCYLREHTAWMIMEYCLGSASDLLEVHKKPLQEIEIAAIAHGALQGLAFLHNHTMIHRDVKAGNILLTEPGQVKLADFGSASLTAPANSFVGTPYWMAPEVILAMDEGQYDGKVDVWSLGITCIELAERKPPLF-NMNAMSALYHIAQNDSPTLQSPE-WSDYFRNFVDSCLQKNGQDRPTSAGLLRHAFVMRDRPESVLIEMIQRTKDAV--RELDNLQYRKMKKLLFQETQNGPS 325          

HSP 2 Score: 122.094 bits (305), Expect = 1.499e-28
Identity = 115/445 (25.84%), Postives = 218/445 (48.99%), Query Frame = 2
Query: 1520 REQMNGLKRIRNQHKRSIQQLEEKHKNELETTKFSLSRELENVTSTFHKELEKLNKTNSLELDKNNKES--------------RQKELNFVKNLETXXXXXXXXXXXXXXXENKNTGQYEVE---------INNVQKLGDA------------RTRKFKRDAIMNRHRLQLKQLDSTLKQEQSQLEQKNALLLQQHDKLVNLQLGHQESMHILRIDQMQKLQNIEIEAQTQYAQQQESFLKKKQAAEVKNFPKYLKVKEQENQKACRDILNIQKKQFKILKEDELRNSRKKHNGESEQQIVDRLKENERQKQVELKAQYDASLEKMKAQELNKLESRHIRETLELENKLQTEKEVLRSFHNSQNEETMKNYNQEHLNLKNQMLNKRNELEVGIQESNRLFSLKRIEMYSELTTYHAKELRNFDLETVQLGIDQILINSISSDYVS 2749
            REQM+G KR+R QH++ +  LE K K E++  +  L +ELE  T+    ++EKL K +   LDK  K +              ++KELN     +       K   K   +EN++T + E +         I + Q   +A              R+FKR  ++ RH L+   L   L ++Q Q + ++A+LL+ H+   +L+  H  ++  +R + ++     E+  Q +Y + +E  L++K   E++  PK L+VKE + +K  +D   +Q +Q+K L+   L  + K  +    + ++ RLK+ + +K   L  QY+ ++ +M + +  +L+     E   L+ +LQ E E+L ++ +     T   + +E   L+ ++  +R  LE  I+E       +R +    L    A+E+  FD E+V+LG   ++++++ ++  S
Sbjct:  465 REQMSGYKRMRRQHQKQLMALENKLKAEMDEHRLRLDKELETHTNGAASDMEKLLKKHQALLDKEVKAAGAEEKKFQQHILSQQKKELNSFLEAQKREYNMRKEQLKRELNENQSTPKKEKQEWLSRQKETIQHFQAEEEATMLRSQRHYLELECRRFKRRMLLERHNLEQGLLREELNKKQMQKDSEHAMLLRHHEATQDLEFRHLNTVQRMRSELIRLQHQTELANQMEYNKGRERELRRKHVMEIRQQPKCLRVKEIQIKKQFQDTCKVQTRQYKALRNHLLETTPKGDH----KAVLKRLKDEQTRKLAILAEQYEHTINEMMSTQALRLDEAQEGECQALKVQLQQELELLNAYQSKIKMRTDAQHERERKELEQKVSLRRALLEQKIEEEMVALQTERSDKIRSLLERQAREIELFDSESVRLGFSNLVLSNLPAEAFS 905          
BLAST of Serine/threonine kinase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002962.1 (pep scaffold:Pmarinus_7.0:GL476671:16080:33623:-1 gene:ENSPMAG00000002691.1 transcript:ENSPMAT00000002962.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 318.546 bits (815), Expect = 2.800e-94
Identity = 157/316 (49.68%), Postives = 216/316 (68.35%), Query Frame = 2
Query:  104 EFDQLLCKDDPSTIFTNLKQIGCGSFGAVYYAQNXXXXXXXXXXXXXVDSKSQKDHWKDIKREICLLKQLNHVNCISFKGYYLKGNNPLIVMDYCLGSVSDIIEVFKKPLQEDEIGCVVVEVLKALNYLHKKNFIHRDIKASNILLTECGLVKLGDFGSSSFVNPANTFVGTPFWIAPEVIMAMESGLYDFKVDIWSLGITCIEMAEMEPPHFKTLNPMAAMYHIASNDSPCLLNPSLWSNEFVFLVVAFLKKSPDNRPSAENALQSKFCTIKRPPFILLKMIKNARNAVAAREKSD-KSDKMKKILLQSKTDNES 1048
            E  +L  K+DP  +F +LK+IG GSFGAVY+A+NI T E++AIK++    K   + W+DI +E+  L +L H N I +KG YL+ +   ++M+YCLGS SD++EV KKPLQE EI  +    L+ L +LH    IHRD+KA NILLTE G VKL DFGS+S   PAN+FVGTP+W+APEVI+AM+ G YD KVD+WSLGITCIE+AE +PP F  +N M+A+YHIA NDSP L +P  WS+ F   V + L+K+  +RP++   L+  F    RP  +L++MI+  ++AV  RE  + +  KMKK+L Q   +  S
Sbjct:   16 EVAELFFKEDPEKLFCDLKEIGHGSFGAVYFARNIHTSEVVAIKKMSYSGKQSNEKWQDIIKEVKFLTKLKHPNIIEYKGCYLREHTAWMIMEYCLGSASDLLEVHKKPLQEIEIAAIAHGALQGLAFLHNHTMIHRDVKAGNILLTEPGQVKLADFGSASLTAPANSFVGTPYWMAPEVILAMDEGQYDGKVDVWSLGITCIELAERKPPLF-NMNAMSALYHIAQNDSPTLQSPE-WSDYFRNFVDSCLQKNGQDRPTSAGLLRHAFVMRDRPESVLIEMIQRTKDAV--RELDNLQYRKMKKLLFQETQNGPS 327          

HSP 2 Score: 118.627 bits (296), Expect = 2.010e-27
Identity = 114/430 (26.51%), Postives = 209/430 (48.60%), Query Frame = 2
Query: 1520 REQMNGLKRIRNQHKRSIQQLEEKHKNELETTKFSLSRELENVTSTFHKELEKLNKTNSLELDKNNKES--------------RQKELNFVKNLETXXXXXXXXXXXXXXXENKNTGQYEVE---------INNVQKLGDA------------RTRKFKRDAIMNRHRLQLKQLDSTLKQEQSQLEQKNALLLQQHDKLVNLQLGHQESMHILRIDQMQKLQNIEIEAQTQYAQQQESFLKKKQAAEVKNFPKYLKVKEQENQKACRDILNIQKKQFKILKEDELRNSRKKHNGESEQQIVDRLKENERQKQVELKAQYDASLEKMKAQELNKLESRHIRETLELENKLQTEKEVLRSFHNSQNEETMKNYNQEHLNLKNQMLNKRNELEVGIQESNRLFSLKRIEMYSELTTYHAKELRNFDLETVQLG 2704
            REQM+G KR+R QH++ +  LE K K E++  +  L +ELE  T+    ++EKL K +   LDK  K +              ++KELN     +       K   K   +EN++T + E +         I + Q   +A              R+FKR  ++ RH L+   L   L ++Q Q + ++A+LL+ H+   +L+  H  ++  +R + ++     E+  Q +Y + +E  L++K   E++  PK L+VKE + +K  +D   +Q +Q+K L+   L  + K  +    + ++ RLK+ + +K   L  QY+ ++ +M + +  +L+     E   L+ +LQ E E+L ++ +     T   + +E   L+ ++  +R  LE  I+E       +R +    L    A+E+  FD E+V+LG
Sbjct:  524 REQMSGYKRMRRQHQKQLMALENKLKAEMDEHRLRLDKELETHTNGAASDMEKLLKKHQALLDKEVKAAGAEEKKFQQHILSQQKKELNSFLEAQKREYNMRKEQLKRELNENQSTPKKEKQEWLSRQKETIQHFQAEEEATMLRSQRHYLELECRRFKRRMLLERHNLEQGLLREELNKKQMQKDSEHAMLLRHHEATQDLEFRHLNTVQRMRSELIRLQHQTELANQMEYNKGRERELRRKHVMEIRQQPKCLRVKEIQIKKQFQDTCKVQTRQYKALRNHLLETTPKGDH----KAVLKRLKDEQTRKLAILAEQYEHTINEMMSTQALRLDEAQEGECQALKVQLQQELELLNAYQSKIKMRTDAQHERERKELEQKVSLRRALLEQKIEEEMVALQTERSDKIRSLLERQAREIELFDSESVRLG 949          
BLAST of Serine/threonine kinase vs. Ensembl Sea Lamprey
Match: slka (STE20-like kinase a [Source:ZFIN;Acc:ZDB-GENE-050411-66])

HSP 1 Score: 204.142 bits (518), Expect = 3.328e-54
Identity = 112/278 (40.29%), Postives = 167/278 (60.07%), Query Frame = 2
Query:  104 EFDQLLCKDDPSTIFTNLKQIGCGSFGAVYYAQNXXXXXXXXXXXXXVDSKSQKDHWKDIKREICLLKQLNHVNCISFKGYYLKGNNPLIVMDYCLGSVSDIIEV-FKKPLQEDEIGCVVVEVLKALNYLHKKNFIHRDIKASNILLTECGLVKLGDFGSSS----FVNPANTFVGTPFWIAPEVIMA--MESGLYDFKVDIWSLGITCIEMAEMEPPHFKTLNPMAAMYHIASNDSPCLLNPSLWSNEFVFLVVAFLKKSPDNRPSAENALQSKFCT 916
            ++D +    DP+ +++ + ++G G+FG VY AQN ++  + A K   +++KS+++  +D   EI +L   +H N +     +   N   I +++C G   D I +  ++ L E +I  V  ++L+ALNYLH    IHRD+KA NILLT  G VKL DFG S+     +   ++F+GTP+W+APEV+M   M+   YD+K DIWSLGIT IE+A+MEPP+ + LNPM  M  IA ND P L  PS WS EF   +   L K+P+ R +A   LQ  F +
Sbjct:   19 QYDHVRRDVDPAELWSVIGELGDGAFGKVYKAQNKESGVLAAAKV--IETKSEEE-LEDYMVEIEILALCDHPNIVGLLNAFYYENKLWIFIEFCPGGAVDAIMLELERGLAEPQIRVVCKQMLEALNYLHTHRIIHRDLKAGNILLTFEGDVKLADFGVSAKNTRTLQRRDSFIGTPYWMAPEVVMCETMKDAPYDYKADIWSLGITLIELAQMEPPNHE-LNPMRVMLKIAKNDPPSLSFPSKWSAEFTDFLKKCLDKNPETRWNALQLLQHSFIS 292          
BLAST of Serine/threonine kinase vs. Ensembl Sea Lamprey
Match: stk25a (serine/threonine kinase 25a [Source:ZFIN;Acc:ZDB-GENE-041010-92])

