Protocadherin Fat 1

Overview
NameProtocadherin Fat 1
Smed IDSMED30008940
Length (bp)3240
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Protocadherin Fat 1 (SMED30008940) t-SNE clustered cells

Violin plots show distribution of expression levels for Protocadherin Fat 1 (SMED30008940) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Protocadherin Fat 1 (SMED30008940) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Protocadherin Fat 1 (SMED30008940) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30008940

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30008940h1SMcG0015848 SmedASXL_010801SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30008940h1SMcG0015848 dd_Smed_v4_13468_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30008940h1SMcG0015848 dd_Smed_v4_13468_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30008940h1SMcG0015848 dd_Smed_v4_13468_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30008940h1SMcG0015848 dd_Smed_v6_13468_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30008940h1SMcG0015848 OX_Smed_1.0.09932ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
body wall musculatureSMED30008940h1SMcG0015848 dd_Smed_v4_13468_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Protocadherin Fat 1 vs. Ensembl Human
Match: CELSR3 (cadherin EGF LAG seven-pass G-type receptor 3 [Source:HGNC Symbol;Acc:HGNC:3230])

HSP 1 Score: 188.734 bits (478), Expect = 1.226e-47
Identity = 164/603 (27.20%), Postives = 284/603 (47.10%), Query Frame = 2
Query:  410 DSGIKISSFYILIKVLDENDNSPKFLPFLNPYQTLPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKL-VNVISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPAR--TIVASLQVSDRDSLVTDIECSLDDYHLNFEITAINEIHPLGHYKEF---IINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIF 2200
            + G + ++  + I VLDENDN+P+F       Q + E+ + +TV+L  +A D D +A G+ +Y I    + GN      +D +     ++ +++PLD E   EY   ++A D       + +G+   I+V DIND+ P+F  T +  +++E++ L  +VI     D D G+N ++  ++                  F  +  TG + +   +D E+  + Y F + A D+G P LS++A V + +++ ND  P        E   +   +  NE A   T V S+   DRD+          +  ++++IT  N  +      +    ++    PLD + ++  Y K+ +  SD+     L  +  +HIN+ D N + PVF  + Y   + E+ P  +  ++  I   D D G+NA +TY ++      +   F IDADSG I+ +  +DYE    ++  I A D      + T  + V V D NDNAP F   HY+  V E+ P  T + QI  TD D     + V+Y  ++  +      ++  SG ++T+  +DRE V    +   A +      +  +  + MV    +DVNDN P+F
Sbjct:  521 EPGPRSATVRVHITVLDENDNAPQFSEKRYVAQ-VREDVRPHTVVLRVTATDRDKDANGLVHYNI----ISGNSRGHFAIDSLTG---EIQVVAPLDFEAEREYALRIRAQDAGRPPLSNNTGL-ASIQVVDINDHIPIFVSTPFQVSVLENAPLGHSVIHIQAVDADHGENARLEYSLTGVAP----------DTPFVINSATGWVSVSGPLDRESVEH-YFFGVEARDHGSPPLSASASVTVTVLDVNDNRP--------EFTMKEYHLRLNEDAAVGTSVVSVTAVDRDA----------NSAISYQITGGNTRNRFAISTQGGVGLVTLALPLDYKQER--YFKLVLTASDR----ALHDHCYVHINITDANTHRPVFQSAHYSVSVNEDRPMGSTIVV--ISASDDDVGENARITYLLED-----NLPQFRIDADSGAITLQAPLDYEDQVTYTLAITARDNGIPQKADTTYVEVMVNDVNDNAPQFVASHYTGLVSEDAPPFTSVLQISATDRDAHANGR-VQYTFQNGEDGDGDFTIEPTSGIVRTVRRLDREAVSVYELTAYAVDRGVPPLRTPVSIQVMV----QDVNDNAPVF 1067          

HSP 2 Score: 159.458 bits (402), Expect = 1.111e-38
Identity = 158/605 (26.12%), Postives = 268/605 (44.30%), Query Frame = 2
Query:  440 ILIKVLDENDNSPKFLPFLNPYQTLPENSQINTVILLPSAIDLDSEA-FGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLISP---LDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVE----HSKLVNVISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLS-STAKVNIILINKNDQAPVIKVIRKGEIVSR--SITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITAINEIHPLGHYKEFIINTLK-------PLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIF 2200
            + + V D ND+SP F       +TL EN +    IL   A D D+     ++Y  +  P      +    +D      P+  LIS    +DRE +  Y  +++A D+  +     + V V I V D NDN P F +  Y A + E    H+ ++ V +   TD D+  N  V   I + N       +  F ID     +TG I+++  +D+E    +Y+  + A D G P LS +T   +I +++ ND  P+         VS    +++ EN P    V  +Q  D D          ++  L + +T +    P      F+IN+         PLDRE  ++ +  +    +      PL+ + ++ + + D+NDN P FT  +Y   L E+    T   +  +  +D+D   N+ ++Y+I +  N+ +    +     G ++    +DY++ + F   + A D+    L     + +++ DAN + P+F   HYS +V E+ P+ + I  I  +D D   EN  + Y      +N     +D +SG +    P+D E   + T+ ITAR+    Q  +    E MV     DVNDN P F
Sbjct:  419 VAVTVADRNDHSPVFEQ-AQYRETLRENVEEGYPILQLRATDGDAPPNANLRYRFVGPPAARAAAAAAFEID------PRSGLISTSGRVDREHMESYELVVEASDQGQEPGPRSATVRVHITVLDENDNAPQFSEKRYVAQVREDVRPHTVVLRVTA---TDRDKDANGLVHYNIISGNS------RGHFAIDS----LTGEIQVVAPLDFEAE-REYALRIRAQDAGRPPLSNNTGLASIQVVDINDHIPI--------FVSTPFQVSVLENAPLGHSVIHIQAVDAD--------HGENARLEYSLTGVAPDTP------FVINSATGWVSVSGPLDRESVEHYFFGVE---ARDHGSPPLSASASVTVTVLDVNDNRPEFTMKEYHLRLNEDAAVGT--SVVSVTAVDRD--ANSAISYQI-TGGNTRNRFAISTQGGVGLVTLALPLDYKQERYFKLVLTASDR---ALHDHCYVHINITDANTHRPVFQSAHYSVSVNEDRPMGSTIVVISASD-DDVGENARITYL---LEDNLPQFRIDADSGAITLQAPLDYEDQVTYTLAITARDNGIPQKADTTYVEVMV----NDVNDNAPQF 961          

HSP 3 Score: 142.124 bits (357), Expect = 2.398e-33
Identity = 186/717 (25.94%), Postives = 296/717 (41.28%), Query Frame = 2
Query:  476 PKFLPFLNPYQTL-PENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLI---SPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEH-SKLVNVISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGL---PRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITAINEIHPLGHYK----EFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLT--IHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKY-FHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIFSLINPAKSSLIFTINKGFRHENCQMIPYAVSDADHDEPNSDSCCILQLDNDQNG----MLYLLS-NTPNF--------LCLQNTMNTPG--IYRVSLTATDNKNNPNKSLKAKVSFNIDVRHEVSDN 2536
            P+F P  N YQTL PEN    T +L   A D D+   G   Y ++    + N     L     S  PQ  LI   + LDRE  S  R  L+   +++   R  +   V + V D ND+ PVF++  Y   + E+  +   ++    TD D   N  +           +      F+ID    L++ S R +D    E+    Y   + A+D G    PR S+T +V+I ++++ND AP     R    V       E+    T+V  +  +DRD     +        +++ I + N     GH+        I  + PLD E ++   L+I      QD   P  +N T    I + DIND+ P+F  + +Q  ++EN P      +  I  +D DHG+NA + Y +      T    F I++ +G +S    +D E  + + F + A D     LS++A + V V+D NDN P F    Y   + E+  V T +  +   D D    N  + Y      T N   I      G +    P+D ++ R   +++TA + A       +   C V I I D N + P+F                       Q   Y+VS  + D P   +  ++   +D  G    + YLL  N P F        + LQ  ++      Y +++TA DN   P K+    V   ++   +V+DN
Sbjct:  323 PQF-PQYN-YQTLVPENEAAGTAVLRVVAQDPDAGEAGRLVYSLAA---LMNSRSLELF----SIDPQSGLIRTAAALDRE--SMERHYLRVTAQDHGSPRLSATTMVAVTVADRNDHSPVFEQAQYRETLRENVEEGYPILQLRATDGDAPPNANLRYRF-VGPPAARAAAAAAFEIDPRSGLISTSGR-VDREHMES----YELVVEASDQGQEPGPR-SATVRVHITVLDENDNAPQFSEKRYVAQVR------EDVRPHTVVLRVTATDRDKDANGL--------VHYNIISGNS---RGHFAIDSLTGEIQVVAPLDFEAEREYALRIRA----QDAGRPPLSNNTGLASIQVVDINDHIPIFVSTPFQVSVLENAPLG--HSVIHIQAVDADHGENARLEYSLTGVAPDTP---FVINSATGWVSVSGPLDRESVEHYFFGVEARDHGSPPLSASASVTVTVLDVNDNRPEFTMKEYHLRLNEDAAVGTSVVSVTAVDRDA---NSAISYQITGGNTRNRFAISTQGGVGLVTLALPLDYKQERYFKLVLTASDRA-------LHDHCYVHINITDANTHRPVF-----------------------QSAHYSVS-VNEDRPMGSTIVVISASDDDVGENARITYLLEDNLPQFRIDADSGAITLQAPLDYEDQVTYTLAITARDN-GIPQKADTTYVEVMVN---DVNDN 957          

HSP 4 Score: 139.043 bits (349), Expect = 2.703e-32
Identity = 152/590 (25.76%), Postives = 250/590 (42.37%), Query Frame = 2
Query:  446 IKVLDENDNSPKFLPFLNPYQ-TLPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKL-VNVISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRD-SLVTDIECSLDDYHLNFEITAINEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLT-IHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIFS 2203
            I+V+D ND+ P F+    P+Q ++ EN+ +   ++   A+D D        Y ++    +  D+ F     I S    + +  PLDRE +  Y F ++A  R++      +   V + V D+NDN P F    Y   + E + +  +V+S  VT +D   N  +S  I   N   +  I        S     G + L   +DY+   Y +   L A+D  L        V+I + + N   PV +          S+++ E+ P  + +  +  SD D      I   L+D    F I A              I    PLD ED     L I    + +D   P   + T + + + D+NDN P F  S Y G + E+ P  T   +  I   D+D   N  V Y   + ++  D + FTI+  SG + + + +D E   ++     A+D+    L +   I V V D NDNAP+FP   +   V+EN  V + + QI   D D  P   I+  +     N  ++  +D  SG+L  +  +D E  +   I++ A +         + S   V + + D NDN P+ +
Sbjct:  639 IQVVDINDHIPIFVS--TPFQVSVLENAPLGHSVIHIQAVDADHGENARLEYSLTG---VAPDTPFV----INSATGWVSVSGPLDRESVEHYFFGVEA--RDHGSPPLSASASVTVTVLDVNDNRPEFTMKEYHLRLNEDAAVGTSVVS--VTAVDRDANSAISYQITGGNTRNRFAI--------STQGGVGLVTLALPLDYKQERY-FKLVLTASDRAL---HDHCYVHINITDANTHRPVFQS------AHYSVSVNEDRPMGSTIVVISASDDDVGENARITYLLEDNLPQFRIDA----------DSGAITLQAPLDYEDQVTYTLAI----TARDNGIPQKADTTYVEVMVNDVNDNAPQFVASHYTGLVSEDAPPFT--SVLQISATDRDAHANGRVQYTFQNGEDG-DGD-FTIEPTSGIVRTVRRLDREAVSVYELTAYAVDRGVPPLRTPVSIQVMVQDVNDNAPVFPAEEFEVRVKENSIVGSVVAQITAVDPDEGPNAHIM--YQIVEGNIPELFQMDIFSGELTALIDLDYEARQEYVIVVQATSAP-------LVSRATVHVRLVDQNDNSPVLN 1170          
BLAST of Protocadherin Fat 1 vs. Ensembl Human
Match: FAT4 (FAT atypical cadherin 4 [Source:HGNC Symbol;Acc:HGNC:23109])

HSP 1 Score: 187.963 bits (476), Expect = 2.049e-47
Identity = 179/612 (29.25%), Postives = 287/612 (46.90%), Query Frame = 2
Query:  440 ILIKVLDENDNSPKFLPFLNPYQTLPENSQINTVILLPSAIDLDSEAFGIKY--YKISKPFLIGNDSHFTLLDKI--ASGRPQLL-LIS--PLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKL-VNVISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIECSL------DDYHLNFEITAINEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLT--------TNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQS--IDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPH-YSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIF 2200
            + + V D NDN+P F P  +   T  E+S     ++L +A D D  + G+ +  Y+I +    GN++    LD     SG    L L+S   LDREV  +Y+ +++  D+     R    ++V + V DINDNPPVF  + Y A + E + +  +V+     D DEG N  +   ++ E           FQ+D      TG I + + +D+E    +YS  + A D G+P L+  A+  I L++ ND  PV+K  R     SR  ++ EN    T+VA L V+D DS   +   S+      +  H   + + +  +         +I     LDRE   +  L +++  SD     P           +L I +N  DIND+PPVF++  Y+  L E  P  +   +  I   D D G NA + Y I  S N   W  F I   SG +++  S  +D E       NI A D+      S A ++V ++D ND  P+F +P  Y  +V EN P  TE+  +  TD D   +N  V++  +    + +   +D  SG+L TI  +DRE+    ++L+ A +  S    ++      + +++ D+NDN P+F
Sbjct:  121 VRVLVRDLNDNAPVF-PDPSIVVTFKEDSSSGRQVILDTATDSDIGSNGVDHRSYRIIR----GNEAGRFRLDITLNPSGEGAFLHLVSKGGLDREVTPQYQLLVEVEDKGEPKRRGY--LQVNVTVQDINDNPPVFGSSHYQAGVPEDAVVGSSVLQVAAADADEGTNADIRYRLQDEGTP--------FQMDPE----TGLITVREPLDFEAR-RQYSLTVQAMDRGVPSLTGRAEALIQLLDVNDNDPVVK-FRYFPATSRYASVDENAQVGTVVALLTVTDADSPAANGNISVQILGGNEQRHFEVQSSKVPNLS--------LIKVASALDRERIPSYNLTVSV--SDNYGAPPGAAVQARSSVASLVIFVN--DINDHPPVFSQQVYRVNLSEEAPPGS--YVSGISATDGDSGLNANLRYSI-VSGNGLGW--FHISEHSGLVTTGSSGGLDRELASQIVLNISARDQGVHPKVSYAQLVVTLLDVNDEKPVFSQPEGYDVSVVENAPTGTELLMLRATDGDLG-DNGTVRFSLQEAETDRRSFRLDPVSGRLSTISSLDREEQAFYSLLVLATDLGSPPQSSM----ARINVSLLDINDNSPVF 689          

HSP 2 Score: 177.948 bits (450), Expect = 2.597e-44
Identity = 169/608 (27.80%), Postives = 280/608 (46.05%), Query Frame = 2
Query:  443 LIKVLDENDNSP----KFLPFLNPYQTLPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDS-HFTLLDKIASGRPQLLLI---SPLDREVISEYRFILKAVDRENDDHRDISGVEVEIK---------VGDINDNPPVFDKTFYTANIVEHSKLVNVIS-FYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQI-DFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTD---IECSLDDYHLNFEITAINEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIF 2200
            LI++LD NDN P    ++ P  + Y ++ EN+Q+ TV+ L +  D DS A       IS   L GN+  HF +    +S  P L LI   S LDRE I  Y   +      +D++    G  V+ +         V DIND+PPVF +  Y  N+ E +   + +S    TD D G N  +  +I + N         +F I + S  + TGS   +D         +   N+ A D G+    S A++ + L++ ND+ PV       +     +++ EN P  T +  L+ +D D  + D   +  SL +   +     ++ +          ++T+  LDRE+    +  + +  +D     P ++   I+++L DINDN PVF   +Y   + EN P  +   I  +   D D G N  V Y I +     D   F ++A SG IS+R ++D E+   +   I+A D       + A++ + V+D  DN P+F +  YSF V ENV +   +G +  + +D    N  + Y   +  +   +  ++Q +G+L T   IDRE+     + + A       +   +  + MV IT++D+NDN P F
Sbjct:  340 LIQLLDVNDNDPVVKFRYFPATSRYASVDENAQVGTVVALLTVTDADSPA---ANGNISVQILGGNEQRHFEVQ---SSKVPNLSLIKVASALDRERIPSYNLTVSV----SDNYGAPPGAAVQARSSVASLVIFVNDINDHPPVFSQQVYRVNLSEEAPPGSYVSGISATDGDSGLNANLRYSIVSGNGLG------WFHISEHSGLVTTGSSGGLDR----ELASQIVLNISARDQGVHPKVSYAQLVVTLLDVNDEKPVFS-----QPEGYDVSVVENAPTGTELLMLRATDGD--LGDNGTVRFSLQEAETDRRSFRLDPVSGR-------LSTISSLDREE--QAFYSLLVLATDLGS-PPQSSMARINVSLLDINDNSPVFYPVQYFAHIKENEPGGS--YITTVSATDPDLGTNGTVKYSISAG----DRSRFQVNAQSGVISTRMALDREEKTAYQLQIVATDGGNLQSPNQAIVTITVLDTQDNPPVFSQVAYSFVVFENVALGYHVGSVSASTMDL---NSNISYLITT-GDQKGMFAINQVTGQLTTANVIDREEQSFYQLKVVA-------SGGTVTGDTMVNITVKDLNDNSPHF 893          

HSP 3 Score: 159.073 bits (401), Expect = 1.686e-38
Identity = 161/588 (27.38%), Postives = 262/588 (44.56%), Query Frame = 2
Query:  446 IKVLDENDNSPKFLPFLNPYQTLPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKLVNVIS-FYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITAINEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIFSL 2206
            I + D NDN P F P      T+ EN    + I+  +A+D D  A  +  Y I    + G D  F    +I      L+    LDRE  S+Y  +++A     DD    S + + I V D+ND+ P F +  Y+ +I E +   ++++    TD D G N +++  +   N+  +D I  FF    +P  +TG   L   +DYE   Y Y   + A D G     +T +V   +++ ND  P+        + S S ++ EN P  + V    V+D D  +        +  L + I + + +      K  ++  LK LDRE      L + ++   Q   +  T+   + I L D+NDNPP F   K    + EN P  TV  +      D D G N+Y+ Y + +   +     F+I    G++     +D E+   ++  ++A DK Q +LSS+  ++V V+D NDN PIF +  Y   + EN    T+I Q+   D D     ++        TN  Q   +D  +G +    P+DREK  +  + + A +  S    +       V I + D+ND  P+F L
Sbjct: 1728 ITLQDINDNPPVF-PTDMLDLTVEENIGDGSKIMQLTAMDADEGANALVTYTI----ISGADDSF----RIDPESGDLIATRRLDRERRSKYSLLVRA-----DDGLQSSDMRINITVSDVNDHTPKFSRPVYSFDIPEDTIPGSLVAAILATDDDSGVNGEITYIV---NEDDEDGI--FF---LNP--ITGVFNLTRLLDYEVQQY-YILTVRAEDGG--GQFTTIRVYFNILDVNDNPPIFS------LNSYSTSLMENLPVGSTVLVFNVTDADDGI--------NSQLTYSIASGDSLGQFTVDKNGVLKVLKALDRESQSFYNLVVQVHDLPQIPASRFTSTAQVSIILLDVNDNPPTFLSPKLT-YIPENTPIDTV--VFKAQATDPDSGPNSYIEYTLLNPLGNK----FSIGTIDGEVRLTGELDREEVSNYTLTVVATDKGQPSLSSSTEVVVMVLDINDNNPIFAQALYKVEINENTLTGTDIIQVFAADGDEGTNGQVRYGIVNGNTN--QEFRIDSVTGAITVAKPLDREKTPTYHLTVQATDRGSTPRTD----TSTVSIVLLDINDFVPVFEL 2261          

HSP 4 Score: 155.221 bits (391), Expect = 2.491e-37
Identity = 164/594 (27.61%), Postives = 257/594 (43.27%), Query Frame = 2
Query:  446 IKVLDENDNSPKFLPFLNPYQTLPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKLVNVISFYV--TDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMF--ENEPARTIVASLQVSDRD-SLVTDIECSLDDYHLNFEITAINEIHPLGHYKEFIINTLKPLDRED----DKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIF 2200
            I V D NDNSP FL  +     + EN Q    I    A+D D    G+  Y + +       + F + +K  +    + L+ PLD    S Y+  + A D         S V + + V D+NDN PVFD+  Y   + E S+ VN   F V  +D D G N +++ TI   N    D    F           G + +  E+D E    +Y   ++A+D  +  LS+T  V +IL + ND  P+          S + T +  E + A + V  +   D+D     ++  S +    +FE+ AI+           I NT +  DRE              +  +DQ    PL    T+H+ + DINDN P F +  YQ  + E+   A +  +  +   D D G N  + Y I       +   F ID+ SG+++    +DYE    +S  I A+D     L+ST  + + ++D NDN P FPK      V EN+ +   +  +  TD D+     +  Y+  + TNN+    +  N+G +     +D E      + ITA++    Q +    S   V+I + D NDNPP F
Sbjct:  881 ITVKDLNDNSPHFLQAIESVNVV-ENWQAGHSIFQAKAVDPDEGVNGMVLYSLKQ----NPKNLFAINEKNGT----ISLLGPLDVHAGS-YQIEILASDMGVPQLS--SSVILTVYVHDVNDNSPVFDQLSYEVTLSE-SEPVNSRFFKVQASDKDSGANGEIAYTIAEGN--TGDAFGIF---------PDGQLYIKSELDRELQD-RYVLMVVASDRAVEPLSATVNVTVILEDVNDNRPLFN--------STNYTFYFEEEQRAGSFVGKVSAVDKDFGPNGEVRYSFEMVQPDFELHAISG---------EITNTHQ-FDRESLMRRRGTAVFSFTVIATDQGIPQPLKDQATVHVYMKDINDNAPKFLKDFYQATISES--AANLTQVLRVSASDVDEGNNGLIHYSI---IKGNEERQFAIDSTSGQVTLIGKLDYEATPAYSLVIQAVDSGTIPLNSTCTLNIDILDENDNTPSFPKSTLFVDVLENMRIGELVSSVTATDSDSGDNADL--YYSITGTNNHGTFSISPNTGSIFLAKKLDFETQSLYKLNITAKD----QGRPPRSSTMSVVIHVRDFNDNPPSF 1420          

HSP 5 Score: 154.066 bits (388), Expect = 5.940e-37
Identity = 170/623 (27.29%), Postives = 284/623 (45.59%), Query Frame = 2
Query:  446 IKVLDENDNSPKFLPFLNPYQT-LPENSQINTVILLPSAIDLDSEAFGIKYYKI---SKPFLIGNDSHFTLLDKIASGRPQLLLIS---PLDREVISEYRFILKAVDRENDDHRDISG-VEVEIKVGDINDNPPV-----FDKTFYTANIVEHSKLVNVISFY-VTDLDE-GQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDN-GLP------RLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITAINEI---HPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSK-YQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIFSLINPAKSSLIF 2236
            + V D NDN P F    + YQ  +PE++ + + +L  +A D D        Y++     PF +                P+  LI+   PLD E   +Y   ++A+DR       ++G  E  I++ D+NDN PV     F  T   A++ E++++  V++   VTD D    N  +S+ I   N+      +R F++  S       I++   +D E  P  Y+  +  +DN G P        SS A + I + + ND  PV       + V R + + E  P  + V+ +  +D DS +        + +L + I + N +   H   H       +   LDRE      + +NI   DQ  + P  +   + + L D+ND  PVF++ + Y   ++EN P  T  ++  +   D D G N  V + +  ++  TD   F +D  SG++S+  S+D E+   +S  ++A D      SS A I V ++D NDN+P+F    Y   ++EN P  + I  +  TD D    N  VKY   +   +     V+  SG + T   +DRE+  +  + I A +  + Q+ N    + +V IT+ D  DNPP+FS +  A S ++F
Sbjct:  238 VTVQDINDNPPVFGS--SHYQAGVPEDAVVGSSVLQVAAADADEGTNADIRYRLQDEGTPFQM---------------DPETGLITVREPLDFEARRQYSLTVQAMDR---GVPSLTGRAEALIQLLDVNDNDPVVKFRYFPATSRYASVDENAQVGTVVALLTVTDADSPAANGNISVQILGGNE------QRHFEVQSSKVPNLSLIKVASALDRERIP-SYNLTVSVSDNYGAPPGAAVQARSSVASLVIFVNDINDHPPVFS-----QQVYR-VNLSEEAPPGSYVSGISATDGDSGL--------NANLRYSIVSGNGLGWFHISEHSGLVTTGSSGGLDRE--LASQIVLNISARDQ-GVHPKVSYAQLVVTLLDVNDEKPVFSQPEGYDVSVVENAPTGTELLM--LRATDGDLGDNGTVRFSLQEAE--TDRRSFRLDPVSGRLSTISSLDREEQAFYSLLVLATDLGSPPQSSMARINVSLLDINDNSPVFYPVQYFAHIKENEPGGSYITTVSATDPDLG-TNGTVKYSISA--GDRSRFQVNAQSGVISTRMALDREEKTAYQLQIVATDGGNLQSPN----QAIVTITVLDTQDNPPVFSQV--AYSFVVF 803          

HSP 6 Score: 152.525 bits (384), Expect = 1.859e-36
Identity = 169/618 (27.35%), Postives = 286/618 (46.28%), Query Frame = 2
Query:  404 QVDSGIKISSFYILIKVLDENDNSPKFLPFLNPYQTLPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKLVN-VISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLP-----RLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMF-ENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITAINEIHPLGHYKEFIINTL-------KPLDREDDKNQYLKINIYCSDQDKLTP-LTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVP-VNTEIGQIETTDLDTRPENKIVKY--FHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIFS 2203
            + D G++ S   I I V D ND++PKF   +  +  +PE++   +++    A D DS   G   Y +++     ++     L+ I        L   LD EV   Y   ++A     D     + + V   + D+NDNPP+F    Y+ +++E+  + + V+ F VTD D+G N Q++ +I + +   +      F +D       G ++++  +D E+  +   +NL+   + LP     R +STA+V+IIL++ ND  P          +S  +T   EN P  T+V   Q +D DS         + Y    E T +N   PLG+  +F I T+         LDRE+  N  L +       DK  P L+++  + + + DINDN P+F ++ Y+ E+ EN    T  +I+ +   D D G N  V Y I    N    + F ID+ +G I+  + +D EK   +   + A D+  +  + T+ + + ++D ND  P+F    YS  V EN+  +   I Q+   D D R  N  + Y  F  +  N + +      SG+L     +DRE      ++ITA +  S      +     + + ++DVNDN P F+
Sbjct: 1815 RADDGLQSSDMRINITVSDVNDHTPKFSRPVYSFD-IPEDTIPGSLVAAILATDDDSGVNGEITYIVNE----DDEDGIFFLNPITG---VFNLTRLLDYEVQQYYILTVRA----EDGGGQFTTIRVYFNILDVNDNPPIFSLNSYSTSLMENLPVGSTVLVFNVTDADDGINSQLTYSIASGDSLGQ------FTVD-----KNGVLKVLKALDRESQSF---YNLVVQVHDLPQIPASRFTSTAQVSIILLDVNDNPPTF--------LSPKLTYIPENTPIDTVVFKAQATDPDS-------GPNSY---IEYTLLN---PLGN--KFSIGTIDGEVRLTGELDREEVSNYTLTV----VATDKGQPSLSSSTEVVVMVLDINDNNPIFAQALYKVEINENTLTGT-DIIQ-VFAADGDEGTNGQVRYGI---VNGNTNQEFRIDSVTGAITVAKPLDREKTPTYHLTVQATDRGSTPRTDTSTVSIVLLDINDFVPVFELSPYSVNVPENLGTLPRTILQVVARD-DDRGSNSKLSYVLFGGNEDNAFTL----SASGELGVTQSLDRETKERFVLMITATDSGS----PALTGTGTINVIVDDVNDNVPTFA 2365          

HSP 7 Score: 146.747 bits (369), Expect = 1.022e-34
Identity = 182/711 (25.60%), Postives = 313/711 (44.02%), Query Frame = 2
Query:  440 ILIKVLDENDNSPKFLPFLNPYQTLPENSQINTVI--LLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKLVN-VISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITAINEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYE------KNKLFSFNIIAIDKD-QSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIFSLINPAKSSLIFTINKGFRHENCQMIPYAVSDADHDEPNSDSCCILQLDNDQNGMLYLLSNTPN-FLCLQNTMNTPGIYRVSLTATDNKNNPNKSLKAKVSFNIDVRHEVSDNP 2539
            + I VLD  DN P F      +    EN  +   +  +  S +DL+S         IS     G+      ++++     QL   + +DRE  S Y+  LK V        D     V I V D+NDN P F +   + N+VE+ +  + +      D DEG N  V  ++       K   K  F I+       G+I L+  +D     Y+    ++A+D G+P+LSS+  + + + + ND +PV       + +S  +T+ E+EP  +    +Q SD+DS          +  + + I   N     G + +  +     LDRE  +++Y+ + +  SD+  + PL+  + + + L D+NDN P+F  + Y     E   Q     +  +  +DKD G N  V Y  +  +       F + A SG+I++    D E         +FSF +IA D+     L   A + V++ D NDNAP F K  Y  T+ E+    T++ ++  +D+D    N  + ++     N  +   +D  SG++  IG +D E   + +++I A +  +      ++S C + I I D NDN P F      KS+L   + +  R      +  +V+  D D  ++          + +G   +  NT + FL  +    T  +Y++++TA D    P  S  + V   I VR + +DNP
Sbjct:  779 VTITVLDTQDNPPVFSQVAYSFVVF-ENVALGYHVGSVSASTMDLNS--------NISYLITTGDQKGMFAINQVTG---QLTTANVIDREEQSFYQ--LKVVASGGTVTGD---TMVNITVKDLNDNSPHFLQAIESVNVVENWQAGHSIFQAKAVDPDEGVNGMVLYSL-------KQNPKNLFAINEK----NGTISLLGPLDVHAGSYQ--IEILASDMGVPQLSSSVILTVYVHDVNDNSPVF------DQLSYEVTLSESEPVNSRFFKVQASDKDSGA--------NGEIAYTIAEGNTGDAFGIFPDGQLYIKSELDRE-LQDRYV-LMVVASDR-AVEPLSATVNVTVILEDVNDNRPLFNSTNYTFYFEEE--QRAGSFVGKVSAVDKDFGPNGEVRYSFEMVQPD-----FELHAISGEITNTHQFDRESLMRRRGTAVFSFTVIATDQGIPQPLKDQATVHVYMKDINDNAPKFLKDFYQATISESAANLTQVLRVSASDVDE--GNNGLIHYSIIKGNEERQFAIDSTSGQVTLIGKLDYEATPAYSLVIQAVDSGTIP----LNSTCTLNIDILDENDNTPSF-----PKSTLFVDVLENMR---IGELVSSVTATDSDSGDNADLYYSITGTNNHGTFSISPNTGSIFLAKKLDFETQSLYKLNITAKDQGRPPRSSTMSVV---IHVR-DFNDNP 1417          

HSP 8 Score: 146.747 bits (369), Expect = 1.076e-34
Identity = 182/668 (27.25%), Postives = 299/668 (44.76%), Query Frame = 2
Query:  422 KISSFYILIKVLDENDNSPKFLPFLNPYQTLPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDREND-DHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKLVNVI--SFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLI--ATDNGLPRLSSTAKVNIILINKND----QAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITAINEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIFSLINPAKSSLIFTINKGFRHENCQMIPYAVSDADHDEPNSD-------SCCILQLDNDQNGMLYLL 2377
            + S+  ++I V D NDN P F P  + ++++ EN  I T ++  +A D D++  G   Y I +    GN  HFT+ D++   +  +   + +DRE  + +   +KA D+    + R  +   V I V D+NDN P+F      A   + S ++  +  +    D DEG N ++   I    D     + R+          +G +R+   +     P +  +NLI  ATD G  R  ST ++ IIL   +     Q   I ++++GE +  ++   E    R   A ++       +  + C         E   +  +  +G +   II T   LDRE     YL +++Y  ++    P T    + I L DINDNPPVF        + ENI   + K+++ +  +D D G NA VTY I S  + +    F ID +SG + + + +D E+   +S  + A D  Q   SS   I + V D ND+ P F +P YSF + E+    + +  I  TD D+    +I    ++   +   +  ++  +G       +D E V+   IL     +   Q   +      V   I DVNDNPPIFSL N   +SL+  +  G       ++ + V+DAD D  NS           + Q   D+NG+L +L
Sbjct: 1400 RSSTMSVVIHVRDFNDNPPSFPPG-DIFKSIVENIPIGTSVISVTAHDPDADINGQLSYTIIQQMPRGN--HFTI-DEV---KGTIYTNAEIDREFANLFELTVKANDQAVPIETRRYALKNVTILVTDLNDNVPMFISQ--NALAADPSAVIGSVLTTIMAADPDEGANGEIEYEI-INGDTDTFIVDRY----------SGDLRVASAL----VPSQLIYNLIVSATDLGPERRKSTTELTIILQGLDGPVFTQPKYITILKEGEPIGTNVISIEAASPRGSEAPVEY-----YIVSVRC---------EEKTVGRLFTIGRHTG-IIQTAAILDREQGACLYL-VDVYAIEKSTAFPRTQRAEVEITLQDINDNPPVFPTDMLDLTVEENIGDGS-KIMQ-LTAMDADEGANALVTYTIISGADDS----FRIDPESGDLIATRRLDRERRSKYSLLVRADDGLQ---SSDMRINITVSDVNDHTPKFSRPVYSFDIPEDTIPGSLVAAILATDDDSGVNGEITYIVNEDDEDG--IFFLNPITGVFNLTRLLDYE-VQQYYILTVRAEDGGGQFTTI-----RVYFNILDVNDNPPIFSL-NSYSTSLMENLPVG-----STVLVFNVTDAD-DGINSQLTYSIASGDSLGQFTVDKNGVLKVL 2003          