HSP 1 Score: 176.022 bits (445), Expect = 6.592e-48
Identity = 111/266 (41.73%), Postives = 157/266 (59.02%), Query Frame = 2
Query:  131 DPSTIFTNLKQIGCGSFGAVYYAQNXXXXXXXXXXXXXVDSKSQKDHWKDIKREICLLKQLNHVNCISFKGYYLKGNNPLIVMDYCLGSVSDIIEVFKKPLQEDEIGCVVVEVLKALNYLHKKNFIHRDIK--ASNILLTECGLVKLGDFGSSSFVNPA----NTFVGTPFWIAPEVIMAMESGLYDFKVDIWSLGITCIEMAEMEPPHFKTLNPMAAMYHIASNDSPCLLNPSLWSNEFVFLVVAFLKKSPDNRPSAENALQSKF 910
            DP  +FT  ++IG GSFG V+  + I  +    +    +D +  +D  +DI++EI +L Q +      + G YLKG    I+M+Y LG  S +  +   PL+E +I  ++ E+LK L+YLH +  IHRDIK  A+N+LL+E G VKL DFG +  +       NTFVGTPFW+APEVI   +   YDFK DIWSLGIT IE+A+ EPP+   L+PM  ++ I  N+ P L     +S  F   V + L K P  RP+A+  L+ KF
Sbjct:   21 DPEELFTKQERIGKGSFGEVF--KGIDNRTKEVVAIKIIDLEEAEDEIEDIQQEITVLSQCDSPYVTHYFGSYLKGTKLWIIMEY-LGGGSALDLIKPGPLEEHQIATILREILKGLDYLHSERKIHRDIKGPAANVLLSEQGDVKLADFGVAGQLTDTQIKRNTFVGTPFWMAPEVI---KQSAYDFKADIWSLGITAIELAKGEPPN-SELHPMRVLFLIPKNNPPTL--EGNYSKAFKEFVDSCLNKDPQFRPTAKELLKHKF 277          
BLAST of Serine/threonine kinase vs. Ensembl Sea Lamprey
Match: MAP4K3 (mitogen-activated protein kinase kinase kinase kinase 3 [Source:HGNC Symbol;Acc:HGNC:6865])

HSP 1 Score: 170.244 bits (430), Expect = 1.068e-43
Identity = 101/262 (38.55%), Postives = 159/262 (60.69%), Query Frame = 2
Query:  146 FTNLKQIGCGSFGAVYYAQNXXXXXXXXXXXXXVDSKSQKDHWKDIKREICLLKQLNHVNCISFKGYYLKGNNPLIVMDYCLG-SVSDIIEVFKKPLQEDEIGCVVVEVLKALNYLHKKNFIHRDIKASNILLTECGLVKLGDFGSSSFVNPA----NTFVGTPFWIAPEVIMAMESGLYDFKVDIWSLGITCIEMAEMEPPHFKTLNPMAAMYHIASN--DSPCLLNPSLWSNEFVFLVVAFLKKSPDNRPSAENALQSKF 910
            F   +++G G++G V+ A+N++T E++AIK IK++     D +  I++EI ++K+  H N +++ G YL+ +   I M++C G S+ DI  V   PL E +I  V  E L+ L YLH +  +HRDIK +NILLT+ G VKL DFG S+ +        +F+GTP+W+APEV      G Y+ + D+W++GIT IE+AE++PP F  L+PM A++ ++ +    P L +   WS  F   +   L K+P  RP+AE  L   +
Sbjct:   14 FELAERLGSGTYGDVHKARNVQTGELVAIKIIKLEPG---DDFSVIQQEIVMMKECKHTNIVAYYGSYLRHDKLWICMEHCGGGSLQDIYHV-TGPLTERQIAYVTRETLQGLAYLHSEGKMHRDIKGANILLTDDGDVKLADFGVSAQITATIAKRKSFIGTPYWMAPEVAAVERKGGYNHQCDVWAVGITAIELAELQPPMFD-LHPMRALFLMSKSGFQPPKLRDKQKWSPVFHNFIKMALTKNPKKRPTAEKMLTHSY 270          
BLAST of Serine/threonine kinase vs. Ensembl Yeast
Match: STE20 (Cdc42p-activated signal transducing kinase; involved in pheromone response, pseudohyphal/invasive growth, vacuole inheritance, down-regulation of sterol uptake; GBB motif binds Ste4p; member of the PAK (p21-activated kinase) family [Source:SGD;Acc:S000000999])

HSP 1 Score: 162.925 bits (411), Expect = 1.461e-41
Identity = 115/290 (39.66%), Postives = 163/290 (56.21%), Query Frame = 2
Query:  119 LCKD-DPSTIFTNLKQIGCGSFGAVYYAQNXXXXXXXXXXXXXVDSKSQKDHWKDIKREICLLKQLNHVNCISF-KGYYLKGNNPLIVMDYC-LGSVSDIIEVFKKPLQEDEIGCVVVEVLKALNYLHKKNFIHRDIKASNILLTECGLVKLGDFGSSSFVNPAN----TFVGTPFWIAPEVIMAMESGLYDFKVDIWSLGITCIEMAEMEPPHFKTLNPMAAMYHIASNDSPCLLNPSLWSNEFVFLVVAFLKKSPDNRPSAENALQSKFCT-IKRPPFILLKMIKNAR 964
            +C D DPST + NL +IG G+ G VY A  I T   +AIK++ ++ + +K+    I  EI ++K   H N ++F   Y LKG+   ++M+Y   GS++D++      L E +IG V  E L  L +LH K  +HRDIK+ NILL+  G +KL DFG  + +N  N    T VGTP+W+APEV+   E   Y  KVDIWSLGI  IEM E EPP+     P+ A+Y IA+N +P L  P   S+     +   L   P++R SA   L  ++ T I      L  ++K AR
Sbjct:  610 ICSDGDPSTKYANLVKIGQGASGGVYTAYEIGTNVSVAIKQMNLEKQPKKEL---IINEILVMKGSKHPNIVNFIDSYVLKGDL-WVIMEYMEGGSLTDVVTHCI--LTEGQIGAVCRETLSGLEFLHSKGVLHRDIKSDNILLSMEGDIKLTDFGFCAQINELNLKRTTMVGTPYWMAPEVVSRKE---YGPKVDIWSLGIMIIEMIEGEPPYLNE-TPLRALYLIATNGTPKLKEPENLSSSLKKFLDWCLCVEPEDRASATELLHDEYITEIAEANSSLAPLVKLAR 889          
BLAST of Serine/threonine kinase vs. Ensembl Yeast
Match: KIC1 (Protein kinase of the PAK/Ste20 family, required for cell integrity; physically interacts with Cdc31p (centrin), which is a component of the spindle pole body; part of the RAM network that regulates cellular polarity and morphogenesis [Source:SGD;Acc:S000001144])

HSP 1 Score: 162.54 bits (410), Expect = 2.929e-41
Identity = 114/282 (40.43%), Postives = 163/282 (57.80%), Query Frame = 2
Query:  131 DPSTIFTNLKQIGCGSFGAVYYAQNXXXXXXXXXXXXXVDSKSQKDHWKDIKREICLLKQLNHVNCIS-FKGYYLKGNNPLIVMDYCLG-SVSDIIEVFKKPLQEDEIGCVVVEVLKALNYLHKKNFIHRDIKASNILLTECGLVKLGDFGSSSFVNPAN----TFVGTPFWIAPEVIMAMESGLYDFKVDIWSLGITCIEMAEMEPPHFKTLNPMAAMYHIASNDSPCLLNPSLWSNEFVFLVVAFLKKSPDNRPSAENALQSKFCTIKR--PPFILLKMI 952
            D S++F   + IG G FG VY   N+KT  + AIK + +DS S  D  +D++REI  L  L  ++ I+ + G YLK  +  I+M++C G S+  ++   K  + E  IG ++ E+L AL  +HK N IHRDIKA+N+L+T  G VKL DFG ++ VN  +    T  GTP+W+APEVI  ME   YD KVDIWSLGIT  E+A   PP+   +  + AM  I  +  P L + S +S      +   L + P  R SA++ L+SKF    +  P  IL ++I
Sbjct:   18 DVSSLFKRTEVIGRGKFGVVYKGYNVKTGRVYAIKVLNLDSDS--DEVEDVQREIQFLASLKQISNITRYYGSYLKDTSLWIIMEHCAGGSLRSLLRPGK--IDEKYIGVIMRELLVALKCIHKDNVIHRDIKAANVLITNEGNVKLCDFGVAAQVNQTSLRRQTMAGTPYWMAPEVI--MEGVYYDTKVDIWSLGITTYEIATGNPPYCD-VEALRAMQLIIKSKPPRLEDRS-YSTSLKEFIALCLDEDPKERLSADDLLKSKFIRAHKATPTSILKELI 291          
BLAST of Serine/threonine kinase vs. Ensembl Yeast
Match: SPS1 (Putative protein serine/threonine kinase; localizes to the nucleus and cytoplasm; required for efficient spore packaging, prospore membrane development and closure and localization of enzymes involved in spore wall synthesis; interacts with and required for Ssp1p phosphorylation and turnover; member of the GCKIII subfamily of STE20 kinases; multiply phosphorylated on S/T residues; interacts with 14-3-3 proteins, Bmh1p and Bmh2p; expressed at the end of meiosis [Source:SGD;Acc:S000002931])

HSP 1 Score: 148.288 bits (373), Expect = 2.440e-38
Identity = 104/264 (39.39%), Postives = 152/264 (57.58%), Query Frame = 2
Query:  134 PSTIFTNLKQIGCGSFGAVYYAQNXXXXXXXXXXXXXVDSKSQKDHWKDIKREICLLKQLNHVNCISFKGYYLKGNNPLIVMDYCLG-SVSDIIE-VFKKPLQEDEIGCVVVEVLKALNYLHKKNFIHRDIKASNILLTECGLVKLGDFGSSSFVNPA---NTFVGTPFWIAPEVIMAMESGLYDFKVDIWSLGITCIEMAEMEPPHFKTLNPMAAMYHIASNDSPCLLNPSLWSNEFVFLVVAFLKKSPDNRPSAENALQSKF 910
            PS +++    IG G+FG VY A +  T+EI+AIK   V+ +   +  + + +EI  L +L      ++    L+  +  IVM+YC G S SD+++  +   L E+++  ++ EV   L YLH++  IHRDIKA+NILL E G+VKLGDFG S  +      +TFVGTP+W+APEV+     G Y+ K DIWSLGIT  E+ +  PP  K  +PM  M ++     P L  P  +S+     V   L K+P +RPSA N L  +F
Sbjct:   14 PSKLYSIQSCIGRGNFGDVYKAVDRVTQEIVAIKV--VNLEHSDEDIELLAQEIFFLAELKSPLITNYIATMLEDVSMWIVMEYCGGGSCSDLLKRSYVNGLPEEKVSFIIHEVTLGLKYLHEQRKIHRDIKAANILLNEEGMVKLGDFGVSGHIRSTLKRDTFVGTPYWMAPEVVCCEVDG-YNEKADIWSLGITTYELLKGLPPLSK-YDPMKVMTNLPKRKPPKLQGP--FSDAAKDFVAGCLVKTPADRPSAYNLLSFEF 271          
BLAST of Serine/threonine kinase vs. Ensembl Yeast
Match: CLA4 (Cdc42p-activated signal transducing kinase; member of the PAK (p21-activated kinase) family, along with Ste20p and Skm1p; involved in septin ring assembly, vacuole inheritance, cytokinesis, sterol uptake regulation; phosphorylates Cdc3p and Cdc10p; CLA4 has a paralog, SKM1, that arose from the whole genome duplication [Source:SGD;Acc:S000005242])