HSP 9 Score: 145.206 bits (365), Expect = 3.193e-34
Identity = 173/619 (27.95%), Postives = 271/619 (43.78%), Query Frame = 2
Query:  428 SSFYILIKVLDENDNSPKFLPFLNPYQTLPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGN--DSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKLVNVIS-FYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYET-----NPYKYSFNLIATDNGLPR-LSSTAKVNIILINKNDQAP-VIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITAINEIHPLGHYKEFIINT-------LKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQV-----IHVDQNSGKLKTIGPIDREKVRSITILITARNEA------SYQNKNLMDSECMVIITIEDVNDNPPIF 2200
            SS  + + V D NDNSP F   L+   TL E+  +N+      A D DS A G   Y I++    GN  D+     D       QL + S LDRE+   Y  ++ A DR  +     + V V + + D+NDN P+F+ T YT    E  +  + +      D D G N +V  + E              Q DF    ++G I    + D E+         +SF +IATD G+P+ L   A V++ + + ND AP  +K   +  I         +E A  +   L+VS  D  V +    L    +++ I   NE       ++F I++       +  LD E      L I    S      PL +  T++I++ D NDN P F +S    +++EN+     +++  +   D D G NA + Y I  + N      F+I  ++G I   + +D+E   L+  NI A D+ +   SST  +++HV D NDN P FP      ++ EN+P+ T +  +   D D     ++      SYT   Q+       +D+  G + T   IDRE      + + A ++A       Y  KN       V I + D+NDN P+F
Sbjct:  978 SSVILTVYVHDVNDNSPVF-DQLSYEVTLSESEPVNSRFFKVQASDKDSGANGEIAYTIAE----GNTGDAFGIFPDG------QLYIKSELDRELQDRYVLMVVASDRAVEPLS--ATVNVTVILEDVNDNRPLFNSTNYTFYFEEEQRAGSFVGKVSAVDKDFGPNGEVRYSFE------------MVQPDFELHAISGEITNTHQFDRESLMRRRGTAVFSFTVIATDQGIPQPLKDQATVHVYMKDINDNAPKFLKDFYQATI---------SESAANLTQVLRVSASD--VDEGNNGL----IHYSIIKGNE------ERQFAIDSTSGQVTLIGKLDYEATPAYSLVIQAVDSGT---IPLNSTCTLNIDILDENDNTPSFPKSTLFVDVLENMRIG--ELVSSVTATDSDSGDNADLYYSITGTNNHGT---FSISPNTGSIFLAKKLDFETQSLYKLNITAKDQGRPPRSSTMSVVIHVRDFNDNPPSFPPGDIFKSIVENIPIGTSVISVTAHDPDADINGQL------SYTIIQQMPRGNHFTIDEVKGTIYTNAEIDREFANLFELTVKANDQAVPIETRRYALKN-------VTILVTDLNDNVPMF 1529          

HSP 10 Score: 142.51 bits (358), Expect = 2.475e-33
Identity = 156/578 (26.99%), Postives = 263/578 (45.50%), Query Frame = 2
Query:  428 SSFYILIKVLDENDNSPKFLPFLNPYQTLPENSQINTVILLPSAIDLDSEAFGIKYYKI---SKPFLIGNDSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKLVN-VISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYE-------TNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITAI--NEIHPLGHYK----EFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARN 2110
            +S  ++I +LDENDN+P+F    + +  +PENS +   +   +  D D     I  Y I   S PF I   +              +++  PL+RE    YR  + A    +D    +S  +V I V DINDN P F +T Y  +  E +++ + V   + TD DEG N QV   I+++++Y        F+I+ +    TG I     + Y+        N  ++SF + ++D G P L S   V I +++ ND AP                  +++    +  +++V  +   VT I+    D+ LN E+     N+ H LG +K       I+    L    D NQ   I +   D+    PL++  T+HI + + N + P F++S     + E+   +   ++  +   D+D   N  + Y I S     +   F I++ +G ++  +++DYE  +     I AID      +    + V+VID NDN+P+F    Y  TV EN P  T +  +  TD D+   N ++ Y  +S  ++  VI  D N+G + T G +D E  +S  + + A N
Sbjct: 2755 TSVKVMINILDENDNAPRFSQIFSAH--VPENSPLGYTVTRVTTSDEDIGINAISRYSIMDASLPFTINPSTG------------DIVISRPLNREDTDRYRIRVSA----HDSGWTVS-TDVTIFVTDINDNAPRFSRTSYYLDCPELTEIGSKVTQVFATDPDEGSNGQVFYFIKSQSEY--------FRINAT----TGEIFNKQILKYQNVTGFSNVNINRHSFIVTSSDRGKPSLISETTVTINIVDSNDNAP---------------QFLKSKYFTPVTKNVKVGTKLIRVTAIDDK--DFGLNSEVEYFISNDNH-LGKFKLDNDTGWISVASSL--ISDLNQNFFITVTAKDKGN-PPLSSQATVHITVTEENYHTPEFSQSHMSATIPES--HSIGSIVRTVSARDRDAAMNGLIKYSISSGN---EEGIFAINSSTGILTLAKALDYELCQKHEMTISAIDGGWVARTGYCSVTVNVIDVNDNSPVFLSDDYFPTVLENAPSGTTVIHLNATDADSG-TNAVIAYTVQSSDSDLFVI--DPNTGVITTQGFLDFETKQSYHLTVKAFN 3272          

HSP 11 Score: 142.124 bits (357), Expect = 2.740e-33
Identity = 164/611 (26.84%), Postives = 262/611 (42.88%), Query Frame = 2
Query:  428 SSFYILIKVLDENDNSPKFLPFLNPYQTLPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKLV--NVISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRS--ITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITAINEIHPLGHYKEFIIN-------TLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATV--KMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSST--ALIIVHVIDANDNAPIFPK---PHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEA--SYQNKNLMDSECMVIITIEDVNDNPPIF 2200
            SS  +++ VLD NDN+P F   L   + + EN+   T I+   A D D    G   Y I      GN +    +D +      + +  PLDRE    Y   ++A DR +    D S   V I + DIND  PVF+ + Y+ N+ E+   +   ++     D D G N ++S  +   N+         F +  S     G + +   +D ET   ++   + ATD+G P L+ T  +N+I+ + ND  P           S++   T+ E+ P  T V  +  SD D+    +                  I  +G   +F IN       T   LDRE   N  L +   CSD     PL+++ ++ + + D+NDNPP F    Y    + +IP  T+    +  +   D D G N+ + Y + S +NS   E F ID   G I +   ++      FS ++    KD  +   T    + V  ++  D    FPK      +F   EN PV++ +  I  + L   P    + Y+  S  N      +DQ +G++    P+D EK++   + I AR+     + +   +D      IT+ DVNDN PIF
Sbjct: 2136 SSTEVVVMVLDINDNNPIFAQALYKVE-INENTLTGTDIIQVFAADGDEGTNGQVRYGIVN----GNTNQEFRIDSVTGA---ITVAKPLDREKTPTYHLTVQATDRGSTPRTDTS--TVSIVLLDINDFVPVFELSPYSVNVPENLGTLPRTILQVVARDDDRGSNSKLSYVLFGGNE------DNAFTLSAS-----GELGVTQSLDRETKE-RFVLMITATDSGSPALTGTGTINVIVDDVNDNVPTF--------ASKAYFTTIPEDAPTGTDVLLVNASDADASKNAV------------------IRIIGGNSQFTINPSTGQIITSALLDRETKDNYTLVV--VCSDAGSPEPLSSSTSVLVTVTDVNDNPPRFQHHPY----VTHIPSPTLPGSFVFAVTVTDADIGPNSELHYSL-SGRNS---EKFHIDPLRGAIMAAGPLNGASEVTFSVHV----KDGGSFPKTDSTTVTVRFVNKAD----FPKVRAKEQTFMFPENQPVSSLVTTITGSSLRGEP----MSYYIAS-GNLGNTFQIDQLTGQVSISQPLDFEKIQKYVVWIEARDGGFPPFSSYEKLD------ITVLDVNDNAPIF 2669          

HSP 12 Score: 137.117 bits (344), Expect = 8.756e-32
Identity = 154/574 (26.83%), Postives = 266/574 (46.34%), Query Frame = 2
Query:  512 LPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVE-VEIKVGDINDNPPVFDKTFYTANIVEHSKLVNVISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDI-ECSLDDYHLNFEITAINEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLF--------SFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIFS 2203
             PEN  +++++   +   L  E   + YY  S     GN  +   +D++     Q+ +  PLD E I +Y   ++A D         S  E ++I V D+NDN P+F +  + + I+E+     +++    D D G N Q+   I   N           +  FS +  TG IR +  +D E   + Y   + ++D G P  S++ KV I ++++ND AP     R  +I S  +   EN P    V  +  SD D  +  I   S+ D  L F I             + +I+  +PL+RED     +++    S  D    ++T++TI +   DINDN P F+R+ Y  +  E + +   K+ + +   D D G N  V Y I S       EYF I+A +G+I ++Q + Y+    F        SF + + D+ + +L S   + ++++D+NDNAP F K  Y   V +NV V T++ ++   D      N  V+YF  S  N+     +D ++G +     +  +  ++  I +TA+++ +      + S+  V IT+ + N + P FS
Sbjct: 2576 FPENQPVSSLVTTITGSSLRGEP--MSYYIAS-----GNLGNTFQIDQLTG---QVSISQPLDFEKIQKYVVWIEARD---GGFPPFSSYEKLDITVLDVNDNAPIFKEDPFISEILENLSPRKILTVSAMDKDSGPNGQLDYEIVNGN----------MENSFSINHATGEIRSVRPLDREKVSH-YVLTIKSSDKGSPSQSTSVKVMINILDENDNAP-----RFSQIFSAHVP--ENSPLGYTVTRVTTSDEDIGINAISRYSIMDASLPFTINP--------STGDIVIS--RPLNREDTDRYRIRV----SAHDSGWTVSTDVTIFVT--DINDNAPRFSRTSYYLDCPE-LTEIGSKVTQ-VFATDPDEGSNGQVFYFIKSQS-----EYFRINATTGEIFNKQILKYQNVTGFSNVNINRHSFIVTSSDRGKPSLISETTVTINIVDSNDNAPQFLKSKYFTPVTKNVKVGTKLIRVTAIDDKDFGLNSEVEYF-ISNDNHLGKFKLDNDTGWISVASSLISDLNQNFFITVTAKDKGNPP----LSSQATVHITVTEENYHTPEFS 3090          

HSP 13 Score: 130.568 bits (327), Expect = 8.991e-30
Identity = 161/606 (26.57%), Postives = 269/606 (44.39%), Query Frame = 2
Query:  410 DSGI--KISSFYILIKVLDENDNSPKFLPFLNPYQTLPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKLVNVI-SFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIE--CSLDDYHLNFEITAINEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIFSLIN 2212
            D G+  K+S   +++ +LD ND  P F        ++ EN+   T +L+  A D D    G   + + +      D     LD + SGR  L  IS LDRE  + Y  ++ A D  +     ++ + V +   DINDN PVF    Y A+I E+    + I +   TD D G N  V  +I   +       +  FQ++    ++  S R+  + + +T    Y   ++ATD G  +  + A V I +++  D  PV         V+ S  +FEN      V S+  S  D L ++I    +  D    F   AIN++   G      + T   +DRE+     LK+            +T +  ++I + D+NDN P F ++     ++EN  QA   + +    +D D G N  V Y +  +  +     F I+  +G IS    +D      +   I+A D     LSS+ ++ V+V D NDN+P+F +  Y  T+ E+ PVN+   +++ +D D+    +I     +  T +   I  D   G+L     +DRE      +++ A + A       + +   V + +EDVNDN P+F+  N
Sbjct:  556 DQGVHPKVSYAQLVVTLLDVNDEKPVFSQPEGYDVSVVENAPTGTELLMLRATDGDLGDNGTVRFSLQE---AETDRRSFRLDPV-SGR--LSTISSLDREEQAFYSLLVLATDLGSPPQSSMARINVSLL--DINDNSPVFYPVQYFAHIKENEPGGSYITTVSATDPDLGTNGTVKYSISAGD-------RSRFQVNAQSGVI--STRMALDREEKT---AYQLQIVATDGGNLQSPNQAIVTITVLDTQDNPPVFSQ------VAYSFVVFENVALGYHVGSVSASTMD-LNSNISYLITTGDQKGMF---AINQV--TGQ-----LTTANVIDREEQSFYQLKVVASGGT------VTGDTMVNITVKDLNDNSPHFLQAIESVNVVENW-QAGHSIFQ-AKAVDPDEGVNGMVLYSLKQNPKN----LFAINEKNGTISLLGPLDVHAGS-YQIEILASDMGVPQLSSSVILTVYVHDVNDNSPVFDQLSYEVTLSESEPVNSRFFKVQASDKDSGANGEIAYTIAEGNTGDAFGIFPD---GQLYIKSELDRELQDRYVLMVVASDRA----VEPLSATVNVTVILEDVNDNRPLFNSTN 1104          

HSP 14 Score: 118.627 bits (296), Expect = 4.223e-26
Identity = 155/596 (26.01%), Postives = 260/596 (43.62%), Query Frame = 2
Query:  440 ILIKVLDENDNSPKFLPFLNPYQTLPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHS-KLVNVISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLP--RLSSTAKVNIILINKNDQAPVIKVIRKGEIVSR--SITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITAINEIHPLGHYKEFIINTLKPLDREDDKNQYLKI------NIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKN-AYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNP 2191
            + I V +EN ++P+F    +   T+PE+  I +++   SA D D+   G+  Y IS     GN+     +  I S    L L   LD E+  ++   + A+D           V V +   D+NDN PVF    Y   ++E++     VI    TD D G N  ++ T+++ +          F ID +    TG I     +D+ET   K S++L      +P     S A VNI L   N+  P          VS+     + E  P  TIV  +  SDRD L TD E     ++L F  +            +  ++ +  LDRE ++   LK+      +I  +D D++T       +++ + D ND PP+FT + Y  ++ E +P  T   +  +   D D   + +  +Y I S   +     F+I+  +G+I+    +D E   +++ +++A+D    + + +A ++V + D NDN P+         V EN    T +  +++TD D  P      Y+  S         +   +G L T   IDRE++    + +  ++    Q    M S   V IT+ D NDNP
Sbjct: 3075 VHITVTEENYHTPEFSQS-HMSATIPESHSIGSIVRTVSARDRDAAMNGLIKYSISS----GNEEG---IFAINSSTGILTLAKALDYELCQKHEMTISAIDGGWVARTGYCSVTVNVI--DVNDNSPVFLSDDYFPTVLENAPSGTTVIHLNATDADSGTNAVIAYTVQSSD-------SDLFVIDPN----TGVITTQGFLDFET---KQSYHLTVKAFNVPDEERCSFATVNIQLKGTNEYVP--------RFVSKLYYFEISEAAPKGTIVGEVFASDRD-LGTDGEV----HYLIFGNSRKKGFQINKKTGQIYVSGI--LDREKEERVSLKVLAKNFGSIRGADIDEVT-------VNVTVLDAND-PPIFTLNIYSVQISEGVPIGT--HVTFVSAFDSDSIPSWSRFSYFIGSGNENG---AFSINPQTGQITVTAELDRETLPIYNLSVLAVDSGTPSATGSASLLVTLEDINDNGPMLTVSEGE--VMENKRPGTLVMTLQSTDPDLPPNQGPFTYYLLSTGPATSYFSL-STAGVLSTTREIDREQIADFYLSVVTKDSGVPQ----MSSTGTVHITVIDQNDNP 3611          

HSP 15 Score: 117.857 bits (294), Expect = 8.036e-26
Identity = 180/666 (27.03%), Postives = 284/666 (42.64%), Query Frame = 2
Query:  245 IDNRLSVVSNIDRESICPIKNSLNDYDQSAETYNSQQSSHSCKYDECCTVFSFQVDSGIKISSFYILIKVLDENDNSPKFLP---FLNPYQTLPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLIS---PLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKL---VNVISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAP-VIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIEC-SLDDYHLNFEITAINEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKV--RSITILITARNEASYQN-KNLMDSECMVIITIEDVNDNPPIF 2200
            +  RLS +S++DRE                     +Q+ +S        V +  + S  + S   I + +LD NDNSP F P   F +  +  P  S I TV    SA D D    G   Y IS     G+ S F +         Q  +IS    LDRE  + Y+  + A D  N   +  +   V I V D  DNPPVF +  Y+  + E+  L   V  +S    DL    N  +S  I T      DQ K  F I+     +TG +   + ID E   + Y   ++A+      ++    VNI + + ND +P  ++ I        S+ + EN  A   +   +  D D  V  +   SL     N  + AINE       K   I+ L PLD      Q   I I  SD   +  L++++ + + + D+NDN PVF +  Y+  L E+ P  +      +   DKD G N  + Y I +  N+ D   F I  D G++  +  +D E    +   ++A D+    LS+T  + V + D NDN P+F   +Y+F   E     + +G++   D D  P N  V+Y  +    ++++  +   SG++      DRE +  R  T + +    A+ Q     +  +  V + ++D+NDN P F
Sbjct:  637 VSGRLSTISSLDRE---------------------EQAFYSL------LVLATDLGSPPQSSMARINVSLLDINDNSPVFYPVQYFAHIKENEPGGSYITTV----SATDPDLGTNGTVKYSISA----GDRSRFQV-------NAQSGVISTRMALDREEKTAYQLQIVATDGGN--LQSPNQAIVTITVLDTQDNPPVFSQVAYSFVVFENVALGYHVGSVSASTMDL----NSNISYLITT-----GDQ-KGMFAIN----QVTGQLTTANVIDREEQSF-YQLKVVASGG---TVTGDTMVNITVKDLNDNSPHFLQAI-------ESVNVVENWQAGHSIFQAKAVDPDEGVNGMVLYSLKQNPKN--LFAINE-------KNGTISLLGPLDVHAGSYQ---IEILASDM-GVPQLSSSVILTVYVHDVNDNSPVFDQLSYEVTLSESEPVNS--RFFKVQASDKDSGANGEIAYTI-AEGNTGD--AFGIFPD-GQLYIKSELDRELQDRYVLMVVASDRAVEPLSATVNVTVILEDVNDNRPLFNSTNYTFYFEEEQRAGSFVGKVSAVDKDFGP-NGEVRYSFEMVQPDFELHAI---SGEITNTHQFDRESLMRRRGTAVFSFTVIATDQGIPQPLKDQATVHVYMKDINDNAPKF 1210          