HSP 1 Score: 141.739 bits (356), Expect = 6.533e-35
Identity = 100/300 (33.33%), Postives = 151/300 (50.33%), Query Frame = 2
Query:   98 MNEFDQLLCKDDPSTIFTNLKQIGCGSFGAVYYAQNXXXXXXXXXXXXXVDSKSQKDHWKD-----------------IKREICLLKQLNHVNCISFKGYYLKGNNPL-IVMDYCLG-SVSDIIEVF------KKPLQEDEIGCVVVEVLKALNYLHKKNFIHRDIKASNILLTECGLVKLGDFGSSSFVNPAN----TFVGTPFWIAPEVIMAMESGLYDFKVDIWSLGITCIEMAEMEPPHFKTLNPMAAMYHIASNDSPCLLNPSLWSNEFVFLVVAFLKKSPDNRPSAENALQSKF 910
            M++  ++    DPS  F  +++ G G+ G+VY A+         + E+ +++   + H  D                 I  EI ++K   H N ++F   YL+ ++ L +VM++  G S++DIIE          PL E +I  +V E  + L +LH K+ IHRDIK+ N+LL     VK+ DFG  + +        T VGTP+W+APEV+   E   YD K+D+WSLGI  IEM E EPP+    +P+ A+Y IA+N +P L +P   S E    +   L      R S E  L   F
Sbjct:  530 MSKLKKVTVNADPSQCFKVIEKAGQGASGSVYLAERTHIPTESNMIEL-INNDIDEPHVGDKVAIKQMVLSKQPRKELIVNEILVMKDSRHKNIVNFLEAYLRTDDDLWVVMEFMEGGSLTDIIENSPTNDNSHSPLTEPQIAYIVRETCQGLKFLHDKHIIHRDIKSDNVLLDTRARVKITDFGFCARLTDKRSKRATMVGTPYWMAPEVVKQRE---YDEKIDVWSLGIMTIEMLEGEPPYLNE-DPLKALYLIATNGTPKLKHPESLSLEIKRFLSVCLCVDVRYRASTEELLHHGF 824          
BLAST of Serine/threonine kinase vs. Ensembl Yeast
Match: SKM1 (Member of the PAK family of serine/threonine protein kinases; similar to Ste20p; involved in down-regulation of sterol uptake; proposed to be a downstream effector of Cdc42p during polarized growth; SKM1 has a paralog, CLA4, that arose from the whole genome duplication [Source:SGD;Acc:S000005473])

HSP 1 Score: 132.109 bits (331), Expect = 2.863e-32
Identity = 82/231 (35.50%), Postives = 127/231 (54.98%), Query Frame = 2
Query:  281 IKREICLLKQLNHVNCISFKGYYLKGNNPL-IVMDYCLGS-VSDIIEVFKK--------PLQEDEIGCVVVEVLKALNYLHKKNFIHRDIKASNILLTECGLVKLGDFGSSSFVNPAN----TFVGTPFWIAPEVIMAMESGLYDFKVDIWSLGITCIEMAEMEPPHFKTLNPMAAMYHIASNDSPCLLNPSLWSNEFVFLVVAFLKKSPDNRPSAENALQSKFCTIKRPP 931
            I  E+ ++      N ++F   Y+  +  L ++M+Y  G  ++DI++   +        PL E+++  +V E  + L +LH K  IHRDIK+ NILL   GLVK+ DFG    +        T VGTP+W+APE++   + G YD KVD+WSLGI  IEM E EPP+    +P+ A+Y IA+N SP L +P   S +    + A L+ + ++R S    L  +F ++   P
Sbjct:  419 IMNELLVMNDSRQENIVNFLEAYIIDDEELWVIMEYMEGGCLTDILDAVARSNTGEHSSPLNENQMAYIVKETCQGLKFLHNKKIIHRDIKSDNILLNSQGLVKITDFGFCVELTEKRSKRATMVGTPYWMAPEIV--NQKG-YDEKVDVWSLGIMLIEMIEGEPPYLNE-DPLKALYLIANNGSPKLRHPESVSKQTKQFLDACLQVNVESRASVRKLLTFEFLSMACSP 645          
BLAST of Serine/threonine kinase vs. Ensembl Nematostella
Match: EDO44592 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RV75])

HSP 1 Score: 410.609 bits (1054), Expect = 9.381e-129
Identity = 294/888 (33.11%), Postives = 476/888 (53.60%), Query Frame = 2
Query:  104 EFDQLLCKDDPSTIFTNLKQIGCGSFGAVYYAQNXXXXXXXXXXXXXVDSKSQKDHWKDIKREICLLKQLNHVNCISFKGYYLKGNNPLIVMDYCLGSVSDIIEVFKKPLQEDEIGCVVVEVLKALNYLHKKNFIHRDIKASNILLTECGLVKLGDFGSSSFVNPANTFVGTPFWIAPEVIMAMESGLYDFKVDIWSLGITCIEMAEMEPPHFKTLNPMAAMYHIASNDSPCLLNPSLWSNEFVFLVVAFLKKSPDNRPSAENALQSKFCTIKRPPFILLKMIKNARNAVAAREKSDKSDKMKKILLQSKTDNESPPEMGRSPSFIEDEFXXXXXXXXXXXXXXXLDLFENLSSIEIPVNKKNRGDISNSSLKNINPMKIDQKLSHSQSDSVKLLSERNNVIPNSKSSGDISRKAGNENKVSKIIKQLQSIDVKSVENLHIISLKIPLHRSSTSSESYEDKYKNPSDINEVWREQMNGLKRIRNQHKRSIQQLEEKHKNELETTKFSLSRELENVTSTFHKELEKLNKTNSLELDKNNKESRQKELNFVKNLETXXXXXXXXXXXXXXXENK-----------NTGQYEVEINNV---------QKLGDART------RKFKRDAIMNRHRLQLKQLDSTLKQEQSQLEQKNALLLQQHDKLVNLQLGHQESMHILRIDQMQKLQNIEIEAQTQYAQQQESFLKKKQAAEVKNFPKYLKVKEQENQKACRDILNIQKKQFKILKEDEL-RNSRKKHNGESEQQIVDRLKENERQKQVELKAQYDASLEKMKAQELNKLESRHIRETLELENKLQTEKEVLRSFHNSQNEETMKNYNQEHLNLKNQMLNKRNELEVG-IQESNRLFSLKRIEMYSELTTYHAKELRNFD 2683
            E+  L    DP  I+ +L++IG GSFGAVYYA+N++T E++AIK++    K  ++ W+DI +E+  LKQ NH N IS+K  ++K +   +VM+YCLGS SDI+EV KKPLQE EI  +  + L+ L+YLH    IHRD+KA N+LLTE G VKL DFGS++  +PAN+FVGTP+W+APEVI+AM+ G YD KVDIWSLGITCIE+AE +PP F  +N M+A+YHIA ND P L     WS +F+  V   L+K P +RP AE  ++  F + KRPP I+  +I+  + AV A +  +   KMKK+++     + S  E G S +    +F       +    + +  L  ++ S    V+ ++  + S  SL            + S+SD       R    P+S +S   S+ A   +K+ +   +  +I  ++V     I+ ++  HRS                  +   +Q+   KR+R  H+R +QQLE K + E+   +  L +E + +   F KEL+KL   +  E+++  K+ +  E   ++++    + ++K      K+E K           N   Y+   +N          QK+   +       RKF+RD ++ RH L+   +   + + ++Q EQ + +L++ H+    L+  H  ++H LR +Q Q     E   Q +Y +Q E  L+KK  +E+K  PK LK  E   +K  RD + IQ  Q+K L++  L R  R +H       ++ + +E+  +K  +L  QYD S+ +M  ++  +L+   ++E  E   KLQ E+E+L ++ + Q  +    + +E   L++++  +R  LE   +QE+ RL  + R +  + L +   +EL +FD
Sbjct:   13 EYAGLFDDHDPEKIYADLREIGHGSFGAVYYARNVRTNEVVAIKKMSYSGKQSQEKWQDIVKEVKFLKQCNHRNTISYKACHIKEHTAWLVMEYCLGSASDILEVHKKPLQELEIAAICADSLQGLHYLHSHEKIHRDVKAGNVLLTEDGTVKLADFGSAALCSPANSFVGTPYWMAPEVILAMDEGQYDGKVDIWSLGITCIELAERKPPLF-NMNAMSALYHIAQNDPPSLSTDG-WSQDFIKFVQLCLQKHPLDRPDAEQLIKHCFVSQKRPPNIIKDLIRRTKAAVRALDNMNYR-KMKKMIMSEAPGDVSESE-GASDADSLSQFKDDEQQGADSDPHGNKQL--SVKSYTSGVSVESSHNSSTESLPG----------TESESD-------RETATPSSPTS--FSQHA---HKIREEDDRFATIRPQNV-----IARQLQEHRSGA----------------DQMHDQLLVYKRMRQNHQRQLQQLENKLQAEMNDHRRQLDKEYDQMVHQFEKELDKLRTRHKAEVEQKVKQMQSDEKKLLRHIRDQQENEMKVFSSKQKAEYKAAKLQFKRDQANRSLYQGRKDNFSATQSRILQQKVQSHKEYLRLELRKFRRDQLVQRHALEKALIAEEMNKLEAQKEQSHQMLIRHHECTQELEFKHLAALHKLRREQQQHQHQTEWTNQMEYNKQAELELRKKHLSELKQQPKTLKQHEIRIKKQYRDAIRIQTLQYKALQKQILERTPRDQHKD-----MIKQFREDRMRKMADLAVQYDQSIAEMLQRQTLRLDEVQLKEQEEFRQKLQGEQELLSAYQSKQAMQLKAQHEREEKELQDKVSVRRALLEEKMMQETERLREM-REQKQAILQSRQERELEDFD 845          
BLAST of Serine/threonine kinase vs. Ensembl Nematostella
Match: EDO49047 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RHW1])

HSP 1 Score: 192.971 bits (489), Expect = 4.526e-55
Identity = 107/271 (39.48%), Postives = 160/271 (59.04%), Query Frame = 2
Query:  119 LCKDDPSTIFTNLKQIGCGSFGAVYYAQNXXXXXXXXXXXXXVDSKSQKDHWKDIKREICLLKQLNHVNCISFKGYYLKGNNPLIVMDYCLGSVSDIIEVFKKPLQEDEIGCVVVEVLKALNYLHKKNFIHRDIKASNILLTECGLVKLGDFGSSSFVNPA----NTFVGTPFWIAPEVIMAMESGLYDFKVDIWSLGITCIEMAEMEPPHFKTLNPMAAMYHIASND--SPCLLNPSLWSNEFVFLVVAFLKKSPDNRPSAENALQSKFC 913
            + + +P  +F  ++++G G++G V+ A+ I T ++ A+K +KV+     D ++ I++EI +++Q  H N I++ G Y++ +   I M+YC G     +     P  E +I  V VE LK L YLH+K+ +HRDIK +NILLT  G VKL DFG S+ +        +F+GTP+W+APE+     +G YD K DIW++GIT IEMAE++PP F  L+PM A+Y I       P L     WSNE    +   L K+P  RPSA+  L   FC
Sbjct:    9 ISRGNPDKVFDLIEKVGGGTYGDVFKARVIATGDLAAVKVVKVEPG---DDFELIQQEIAMMQQCRHNNIINYIGAYMRRDKLWIGMEYCGGGSIQDVYCVTGPCSETQISFVTVETLKGLAYLHEKSLMHRDIKGANILLTTNGEVKLADFGISARITETMKKRKSFIGTPYWMAPEMAAVERTGGYDLKCDIWAVGITAIEMAELQPPMFD-LHPMRALYIIGKKSFIPPTLKEKDKWSNEMHHFIKVALIKNPKKRPSADKMLTHPFC 275          
BLAST of Serine/threonine kinase vs. Ensembl Nematostella
Match: EDO42845 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S0A9])