HSP 16 Score: 112.079 bits (279), Expect = 4.216e-24
Identity = 145/604 (24.01%), Postives = 261/604 (43.21%), Query Frame = 2
Query:  425 ISSFYILIKVLDENDNSPKFLP--FLNPYQTLPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKLVNVI-SFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSI--TMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITAINEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIY-CSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTAL----IIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIFSL 2206
            IS   + I ++D NDN+P+FL   +  P   + +N ++ T ++  +AID   + FG+        + I ND+H     K+ +    + + S L  ++   +   + A D+ N      S   V I V + N + P F ++  +A I E   + +++ +    D D   N  +  +I + N+      +  F I+ S    TG + L   +DYE    K+   + A D G    +    V + +I+ ND +PV         +S     T+ EN P+ T V  L  +D DS    +      Y +    + +  I P       +I T   LD E  ++ +L +  +   D+++ +  T N    I L   N+  P F    Y  E+ E  P+ T+  +  +   D+D G +  V Y I  +      + F I+  +G+I     +D EK +  S  ++A  K+  ++    +    + V V+DAND  PIF    YS  + E VP+ T +  +   D D+ P      YF  S   N     ++  +G++     +DRE +    + + A +  +            +++T+ED+NDN P+ ++
Sbjct: 2964 ISETTVTINIVDSNDNAPQFLKSKYFTP---VTKNVKVGTKLIRVTAID--DKDFGLNS---EVEYFISNDNHLGKF-KLDNDTGWISVASSLISDLNQNFFITVTAKDKGNPPLS--SQATVHITVTEENYHTPEFSQSHMSATIPESHSIGSIVRTVSARDRDAAMNGLIKYSISSGNE------EGIFAINSS----TGILTLAKALDYELC-QKHEMTISAIDGGWVARTGYCSVTVNVIDVNDNSPVF--------LSDDYFPTVLENAPSGTTVIHLNATDADSGTNAVIA----YTVQSSDSDLFVIDP----NTGVITTQGFLDFETKQSYHLTVKAFNVPDEERCSFATVN----IQLKGTNEYVPRFVSKLYYFEISEAAPKGTI--VGEVFASDRDLGTDGEVHYLIFGNSRK---KGFQINKKTGQIYVSGILDREKEERVSLKVLA--KNFGSIRGADIDEVTVNVTVLDAND-PPIFTLNIYSVQISEGVPIGTHVTFVSAFDSDSIPSWSRFSYFIGSGNEN-GAFSINPQTGQITVTAELDRETLPIYNLSVLAVDSGTPS----ATGSASLLVTLEDINDNGPMLTV 3512          

HSP 17 Score: 110.538 bits (275), Expect = 1.390e-23
Identity = 160/605 (26.45%), Postives = 266/605 (43.97%), Query Frame = 2
Query:  446 IKVLDENDNSPKFL--PFLNPYQTLPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGN-DSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKLVNVISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQID----FSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAP-------VIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITAINEIHPLGHYKEFIINTLKPLDREDDKNQYLKINI-----YCSDQDKLTP-LTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIF 2200
            I VLD NDN+P F   PF++    + EN     ++ + SA+D DS   G   Y+I      GN ++ F++    A+G  ++  + PLDRE +S Y   +K+ D+ +      + V+V I + D NDN P F + F +A++ E+S L   ++  VT  DE              D   + I R+  +D    F+ +  TG I +   ++ E +  +Y   + A D+G    + +  V I + + ND AP        +      EI S+   +F  +P           D  S          +  + + I + +E   +      I N  K + +  +   +  +NI       +  D+  P L +  T+ IN+ D NDN P F +SKY   + +N+   T K+I      DKD G N+ V Y I    N      F +D D+G IS   S+  + N+ F   + A DK    LSS A + + V + N + P F + H S T+ E+  + + +  +   D D    N ++KY   S  N   +  ++ ++G L     +D E  +   + I+A +             C V + + DVNDN P+F
Sbjct: 2657 ITVLDVNDNAPIFKEDPFIS---EILENLSPRKILTV-SAMDKDSGPNGQLDYEIVN----GNMENSFSI--NHATG--EIRSVRPLDREKVSHYVLTIKSSDKGSPSQS--TSVKVMINILDENDNAPRFSQIF-SAHVPENSPLGYTVT-RVTTSDE--------------DIGINAISRYSIMDASLPFTINPSTGDIVISRPLNRE-DTDRYRIRVSAHDSGW---TVSTDVTIFVTDINDNAPRFSRTSYYLDCPELTEIGSKVTQVFATDP-----------DEGS----------NGQVFYFIKSQSEYFRINATTGEIFN--KQILKYQNVTGFSNVNINRHSFIVTSSDRGKPSLISETTVTINIVDSNDNAPQFLKSKYFTPVTKNVKVGT-KLIRVTAIDDKDFGLNSEVEYFI---SNDNHLGKFKLDNDTGWISVASSLISDLNQNFFITVTAKDKGNPPLSSQATVHITVTEENYHTPEFSQSHMSATIPESHSIGSIVRTVSARDRDAA-MNGLIKY-SISSGNEEGIFAINSSTGILTLAKALDYELCQKHEMTISAIDGGWVARTGY----CSVTVNVIDVNDNSPVF 3194          

HSP 18 Score: 100.908 bits (250), Expect = 1.223e-20
Identity = 78/300 (26.00%), Postives = 141/300 (47.00%), Query Frame = 2
Query: 1349 IHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTN-LTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPI-----FPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENK--IVKYFHKSYTNNYQVIHVD-QNSGKLKTIGPIDREKVRSITILIT------ARNEASYQNKNLMDSECMVIITIEDVNDNPPIFS 2203
            ++P G      + +   LDRE      L + +    +DK  P     L +++ + DINDNPPVF  S YQ  + E+        +  +   D D G NA + Y++           F +D ++G I+ R+ +D+E  + +S  + A+D+   +L+  A  ++ ++D NDN P+     FP      +V EN  V T +  +  TD D+   N    V+    +   +++V      N   +K    +DRE++ S  + ++      A   A+ Q ++ + S   ++I + D+ND+PP+FS
Sbjct:  191 LNPSGEGAFLHLVSKGGLDREVTPQYQLLVEV----EDKGEPKRRGYLQVNVTVQDINDNPPVFGSSHYQAGVPED--AVVGSSVLQVAAADADEGTNADIRYRLQDEGTP-----FQMDPETGLITVREPLDFEARRQYSLTVQAMDRGVPSLTGRAEALIQLLDVNDNDPVVKFRYFPATSRYASVDENAQVGTVVALLTVTDADSPAANGNISVQILGGNEQRHFEVQSSKVPNLSLIKVASALDRERIPSYNLTVSVSDNYGAPPGAAVQARSSVAS---LVIFVNDINDHPPVFS 476          

HSP 19 Score: 94.3597 bits (233), Expect = 1.040e-18
Identity = 160/621 (25.76%), Postives = 265/621 (42.67%), Query Frame = 2
Query:  440 ILIKVLDENDNSPKFLPFLNPYQT-LPEN-SQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGN-DSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKL-VNVISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPR-LSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDR---DSLVTDIECSLDDYHLNFEITAIN----EIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELI-ENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKI-VKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPP----IFSLINPAKSSLIFTINK 2248
            + I +LD ND  P F   L+PY   +PEN   +   IL   A D D  +      K+S     GN D+ FTL    ASG  +L +   LDRE  ++ RF+L     ++          + + V D+NDN P F    Y   I E +    +V+    +D D  +N  + I            I    Q   +PS  TG I     +D ET    Y+  ++ +D G P  LSS+  V + + + ND  P                 F++ P  T + S  +         VTD +   +   L++ ++  N     I PL       I    PL+   +    +  +++  D     P T + T+ +   +  D P V  R+K Q  +  EN P +++     + T+     +   ++Y I S         F ID  +G++S  Q +D+EK + +   I A D      SS   + + V+D NDNAPIF +  +   + EN+    +I  +   D D+ P  ++  +  + +  N++ + H    +G+++++ P+DREKV    + I + ++ S        +   V+I I D NDN P    IFS   P  S L +T+ +
Sbjct: 2245 VSIVLLDINDFVPVFE--LSPYSVNVPENLGTLPRTILQVVARDDDRGS----NSKLSYVLFGGNEDNAFTLS---ASG--ELGVTQSLDRE--TKERFVLMITATDSGSPALTGTGTINVIVDDVNDNVPTFASKAYFTTIPEDAPTGTDVLLVNASDADASKNAVIRI------------IGGNSQFTINPS--TGQIITSALLDRETKD-NYTLVVVCSDAGSPEPLSSSTSVLVTVTDVNDNPP----------------RFQHHPYVTHIPSPTLPGSFVFAVTVTDADIGPNS-ELHYSLSGRNSEKFHIDPL----RGAIMAAGPLNGASE----VTFSVHVKDGGSF-PKTDSTTVTVRFVNKADFPKV--RAKEQTFMFPENQPVSSL-----VTTITGSSLRGEPMSYYIASGNLGNT---FQIDQLTGQVSISQPLDFEKIQKYVVWIEARDGGFPPFSSYEKLDITVLDVNDNAPIFKEDPFISEILENLSPR-KILTVSAMDKDSGPNGQLDYEIVNGNMENSFSINHA---TGEIRSVRPLDREKVSHYVLTIKSSDKGSPSQS----TSVKVMINILDENDNAPRFSQIFSAHVPENSPLGYTVTR 2793          

HSP 20 Score: 86.2705 bits (212), Expect = 3.213e-16
Identity = 128/506 (25.30%), Postives = 205/506 (40.51%), Query Frame = 2
Query:  782 EVEIKVGDINDNPPVF-DKTFYTANIVEHSKLVNVISFYVTDLDEGQNKQVSITIETENDYKKDQIKRF-FQIDFSPSLMTGSIRLIDE--IDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVAS--LQVSDRDS---LVTDIECSLDDYHLNFEITAINEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTP-LTTNLTIHINLFDINDNPPV-----FTRSKYQGELIENIPQATVKMIEPILTL-DKDH-GKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSID----YEKNKLFSFNIIAIDKDQSNL---------SSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKT--IGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIFS 2203
            EV + V D+NDN PVF D +       + S    VI    TD D G N    +   +    + ++  RF   I  +PS     + L+ +  +D E  P +Y   +   D G P+     +VN+ + + ND  PV            S       P   +V S  LQV+  D+      DI   L D    F++            +  +I   +PLD E  +   L +       D+  P LT      I L D+NDN PV     F  +     + EN   A V  +  +LT+ D D    N  ++ +I        +E       S K+ +   I      ++ ++ S+N+     D             SS A +++ V D ND+ P+F +  Y   + E  P  + +  I  TD D+   N  ++Y   S  N     H+ ++SG + T   G +DRE    I + I+AR++  +       S   +++T+ DVND  P+FS
Sbjct:  120 EVRVLVRDLNDNAPVFPDPSIVVTFKEDSSSGRQVILDTATDSDIGSN---GVDHRSYRIIRGNEAGRFRLDITLNPSGEGAFLHLVSKGGLDREVTP-QYQLLVEVEDKGEPKRRGYLQVNVTVQDINDNPPVFG----------SSHYQAGVPEDAVVGSSVLQVAAADADEGTNADIRYRLQDEGTPFQMDP----------ETGLITVREPLDFEARRQYSLTVQA----MDRGVPSLTGRAEALIQLLDVNDNDPVVKFRYFPATSRYASVDEN---AQVGTVVALLTVTDADSPAANGNISVQILGGNEQRHFE-----VQSSKVPNLSLIKVASALDRERIPSYNLTVSVSDNYGAPPGAAVQARSSVASLVIFVNDINDHPPVFSQQVYRVNLSEEAPPGSYVSGISATDGDSG-LNANLRYSIVS-GNGLGWFHISEHSGLVTTGSSGGLDRELASQIVLNISARDQGVHPKV----SYAQLVVTLLDVNDEKPVFS 583          
BLAST of Protocadherin Fat 1 vs. Ensembl Human
Match: CELSR2 (cadherin EGF LAG seven-pass G-type receptor 2 [Source:HGNC Symbol;Acc:HGNC:3231])

HSP 1 Score: 184.111 bits (466), Expect = 2.707e-46
Identity = 166/599 (27.71%), Postives = 280/599 (46.74%), Query Frame = 2
Query:  410 DSGIKISSFYILIKVLDENDNSPKFLPFLNPYQTLPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKL-VNVISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDS-LVTDIECSLDDYHLNFEITAINEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIF 2200
            D G + ++  + + V D+NDN+P+F       Q + E+      +L  +A D D  +  + +Y I    + GN      LD        L ++SPLD E   EY   ++A D       ++SG+ V ++V DINDN P+F  T + A ++E   L   V+     D D G N ++        +Y+   +   F   F+ +  TG I +  E+D E   + YSF + A D+G P L+++A V++ +++ ND  P             ++ + E+    T V ++   DRD+  V   + +  +    F IT+             +++   PLD + ++ QY+ + +  SD  +         I +N+ D N + PVF  S Y   + E+ P  T  ++  I   D+D G+NA +TY ++ S        F IDAD+G ++++  +DYE    ++  I A D      S T  + + V D NDNAP F +  Y  +V E+VP  T + QI  TD D+    ++   F      +   I V+  SG ++T+  +DRE V    +   A ++     +  M+    V +T+ DVNDNPP+F
Sbjct:  375 DPGPRSTTAAVFLSVEDDNDNAPQFSEKRYVVQ-VREDVTPGAPVLRVTASDRDKGSNAVVHYSI----MSGNARGQFYLDAQTGA---LDVVSPLDYETTKEYTLRVRAQDGGRPPLSNVSGL-VTVQVLDINDNAPIFVSTPFQATVLESVPLGYLVLHVQAIDADAGDNARL--------EYRLAGVGHDFP--FTINNGTGWISVAAELDREEVDF-YSFGVEARDHGTPALTASASVSVTVLDVNDNNPTFTQ------PEYTVRLNEDAAVGTSVVTVSAVDRDAHSVITYQITSGNTRNRFSITS--------QSGGGLVSLALPLDYKLER-QYV-LAVTASDGTR----QDTAQIVVNVTDANTHRPVFQSSHYTVNVNEDRPAGTTVVL--ISATDEDTGENARITYFMEDSIPQ-----FRIDADTGAVTTQAELDYEDQVSYTLAITARDNGIPQKSDTTYLEILVNDVNDNAPQFLRDSYQGSVYEDVPPFTSVLQISATDRDSGLNGRVFYTFQGGDDGDGDFI-VESTSGIVRTLRRLDRENVAQYVLRAYAVDKGMPPARTPME----VTVTVLDVNDNPPVF 921          

HSP 2 Score: 162.925 bits (411), Expect = 9.158e-40
Identity = 162/603 (26.87%), Postives = 272/603 (45.11%), Query Frame = 2
Query:  440 ILIKVLDENDNSPKFLPFLNPY-QTLPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEH-SKLVNVISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAK-VNIILINKNDQAPVIKVIRKGEIVSRSI--TMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITAINEIHPLGHYKEFIIN-------TLKPLDREDDKNQYLKINIY---CSDQDKLTP-LTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIF 2200
            + I V D ND+ P F      Y ++L EN ++   +L   A D D+       Y++    L G+    + + +I      +    P+DRE +  Y+  ++A D+  D     +   V + V D NDN P F +  Y   + E  +    V+    +D D+G N  V  +I + N   +      F +D      TG++ ++  +DYET   +Y+  + A D G P LS+ +  V + +++ ND AP+         VS     T+ E+ P   +V  +Q  D D        + D+  L + +  +      GH   F IN           LDRE+       ++ Y      +D  TP LT + ++ + + D+NDN P FT+ +Y   L E+    T   +  +  +D+D   ++ +TY+I +S N+ +    T  +  G +S    +DY+  + +   + A D  + +   TA I+V+V DAN + P+F   HY+  V E+ P  T +  I  TD DT  EN  + YF +     ++   +D ++G + T   +D E   S T+ ITAR+    Q  +    E    I + DVNDN P F
Sbjct:  275 LTILVTDTNDHDPVFEQ--QEYKESLRENLEVGYEVLTVRATDGDAPPNANILYRL----LEGSGGSPSEVFEIDPRSGVIRTRGPVDREEVESYQLTVEASDQGRDPGPRSTTAAVFLSVEDDNDNAPQFSEKRYVVQVREDVTPGAPVLRVTASDRDKGSNAVVHYSIMSGNARGQ------FYLD----AQTGALDVVSPLDYETTK-EYTLRVRAQDGGRPPLSNVSGLVTVQVLDINDNAPI--------FVSTPFQATVLESVPLGYLVLHVQAIDAD--------AGDNARLEYRLAGV------GHDFPFTINNGTGWISVAAELDREE-------VDFYSFGVEARDHGTPALTASASVSVTVLDVNDNNPTFTQPEYTVRLNEDAAVGT--SVVTVSAVDRD--AHSVITYQI-TSGNTRNRFSITSQSGGGLVSLALPLDYKLERQYVLAVTASDGTRQD---TAQIVVNVTDANTHRPVFQSSHYTVNVNEDRPAGTTVVLISATDEDT-GENARITYFMEDSIPQFR---IDADTGAVTTQAELDYEDQVSYTLAITARDNGIPQKSDTTYLE----ILVNDVNDNAPQF 815          

HSP 3 Score: 146.362 bits (368), Expect = 1.153e-34
Identity = 148/599 (24.71%), Postives = 265/599 (44.24%), Query Frame = 2
Query:  440 ILIKVLDENDNSPKFLPFLNPYQ-TLPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKL-VNVISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGS--IRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDS-----LVTDIECSLDDYHLNFEITAINEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPL---TTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIF 2200
            + ++VLD NDN+P F+    P+Q T+ E+  +  ++L   AID D+       Y+++    +G+D  FT    I +G   + + + LDRE +  Y F ++A  R++      +   V + V D+NDN P F +  YT  + E + +  +V++  V+ +D   +  ++  I + N   +          FS +  +G   + L   +DY+    +Y   + A+D        TA++ + + + N   PV +          ++ + E+ PA T V  +  +D D+     +   +E S+  + ++ +  A+               T   LD ED  +  L I    + +D   P    TT L I +N  D+NDN P F R  YQG + E++P  T   +  I   D+D G N  V Y      +      F +++ SG + + + +D E    +     A+DK      +   + V V+D NDN P+F +  +   V EN P+   + ++  TD D     +I+  +     N  +V  +D  SG+L  +  +D E      ++I A +         + S   V + + D NDNPP+ 
Sbjct:  491 VTVQVLDINDNAPIFVS--TPFQATVLESVPLGYLVLHVQAIDADAGDNARLEYRLAG---VGHDFPFT----INNGTGWISVAAELDREEVDFYSFGVEA--RDHGTPALTASASVSVTVLDVNDNNPTFTQPEYTVRLNEDAAVGTSVVT--VSAVDRDAHSVITYQITSGNTRNR----------FSITSQSGGGLVSLALPLDYKLE-RQYVLAVTASDG---TRQDTAQIVVNVTDANTHRPVFQS------SHYTVNVNEDRPAGTTVVLISATDEDTGENARITYFMEDSIPQFRIDADTGAVT--------------TQAELDYEDQVSYTLAI----TARDNGIPQKSDTTYLEILVN--DVNDNAPQFLRDSYQGSVYEDVPPFT--SVLQISATDRDSGLNGRVFYTFQGGDDGD--GDFIVESTSGIVRTLRRLDRENVAQYVLRAYAVDKGMPPARTPMEVTVTVLDVNDNPPVFEQDEFDVFVEENSPIGLAVARVTATDPDEGTNAQIM--YQIVEGNIPEVFQLDIFSGELTALVDLDYEDRPEYVLVIQATSAP-------LVSRATVHVRLLDRNDNPPVL 1023          

HSP 4 Score: 146.362 bits (368), Expect = 1.333e-34
Identity = 129/474 (27.22%), Postives = 225/474 (47.47%), Query Frame = 2
Query:  812 DNPPVFDKTFYTANIVEHSKL-VNVISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDS------LVTDIECSLDDYHLNFEITAINEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDK-LTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENI-PQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSS-TALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIFS 2203
            +  P F    Y A + E+      V S    D DEG+  ++  T++   D + +Q   FF +D  P  +TG++   +E+D ET    + F + A D+G+PR S+ A + I++ + ND  PV +     E      ++ EN      V +++ +D D+      L   +E S          + + EI P    +  +I T  P+DRE+ ++  L +    SDQ +   P +T   + +++ D NDN P F+  +Y  ++ E++ P A V  +      D+D G NA V Y I S         F +DA +G +     +DYE  K ++  + A D  +  LS+ + L+ V V+D NDNAPIF    +  TV E+VP+   +  ++  D D   +N  ++Y      +++    ++  +G +     +DRE+V   +  + AR+  +      + +   V +T+ DVNDN P F+
Sbjct:  176 NTAPQFQPPSYQATVPENQPAGTPVASLRAIDPDEGEAGRLEYTMDALFDSRSNQ---FFSLD--P--VTGAVTTAEELDRETKS-THVFRVTAQDHGMPRRSALATLTILVTDTNDHDPVFEQQEYKE------SLRENLEVGYEVLTVRATDGDAPPNANILYRLLEGS------GGSPSEVFEIDP----RSGVIRTRGPVDREEVESYQLTVE--ASDQGRDPGPRSTTAAVFLSVEDDNDNAPQFSEKRYVVQVREDVTPGAPVLRVT---ASDRDKGSNAVVHYSIMSGNARGQ---FYLDAQTGALDVVSPLDYETTKEYTLRVRAQDGGRPPLSNVSGLVTVQVLDINDNAPIFVSTPFQATVLESVPLGYLVLHVQAIDADA-GDNARLEYRLAGVGHDFPFT-INNGTGWISVAAELDREEVDFYSFGVEARDHGT----PALTASASVSVTVLDVNDNNPTFT 611          

HSP 5 Score: 137.887 bits (346), Expect = 5.732e-32
Identity = 149/590 (25.25%), Postives = 262/590 (44.41%), Query Frame = 2
Query:  467 DNSPKFLPFLNPYQ-TLPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKL-VNVISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGL---PRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITAINEIHPLGHY----KEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLT--IHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIG-PIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIF 2200
            + +P+F P    YQ T+PEN    T +    AID D    G   Y +   F   ++  F+ LD +      +     LDRE  S + F + A D  +   R  +   + I V D ND+ PVF++  Y  ++ E+ ++   V++   TD D   N  +   +   +     ++   F+ID  P   +G IR    +D E     Y   + A+D G    PR S+TA V + + + ND AP     R    V   +T     P   + A    SDRD     +        +++ I + N     G +    +   ++ + PLD E  K   L++      QD   P  +N++  + + + DINDN P+F  + +Q  ++E++P     ++  +  +D D G NA + Y++    +      FTI+  +G IS    +D E+   +SF + A D     L+++A + V V+D NDN P F +P Y+  + E+  V T +  +   D D    + ++ Y   S     +     Q+ G L ++  P+D +  R   + +TA ++ + Q+         +++ + D N + P+F
Sbjct:  176 NTAPQFQP--PSYQATVPENQPAGTPVASLRAIDPDEGEAGRLEYTMDALFDSRSNQFFS-LDPVTGA---VTTAEELDRETKSTHVFRVTAQD--HGMPRRSALATLTILVTDTNDHDPVFEQQEYKESLRENLEVGYEVLTVRATDGDAPPNANILYRLLEGSGGSPSEV---FEID--PR--SGVIRTRGPVDRE-EVESYQLTVEASDQGRDPGPR-STTAAVFLSVEDDNDNAPQFSEKRYVVQVREDVT--PGAPVLRVTA----SDRDKGSNAV--------VHYSIMSGN---ARGQFYLDAQTGALDVVSPLDYETTKEYTLRVRA----QDGGRPPLSNVSGLVTVQVLDINDNAPIFVSTPFQATVLESVPLGY--LVLHVQAIDADAGDNARLEYRLAGVGHDFP---FTINNGTGWISVAAELDREEVDFYSFGVEARDHGTPALTASASVSVTVLDVNDNNPTFTQPEYTVRLNEDAAVGTSVVTVSAVDRDA---HSVITYQITSGNTRNRFSITSQSGGGLVSLALPLDYKLERQYVLAVTA-SDGTRQDT------AQIVVNVTDANTHRPVF 712          

HSP 6 Score: 117.087 bits (292), Expect = 1.091e-25
Identity = 103/385 (26.75%), Postives = 176/385 (45.71%), Query Frame = 2
Query: 1202 SRSITMFENEPARTIVASLQVSDRDS-LVTDIECSLDDYHLNFEITAINEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNL-TIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAID--KDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIFSLINPAKSSLIFTINKGFRHENCQMI----------PYAVSDADHDEP 2314
            S   T+ EN+PA T VASL+  D D      +E ++D    +        + P+       + T + LDRE       ++    + QD   P  + L T+ I + D ND+ PVF + +Y+  L EN+       +  +   D D   NA + Y++      +  E F ID  SG I +R  +D E+ + +   + A D  +D    S+TA + + V D NDNAP F +  Y   VRE+V     + ++  +D D +  N +V Y   S     Q  ++D  +G L  + P+D E  +  T+ + A++        L +   +V + + D+NDN PIF +  P +++++ ++  G+   + Q I           Y ++   HD P
Sbjct:  185 SYQATVPENQPAGTPVASLRAIDPDEGEAGRLEYTMDAL-FDSRSNQFFSLDPVTG----AVTTAEELDRETKSTHVFRV----TAQDHGMPRRSALATLTILVTDTNDHDPVFEQQEYKESLRENLEVGY--EVLTVRATDGDAPPNANILYRLLEGSGGSPSEVFEIDPRSGVIRTRGPVDREEVESYQLTVEASDQGRDPGPRSTTAAVFLSVEDDNDNAPQFSEKRYVVQVREDVTPGAPVLRVTASDRD-KGSNAVVHYSIMSGNARGQ-FYLDAQTGALDVVSPLDYETTKEYTLRVRAQDGG---RPPLSNVSGLVTVQVLDINDNAPIF-VSTPFQATVLESVPLGYLVLHVQAIDADAGDNARLEYRLAGVGHDFP 552          

HSP 7 Score: 87.4261 bits (215), Expect = 1.337e-16
Identity = 84/259 (32.43%), Postives = 130/259 (50.19%), Query Frame = 2
Query:  410 DSGI--KISSFYILIKVLDENDNSPKFLPFLNPYQ-TLPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKL-VNVISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVI 1174
            D+GI  K  + Y+ I V D NDN+P+FL   + YQ ++ E+    T +L  SA D DS   G  +Y     F  G+D     + +  SG  + L    LDRE +++Y     AVD+     R  + +EV + V D+NDNPPVF++  +   + E+S + + V     TD DEG N Q+   I   N      I   FQ+D    + +G +  + ++DYE  P    + L+      P L S A V++ L+++ND  PV+
Sbjct:  789 DNGIPQKSDTTYLEILVNDVNDNAPQFLR--DSYQGSVYEDVPPFTSVLQISATDRDSGLNGRVFYT----FQGGDDGDGDFIVESTSGIVRTL--RRLDRENVAQYVLRAYAVDKGMPPAR--TPMEVTVTVLDVNDNPPVFEQDEFDVFVEENSPIGLAVARVTATDPDEGTNAQIMYQIVEGN------IPEVFQLD----IFSGELTALVDLDYEDRP---EYVLVIQATSAP-LVSRATVHVRLLDRNDNPPVL 1023          
BLAST of Protocadherin Fat 1 vs. Ensembl Human
Match: PCDHB8 (protocadherin beta 8 [Source:HGNC Symbol;Acc:HGNC:8693])

HSP 1 Score: 180.259 bits (456), Expect = 5.634e-46
Identity = 179/539 (33.21%), Postives = 268/539 (49.72%), Query Frame = 2
Query:  368 CKYDECCTVFSFQVDSGIKISSFYILIKVLDENDNSPKFLPFLNPYQTL---PENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIAS-GR--PQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKL-VNVISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSIT--MFENEPARTIVASLQVSDRDSLVTD-IECSLDDYHLNFEITAINEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTP-LTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNS--TDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAP--IFPKPHYSFTVRENVPVNTEIGQIET 1939
            C + E C V  FQV        F   ++V+D ND+SP FL      Q L    E+S   T   L +A DLD     I+ Y IS       +S+F +L +  S GR  P+L+L   LDRE  +E R  L A+D  +      +  +V I+V D+NDN P F++ FY   I E S +   V+    TD+D G N ++S ++   +D    +I + F++DF    +TG IRL  ++D+E     Y  N+ A D G    S    V I +I+ ND AP        E+   + T  + EN P  T+VA   VSD DS     I CS+ +  L F + +      +G++   +  T  PLDRE  + +Y   N+  +  D  TP LTT+L + + + D+NDN P FT++ Y   + EN   +    I  +   D+D G NA VTY +   ++         +I+ D+G + + +S+DYE  + F F + A D+    LSS AL+ V V+DANDN+P  ++P  + S    E VP   E G + T
Sbjct:   97 CGHTEPC-VLRFQVLLESPFEFFQAELQVIDINDHSPVFLD----KQMLVKVSESSPPGTAFPLKNAEDLDIGQNNIENYIISP------NSYFRVLTRKRSDGRKYPELVLDKALDREEEAELRLTLTALDGGSPPRSGTA--QVYIEVVDVNDNAPEFEQPFYRVQISEDSPISFLVVKVSATDVDTGVNGEISYSLFQASD----EISKTFKVDF----LTGEIRLKKQLDFEKF-QSYEVNIEARDAG--GFSGKCTVLIQVIDVNDHAP--------EVTMSAFTSPIPENAP-ETVVALFSVSDLDSGENGKISCSIQE-DLPFLLKS-----SVGNFYTLLTET--PLDRES-RAEY---NVTITVTDLGTPRLTTHLNMTVLVSDVNDNAPAFTQTSYTLFVREN--NSPALHIGSVSATDRDSGTNAQVTYSLLPPQDPHLPLASLVSINTDNGHLFALRSLDYEALQAFEFRVGASDRGSPALSSEALVRVLVLDANDNSPFVLYPLQNGSAPCTELVPRAAEPGYLVT 588          

HSP 2 Score: 95.9005 bits (237), Expect = 2.191e-19
Identity = 118/480 (24.58%), Postives = 198/480 (41.25%), Query Frame = 2
Query:  782 EVEIKVGDINDNPPVFDKTFYTANIVEHSKLVNVISFY-VTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITAINEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSK----NSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYF---HKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPI 2197
            + E++V DIND+ PVF        + E S            DLD GQN  +   I + N Y +   ++       P L+     L   +D E    +    L A D G P  S TA+V I +++ ND AP      + E     + + E+ P   +V  +  +D D+ V   E S   +  + EI+   ++  L       I   K LD E  K Q  ++NI   D    +      T+ I + D+ND+ P  T S +   + EN P+  V +       D D G+N  ++  I         S+   ++T+  ++        +D E    ++  I   D     L++   + V V D NDNAP F +  Y+  VREN      IG +  TD D+    ++          +     ++ ++ ++G L  +  +D E +++    + A +  S      + SE +V + + D NDN P 
Sbjct:  119 QAELQVIDINDHSPVFLDKQMLVKVSESSPPGTAFPLKNAEDLDIGQNN-IENYIISPNSYFRVLTRKRSDGRKYPELV-----LDKALDREEE-AELRLTLTALDGGSPPRSGTAQVYIEVVDVNDNAP------EFEQPFYRVQISEDSPISFLVVKVSATDVDTGVNG-EISYSLFQASDEISKTFKVDFLTGE----IRLKKQLDFE--KFQSYEVNIEARDAGGFS---GKCTVLIQVIDVNDHAPEVTMSAFTSPIPENAPETVVALFS---VSDLDSGENGKISCSIQEDLPFLLKSSVGNFYTLLTET-------PLDRESRAEYNVTITVTDLGTPRLTTHLNMTVLVSDVNDNAPAFTQTSYTLFVRENNSPALHIGSVSATDRDSGTNAQVTYSLLPPQDPHLPLASLVSINTDNGHLFALRSLDYEALQAFEFRVGASDRGS----PALSSEALVRVLVLDANDNSPF 561          

HSP 3 Score: 88.9669 bits (219), Expect = 3.239e-17
Identity = 71/286 (24.83%), Postives = 133/286 (46.50%), Query Frame = 2
Query: 1367 YKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKI-------VKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIFS 2203
            Y E +++  K LDRE++    L++ +   D     P +    ++I + D+NDN P F +  Y+ ++ E+ P +   ++  +   D D G N  ++Y +  + +    + F +D  +G+I  ++ +D+EK + +  NI A  +D    S    +++ VID ND+AP      ++  + EN P  T +     +DLD+    KI       + +  KS   N+           L T  P+DRE      + IT  +  + +    + +   + + + DVNDN P F+
Sbjct:  192 YPELVLD--KALDREEEAE--LRLTLTALDGGS-PPRSGTAQVYIEVVDVNDNAPEFEQPFYRVQISEDSPISF--LVVKVSATDVDTGVNGEISYSLFQASDEIS-KTFKVDFLTGEIRLKKQLDFEKFQSYEVNIEA--RDAGGFSGKCTVLIQVIDVNDHAPEVTMSAFTSPIPENAP-ETVVALFSVSDLDSGENGKISCSIQEDLPFLLKSSVGNFYT---------LLTETPLDRESRAEYNVTITVTDLGTPR----LTTHLNMTVLVSDVNDNAPAFT 453          