HSP 1 Score: 192.971 bits (489), Expect = 7.838e-55
Identity = 115/281 (40.93%), Postives = 167/281 (59.43%), Query Frame = 2
Query:  134 PSTIFTNLKQIGCGSFGAVYYAQNXXXXXXXXXXXXXVDSKSQKDHWKDIKREICLLKQLNHVNCISFKGYYLKGNNPLIVMDYC-LGSVSDIIEVFKKPLQEDEIGCVVVEVLKALNYLHKKNFIHRDIKASNILLTECGLVKLGDFGSSSFVNPA----NTFVGTPFWIAPEVIMAMESGLYDFKVDIWSLGITCIEMAEMEPPHFKTLNPMAAMYHIASNDSPCLLNPSLWSNEFVFLVVAFLKKSPDNRPSAENALQSKFCTIKRPPFILLKMIKNA 961
            P  +F  L+++G GS+G+V+ A + ++ +++AIK++ VD+  Q     +I +EI +++Q +    + + G Y K  +  IVM+YC  GSVSD++++  K L E+EI CV+   LK L YLH +  IHRDIKA NILL   G  KL DFG +  +       NT +GTPFW+APEVI   E G YD   DIWSLGIT +EMAE +PP +  ++PM A++ I +   P   +P  WS +F   V   L K+P+ R +A   LQ  F    +   IL  MI+ A
Sbjct:   20 PEEVFDVLEKLGEGSYGSVFKAMHKESGQVVAIKQVPVDTDLQ-----EIIKEISMMQQCDSPYVVKYYGSYFKNTDLWIVMEYCGAGSVSDLMKIRNKTLTEEEIKCVLKYTLKGLEYLHLRRKIHRDIKAGNILLNSEGHAKLADFGVAGQLTDTMAKRNTVIGTPFWMAPEVI--QEVG-YDCLADIWSLGITAMEMAEGKPP-YADIHPMRAIFMIPTKPPPTFRDPGQWSEDFKDFVSKCLVKNPEERATATELLQHSFIQGAKQISILSSMIQEA 291          
BLAST of Serine/threonine kinase vs. Ensembl Nematostella
Match: EDO31934 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SWI4])

HSP 1 Score: 176.022 bits (445), Expect = 3.478e-48
Identity = 113/285 (39.65%), Postives = 169/285 (59.30%), Query Frame = 2
Query:  125 KDDPSTIFTNLKQIGCGSFGAVYYAQNXXXXXXXXXXXXXVDSKSQKDHWKDIKREICLLKQLNHVNCISFKGYYLKGNNPLIVMDYCLGSVSDIIEVFKKPLQEDEIGCVVVEVLKALNYLHKKNFIHRDIKASNILLTECGLVKLGDFGSSS----FVNPANTFVGTPFWIAPEVIMAMESGLYDFKVDIWSLGITCIEMAEMEPPHFKTLNPMAAMYHIASNDSPCLL-NPSLWSNEFVFLVVAFLKKSPDNRPSAENALQSKFCTIKRPPFILLKMIKNAR 964
            K DP  +F+ L++IG GSFG V+  + I  +    +    +D +  +D  +DI++EI +L Q + +    + G YLKG    I+M+Y LG  S +  +    ++E  I  ++ EVLK L+YLH +  +HRDIKA+N+L++E G VKL DFG +      +N  NTFVGTPFW+APEVI   +   YD K DIWSLGIT IE+A+ EPP+   L+PM  ++ I  N+ P L  N S    EFV L    L K P++RP+A+  L+ +F    +    L+++I+  +
Sbjct:    4 KADPEKLFSKLERIGKGSFGEVF--KGIDNRTNEVVAIKIIDLEEAEDEIEDIQQEITVLSQCDSLYVTKYHGSYLKGTKLWIIMEY-LGGGSALDLMKAGNIEEFYIATILREVLKGLDYLHTEKKLHRDIKAANVLMSETGDVKLADFGVAGQLTDTLNKRNTFVGTPFWMAPEVI---KQSAYDSKADIWSLGITAIELAKGEPPN-SDLHPMRVLFLIPKNNPPELTGNFSKAFKEFVSLC---LNKDPNDRPTAKELLKHRFIKTAKKNAYLVELIERHK 278          
BLAST of Serine/threonine kinase vs. Ensembl Nematostella
Match: EDO48741 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RIM4])

HSP 1 Score: 182.956 bits (463), Expect = 1.761e-47
Identity = 95/285 (33.33%), Postives = 160/285 (56.14%), Query Frame = 2
Query:   83 LEVNNMNEFDQLLCKDDPSTIFTNLKQIGCGSFGAVYYAQNXXXXXXXXXXXXXVDSKSQKDHWKDIKREICLLKQLNHVNCISFKGYYLKGNNPLIVMDYCLG-SVSDIIEVFKKPLQEDEIGCVVVEVLKALNYLHKKNFIHRDIKASNILLTECGLVKLGDFGSSS----FVNPANTFVGTPFWIAPEVIM--AMESGLYDFKVDIWSLGITCIEMAEMEPPHFKTLNPMAAMYHIASNDSPCLLNPSLWSNEFVFLVVAFLKKSPDNRPSAENALQSKFCT 916
            ++V    EF  ++   DP++ +  + ++G GSFG VY AQ+     + A K I V+ +++    +D   EI +L +  H N +     +L      +++++C G ++ D++   ++ L E EI  V  ++ + L +LH    IHRD+KA N+LL   G VK+ DFG S+     +   +TF+GTP+W+APEV++    +   YD+K DIWS GIT IE+A+M PP+   ++PM  ++ I  +D P   NP+ WSN+    + + + K+PD R SA   ++  F  
Sbjct:    1 MKVKKKKEFSYIIKDVDPNSNWELVGELGDGSFGKVYKAQHKTESSLSAAKIIIVNDENE---LEDFMVEIDILSECKHKNLVGLFETFLHDGKLWMMLEFCSGGALDDLMLELERGLNEPEIRAVTRQLFEGLQFLHNHKVIHRDLKAGNLLLASDGNVKMADFGVSAKNKKTLQKRSTFIGTPYWMAPEVVVTETYKDDPYDYKADIWSAGITLIELAQMVPPNH-NMHPMRVLFKIPKSDPPTFDNPNKWSNDLNDFLASCVVKNPDMRASATEMIKHPFIA 281          
BLAST of Serine/threonine kinase vs. Ensembl Medaka
Match: taok3a (TAO kinase 3 [Source:NCBI gene;Acc:101156330])

HSP 1 Score: 329.717 bits (844), Expect = 3.918e-98
Identity = 165/311 (53.05%), Postives = 211/311 (67.85%), Query Frame = 2
Query:  104 EFDQLLCKDDPSTIFTNLKQIGCGSFGAVYYAQNXXXXXXXXXXXXXVDSKSQKDHWKDIKREICLLKQLNHVNCISFKGYYLKGNNPLIVMDYCLGSVSDIIEVFKKPLQEDEIGCVVVEVLKALNYLHKKNFIHRDIKASNILLTECGLVKLGDFGSSSFVNPANTFVGTPFWIAPEVIMAMESGLYDFKVDIWSLGITCIEMAEMEPPHFKTLNPMAAMYHIASNDSPCLLNPSLWSNEFVFLVVAFLKKSPDNRPSAENALQSKFCTIKRPPFILLKMIKNARNAVAAREKSD-KSDKMKKILLQSK 1033
            E   L  KDDP  +F +L +IG GSFGAVY+A+N  + E++AIK++  + K   + W+DI +E+  L QL H N I +KG YLK N   +VM+YCLGS SD++EV KKPLQE EI  +    L  L YLH  N IHRD+KA NILLTE GLVKL DFGS+S  +PAN+FVGTP+W+APEVI+AM+ G Y+ KVDIWSLGITCIE+AE +PP F  +N M+A+YHIA NDSP  L  + WS+ F   V   L K P +RPS+   L+  F    R P ILL +I+  ++AV  RE  + +  KMKKIL Q K
Sbjct:   14 ELGDLFFKDDPEDVFCDLHEIGHGSFGAVYFARNSYSNEVVAIKKMSYNGKQTTEKWQDIIKEVKFLGQLRHPNTIEYKGCYLKDNTAWLVMEYCLGSASDLLEVHKKPLQEMEIAAITHGALLGLAYLHSHNMIHRDVKAGNILLTELGLVKLADFGSASIASPANSFVGTPYWMAPEVILAMDEGQYEGKVDIWSLGITCIELAERKPPLF-NMNAMSALYHIAQNDSPT-LQSNEWSDIFRSFVDYCLLKIPQDRPSSGELLRHDFVRRDRSPRILLDLIQRTKDAV--RELDNLQYRKMKKILYQEK 320          
BLAST of Serine/threonine kinase vs. Ensembl Medaka
Match: taok2a (serine/threonine-protein kinase TAO2 [Source:NCBI gene;Acc:101169206])

HSP 1 Score: 328.561 bits (841), Expect = 4.528e-96
Identity = 157/311 (50.48%), Postives = 219/311 (70.42%), Query Frame = 2
Query:  113 QLLCKDDPSTIFTNLKQIGCGSFGAVYYAQNXXXXXXXXXXXXXVDSKSQKDHWKDIKREICLLKQLNHVNCISFKGYYLKGNNPLIVMDYCLGSVSDIIEVFKKPLQEDEIGCVVVEVLKALNYLHKKNFIHRDIKASNILLTECGLVKLGDFGSSSFVNPANTFVGTPFWIAPEVIMAMESGLYDFKVDIWSLGITCIEMAEMEPPHFKTLNPMAAMYHIASNDSPCLLNPSLWSNEFVFLVVAFLKKSPDNRPSAENALQSKFCTIKRPPFILLKMIKNARNAVAAREKSD-KSDKMKKILLQSKTDN 1042
            +L CKDDP  +F +L++IG GSFGAVY+A++++  E++AIK++    K   + W+DI +E+  L++L H N I ++G YLK +   +VM+YCLGS SD++EV KKPLQE EI  +    L+ L YLH  N IHRD+KA NILLTE G VKLGDFGS+S V PAN+FVGTP+W+APEVI+AM+ G YD KVD+WSLGITCIE+AE +PP F  +N M+A+YHIA N+SP +L  + WS+ F   V + L+K P +RP+++  L  +F   +RP  +++ +I   ++AV  RE  + +  KMKKIL Q    N
Sbjct:   17 ELFCKDDPEKLFADLREIGHGSFGAVYFARDVRNNEVVAIKKMSYSGKQTNEKWQDIIKEVKFLQKLRHPNTIEYRGCYLKEHTAWLVMEYCLGSASDLLEVHKKPLQEVEIAAITHGALQGLAYLHSHNMIHRDVKAGNILLTEPGQVKLGDFGSASIVAPANSFVGTPYWMAPEVILAMDEGQYDGKVDVWSLGITCIELAERKPPLF-NMNAMSALYHIAQNESP-ILQSNHWSDSFRNFVDSCLQKIPQDRPTSDVLLNHRFLCRERPLTVVMDLIARTKDAV--RELDNLQYRKMKKILFQETQQN 323          
BLAST of Serine/threonine kinase vs. Ensembl Medaka
Match: taok1b (serine/threonine-protein kinase TAO1 [Source:NCBI gene;Acc:101163990])

HSP 1 Score: 320.472 bits (820), Expect = 6.888e-94
Identity = 155/308 (50.32%), Postives = 217/308 (70.45%), Query Frame = 2
Query:  104 EFDQLLCKDDPSTIFTNLKQIGCGSFGAVYYAQNXXXXXXXXXXXXXVDSKSQKDHWKDIKREICLLKQLNHVNCISFKGYYLKGNNPLIVMDYCLGSVSDIIEVFKKPLQEDEIGCVVVEVLKALNYLHKKNFIHRDIKASNILLTECGLVKLGDFGSSSFVNPANTFVGTPFWIAPEVIMAMESGLYDFKVDIWSLGITCIEMAEMEPPHFKTLNPMAAMYHIASNDSPCLLNPSLWSNEFVFLVVAFLKKSPDNRPSAENALQSKFCTIKRPPFILLKMIKNARNAVAAREKSD-KSDKMKKILL 1024
            E  +L  K+DP  +F++L++IG GSFGAVY+A +++T E++AIK++    K   + W+DI +E+  L+++ H N I +KG YL+ +   +VM+YCLGS SD++EV KKPLQE EI  +    L+ L YLH  N IHRD+KA NILLTE G VKL DFGS+S  +PAN+FVGTP+W+APEVI+AM+ G YD KVD+WSLGITCIE+AE +PP F  +N M+A+YHIA N+SP  L  S WS+ F   V + L+K P +RP +++ L   F   +RP  +L+ +I+  ++AV  RE  + +  KMKKILL
Sbjct:   14 EVAELFFKEDPEKLFSDLREIGHGSFGAVYFAWDVRTNEVVAIKKMSYSGKQSNEKWQDIIKEVKFLQRIRHPNSIEYKGCYLREHTAWLVMEYCLGSASDLLEVHKKPLQEVEIAAITHGALQGLAYLHSHNMIHRDVKAGNILLTEPGQVKLADFGSASIASPANSFVGTPYWMAPEVILAMDEGQYDGKVDVWSLGITCIELAERKPPLF-NMNAMSALYHIAQNESPT-LQSSDWSDYFRNFVDSCLQKIPQDRPHSDDMLGHAFLQRERPESVLMDLIQRTKDAV--RELDNLQYRKMKKILL 317          
BLAST of Serine/threonine kinase vs. Ensembl Medaka
Match: ENSORLT00000006223.2 (serine/threonine-protein kinase TAO1 [Source:NCBI gene;Acc:101166893])