HSP 4 Score: 85.5001 bits (210), Expect = 2.999e-16
Identity = 85/336 (25.30%), Postives = 147/336 (43.75%), Query Frame = 2
Query: 1496 HINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDH--------GKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIFSLINPAKSSLIFTINKGFRHENCQMIPYAVSDADHDEPNSDSCCILQLDNDQNGMLYLL-SNTPNFLCLQNTMNTP------GIYRVSLTATD 2458
             + + DIND+ PVF   +   ++ E+ P  T   ++    LD             N+Y  +++ + K S   +Y  +  D       +++D E+       + A+D      S TA + + V+D NDNAP F +P Y   + E+ P++  + ++  TD+DT    +I     ++     +   VD  +G+++    +D EK +S  + I AR+   +  K      C V+I + DVND+ P  ++     S+    I +        +  ++VSD D  E    SC I      Q  + +LL S+  NF  L     TP        Y V++T TD
Sbjct:  121 ELQVIDINDHSPVFLDKQMLVKVSESSPPGTAFPLKNAEDLDIGQNNIENYIISPNSY--FRVLTRKRSDGRKYPELVLD-------KALDREEEAELRLTLTALDGGSPPRSGTAQVYIEVVDVNDNAPEFEQPFYRVQISEDSPISFLVVKVSATDVDTGVNGEISYSLFQASDEISKTFKVDFLTGEIRLKKQLDFEKFQSYEVNIEARDAGGFSGK------CTVLIQVIDVNDHAPEVTM-----SAFTSPIPENAPETVVAL--FSVSDLDSGENGKISCSI------QEDLPFLLKSSVGNFYTL--LTETPLDRESRAEYNVTITVTD 426          
BLAST of Protocadherin Fat 1 vs. Ensembl Human
Match: PCDH1 (protocadherin 1 [Source:HGNC Symbol;Acc:HGNC:8655])

HSP 1 Score: 180.644 bits (457), Expect = 1.319e-45
Identity = 177/675 (26.22%), Postives = 307/675 (45.48%), Query Frame = 2
Query:  221 EKASPFSLIDNR----LSVVSNIDRESICPIKNSLNDYDQSAETYNSQQSSHSCKYDECCTVFSFQVDSGIKISSFYIL---IKVLDENDNSPKFLPFLNPYQTL--PENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIAS----GRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKLVN-VISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMF---ENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITAINEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPP 2194
            E  +P+  +D +     +  ++IDRE +   +N L                     D C   F   +   ++  S  +L   I+V D NDN+P F    +P  TL  PEN+ I ++  +P A D D+   G+  Y++      G ++      ++A      +PQL+++  LDRE    Y   +K  D  +      S   + + V D NDN P F++  Y A + E+S + + VI     D D+G N ++  T     +     ++R  ++D +    TG I +   +D E +     F+++A D G    S+ A+V + + + ND AP I+ IR   +V+    M    E+    T VA +QVSDRD         +    + F++   +E       K++ + T  PLD E  K+  ++I    S      PL++  ++ + + D+NDN PVFT+S  +    EN      ++I  I   D D G NA + Y ++    +     FTI  ++G+I  + S+D E+ + +   ++A D+   +L  TA ++V+V+D NDN P F    Y+F+V EN+P  + +G +   D D + EN  V+   +    ++    +   +G + +    DRE+  + T  + A +         +     V I + D NDN P
Sbjct:   93 EVGAPYLRVDGKTGDIFTTETSIDREGLRECQNQL-------------------PGDPCILEFEVSITDLVQNGSPRLLEGQIEVQDINDNTPNFA---SPVITLAIPENTNIGSLFPIPLASDRDAGPNGVASYELQA----GPEAQELFGLQVAEDQEEKQPQLIVMGNLDRERWDSYDLTIKVQDGGSPPR--ASSALLRVTVLDTNDNAPKFERPSYEAELSENSPIGHSVIQVKANDSDQGANAEIEYTFHQAPEV----VRRLLRLDRN----TGLITVQGPVDRE-DLSTLRFSVLAKDRGTNPKSARAQVVVTVKDMNDNAPTIE-IRGIGLVTHQDGMANISEDVAEETAVALVQVSDRDEGENAAVTCVVAGDVPFQLRQASETGS-DSKKKYFLQTTTPLDYEKVKDYTIEIVAVDSGN---PPLSSTNSLKVQVVDVNDNAPVFTQSVTEVAFPEN--NKPGEVIAEITASDADSGSNAELVYSLEPEPAAKGL--FTISPETGEIQVKTSLDREQRESYELKVVAADRGSPSLQGTATVLVNVLDCNDNDPKFMLSGYNFSVMENMPALSPVGMVTVIDGD-KGENAQVQLSVEQDNGDFV---IQNGTGTILSSLSFDREQQSTYTFQLKAVDGGVPPRSAYVG----VTINVLDENDNAP 713          

HSP 2 Score: 127.487 bits (319), Expect = 4.490e-29
Identity = 154/576 (26.74%), Postives = 250/576 (43.40%), Query Frame = 2
Query:  422 KISSFYILIKVLDENDNSPKFLPFLNPYQT-LPENSQINTVILLPSAIDLDSEAFG-IKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFD--------KTFYTANIVEH-SKLVNVISFYVTDLDEGQNKQVSITIETE--------NDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMF---ENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITAINEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTP-LTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIG----QIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDR 2068
            + SS  + + VLD NDN+PKF      Y+  L ENS I   ++   A D D  A   I+Y     P ++        LD+       + +  P+DRE +S  RF + A DR  +     + V V +K  D+NDN P  +             ANI E  ++   V    V+D DEG+N  V+  +  +        ++   D  K++F    +P            +DYE     Y+  ++A D+G P LSST  + + +++ ND APV          ++S+T     EN     ++A +  SD DS  ++ E     Y L  E  A           E  + T   LDRE  ++  LK+       D+ +P L    T+ +N+ D NDN P F  S Y   ++EN+P   +  +  +  +D D G+NA V   ++          F I   +G I S  S D E+   ++F + A+D      S+   + ++V+D NDNAP    P  S T  + +   T +G    Q+   D D+    +++  +  +  N Y +  +  +SG +     I+R
Sbjct:  260 RASSALLRVTVLDTNDNAPKF--ERPSYEAELSENSPIGHSVIQVKANDSDQGANAEIEYTFHQAPEVV---RRLLRLDRNTG---LITVQGPVDREDLSTLRFSVLAKDRGTNPKSARAQVVVTVK--DMNDNAPTIEIRGIGLVTHQDGMANISEDVAEETAVALVQVSDRDEGENAAVTCVVAGDVPFQLRQASETGSDSKKKYFLQTTTP------------LDYEKV-KDYTIEIVAVDSGNPPLSSTNSLKVQVVDVNDNAPVF---------TQSVTEVAFPENNKPGEVIAEITASDADS-GSNAELV---YSLEPEPAAKGLFTISPETGEIQVKTS--LDREQRESYELKVVA----ADRGSPSLQGTATVLVNVLDCNDNDPKFMLSGYNFSVMENMP--ALSPVGMVTVIDGDKGENAQVQLSVEQDNGD-----FVIQNGTGTILSSLSFDREQQSTYTFQLKAVDGGVPPRSAYVGVTINVLDENDNAPYITAP--SNTSHKLLTPQTRLGETVSQVAAEDFDSGVNAELI--YSIAGGNPYGLFQIGSHSGAITLEKEIER 782          

HSP 3 Score: 99.7525 bits (247), Expect = 1.861e-20
Identity = 75/298 (25.17%), Postives = 135/298 (45.30%), Query Frame = 2
Query: 1487 LTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPI-LTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSR----QSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIFSLINPAKSSLIFTINKGFRH------ENCQMIPYAVSDADHDEPNSDSCCILQLD 2347
            L   I + DINDN P F        + EN     +  + PI L  D+D G N   +Y++ +   + +     +  D  +   +     ++D E+   +   I   D      +S+AL+ V V+D NDNAP F +P Y   + EN P+   + Q++  D D     +I   FH++     +++ +D+N+G +   GP+DRE + ++   + A++  +    N   +   V++T++D+NDN P   +    +   + T   G  +      E   +    VSD D  E N+   C++  D
Sbjct:  152 LEGQIEVQDINDNTPNFASPVITLAIPEN---TNIGSLFPIPLASDRDAGPNGVASYELQAGPEAQELFGLQVAEDQEEKQPQLIVMGNLDRERWDSYDLTIKVQDGGSPPRASSALLRVTVLDTNDNAPKFERPSYEAELSENSPIGHSVIQVKANDSDQGANAEIEYTFHQAPEVVRRLLRLDRNTGLITVQGPVDREDLSTLRFSVLAKDRGT----NPKSARAQVVVTVKDMNDNAPTIEI----RGIGLVTHQDGMANISEDVAEETAVALVQVSDRDEGE-NAAVTCVVAGD 437          

HSP 4 Score: 77.7962 bits (190), Expect = 9.618e-14
Identity = 78/282 (27.66%), Postives = 123/282 (43.62%), Query Frame = 2
Query: 1400 LDREDDKNQYLKINIYCSDQDKLTP-LTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFT--------VRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYT--NNYQVIHVDQNSGK---LKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIFS 2203
            LDRE   +  L I +    QD  +P   ++  + + + D NDN P F R  Y+ EL EN P     +I+ +   D D G NA + Y    +          +D ++G I+ +  +D E      F+++A D+  +  S+ A ++V V D NDNAP                  + E+V   T +  ++ +D D   EN  V             Q      +S K   L+T  P+D EKV+  TI I A +     N  L  +  + +  + DVNDN P+F+
Sbjct:  238 LDRERWDSYDLTIKV----QDGGSPPRASSALLRVTVLDTNDNAPKFERPSYEAELSENSPIGH-SVIQ-VKANDSDQGANAEIEYTFHQAPEVV-RRLLRLDRNTGLITVQGPVDREDLSTLRFSVLAKDRGTNPKSARAQVVVTVKDMNDNAPTIEIRGIGLVTHQDGMANISEDVAEETAVALVQVSDRDEG-ENAAVTCVVAGDVPFQLRQASETGSDSKKKYFLQTTTPLDYEKVKDYTIEIVAVDSG---NPPLSSTNSLKVQVV-DVNDNAPVFT 507          
BLAST of Protocadherin Fat 1 vs. Ensembl Celegans
Match: fmi-1 (FlaMIngo (Cadherin plus 7TM domain) homolog [Source:UniProtKB/TrEMBL;Acc:A0A0K3AUS4])

HSP 1 Score: 156.377 bits (394), Expect = 3.835e-38
Identity = 147/563 (26.11%), Postives = 262/563 (46.54%), Query Frame = 2
Query:  512 LPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKL-VNVISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITAINEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDRE--KVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNP 2191
            LPE++ I T+I    A    S+     YY +  P    + + FTL D ++    ++ L   +DREV+ ++  ILK    E  D    +   V + V D+ DN P+F+K  Y   I E + +   V+S +  DLD G+N ++  ++   N       K    I+      +G I+    +D ET       ++IA+D G P+  STA V I +++ ND APV          S ++T+ EN     ++A+++ +D D           +  +++ + + + I   G   ++    +   +R D KN  +   I   D  +   L++ + + IN+ DIND+ P    ++    L EN+  A  + +  +  +D+D G N  + Y ++ S++      F ID DSG I + + +D E    +S  + A D    +L+++  I V + D NDNAP F K  Y+ T+ E +P  ++I  ++  D D   + KI     ++    + ++ +      L   G + R+  KVR   + I+A ++   Q +      C+V + I+DVN  P
Sbjct:  174 LPEDTPIETIIASVKASHASSQPL---YYSMVAPQDSRSQNLFTL-DTMSG---EIRLAKSMDREVLDKH--ILKVTAYERVDPTISASTTVVVHVLDVQDNSPIFEKDSYFGEIREDAPIGTTVLSVFARDLDSGENGEIEYSLGEGNG------KNLLAIN----AKSGVIQTAAPLDRETLSL-IRLDVIASDKGTPKRESTAMVEITVVDVNDNAPVFASD------SYNVTILENITIPAVIATVKATDEDFGT--------NGKVHYSMASSSGIG--GLTIDYSTGEVTLRERIDAKNSPITAVIRAKDGAQ-PALSSTVPLTINVIDINDHAPTLIAAQKMITLEENV--AIGEEVGRVYAIDEDSGPNGIIKYSMEGSED------FIIDEDSGLIKTTKLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDNDE--DQKITYRIEEADREVFSILDIGDQGAILSVSGELKRQDHKVR---VEISATDQGGLQGR------CVVNVFIDDVNSAP 680          

HSP 2 Score: 154.451 bits (389), Expect = 1.751e-37
Identity = 167/600 (27.83%), Postives = 267/600 (44.50%), Query Frame = 2
Query:  428 SSFYILIKVLDENDNSPKFLPFLNPYQ-TLPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDI--SGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKLVNVIS-FYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITAINEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTL---DKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYF--HKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIF 2200
            S+  + I V+D NDN+P F    + Y  T+ EN  I  VI    A D D    G  +Y ++    IG      L    ++G   L       RE I      + AV R  D  +    S V + I V DIND+ P          + E+  +   +   Y  D D G N  +  ++E   D+  D+              +G I+    +D ET   +YS  + A D G P L+++  + ++L + ND AP      K E    ++T+ E  P  + + +L+  D D    D + +      + E+ +I +I   G     I++    L R+D K   +++ I  +DQ  L        +++ + D+N + P F    +  ++ E+ P     +  P++TL   D D G NA + Y IDSS      ++F ID  SG IS    +D E    FS  + A D     L+++  I V + D NDN+P F    Y+ T+ E++PV T   Q+   D D  P N IV YF    S + + Q+  +D+ SG L+    +DRE+   I + I AR+  +      + +   + +T+ DVNDN P F
Sbjct:  357 STAMVEITVVDVNDNAPVFAS--DSYNVTILENITIPAVIATVKATDEDFGTNGKVHYSMASSSGIGG-----LTIDYSTGEVTL-------RERIDAKNSPITAVIRAKDGAQPALSSTVPLTINVIDINDHAPTLIAAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSMEGSEDFIIDE-------------DSGLIKTTKLLDRETTA-RYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFD---KKEY---NVTISEEMPRGSQIITLKAVDNDE---DQKITYRIEEADREVFSILDIGDQGA----ILSVSGELKRQDHK---VRVEISATDQGGLQ---GRCVVNVFIDDVN-SAPYFNDHPFSVKIPEHSP-----IGYPVITLKAEDHDRGDNARIVYSIDSS------QFFRIDPSSGDISVSSDLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISEDIPVGTSFLQVSAIDADIGP-NGIVDYFLNESSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTPS----LSAASEITLTLSDVNDNAPTF 892          

HSP 3 Score: 144.05 bits (362), Expect = 2.386e-34
Identity = 170/605 (28.10%), Postives = 271/605 (44.79%), Query Frame = 2
Query:  404 QVDSGIKISSFYILIKVLDENDNSPKFLPFLNPYQTLPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKLVNVIS-FYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITAINEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTP-LTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDK-DHGKNAYVTYKIDSSKNSTDWEYFTI--DADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIFS 2203
            +VD  I  S+  +++ VLD  DNSP F    + +  + E++ I T +L   A DLDS   G   Y + +    GN  +   ++   SG  Q    +PLDRE +S  R  + A D+        S   VEI V D+NDN PVF    Y   I+E+  +  VI+    TD D G N +V  ++ + +            ID+S    TG + L + ID + +P        A D   P LSST  + I +I+ ND AP +   +K       IT+ EN      V  +   D DS    I        + + +    +   +      +I T K LDRE      LK+    + +D  TP L T+ TI + L DINDN P F + +Y   + E +P+ +      I+TL   D+ ++  +TY+I+ +    D E F+I    D G I S       ++      I A   DQ  L    ++ V + D N +AP F    +S  + E+ P+   +  ++  D D     +IV     S     Q   +D +SG +     +DRE   + ++++TA + AS      +++   + + ++D+NDN P F+
Sbjct:  245 RVDPTISAST-TVVVHVLDVQDNSPIFEKD-SYFGEIREDAPIGTTVLSVFARDLDSGENGEIEYSLGE----GNGKNLLAINA-KSGVIQ--TAAPLDRETLSLIRLDVIASDKGTPKRE--STAMVEITVVDVNDNAPVFASDSYNVTILENITIPAVIATVKATDEDFGTNGKVHYSMASSSGIGG------LTIDYS----TGEVTLRERIDAKNSPITAVIR--AKDGAQPALSSTVPLTINVIDINDHAPTLIAAQK------MITLEENVAIGEEVGRVYAIDEDSGPNGI--------IKYSMEGSEDF--IIDEDSGLIKTTKLLDRETTARYSLKV----TARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGS-----QIITLKAVDNDEDQKITYRIEEA----DREVFSILDIGDQGAILSVSGELKRQDHKVRVEISA--TDQGGLQGRCVVNVFIDDVN-SAPYFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSIDSS-----QFFRIDPSSGDISVSSDLDREDRATFSVIVTASDHASPP----LNTSTQIEVILDDINDNSPQFT 785          

HSP 4 Score: 107.842 bits (268), Expect = 2.926e-23
Identity = 74/272 (27.21%), Postives = 133/272 (48.90%), Query Frame = 2
Query: 1382 INTLKPLDREDDKNQYLKINIYCSDQDKLTP-LTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPP 2194
            I   K +DRE      LK+  Y    +++ P ++ + T+ +++ D+ DN P+F +  Y GE+ E+ P  T  +   +   D D G+N  + Y +             I+A SG I +   +D E   L   ++IA DK      STA++ + V+D NDNAP+F    Y+ T+ EN+ +   I  ++ TD D     K+  ++  + ++    + +D ++G++     ID  K   IT +I A++ A    +  + S   + I + D+ND+ P
Sbjct:  222 IRLAKSMDREVLDKHILKVTAY----ERVDPTISASTTVVVHVLDVQDNSPIFEKDSYFGEIREDAPIGTTVL--SVFARDLDSGENGEIEYSLGEGNGKN---LLAINAKSGVIQTAAPLDRETLSLIRLDVIASDKGTPKRESTAMVEITVVDVNDNAPVFASDSYNVTILENITIPAVIATVKATDEDFGTNGKV--HYSMASSSGIGGLTIDYSTGEVTLRERID-AKNSPITAVIRAKDGA----QPALSSTVPLTINVIDINDHAP 477          

HSP 5 Score: 104.375 bits (259), Expect = 3.528e-22
Identity = 66/223 (29.60%), Postives = 117/223 (52.47%), Query Frame = 2
Query: 1535 FTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIFS 2203
            F + KY  EL E+ P  T+     I ++   H  +  + Y + + ++S     FT+D  SG+I   +S+D E        + A ++    +S++  ++VHV+D  DN+PIF K  Y   +RE+ P+ T +  +   DLD+  EN  ++Y      N   ++ ++  SG ++T  P+DRE +  I + + A ++ + +     +S  MV IT+ DVNDN P+F+
Sbjct:  165 FQQEKYVKELPEDTPIETI-----IASVKASHASSQPLYYSMVAPQDSRSQNLFTLDTMSGEIRLAKSMDREVLDKHILKVTAYERVDPTISASTTVVVHVLDVQDNSPIFEKDSYFGEIREDAPIGTTVLSVFARDLDS-GENGEIEY-SLGEGNGKNLLAINAKSGVIQTAAPLDRETLSLIRLDVIASDKGTPKR----ESTAMVEITVVDVNDNAPVFA 376          

HSP 6 Score: 69.3218 bits (168), Expect = 1.810e-11
Identity = 75/244 (30.74%), Postives = 111/244 (45.49%), Query Frame = 2
Query:  458 DENDNSPKFLPFLNPYQ-TLPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKLVNVISFYVT-DLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLID--EIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIK 1177
            D NDNSP+F    + Y  T+ E+  + T  L  SAID D    GI  Y +++     + S    L ++      L + S LDRE  +     + A DR        S  E+ + + D+NDN P F++  Y   I E+S + + +   V  D DEG N  +S  I    D K       F I+   +   G +R++   E DYE    K+ F L A+     +LSST  V I + + ND  P +K
Sbjct:  776 DINDNSPQFTS--SSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDYFLNE----SSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTPSLSAAS--EITLTLSDVNDNAPTFEQLSYDLYIAENSPVGSTVGTIVARDADEGDNADISFRIFGGADAK------LFDIE-EDAEQNGVVRILTRAEFDYEAKANKFFFELQASSG---QLSSTVPVRIHVSDVNDNKPALK 1001          
BLAST of Protocadherin Fat 1 vs. Ensembl Celegans
Match: fmi-1 (FlaMIngo (Cadherin plus 7TM domain) homolog [Source:UniProtKB/TrEMBL;Acc:A0A0K3AUS4])

HSP 1 Score: 153.68 bits (387), Expect = 2.534e-37
Identity = 166/594 (27.95%), Postives = 264/594 (44.44%), Query Frame = 2
Query:  446 IKVLDENDNSPKFLPFLNPYQ-TLPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDI--SGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKLVNVIS-FYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITAINEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTL---DKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYF--HKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIF 2200
            I V+D NDN+P F    + Y  T+ EN  I  VI    A D D    G  +Y ++    IG      L    ++G   L       RE I      + AV R  D  +    S V + I V DIND+ P          + E+  +   +   Y  D D G N  +  ++E   D+  D+              +G I+    +D ET   +YS  + A D G P L+++  + ++L + ND AP      K E    ++T+ E  P  + + +L+  D D    D + +      + E+ +I +I   G     I++    L R+D K   +++ I  +DQ  L        +++ + D+N + P F    +  ++ E+ P     +  P++TL   D D G NA + Y IDSS      ++F ID  SG IS    +D E    FS  + A D     L+++  I V + D NDN+P F    Y+ T+ E++PV T   Q+   D D  P N IV YF    S + + Q+  +D+ SG L+    +DRE+   I + I AR+  +      + +   + +T+ DVNDN P F
Sbjct:    4 ITVVDVNDNAPVFAS--DSYNVTILENITIPAVIATVKATDEDFGTNGKVHYSMASSSGIGG-----LTIDYSTGEVTL-------RERIDAKNSPITAVIRAKDGAQPALSSTVPLTINVIDINDHAPTLIAAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSMEGSEDFIIDE-------------DSGLIKTTKLLDRETTA-RYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFD---KKEY---NVTISEEMPRGSQIITLKAVDNDE---DQKITYRIEEADREVFSILDIGDQGA----ILSVSGELKRQDHK---VRVEISATDQGGLQ---GRCVVNVFIDDVN-SAPYFNDHPFSVKIPEHSP-----IGYPVITLKAEDHDRGDNARIVYSIDSS------QFFRIDPSSGDISVSSDLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISEDIPVGTSFLQVSAIDADIGP-NGIVDYFLNESSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTPS----LSAASEITLTLSDVNDNAPTF 533          

HSP 2 Score: 119.783 bits (299), Expect = 6.657e-27
Identity = 137/479 (28.60%), Postives = 214/479 (44.68%), Query Frame = 2
Query:  785 VEIKVGDINDNPPVFDKTFYTANIVEHSKLVNVIS-FYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHL-NFEITAINEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTP-LTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDK-DHGKNAYVTYKIDSSKNSTDWEYFTI--DADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIFS 2203
            VEI V D+NDN PVF    Y   I+E+  +  VI+    TD D G N +V  ++ + +            ID+S    TG + L + ID + +P        A D   P LSST  + I +I+ ND AP +   +K       IT+ EN      V  +   D DS    I      Y +   E   I+E   L       I T K LDRE      LK+    + +D  TP L T+ TI + L DINDN P F + +Y   + E +P+ +      I+TL   D+ ++  +TY+I+ +    D E F+I    D G I S       ++      I A   DQ  L    ++ V + D N +AP F    +S  + E+ P+   +  ++  D D     +IV     S     Q   +D +SG +     +DRE   + ++++TA + AS      +++   + + ++D+NDN P F+
Sbjct:    2 VEITVVDVNDNAPVFASDSYNVTILENITIPAVIATVKATDEDFGTNGKVHYSMASSSGIGG------LTIDYS----TGEVTLRERIDAKNSPITAVIR--AKDGAQPALSSTVPLTINVIDINDHAPTLIAAQK------MITLEENVAIGEEVGRVYAIDEDSGPNGI----IKYSMEGSEDFIIDEDSGL-------IKTTKLLDRETTARYSLKV----TARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGS-----QIITLKAVDNDEDQKITYRIEEA----DREVFSILDIGDQGAILSVSGELKRQDHKVRVEISA--TDQGGLQGRCVVNVFIDDVN-SAPYFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSIDSS-----QFFRIDPSSGDISVSSDLDREDRATFSVIVTASDHASPP----LNTSTQIEVILDDINDNSPQFT 426          

HSP 3 Score: 69.3218 bits (168), Expect = 1.511e-11
Identity = 75/244 (30.74%), Postives = 111/244 (45.49%), Query Frame = 2
Query:  458 DENDNSPKFLPFLNPYQ-TLPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKLVNVISFYVT-DLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLID--EIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIK 1177
            D NDNSP+F    + Y  T+ E+  + T  L  SAID D    GI  Y +++     + S    L ++      L + S LDRE  +     + A DR        S  E+ + + D+NDN P F++  Y   I E+S + + +   V  D DEG N  +S  I    D K       F I+   +   G +R++   E DYE    K+ F L A+     +LSST  V I + + ND  P +K
Sbjct:  417 DINDNSPQFTS--SSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDYFLNE----SSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTPSLSAAS--EITLTLSDVNDNAPTFEQLSYDLYIAENSPVGSTVGTIVARDADEGDNADISFRIFGGADAK------LFDIE-EDAEQNGVVRILTRAEFDYEAKANKFFFELQASSG---QLSSTVPVRIHVSDVNDNKPALK 642          
BLAST of Protocadherin Fat 1 vs. Ensembl Celegans
Match: cdh-1 (CaDHerin family [Source:UniProtKB/TrEMBL;Acc:Q5F4W0])

HSP 1 Score: 125.176 bits (313), Expect = 1.632e-28
Identity = 154/601 (25.62%), Postives = 260/601 (43.26%), Query Frame = 2
Query:  440 ILIKVLDENDNSPKFLPFLNPYQTLPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGN-DSHFTLLDKIASGRPQ--LLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKL-VNVISFYVTDLDEGQNKQVSITIETENDYKKD--QIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSD--RDSLVTDIECSL------DDYHLNFEITAINEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIF 2200
            IL++V DENDN+P F   +   + + E +Q+ T   LP+  D D   F +  + I    L GN ++ F L  +  + + Q  L++   LDRE   +Y  +++A D        I  +   I++ D NDN PVF ++ YTA++  +  +  ++I+   TD D G+N ++S  I+  +        I +   I  + SL+  S               +   ++A+D+G P LSS+A V I ++     +P + +I   E  S S  + EN    +IVA + ++   RD+ +  I  S       D  H+                  +++     LDRE     +LK  +   D   +      LTI     DINDN P +  S+    L  N  Q   +    +   D D G+N ++ Y +       D E  +ID ++G+I    +ID        F + A D     LS+   ++  ++D     P F K  +   + E+ P+ T + ++   +      +K ++Y   S  N  + + VD  SG +      D EK +S    + A       N N   S  ++ I ++DVNDN PIF
Sbjct:  108 ILVEVDDENDNAPSFADQVVKLE-ISEFAQLGTSFALPTVTDGDGPKFDVHRFVI----LQGNVNNVFKLASRKVNEQLQADLVVNGQLDREFRDKYELLIEAQD--GGKPAKIGQLRCSIEIIDANDNAPVFSRSRYTASVSANISIGSHLITVQATDADIGENSRISYDIKKTSAPSNSNFAISQSGVITTTASLLPAS--------------THDVIVVASDHGSPSLSSSAVVTITVLGSTLSSPPLDIIWLVE--SNSAHLMENSTLGSIVARVSIAQQYRDTKLRLIGSSALCPQQTDQAHV------------------YLLLLCGILDRETASEHHLKF-LLEKDGQIIIEHPQLLTIG----DINDNAPQWHSSQIHISL--NRTQGGSRT---LTAKDPDLGQNGWIRYSV------LDTELVSIDKETGRIFVPNTIDCNIGSEIKFRVRAEDGGSPALSTDLQVVADLLDTESKPPQFEKALWQVEIPEDTPIGTCLVKVVANNSQCG-NSKRIRY---SLQNQDEHLTVDTMSGTVCIQKTFDFEKQKSYQTTVIA------TNANSETSTSLISIRLKDVNDNWPIF 641          

HSP 2 Score: 107.071 bits (266), Expect = 5.794e-23
Identity = 134/501 (26.75%), Postives = 219/501 (43.71%), Query Frame = 2
Query:  785 VEIKVGDINDNPPVFDKTFYTANIVEHSKLVN-VISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPY-KYSFNLI--ATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIECSL--DDYHLNFEITAINEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLT-IHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTL---DKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPP----IFSLINPAKSSLIFTIN 2245
            + I++ D+NDN P+F    Y   + E  K    ++    +D+D G   +VS  I +E+              FS + +TG +       +   P  +  F+L+  A D G     ++A ++I +I+K+ + P           SRS   +E      I+  + +    ++ + ++ S+   D   NF I            K ++   L     + D +  + +NI    Q  L    +N T + I + D NDNPP F+ S     L+E   +  +K+ EP   +   DKD  KN  V Y I SS   +  E   ID  +G++S+   +DYE  + +   + A D      SS   + +HV+D NDNAP F K  Y+  V EN P  T +G++   D D+    +IV       TN  +   +D+  G + T   IDRE +  + I I A ++      +   +     I++ DVNDNPP    I  ++ PA S L   I 
Sbjct:  627 ISIRLKDVNDNWPIFYPNEYHLTVREGPKPEEPLLVVSASDMDSGTFGEVSYHILSESS------------SFSINPVTGEV-------FAQKPLARGRFHLVVSAKDGGGQSSENSANIHITVIDKDTKTPQF---------SRS--KYEIRTTEDILPGIAIGSVGAM-SKVKYSIYSGDQDHNFSIDEDTG-------KIYVTRYL-----DADVHDTVLLNI----QATLPSGESNQTQVVIFIEDHNDNPPQFSSS-----LVEISIREDLKLHEPFYVVQASDKDKKKNGEVRYSIISSHPGSSIE---IDQFTGQLSTGSLLDYEATRNYKLRVKATDLGIPPRSSNMTLFIHVLDVNDNAPEFEKSWYTMEVLENSPPKTIVGKVVARDKDSLENGQIVYRI----TNGSEYFGIDEKLGNVYTKRSIDREVISHVDISIVAEDKGVPPRSSTASAR----ISVLDVNDNPPSCLSITPIVVPAGSPLSTAIG 1064          

HSP 3 Score: 86.2705 bits (212), Expect = 1.176e-16
Identity = 63/194 (32.47%), Postives = 98/194 (50.52%), Query Frame = 2
Query: 1382 INTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAP----IFPKPHYSFTVRENVPVNTEIGQIETTDLD 1951
            ++T   LD E  +N  L++    +    + P ++N+T+ I++ D+NDN P F +S Y  E++EN P  T+  +  ++  DKD  +N  + Y+I +       EYF ID   G + +++SID E       +I+A DK     SSTA   + V+D NDN P    I P       V    P++T IG I   D D
Sbjct:  894 LSTGSLLDYEATRNYKLRVK---ATDLGIPPRSSNMTLFIHVLDVNDNAPEFEKSWYTMEVLENSPPKTI--VGKVVARDKDSLENGQIVYRITNGS-----EYFGIDEKLGNVYTKRSIDREVISHVDISIVAEDKGVPPRSSTASARISVLDVNDNPPSCLSITP-----IVVPAGSPLSTAIGTIVAMDPD 1072          

HSP 4 Score: 71.633 bits (174), Expect = 3.372e-12
Identity = 137/604 (22.68%), Postives = 254/604 (42.05%), Query Frame = 2
Query:  443 LIKVLDENDNSPKFLPFLNPYQTLPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGN--------DSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKLVNVISFYVTDLDE-GQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVI------KVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITAINEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTN-LTIHINLFDINDNPPVFTRSKYQGELIENI-PQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIA-IDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIF 2200
            L+ + D NDN+P++            +SQI+        I L+    G +      P L  N        D+    +DK  +GR  + + + +D  + SE +F ++A D  +      + ++V   + D    PP F+K  +   I E + +   +   V +  + G +K++  +++ ++++             +   M+G++ +    D+E     Y   +IAT+      +ST+ ++I L + ND  P+         +R+G            EP   + AS    D DS  T  E S   YH+  E ++ + I+P+       +   KPL R        + ++  S +D     + N   IHI + D +   P F+RSKY+    E+I P   +  +  +        K  Y  Y  D   N      F+ID D+GKI   + +D + +     NI A +   +SN +    +++ + D NDN P F       ++RE++ ++     ++ +D D +   ++      S+  +   I +DQ +G+L T   +D E  R+  + + A +       + M     + I + DVNDN P F
Sbjct:  428 LLTIGDINDNAPQW-----------HSSQIH--------ISLNRTQGGSRTLTAKDPDLGQNGWIRYSVLDTELVSIDK-ETGR--IFVPNTIDCNIGSEIKFRVRAEDGGSPALS--TDLQVVADLLDTESKPPQFEKALWQVEIPEDTPIGTCLVKVVANNSQCGNSKRIRYSLQNQDEH------------LTVDTMSGTVCIQKTFDFEKQ-KSYQTTVIATNAN--SETSTSLISIRLKDVNDNWPIFYPNEYHLTVREGPK--------PEEPLLVVSAS----DMDS-GTFGEVS---YHILSESSSFS-INPVTGE----VFAQKPLARG-------RFHLVVSAKDGGGQSSENSANIHITVIDKDTKTPQFSRSKYEIRTTEDILPGIAIGSVGAM-------SKVKYSIYSGDQDHN------FSIDEDTGKIYVTRYLDADVHDTVLLNIQATLPSGESNQTQ---VVIFIEDHNDNPPQFSSSLVEISIREDLKLHEPFYVVQASDKDKKKNGEVRYSIISSHPGSS--IEIDQFTGQLSTGSLLDYEATRNYKLRVKATDLGIPPRSSNM----TLFIHVLDVNDNAPEF 942          