HSP 1 Score: 314.694 bits (805), Expect = 2.806e-92
Identity = 154/306 (50.33%), Postives = 213/306 (69.61%), Query Frame = 2
Query:  113 QLLCKDDPSTIFTNLKQIGCGSFGAVYYAQNXXXXXXXXXXXXXVDSKSQKDHWKDIKREICLLKQLNHVNCISFKGYYLKGNNPLIVMDYCLGSVSDIIEVFKKPLQEDEIGCVVVEVLKALNYLHKKNFIHRDIKASNILLTECGLVKLGDFGSSSFVNPANTFVGTPFWIAPEVIMAMESGLYDFKVDIWSLGITCIEMAEMEPPHFKTLNPMAAMYHIASNDSPCLLNPSLWSNEFVFLVVAFLKKSPDNRPSAENALQSKFCTIKRPPFILLKMIKNARNAVAAREKSD-KSDKMKKILLQ 1027
            +L  K+DP  +FT+L++IG GSFGAVY+A++++T +++AIK++    K   + W+DI +E+  L+++ H N I +KG +L+     +VM+YCLGS SD++EV KKPLQE EI  +    L+ L YLH  N IHRDIKA NILLTE G VKL DFGS+S   PAN+FVGTP+W+APEVI+AM+ G YD KVDIWSLGITCIE+AE +PP F  +N M+A+YHIA N+SP  L  + W+++F   V + L+K P  RP++E  L+  F   KRP  +L  +I   ++AV  RE  + +  K KKIL Q
Sbjct:   17 ELFFKEDPEKLFTDLQEIGHGSFGAVYFARDVRTNDVVAIKKMSYLGKQSTEKWQDIIKEVKFLRRIKHPNSIEYKGCFLRETTAWLVMEYCLGSASDLLEVHKKPLQEVEIAAITDGALQGLAYLHSHNMIHRDIKAGNILLTEPGQVKLADFGSASIACPANSFVGTPYWMAPEVILAMDEGQYDGKVDIWSLGITCIELAERKPPLF-NMNAMSALYHIAQNESPT-LQSTEWTDDFGNFVESCLQKIPQERPNSEELLKHSFVQRKRPESVLTDLINRTKDAV--RELDNLQYRKRKKILFQ 318          

HSP 2 Score: 121.324 bits (303), Expect = 1.282e-27
Identity = 117/446 (26.23%), Postives = 220/446 (49.33%), Query Frame = 2
Query: 1520 REQMNGLKRIRNQHKRSIQQLEEKHKNELETTKFSLSRELENVTSTFHKELEKLNKTNSLELDKNNK-------------ESRQK-ELNFVKNLETXXXXXXXXXXXXXXXENKNT--------------------GQYEVEINNVQK-LGDARTRKFKRDAIMNRHRLQLKQLDSTLKQEQSQLEQKNALLLQQHDKLVNLQLGHQESMHILRIDQMQKLQNIEIEAQTQYAQQQESFLKKKQAAEVKNFPKYLKVKEQENQKACRDILNIQKKQFKILKEDELRNSRK-KHNGESEQQIVDRLKENERQKQVELKAQYDASLEKMKAQELNKLESRHIRETLELENKLQTEKEVLRSFHNSQNEETMKNYNQEHLNLKNQMLNKRNELEVGIQESNRLFSLKRIEMYSELTTYHAKELRNFDLETVQLGIDQILINSISSDYVS 2749
            R+QM G KR+R QH++ +  LE K K E++  +  L +ELEN  + F +E++KL K +   +DK  K             +S+QK ELN     +    K  K   K   +E+++T                       E E+   Q+   +   R+F +  ++ RH ++   L   L + Q+Q + ++A+LL+ H+ +  L+  H  ++   R +  +     E+  Q +Y ++ E  L++K A EV+  PK LK KEQ+ +K  +D   IQ +Q+K L+   L  + K +H       +++RL   +++K   L  QYD ++ +M + +  +L+     +   L  +LQ E+E+L ++ +    +   ++ +E  +L++++  +R  LE  I+E    F  +  E    L    A+++  FD E+++LG   +L+++I  D +S
Sbjct:  455 RQQMLGYKRMRRQHQKQLMALENKLKAEIDEHRLRLDKELENQRNNFAQEMDKLVKKHQASMDKETKTFCNDEKKFQQNIQSQQKKELNIFIETQKREYKLRKEQLKEELNEHQSTPKKKKQEWLSKQKENLQVYQAAKEAELQRRQRDFLEQECRRFNKKKLIERHNIEKDLLQEELNKRQTQKDLEHAMLLRHHESMQELEFRHLNTIQKTRSELTRLQHQTELLNQLEYNKKMERELRRKHAMEVRQQPKCLKSKEQQIKKQFQDTCKIQTRQYKALRNHLLETTPKCEHKA-----VLERLMVEQQRKLAILAEQYDQTISEMFSTQTLRLDETQEAQRQTLIMQLQKEQELLNAYQSKIKMQIEAHHEREKRHLEDRVALRRGLLEQKIKEEMHAFQKEHQERTRRLLERQARQVEAFDSESMRLGFSGMLLSNIQPDALS 895          
BLAST of Serine/threonine kinase vs. Ensembl Medaka
Match: ENSORLT00000007838.2 (serine/threonine-protein kinase TAO2 [Source:NCBI gene;Acc:101155230])

HSP 1 Score: 316.235 bits (809), Expect = 1.540e-91
Identity = 153/317 (48.26%), Postives = 219/317 (69.09%), Query Frame = 2
Query:  104 EFDQLLCKDDPSTIFTNLKQIGCGSFGAVYYAQNXXXXXXXXXXXXXVDSKSQKDHWKDIKREICLLKQLNHVNCISFKGYYLKGNNPLIVMDYCLGSVSDIIEVFKKPLQEDEIGCVVVEVLKALNYLHKKNFIHRDIKASNILLTECGLVKLGDFGSSSFVNPANTFVGTPFWIAPEVIMAMESGLYDFKVDIWSLGITCIEMAEMEPPHFKTLNPMAAMYHIASNDSPCLLNPSLWSNEFVFLVVAFLKKSPDNRPSAENALQSKFCTIKRPPFILLKMIKNARNAVAAREKSD-KSDKMKKILLQSKTDNESP 1051
            E  +L  ++DP  +FT+L++IG GSFGAVY+A +I+T E++AIK++    K   + W+DI +E+  L++L H N + + G YL+ +   +VM+YCLGS SD++EV KKPLQE EI  +    L+ L YLH  N IHRD+KA NILLTE G VKLGDFGS+S + PAN+FVGTP+W+APEVI+AM+ G YD KVD+WSLGITCIE+AE +PP F  +N M+A+YHIA N+SP +L  + WS+ F   V + L+K   +RP+++  L+  F   +RP  +++ +I   ++AV  RE  + +  KMKKIL     +  +P
Sbjct:   14 EVAELFSREDPEKLFTDLREIGHGSFGAVYFAHDIRTNEVVAIKKMSYSGKQSNEKWQDIIKEVKFLQKLRHPNTVEYHGCYLREHTAWLVMEYCLGSASDLLEVHKKPLQEVEIAAITHGALQGLVYLHSHNMIHRDVKAGNILLTEPGQVKLGDFGSASIIAPANSFVGTPYWMAPEVILAMDEGQYDGKVDVWSLGITCIELAERKPPLF-NMNAMSALYHIAQNESP-VLQSNHWSDYFRNFVDSCLQKLAQDRPTSDVLLKHHFLCRERPMTVVMDLIARTKDAV--RELDNLQYRKMKKILFHEALNGPAP 326          

HSP 2 Score: 113.235 bits (282), Expect = 4.844e-25
Identity = 119/457 (26.04%), Postives = 215/457 (47.05%), Query Frame = 2
Query: 1520 REQMNGLKRIRNQHKRSIQQLEEKHKNELETTKFSLSRELENVTSTFHKELEKLNKTNSL----ELDKNNKESRQ----------KELNFVKNLETXXXXXXXXXXXXXXXENKNTGQYEVE---------------------INNVQKLGDARTRKFKRDAIMNRHRLQLKQLDSTLKQEQSQLEQKNALLLQQHDKLVNLQLGHQESMHILRIDQMQKLQNIEIEAQTQYAQQQESFLKKKQAAEVKNFPKYLKVKEQENQKACRDILNIQKKQFKILKEDELRNSRKKHNGESEQQIVDRLKENERQKQVELKAQYDASLEKMKAQELNKLESRHIRETLELENKLQTEKEVLRSFHNSQNEETMKNYNQEHLNLKNQMLNKRNELEVGIQESNRLFSLKRIEMYSELTTYHAKELRNFDLETVQLGIDQILINSISSDYVSVK*MLNYSYYFP 2785
            REQM+G KR+R QH++ +  LE K K E++  +  L +ELEN  + F  E EKL+K +      EL     E ++          KEL  + + +    +  K   K   +EN++T + E +                     +   ++  + + R++KR  +++RH L+   L   L ++Q+  + + A+LL+ H+    L+      +   R D ++     E+  Q +Y +++E  L++K A EV+  PK LK KE + ++  +D   IQ +Q+K L+   L N+ K       + ++ RLK+ + +K   L  QYD S+  M + +  +L+     E   L  +LQ E E+L ++ +     T   + +E  +L+ ++  +R  LE  I+E       +R E    L    A E+  FD E+++LG   + ++ I  +  S +    YS   P
Sbjct:  468 REQMSGYKRMRRQHQKQLMGLENKLKAEMDEHQLRLDKELENQRNNFSMEAEKLSKKHQAIQEKELKATQTEEKKFQQHILGQQKKELTTLIDSQKRQYRQRKEQLKEELNENQSTPKREKQEWLVHQKECLQQLQAEEEAGLLRRQRQYYELQCRQYKRKMLLSRHNLEQDLLREDLNKKQTLKDLECAMLLRHHESTQELEFRQLSVVQRTRADLIRTQHQTELTNQMEYNKRREQELRQKHAMEVRQQPKSLKSKELQIKRQFQDTCKIQTRQYKALRNHLLENTPKS----DHKAVLKRLKDEQTRKLAILAEQYDHSINDMLSTQALRLDETQEAEYKVLRMQLQQELELLNAYQSKIKIHTDTQHEREVKDLEQRVSIRRALLEQRIEEEMLALQNERSERIRTLLERQASEIEAFDSESLRLGFSNMALSGIPGEAYSKQ---GYSNAVP 917          
BLAST of Serine/threonine kinase vs. Planmine SMEST
Match: SMESG000046962.1 (SMESG000046962.1)

HSP 1 Score: 1074.69 bits (2778), Expect = 0.000e+0
Identity = 562/565 (99.47%), Postives = 564/565 (99.82%), Query Frame = 2
Query:   71 MTKVLEVNNMNEFDQLLCKDDPSTIFTNLKQIGCGSFGAVYYAQNXXXXXXXXXXXXXVDSKSQKDHWKDIKREICLLKQLNHVNCISFKGYYLKGNNPLIVMDYCLGSVSDIIEVFKKPLQEDEIGCVVVEVLKALNYLHKKNFIHRDIKASNILLTECGLVKLGDFGSSSFVNPANTFVGTPFWIAPEVIMAMESGLYDFKVDIWSLGITCIEMAEMEPPHFKTLNPMAAMYHIASNDSPCLLNPSLWSNEFVFLVVAFLKKSPDNRPSAENALQSKFCTIKRPPFILLKMIKNARNAVAAREKSDKSDKMKKILLQSKTDNESPPEMGRSPSFIEDEFXXXXXXXXXXXXXXXLDLFENLSSIEIPVNKKNRGDISNSSLKNINPMKIDQKLSHSQSDSVKLLSERNNVIPNSKSSGDISRKAGNENKVSKIIKQLQSIDVKSVENLHIISLKIPLHRSSTSSESYEDKYKNPSDINEVWREQMNGLKRIRNQHKRSIQQLEEKHKNELETTKFSLSRELENVTSTFHKELEKLNKTNSLELDKNNKESRQKELNFVKNLET 1765
            MTKVLE+NNMNEFDQLLCKDDPSTIFTNLKQIGCGSFGAVYYAQNIKTKEIIAIKEIKVDSKSQKDHWKDIKREICLLKQLNHVNCISFKGYYLKGNNPLIVMDYCLGSVSDIIEVFKKPLQEDEIGCVVVEVLKALNYLHKKNFIHRDIKASNILLTECGLVKLGDFGSSSFVNPANTFVGTPFWIAPEVIMAMESGLYDFKVDIWSLGITCIEMAEMEPPHFKTLNPMAAMYHIASNDSPCLLNPSLWSNEFVFLVVAFLKKSPDNRPSAENALQSKFCTIKRPPFILLKMIKNARNAVAAREKSDKSDKMKKILLQSKTDNESPPEMGRSPSFIEDEFISKHSSKSSDTSNISLDLFENLSSIEIPVNKKNRGDISNSSLKNINPMKIDQKLSHSQSDSVKLLSERNNVIPNSKSSGDISRKAGNENKVSKIIKQLQSIDVKSVENLHIISLKIPLHRSSTSSESYEDKYKNPSDINEVWREQMNGLKRIRNQHKRSIQQLEEKHKNELETTKF LSRELENVT+TFHKELEKLNKTNSLELDKNNKESRQKELNFVKNLET
Sbjct:    1 MTKVLEINNMNEFDQLLCKDDPSTIFTNLKQIGCGSFGAVYYAQNIKTKEIIAIKEIKVDSKSQKDHWKDIKREICLLKQLNHVNCISFKGYYLKGNNPLIVMDYCLGSVSDIIEVFKKPLQEDEIGCVVVEVLKALNYLHKKNFIHRDIKASNILLTECGLVKLGDFGSSSFVNPANTFVGTPFWIAPEVIMAMESGLYDFKVDIWSLGITCIEMAEMEPPHFKTLNPMAAMYHIASNDSPCLLNPSLWSNEFVFLVVAFLKKSPDNRPSAENALQSKFCTIKRPPFILLKMIKNARNAVAAREKSDKSDKMKKILLQSKTDNESPPEMGRSPSFIEDEFISKHSSKSSDTSNISLDLFENLSSIEIPVNKKNRGDISNSSLKNINPMKIDQKLSHSQSDSVKLLSERNNVIPNSKSSGDISRKAGNENKVSKIIKQLQSIDVKSVENLHIISLKIPLHRSSTSSESYEDKYKNPSDINEVWREQMNGLKRIRNQHKRSIQQLEEKHKNELETTKFLLSRELENVTTTFHKELEKLNKTNSLELDKNNKESRQKELNFVKNLET 565          

HSP 2 Score: 65.855 bits (159), Expect = 9.733e-11
Identity = 32/32 (100.00%), Postives = 32/32 (100.00%), Query Frame = 3
Query: 1806 NQKIKIPVNMRLKLITFRNSVMLEPENLKEMR 1901
            NQKIKIPVNMRLKLITFRNSVMLEPENLKEMR
Sbjct:  579 NQKIKIPVNMRLKLITFRNSVMLEPENLKEMR 610          
BLAST of Serine/threonine kinase vs. Planmine SMEST
Match: SMESG000046962.1 (SMESG000046962.1)

HSP 1 Score: 1057.74 bits (2734), Expect = 0.000e+0
Identity = 554/556 (99.64%), Postives = 555/556 (99.82%), Query Frame = 2
Query:   98 MNEFDQLLCKDDPSTIFTNLKQIGCGSFGAVYYAQNXXXXXXXXXXXXXVDSKSQKDHWKDIKREICLLKQLNHVNCISFKGYYLKGNNPLIVMDYCLGSVSDIIEVFKKPLQEDEIGCVVVEVLKALNYLHKKNFIHRDIKASNILLTECGLVKLGDFGSSSFVNPANTFVGTPFWIAPEVIMAMESGLYDFKVDIWSLGITCIEMAEMEPPHFKTLNPMAAMYHIASNDSPCLLNPSLWSNEFVFLVVAFLKKSPDNRPSAENALQSKFCTIKRPPFILLKMIKNARNAVAAREKSDKSDKMKKILLQSKTDNESPPEMGRSPSFIEDEFXXXXXXXXXXXXXXXLDLFENLSSIEIPVNKKNRGDISNSSLKNINPMKIDQKLSHSQSDSVKLLSERNNVIPNSKSSGDISRKAGNENKVSKIIKQLQSIDVKSVENLHIISLKIPLHRSSTSSESYEDKYKNPSDINEVWREQMNGLKRIRNQHKRSIQQLEEKHKNELETTKFSLSRELENVTSTFHKELEKLNKTNSLELDKNNKESRQKELNFVKNLET 1765
            MNEFDQLLCKDDPSTIFTNLKQIGCGSFGAVYYAQNIKTKEIIAIKEIKVDSKSQKDHWKDIKREICLLKQLNHVNCISFKGYYLKGNNPLIVMDYCLGSVSDIIEVFKKPLQEDEIGCVVVEVLKALNYLHKKNFIHRDIKASNILLTECGLVKLGDFGSSSFVNPANTFVGTPFWIAPEVIMAMESGLYDFKVDIWSLGITCIEMAEMEPPHFKTLNPMAAMYHIASNDSPCLLNPSLWSNEFVFLVVAFLKKSPDNRPSAENALQSKFCTIKRPPFILLKMIKNARNAVAAREKSDKSDKMKKILLQSKTDNESPPEMGRSPSFIEDEFISKHSSKSSDTSNISLDLFENLSSIEIPVNKKNRGDISNSSLKNINPMKIDQKLSHSQSDSVKLLSERNNVIPNSKSSGDISRKAGNENKVSKIIKQLQSIDVKSVENLHIISLKIPLHRSSTSSESYEDKYKNPSDINEVWREQMNGLKRIRNQHKRSIQQLEEKHKNELETTKF LSRELENVT+TFHKELEKLNKTNSLELDKNNKESRQKELNFVKNLET
Sbjct:    1 MNEFDQLLCKDDPSTIFTNLKQIGCGSFGAVYYAQNIKTKEIIAIKEIKVDSKSQKDHWKDIKREICLLKQLNHVNCISFKGYYLKGNNPLIVMDYCLGSVSDIIEVFKKPLQEDEIGCVVVEVLKALNYLHKKNFIHRDIKASNILLTECGLVKLGDFGSSSFVNPANTFVGTPFWIAPEVIMAMESGLYDFKVDIWSLGITCIEMAEMEPPHFKTLNPMAAMYHIASNDSPCLLNPSLWSNEFVFLVVAFLKKSPDNRPSAENALQSKFCTIKRPPFILLKMIKNARNAVAAREKSDKSDKMKKILLQSKTDNESPPEMGRSPSFIEDEFISKHSSKSSDTSNISLDLFENLSSIEIPVNKKNRGDISNSSLKNINPMKIDQKLSHSQSDSVKLLSERNNVIPNSKSSGDISRKAGNENKVSKIIKQLQSIDVKSVENLHIISLKIPLHRSSTSSESYEDKYKNPSDINEVWREQMNGLKRIRNQHKRSIQQLEEKHKNELETTKFLLSRELENVTTTFHKELEKLNKTNSLELDKNNKESRQKELNFVKNLET 556          

HSP 2 Score: 65.855 bits (159), Expect = 9.702e-11
Identity = 32/32 (100.00%), Postives = 32/32 (100.00%), Query Frame = 3
Query: 1806 NQKIKIPVNMRLKLITFRNSVMLEPENLKEMR 1901
            NQKIKIPVNMRLKLITFRNSVMLEPENLKEMR
Sbjct:  570 NQKIKIPVNMRLKLITFRNSVMLEPENLKEMR 601          
BLAST of Serine/threonine kinase vs. Planmine SMEST
Match: SMESG000046951.1 (SMESG000046951.1)

HSP 1 Score: 467.618 bits (1202), Expect = 2.150e-159
Identity = 237/238 (99.58%), Postives = 237/238 (99.58%), Query Frame = 2
Query: 2042 MHILRIDQMQKLQNIEIEAQTQYAQQQESFLKKKQAAEVKNFPKYLKVKEQENQKACRDILNIQKKQFKILKEDELRNSRKKHNGESEQQIVDRLKENERQKQVELKAQYDASLEKMKAQELNKLESRHIRETLELENKLQTEKEVLRSFHNSQNEETMKNYNQEHLNLKNQMLNKRNELEVGIQESNRLFSLKRIEMYSELTTYHAKELRNFDLETVQLGIDQILINSISSDYVSVK 2755
            MHILRIDQMQKLQNIEIEAQTQYAQQQESFLKKKQAAEVKNFPKYLKVKEQENQKACRDILNIQKKQFKILKEDELRNSRKKHNGESEQQIVDRLKENERQKQVELKAQYDASLEKMKAQELNKLESRHIRETLELENKLQTEKEVLRSFHNSQNEETMKNYNQEHLNLKNQMLNKRNELEVGIQESNRLFSLKRIEMYSELTTYHAKELRNFDLETVQLGIDQ LINSISSDYVSVK
Sbjct:    1 MHILRIDQMQKLQNIEIEAQTQYAQQQESFLKKKQAAEVKNFPKYLKVKEQENQKACRDILNIQKKQFKILKEDELRNSRKKHNGESEQQIVDRLKENERQKQVELKAQYDASLEKMKAQELNKLESRHIRETLELENKLQTEKEVLRSFHNSQNEETMKNYNQEHLNLKNQMLNKRNELEVGIQESNRLFSLKRIEMYSELTTYHAKELRNFDLETVQLGIDQNLINSISSDYVSVK 238          
BLAST of Serine/threonine kinase vs. Planmine SMEST
Match: SMESG000046951.1 (SMESG000046951.1)

HSP 1 Score: 450.284 bits (1157), Expect = 1.078e-152
Identity = 229/230 (99.57%), Postives = 229/230 (99.57%), Query Frame = 2
Query: 2066 MQKLQNIEIEAQTQYAQQQESFLKKKQAAEVKNFPKYLKVKEQENQKACRDILNIQKKQFKILKEDELRNSRKKHNGESEQQIVDRLKENERQKQVELKAQYDASLEKMKAQELNKLESRHIRETLELENKLQTEKEVLRSFHNSQNEETMKNYNQEHLNLKNQMLNKRNELEVGIQESNRLFSLKRIEMYSELTTYHAKELRNFDLETVQLGIDQILINSISSDYVSVK 2755
            MQKLQNIEIEAQTQYAQQQESFLKKKQAAEVKNFPKYLKVKEQENQKACRDILNIQKKQFKILKEDELRNSRKKHNGESEQQIVDRLKENERQKQVELKAQYDASLEKMKAQELNKLESRHIRETLELENKLQTEKEVLRSFHNSQNEETMKNYNQEHLNLKNQMLNKRNELEVGIQESNRLFSLKRIEMYSELTTYHAKELRNFDLETVQLGIDQ LINSISSDYVSVK
Sbjct:    1 MQKLQNIEIEAQTQYAQQQESFLKKKQAAEVKNFPKYLKVKEQENQKACRDILNIQKKQFKILKEDELRNSRKKHNGESEQQIVDRLKENERQKQVELKAQYDASLEKMKAQELNKLESRHIRETLELENKLQTEKEVLRSFHNSQNEETMKNYNQEHLNLKNQMLNKRNELEVGIQESNRLFSLKRIEMYSELTTYHAKELRNFDLETVQLGIDQNLINSISSDYVSVK 230          
BLAST of Serine/threonine kinase vs. Planmine SMEST
Match: SMESG000074970.1 (SMESG000074970.1)

HSP 1 Score: 389.037 bits (998), Expect = 3.677e-119
Identity = 189/309 (61.17%), Postives = 238/309 (77.02%), Query Frame = 2
Query:  104 EFDQLLCKDDPSTIFTNLKQIGCGSFGAVYYAQNXXXXXXXXXXXXXVDSK---SQKDHWKDIKREICLLKQLNHVNCISFKGYYLKGNNPLIVMDYCLGSVSDIIEVFKKPLQEDEIGCVVVEVLKALNYLHKKNFIHRDIKASNILLTECGLVKLGDFGSSSFVNPANTFVGTPFWIAPEVIMAMESGLYDFKVDIWSLGITCIEMAEMEPPHFKTLNPMAAMYHIASNDSPCLLNPSLWSNEFVFLVVAFLKKSPDNRPSAENALQSKFCTIKRPPFILLKMIKNARNAVAAREKSDKSDKMKKIL 1021
            +   L   DDP+ I+T+L+QIGCG+FGAVYYA+NI T+EI+AIKEIKVD K   S+++ W+DI RE+  L++L+H NC+S+KG YLK  N  +VMDYCLGSV+DI+EV K+ L+E EI CVV EVL  L YLH    IHRDIKASNIL+T+ G +K+GDFGS SF++PAN+FVGTPFWIAPEVI+AMESGLY+ KVD+WSLGITCIEMAEMEPP+F+ LNPMAAMY IASNDSP L +P  WS  F   + + L+KSPD RPSA +ALQ  F        +L +MI   +NAVAA+E +  S K++K+L
Sbjct:   15 DISSLFTNDDPTFIYTDLRQIGCGNFGAVYYARNISTQEIVAIKEIKVDGKKKKSEREDWEDIAREVRFLRELDHKNCLSYKGCYLKDQNAWLVMDYCLGSVADILEVHKESLRESEIACVVTEVLCGLQYLHGNGHIHRDIKASNILITDQGGIKIGDFGSVSFISPANSFVGTPFWIAPEVILAMESGLYNEKVDVWSLGITCIEMAEMEPPYFRRLNPMAAMYQIASNDSPKLTDPLNWSIHFNSFLTSLLQKSPDQRPSAFDALQMPFSRNNVSRDVLHQMIARTKNAVAAQE-TQMSHKLRKML 322          

HSP 2 Score: 247.284 bits (630), Expect = 3.221e-68
Identity = 160/424 (37.74%), Postives = 263/424 (62.03%), Query Frame = 2
Query: 1517 WREQMNGLKRIRNQHKRSIQQLEEKHKNELETTKFSLSRELENVTSTFHKELEKLNKTNSLELDKNNKESRQKELNFVKNLETXXXXXXXXXXXXXXXENKNTGQYEVEINNVQKLGDART-------RKFKRDAIMNRHRLQLKQLDSTLKQEQSQLEQKNALLLQQHDKLVNLQLGHQESMHILRIDQMQKLQNIEIEAQTQYAQQQESFLKKKQAAEVKNFPKYLKVKEQENQKACRDILNIQKKQFKILKEDELRNSRKK------HNGESEQQIVDRLKENERQKQVELKAQYDASLEKMKAQELNKLESRHIRETLELENKLQTEKEVLRSFHNSQNEETMKNYNQEHLNLKNQMLNKRNELEVGIQESNRLFSLKRIEMYSELTTYHAKELRNFDLETVQLGIDQILINSISSDYVS 2749
            WREQMNGLKR+R+QHK+ ++QLEE++  E E  K +L+R+ +N     +KELEKL   + ++L+K     R+KEL    NLET + +  +   K      K   + E   NN+Q+L D R        RK KR++++    L+ +Q +  +K ++ QLE++NAL+L QH+KL  L+   +E++H L++DQ++K  ++E+E Q QYA Q+E+ +KK+ + EVKN PKYLK+KEQE +K  RD  +IQKKQFKIL+E+ LR  R        ++  +E+Q+++ L++ ER+KQ +L++QY+ S++ +K Q+ +K++S  I+E  +  + L+ EK +L  F   Q E   +++ +++  LK+++  ++  LE  IQ+ N  F  +R    + L    A EL++FD  T +LGID   + S +S   S
Sbjct:  572 WREQMNGLKRLRSQHKKQLKQLEERNAVEEENLKQALNRDFDNTRQNHNKELEKLEAVHQVDLEK-----RKKELT---NLETQTLRKWEADTKGEIKSAKKNAKSESGSNNIQELIDRRQTLTNVELRKLKRESLLRIQNLEKQQTEEKIKLQEKQLERENALMLSQHEKLQALEYKQKENLHRLKMDQIKKQHDLEMENQLQYAAQEEAQIKKRHSHEVKNLPKYLKLKEQEIRKQYRDAASIQKKQFKILREERLRAMRNAADVNINNHAINEKQLLENLRDEERRKQADLESQYENSIDALKRQQNDKIDSTQIQELTKCHDDLEKEKNMLSEFQRLQQEHMQQSHVEDYNALKDRIAKRKALLETTIQQKNDEFQNRRRINLTTLFDRQASELKSFDNHTQRLGIDNYKVVSATSRQAS 987          
The following BLAST results are available for this feature:
BLAST of Serine/threonine kinase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TAOK22.321e-9650.98TAO kinase 2 [Source:HGNC Symbol;Acc:HGNC:16835][more]
TAOK31.556e-9551.78TAO kinase 3 [Source:HGNC Symbol;Acc:HGNC:18133][more]
TAOK31.556e-9551.78TAO kinase 3 [Source:HGNC Symbol;Acc:HGNC:18133][more]
TAOK12.269e-9350.16TAO kinase 1 [Source:HGNC Symbol;Acc:HGNC:29259][more]
TAOK13.747e-9350.16TAO kinase 1 [Source:HGNC Symbol;Acc:HGNC:29259][more]
back to top
BLAST of Serine/threonine kinase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kin-181.933e-7542.01Serine/threonine-protein kinase SULU [Source:UniP... [more]
kin-181.933e-7542.01Serine/threonine-protein kinase SULU [Source:UniP... [more]
kin-182.348e-7544.18Serine/threonine-protein kinase SULU [Source:UniP... [more]
kin-182.348e-7544.18Serine/threonine-protein kinase SULU [Source:UniP... [more]
gck-19.754e-5239.80Germinal center kinase 1 [Source:UniProtKB/Swiss-... [more]
back to top
BLAST of Serine/threonine kinase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Tao2.087e-9652.53gene:FBgn0031030 transcript:FBtr0336691[more]
Tao5.478e-9552.22gene:FBgn0031030 transcript:FBtr0303999[more]
Tao5.478e-9552.22gene:FBgn0031030 transcript:FBtr0074772[more]
Tao5.478e-9552.22gene:FBgn0031030 transcript:FBtr0074771[more]
Tao3.147e-9252.22gene:FBgn0031030 transcript:FBtr0336692[more]
back to top
BLAST of Serine/threonine kinase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
taok1a7.063e-12732.02TAO kinase 1a [Source:ZFIN;Acc:ZDB-GENE-130103-9][more]
taok3a3.767e-9851.06TAO kinase 3a [Source:ZFIN;Acc:ZDB-GENE-100921-50][more]
taok3a4.191e-9851.06TAO kinase 3a [Source:ZFIN;Acc:ZDB-GENE-100921-50][more]
taok2a1.587e-9350.00TAO kinase 2a [Source:ZFIN;Acc:ZDB-GENE-030131-941... [more]
taok2a1.587e-9350.00TAO kinase 2a [Source:ZFIN;Acc:ZDB-GENE-030131-941... [more]
back to top
BLAST of Serine/threonine kinase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cirbp2.129e-9752.46cold inducible RNA binding protein [Source:Xenbase... [more]
cirbp4.438e-9752.13cold inducible RNA binding protein [Source:Xenbase... [more]
cirbp5.433e-9752.46cold inducible RNA binding protein [Source:Xenbase... [more]
cirbp1.050e-9652.13cold inducible RNA binding protein [Source:Xenbase... [more]
cirbp1.214e-9652.13cold inducible RNA binding protein [Source:Xenbase... [more]
back to top
BLAST of Serine/threonine kinase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Taok32.589e-9752.10TAO kinase 3 [Source:MGI Symbol;Acc:MGI:3041177][more]
Taok32.589e-9752.10TAO kinase 3 [Source:MGI Symbol;Acc:MGI:3041177][more]
Taok32.589e-9752.10TAO kinase 3 [Source:MGI Symbol;Acc:MGI:3041177][more]
Taok33.159e-9752.10TAO kinase 3 [Source:MGI Symbol;Acc:MGI:3041177][more]
Taok21.822e-9650.98TAO kinase 2 [Source:MGI Symbol;Acc:MGI:1915919][more]
back to top
BLAST of Serine/threonine kinase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9I9E0|TAOK3_CHICK2.293e-9752.75Serine/threonine-protein kinase TAO3 OS=Gallus gal... [more]
sp|Q8BYC6|TAOK3_MOUSE1.811e-9652.10Serine/threonine-protein kinase TAO3 OS=Mus muscul... [more]
sp|Q53UA7|TAOK3_RAT2.748e-9652.10Serine/threonine-protein kinase TAO3 OS=Rattus nor... [more]
sp|Q6DD27|TAOK3_XENLA3.717e-9552.13Serine/threonine-protein kinase TAO3 OS=Xenopus la... [more]
sp|Q9H2K8|TAOK3_HUMAN7.475e-9551.78Serine/threonine-protein kinase TAO3 OS=Homo sapie... [more]
back to top
BLAST of Serine/threonine kinase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3H2726.050e-14535.72serine/threonine-protein kinase TAO1 OS=Lingula un... [more]
A0A1S3HQM66.378e-14535.61serine/threonine-protein kinase TAO1 isoform X1 OS... [more]
T1KQT59.909e-13934.41Protein kinase domain-containing protein OS=Tetran... [more]
A0A1V9WY187.649e-13333.80Serine/threonine-protein kinase TAO1-like OS=Tropi... [more]
A0A226E3V91.852e-12733.55Serine/threonine-protein kinase TAO1 OS=Folsomia c... [more]
back to top
BLAST of Serine/threonine kinase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
taok1b4.642e-9450.16TAO kinase 1 [Source:NCBI gene;Acc:103030718][more]
taok1b7.518e-9450.16TAO kinase 1 [Source:NCBI gene;Acc:103030718][more]
taok1a1.398e-9351.64serine/threonine-protein kinase TAO1-like [Source:... [more]
taok1a2.503e-9351.64serine/threonine-protein kinase TAO1-like [Source:... [more]
taok2a3.111e-9350.82serine/threonine-protein kinase TAO2-like [Source:... [more]
back to top
BLAST of Serine/threonine kinase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000002959.12.062e-9449.68pep scaffold:Pmarinus_7.0:GL476671:15807:33413:-1 ... [more]
ENSPMAT00000002962.12.800e-9449.68pep scaffold:Pmarinus_7.0:GL476671:16080:33623:-1 ... [more]
slka3.328e-5440.29STE20-like kinase a [Source:ZFIN;Acc:ZDB-GENE-0504... [more]
stk25a6.592e-4841.73serine/threonine kinase 25a [Source:ZFIN;Acc:ZDB-G... [more]
MAP4K31.068e-4338.55mitogen-activated protein kinase kinase kinase kin... [more]
back to top
BLAST of Serine/threonine kinase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
STE201.461e-4139.66Cdc42p-activated signal transducing kinase; involv... [more]
KIC12.929e-4140.43Protein kinase of the PAK/Ste20 family, required f... [more]
SPS12.440e-3839.39Putative protein serine/threonine kinase; localize... [more]
CLA46.533e-3533.33Cdc42p-activated signal transducing kinase; member... [more]
SKM12.863e-3235.50Member of the PAK family of serine/threonine prote... [more]
back to top
BLAST of Serine/threonine kinase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO445929.381e-12933.11Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO490474.526e-5539.48Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO428457.838e-5540.93Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO319343.478e-4839.65Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO487411.761e-4733.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Serine/threonine kinase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
taok3a3.918e-9853.05TAO kinase 3 [Source:NCBI gene;Acc:101156330][more]
taok2a4.528e-9650.48serine/threonine-protein kinase TAO2 [Source:NCBI ... [more]
taok1b6.888e-9450.32serine/threonine-protein kinase TAO1 [Source:NCBI ... [more]
ENSORLT00000006223.22.806e-9250.33serine/threonine-protein kinase TAO1 [Source:NCBI ... [more]
ENSORLT00000007838.21.540e-9148.26serine/threonine-protein kinase TAO2 [Source:NCBI ... [more]
back to top
BLAST of Serine/threonine kinase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000046962.19.733e-1199.47SMESG000046962.1[more]
SMESG000046962.19.702e-1199.64SMESG000046962.1[more]
SMESG000046951.12.150e-15999.58SMESG000046951.1[more]
SMESG000046951.11.078e-15299.57SMESG000046951.1[more]
SMESG000074970.13.677e-11961.17SMESG000074970.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30008952 ID=SMED30008952|Name=Serine/threonine kinase|organism=Schmidtea mediterranea sexual|type=transcript|length=2864bp
CAAGATATTAATTTTAAAGAATTGTGAATTTATATTTTAATAAAAATTTA
TATTAGAATGATAAAATTTAATGACTAAAGTTTTAGAAGTTAATAATATG
AATGAGTTTGATCAACTTTTATGCAAAGATGATCCATCGACAATATTCAC
AAATCTTAAACAGATTGGATGTGGAAGTTTTGGAGCTGTCTATTATGCTC
AAAATATTAAAACTAAAGAAATAATAGCAATTAAAGAGATTAAAGTCGAT
TCAAAATCACAAAAGGATCACTGGAAAGATATTAAAAGGGAAATATGTTT
ATTGAAACAGTTAAACCATGTAAATTGTATATCATTTAAAGGATATTATT
TAAAAGGAAACAATCCATTAATTGTGATGGATTATTGCTTGGGCTCTGTA
TCTGATATAATTGAAGTTTTTAAGAAGCCACTTCAAGAAGATGAAATAGG
ATGTGTTGTGGTGGAAGTATTGAAGGCACTAAATTATTTACACAAGAAAA
ATTTCATACACAGAGATATTAAAGCCAGCAATATATTACTTACAGAATGC
GGGCTAGTAAAACTGGGTGACTTTGGATCCAGTAGTTTTGTAAATCCTGC
TAATACATTTGTGGGTACTCCATTTTGGATCGCGCCAGAAGTCATTATGG
CTATGGAAAGTGGGTTATACGACTTCAAAGTCGATATTTGGTCACTGGGT
ATTACTTGTATTGAAATGGCTGAAATGGAACCTCCACACTTCAAAACACT
GAATCCCATGGCAGCAATGTACCATATAGCTTCTAATGATTCCCCATGCC
TTTTAAATCCTTCTTTGTGGTCAAATGAATTTGTATTTCTAGTAGTTGCC
TTTCTTAAAAAATCTCCAGATAATCGTCCTTCTGCTGAAAATGCTCTCCA
GTCTAAATTTTGTACCATAAAACGTCCTCCATTCATTTTACTTAAAATGA
TTAAAAATGCCAGAAACGCAGTAGCAGCTAGAGAGAAATCAGACAAATCC
GATAAAATGAAAAAAATACTTCTTCAATCAAAAACGGATAATGAAAGTCC
GCCTGAAATGGGCCGATCACCATCTTTTATTGAAGATGAATTTATTTCTA
AACATTCATCCAAAAGTTCTGACACGTCTAATATATCTTTGGATTTATTT
GAAAATTTGAGCTCCATTGAAATACCCGTCAATAAGAAAAACAGAGGTGA
CATTTCCAATAGTTCCTTGAAAAATATCAACCCAATGAAGATAGACCAAA
AATTATCACATAGTCAATCAGATAGTGTAAAACTTTTATCTGAACGAAAC
AATGTCATTCCAAATTCTAAGTCATCAGGCGATATCAGCAGAAAAGCAGG
TAATGAAAACAAAGTCTCAAAAATCATTAAACAATTGCAAAGCATTGATG
TTAAATCAGTTGAAAATCTTCACATAATTTCATTAAAAATACCCCTGCAC
CGATCATCAACATCATCAGAAAGTTATGAAGATAAATATAAAAATCCCTC
GGATATCAATGAAGTGTGGCGTGAGCAAATGAATGGATTAAAACGAATTC
GTAATCAACACAAACGATCCATTCAACAACTTGAAGAAAAACACAAGAAT
GAATTAGAAACAACAAAGTTTTCATTGAGTCGAGAATTAGAAAATGTGAC
AAGCACATTTCACAAAGAGCTAGAGAAGCTGAATAAAACTAATTCTTTGG
AATTAGACAAAAATAATAAAGAAAGTCGTCAAAAAGAATTAAATTTTGTA
AAAAATTTAGAGACCATATCAAAGAAAGATATTAAAAATATTAAAAAAAA
TTTCAAATCAGAAAATAAAAATACCGGTCAATATGAGGTTGAAATTAATA
ACGTTCAGAAACTCGGTGATGCTAGAACCAGAAAATTTAAAAGAGATGCG
ATAATGAACCGCCACAGATTACAGCTTAAACAATTGGATTCCACGTTGAA
ACAAGAACAATCTCAATTGGAACAGAAAAATGCTTTATTGTTGCAGCAAC
ACGATAAATTGGTTAACTTGCAGTTAGGCCATCAGGAAAGTATGCACATT
TTACGAATCGATCAAATGCAAAAATTGCAAAATATTGAAATTGAAGCTCA
AACTCAGTACGCTCAACAACAAGAATCATTTCTTAAAAAAAAACAAGCAG
CGGAAGTCAAAAACTTTCCAAAATATTTGAAAGTAAAAGAGCAAGAAAAT
CAAAAAGCTTGTCGTGACATATTAAACATTCAGAAAAAGCAATTTAAAAT
TTTGAAAGAAGACGAATTAAGAAACAGTCGGAAAAAGCATAATGGTGAAT
CTGAACAACAGATAGTTGATAGATTGAAAGAAAATGAACGCCAGAAACAA
GTAGAACTTAAAGCTCAATATGATGCCAGTCTTGAAAAAATGAAAGCTCA
AGAATTGAATAAATTGGAGAGTAGACATATTCGAGAAACTTTAGAGTTAG
AAAATAAATTGCAAACTGAGAAAGAAGTGTTGAGATCATTCCATAATTCA
CAAAACGAAGAAACTATGAAAAATTATAATCAAGAACACTTGAATCTAAA
AAATCAAATGTTAAATAAACGAAATGAATTGGAAGTTGGGATTCAAGAAT
CCAATCGGTTATTTTCTCTTAAACGCATAGAAATGTACAGCGAACTCACA
ACGTATCATGCCAAAGAATTGAGAAATTTTGACCTCGAAACAGTTCAGCT
GGGCATTGATCAAATTTTGATCAACTCGATCAGCTCAGATTACGTTTCAG
TGAAATAAATGCTCAATTATTCCTATTACTTTCCAATCATCTCATTTTTG
CAATTTGTGTATATTATTCAATTTATAGATGATATTATGATATTATTATT
ATTATTATTGTTGT
back to top

protein sequence of SMED30008952-orf-1

>SMED30008952-orf-1 ID=SMED30008952-orf-1|Name=SMED30008952-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=896bp
MTKVLEVNNMNEFDQLLCKDDPSTIFTNLKQIGCGSFGAVYYAQNIKTKE
IIAIKEIKVDSKSQKDHWKDIKREICLLKQLNHVNCISFKGYYLKGNNPL
IVMDYCLGSVSDIIEVFKKPLQEDEIGCVVVEVLKALNYLHKKNFIHRDI
KASNILLTECGLVKLGDFGSSSFVNPANTFVGTPFWIAPEVIMAMESGLY
DFKVDIWSLGITCIEMAEMEPPHFKTLNPMAAMYHIASNDSPCLLNPSLW
SNEFVFLVVAFLKKSPDNRPSAENALQSKFCTIKRPPFILLKMIKNARNA
VAAREKSDKSDKMKKILLQSKTDNESPPEMGRSPSFIEDEFISKHSSKSS
DTSNISLDLFENLSSIEIPVNKKNRGDISNSSLKNINPMKIDQKLSHSQS
DSVKLLSERNNVIPNSKSSGDISRKAGNENKVSKIIKQLQSIDVKSVENL
HIISLKIPLHRSSTSSESYEDKYKNPSDINEVWREQMNGLKRIRNQHKRS
IQQLEEKHKNELETTKFSLSRELENVTSTFHKELEKLNKTNSLELDKNNK
ESRQKELNFVKNLETISKKDIKNIKKNFKSENKNTGQYEVEINNVQKLGD
ARTRKFKRDAIMNRHRLQLKQLDSTLKQEQSQLEQKNALLLQQHDKLVNL
QLGHQESMHILRIDQMQKLQNIEIEAQTQYAQQQESFLKKKQAAEVKNFP
KYLKVKEQENQKACRDILNIQKKQFKILKEDELRNSRKKHNGESEQQIVD
RLKENERQKQVELKAQYDASLEKMKAQELNKLESRHIRETLELENKLQTE
KEVLRSFHNSQNEETMKNYNQEHLNLKNQMLNKRNELEVGIQESNRLFSL
KRIEMYSELTTYHAKELRNFDLETVQLGIDQILINSISSDYVSVK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000070intestinal phagocyte
PLANA:0000099neuron
Vocabulary: INTERPRO
TermDefinition
IPR000719Prot_kinase_dom
IPR017441Protein_kinase_ATP_BS
IPR008271Ser/Thr_kinase_AS
IPR011009Kinase-like_dom_sf
Vocabulary: molecular function
TermDefinition
GO:0005524ATP binding
GO:0004672protein kinase activity
GO:0000166nucleotide binding
GO:0004674protein serine/threonine kinase activity
GO:0004702signal transducer, downstream of receptor, with serine/threonine kinase activity
GO:0005515protein binding
GO:0016301kinase activity
GO:0016740transferase activity
Vocabulary: biological process
TermDefinition
GO:0006468protein phosphorylation
GO:0006281DNA repair
GO:0006915apoptotic process
GO:0006974cellular response to DNA damage stimulus
GO:0007062sister chromatid cohesion
GO:0016310phosphorylation
GO:0023014signal transduction by protein phosphorylation
GO:0031572G2 DNA damage checkpoint
GO:0032874positive regulation of stress-activated MAPK cascade
GO:0046330positive regulation of JNK cascade
GO:0051493regulation of cytoskeleton organization
GO:0097194execution phase of apoptosis
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0005829cytosol
GO:0070062extracellular exosome