HSP 5 Score: 66.6254 bits (161), Expect = 1.030e-10
Identity = 111/435 (25.52%), Postives = 178/435 (40.92%), Query Frame = 2
Query:  692 PLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDK-TFYTANIVEHSKLVNVI-SFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQ----APVIKVIRKGEIVSRSI--TMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITAINEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLD-KDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQ----IETTDLDTR 1957
            PLDRE   E+  I+   D  + +        V + V D NDN P  D  T     I E S++ +V+  F  +D+D GQN + S  +  ++            +D  P      +R +  +        +   L   D+G+P L    + N+ + N+N Q    AP+       E + ++   T+ E  P    +A LQ        + +E ++D     F + +           E +I T   LDRE  +   LK+    S Q     + T + + +N  ++NDN P F  SK +      +P+  +++   + T+  KD    A + Y + S  +     +F ID  +G I     +D+E     +  I A D      ++   + + V D NDNAP F KP Y  TV    P     GQ    IE  DLD R
Sbjct: 1686 PLDREASQEHLLIIILTDGGSRN----DSCTVRVTVADQNDNKPQLDASTPSELEIAESSRVGDVLHRFRASDMDIGQNGKFSFELLEDSSGS---------LDLVPETGDLVLRRLSSLQ------SWKIKLRVVDHGVPGL--YVEKNLEISNRNPQTEAKAPL-------EFLKQTYLSTIDEGLPRGQFIAKLQPELAGLTYSIVEGNIDSA---FSVDS-----------EGVIRTNLELDREILERYSLKVIGTGSGQQ----IGTRVDVRVN--NLNDNVPSFPMSKPR-----RVPE-NLRVGSYVATVGAKDVDNLAPLRYFLVSDSSGQTPTHFNIDQFTGTIHLTAPLDFEVLPEHTLTIKATDGSFDTFTN---LTIFVSDINDNAPTFSKPLYQTTVS---PATFSPGQPFAKIEAHDLDAR 2060          

HSP 6 Score: 65.855 bits (159), Expect = 1.797e-10
Identity = 123/520 (23.65%), Postives = 217/520 (41.73%), Query Frame = 2
Query:  677 LLLISPLDREVISEY--RFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKLVNVISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQID---FSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVI-KVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITAINEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTL---DKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSS--TALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIFS 2203
            LLL   LDRE  SE+  +F+L+   +   +H  +      + +GDINDN P +           HS  +++       L+  Q    ++T + + D  ++   R+  +D    S    TG I + + ID      +  F + A D G P LS+  +V   L++   + P   K + + EI        E+ P  T +  +       +  + +C  +   + + +   +E H         +   K  D E  K+    +    ++ +  T L     I I L D+NDN P+F  ++Y   + E       K  EP+L +   D D G    V+Y I S  +S     F+I+  +G++ +++ +   +     F+++   KD    SS  +A I + VID +   P F +  Y     E++     IG +             VKY   S   ++    +D+++GK+     +D +   ++ + I A   +   N      +  V+I IED NDNPP FS
Sbjct:  395 LLLCGILDRETASEHHLKFLLEKDGQIIIEHPQL------LTIGDINDNAPQW-----------HSSQIHI------SLNRTQGGSRTLTAK-DPDLGQNGWIRYSVLDTELVSIDKETGRIFVPNTIDCNIG-SEIKFRVRAEDGGSPALSTDLQVVADLLDTESKPPQFEKALWQVEIP-------EDTPIGTCLVKV-------VANNSQCG-NSKRIRYSLQNQDE-HLTVDTMSGTVCIQKTFDFEKQKSYQTTVIATNANSETSTSL-----ISIRLKDVNDNWPIFYPNEYHLTVREG-----PKPEEPLLVVSASDMDSGTFGEVSYHILSESSS-----FSINPVTGEVFAQKPLARGR-----FHLVVSAKDGGGQSSENSANIHITVIDKDTKTPQFSRSKYEIRTTEDILPGIAIGSVGAMSK--------VKYSIYSGDQDHN-FSIDEDTGKIYVTRYLDADVHDTVLLNIQATLPSGESN------QTQVVIFIEDHNDNPPQFS 838          

HSP 7 Score: 60.4622 bits (145), Expect = 8.016e-9
Identity = 142/614 (23.13%), Postives = 242/614 (39.41%), Query Frame = 2
Query:  410 DSGIKISSFYILIKVLDENDNSPKFLPFLNPYQTLPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKLVNVISFYVTDLDEGQNK-QVSITIETE-----NDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITAINEIHPLGHYK--EF--IINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDK-DHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDAN-DNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTN--NYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIFSLI 2209
            D G +  S  + + V D+NDN P+          + E+S++  V+    A D+D    G    K S  F +  DS  +L     +G   L  +S L       ++  L+ VD        + G+ VE  +   N NP    K          + L  +   Y++ +DEG  + Q    ++ E         +  I   F +D       G IR   E+D E    +YS  +I T +G        +V++ + N ND  P          +S+   + EN    + VA++   D D+L            L + + + +      H+   +F   I+   PLD E      L I       D      TNLTI ++  DINDN P F++  YQ      +  AT    +P   ++  D      +TY +    +S     F +  +SG +  +  +     + +   + A D    + S++  + V + +A   + P F K  + F V EN  +  +IG +   +          + FH    +    ++  +D+  G+L   GPIDRE+  +    +   NE     K  +  +C VI+   D NDN P+F+ +
Sbjct: 1703 DGGSRNDSCTVRVTVADQNDNKPQLDASTPSELEIAESSRVGDVLHRFRASDMDIGQNG----KFS--FELLEDSSGSLDLVPETGDLVLRRLSSLQ-----SWKIKLRVVD------HGVPGLYVEKNLEISNRNPQTEAK----------APLEFLKQTYLSTIDEGLPRGQFIAKLQPELAGLTYSIVEGNIDSAFSVD-----SEGVIRTNLELDREIL-ERYSLKVIGTGSG---QQIGTRVDVRVNNLNDNVPSFP-------MSKPRRVPENLRVGSYVATVGAKDVDNLAP----------LRYFLVSDSSGQTPTHFNIDQFTGTIHLTAPLDFEVLPEHTLTIKATDGSFDTF----TNLTIFVS--DINDNAPTFSKPLYQ----TTVSPATFSPGQPFAKIEAHDLDARGALTYSLGQGSSS----IFRVAPESGALFMK--VLPPAGERYLVTVTATDNGVPSFSTSVPVSVIIGEAEPTDKPGFEKAEFRFEVMENSKIGLQIGNLSGEE---------SREFHYRIQDPEASKIFSIDK-FGRLFVAGPIDREQRATHEFQVEIDNEMMTSQK--VQCKCHVIVL--DENDNLPVFTSV 2233          

HSP 8 Score: 56.6102 bits (135), Expect = 1.233e-7
Identity = 69/245 (28.16%), Postives = 111/245 (45.31%), Query Frame = 2
Query:  440 ILIKVLDENDNSPKFLPFLNPYQTLPENSQINTVILLPSAIDLDSEAFG-IKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKLVNVISFYVT-DLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAP 1168
            ++I + D NDN P+F   L    ++ E+ +++    +  A D D +  G ++Y  IS        SH     +I     QL   S LD E    Y+  +KA D         S + + I V D+NDN P F+K++YT  ++E+S    ++   V  D D  +N Q+   I   ++Y        F ID       G++     ID E   +    +++A D G+P  SSTA   I +++ ND  P
Sbjct:  823 VVIFIEDHNDNPPQFSSSLVEI-SIREDLKLHEPFYVVQASDKDKKKNGEVRYSIIS--------SHPGSSIEIDQFTGQLSTGSLLDYEATRNYKLRVKATDLGIPPRS--SNMTLFIHVLDVNDNAPEFEKSWYTMEVLENSPPKTIVGKVVARDKDSLENGQIVYRITNGSEY--------FGIDEK----LGNVYTKRSIDREVISH-VDISIVAEDKGVPPRSSTASARISVLDVNDNPP 1043          

HSP 9 Score: 51.2174 bits (121), Expect = 6.024e-6
Identity = 51/177 (28.81%), Postives = 78/177 (44.07%), Query Frame = 2
Query: 1688 EYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKY--FHKSYTNNYQVIHV---DQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIFS 2203
            ++  +D  SG+IS+   +DYEK     F+I+A+  ++S    T  I+V V D NDNAP F        + E   + T       TD D  P+  + ++     +  N +++      +Q    L   G +DRE      +LI    EA    K     +    I I D NDN P+FS
Sbjct:   67 KFLKVDERSGEISTIAHLDYEKRS--KFDIVAVKVEESG--ETIDILVEVDDENDNAPSFADQVVKLEISEFAQLGTSFALPTVTDGDG-PKFDVHRFVILQGNVNNVFKLASRKVNEQLQADLVVNGQLDREFRDKYELLI----EAQDGGKPAKIGQLRCSIEIIDANDNAPVFS 234          
BLAST of Protocadherin Fat 1 vs. Ensembl Celegans
Match: hmr-1 (Cadherin-related hmr-1 [Source:UniProtKB/Swiss-Prot;Acc:Q967F4])

HSP 1 Score: 111.694 bits (278), Expect = 2.171e-24
Identity = 167/630 (26.51%), Postives = 273/630 (43.33%), Query Frame = 2
Query:  428 SSFYILIKVLDENDNSPKFL--PFLNPYQTLPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGN--DSHFTLLDKIASGRP--QLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVE------HSKLVN---VISFYVTDLD-EGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSST-------AKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITAINEIHPLG-HYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIE---NIPQATVKMIEPILTLDKDHG-KNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKL---FSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTE---IGQIETTDLD-TRPENKIVKY--FHKSYTNNYQVIHVDQNSGKLKTIGPIDRE--KVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIF 2200
            SS  + + VLD+   +PK+   P   P  T+ EN ++N VIL   A+           YK++     GN  +S F   +K  +G    +++++  LD E ++ Y   L A D  +   R  S     ++V D+ND  P F    +T  I E      H +  N   +++    D D +G   +V   I  E + ++    + F+ID     +TG I   ++ D E     Y   + A+D  +  L           KV I++ + ND AP  +   + + + R   + E+E     V +++  D D      + S   YHL   I A     P G       I   +PLD E   +QY  + I     D     TTN+ IHI   D+NDN P F + KY   +IE   +IP    K++  +   D D   K++ + Y+++        E F I   SG I   +++D +       ++F + AID D + L   A + V+V D NDN+PIFP+  + +      P++++      ++  D D    EN  ++Y        N   V  +DQN+GK+  +  +DRE    R   I + A +      +   +    V I + D+NDN P F
Sbjct: 1075 SSAQVTLNVLDKQQKAPKWQTSPDCKPGITVDENVELNKVILRCRAVSSGDSRNSDVIYKLTASGGPGNKAESKFRQFNKFENGNEWVEVVIMEGLDYEQVNNYTLTLTATDMTS---RVASTKTFVVEVRDVNDVVPQFTVDLFTGTIDEEMTPNEHLEKTNGKPIVTVKAIDTDSDGPQNEVHYRIVGEANGEE---TKHFRID----ELTGEIFPNEKFDREKIDM-YILTVEASDRSVSALPGANGPNKDNVKVQIVINDVNDNAPSFE---EQKYIGR---VKESEGEGHDVITIKAHDLD------KHSNLRYHL---IGAGGGRIPFGVRTDSGTIFVKEPLDFEA-SDQYHLVLIA---SDGRHNATTNVYIHIE--DVNDNAPQFEQQKYATTVIEEDVDIP----KVLFNVHATDADQDEKSSRIVYRLEGQGAD---EVFRIGKYSGTIELVKALDRDPPAGVPSWNFVVQAIDDDGNGLVGYADVQVNVRDINDNSPIFPERLFGYIEENREPIHSDGVYFMDVQARDFDDPTTENANIEYGIVRNKLINGESVFRIDQNTGKIFAMRSLDREISSEREFIIEVRANDRGVPSREGFAN----VTIKVTDMNDNAPFF 1661          

HSP 2 Score: 107.842 bits (268), Expect = 2.731e-23
Identity = 161/643 (25.04%), Postives = 273/643 (42.46%), Query Frame = 2
Query:  377 DECCTVFSFQVDSGIKISSFYILIKVLDENDNSPKFLPFLNPYQTLPENSQIN-----TVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLISP---LDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKL-VNVISFYVTDLDEGQNKQVSITIETENDYKKDQIKR--FFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPR-LSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFEN-EPARTIVASLQVSDRDSLVTDI--ECSLDDYHLNFEITAINEIHPLGHYKEFI-INTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENI------------PQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSST-------ALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIF 2200
            D  C V+     S    S   +LI + D N+N P+F P    Y  + +  +         I+   A D DS A G   Y +   +   ++S    +    +G   +L  SP    DRE        +KA DR   D   I   +  ++V DINDN P F++  Y  ++     +  +VI+ +  D D   N +++ ++E +    ++      FF++    +  +G I LI  I  +T   K+ FN+IA DNG+P  L S+A+V + +++K  +AP  +           IT+ EN E  + I+    VS  DS  +D+  + +      N   +   + +   +  E++ +  ++ LD E   N  L +    +  D  + + +  T  + + D+ND  P FT   + G + E +            P  TVK I+     D D  +N  V Y+I    N  + ++F ID  +G+I   +  D EK  ++   + A D+  S L            + + + D NDNAP F +  Y   V+E+     ++  I+  DLD   ++  ++Y             V  +SG +    P+D E      +++ A +       N       V I IEDVNDN P F
Sbjct:  834 DGSCCVYP----SKTHTSYATLLIGIEDVNNNKPEF-PDCAKYSDIAKIMEGTYKTDPPTIVKVEATDDDSSANGDIVYSL---YYTQSESRKAFVIDRQTG---VLTPSPHVVFDRETRPREDVTVKATDR--GDRPLIGFCQFSVEVVDINDNSPQFERPSYETSVSRFEAVGTSVITVFAFDNDAAHNAEITYSLEIDTTAGEEHQNDLDFFEL---VNRRSGEITLIKPIPMKTQ--KFIFNVIADDNGIPEALQSSAQVTLNVLDKQQKAPKWQTSPD---CKPGITVDENVELNKVILRCRAVSSGDSRNSDVIYKLTASGGPGNKAESKFRQFNKFENGNEWVEVVIMEGLDYEQVNNYTLTL----TATDMTSRVASTKTFVVEVRDVNDVVPQFTVDLFTGTIDEEMTPNEHLEKTNGKPIVTVKAID----TDSDGPQNE-VHYRIVGEANGEETKHFRIDELTGEIFPNEKFDREKIDMYILTVEASDRSVSALPGANGPNKDNVKVQIVINDVNDNAPSFEEQKYIGRVKESEGEGHDVITIKAHDLD---KHSNLRYHLIGAGGGRIPFGVRTDSGTIFVKEPLDFEASDQYHLVLIASDGRHNATTN-------VYIHIEDVNDNAPQF 1436          

HSP 3 Score: 104.375 bits (259), Expect = 3.830e-22
Identity = 143/603 (23.71%), Postives = 248/603 (41.13%), Query Frame = 2
Query:  440 ILIKVLDENDNSPKFLPFLNPYQTLPENSQINTVILLPSAIDLDSEAFGIKYYKISK-----PFLIGNDSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKLVNVISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLI--ATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIE-CSLDDYHLNFEITAINEIHPLGHYK----EFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLT-IHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADS-----GKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPP 2194
            + I + D NDN+P F       +      + + VI +  A DLD  +  ++Y+ I       PF +  DS              + +  PLD E   +Y  +L A      D R  +   V I + D+NDN P F++  Y   ++E    +  + F V   D  Q+++ S  +        D++ R  +        +G+I L+  +D +      S+N +  A D+    L   A V + + + ND +P+      G I          E  R  + S  V   D    D +  + ++ ++ + I     I+    ++       I  ++ LDRE    +   I +  +D+    P       + I + D+NDN P F +++Y+G + E  P     M       D++   N + TY++      +D+ Y T D DS     G +  +Q +DYE         + I        + A + V ++D ND+AP          VRE+VP  T IG+   TD D        ++     ++  +   +DQ+ G L+    +DRE +    ++I A     Y N N +  + MV + ++DVNDN P
Sbjct: 1321 VQIVINDVNDNAPSFEEQKYIGRVKESEGEGHDVITI-KAHDLDKHS-NLRYHLIGAGGGRIPFGVRTDSG------------TIFVKEPLDFEASDQYHLVLIA-----SDGRHNATTNVYIHIEDVNDNAPQFEQQKYATTVIEEDVDIPKVLFNVHATDADQDEKSSRIVYRLEGQGADEVFRIGK-------YSGTIELVKALDRDPPAGVPSWNFVVQAIDDDGNGLVGYADVQVNVRDINDNSPIFPERLFGYI----------EENREPIHSDGVYFMDVQARDFDDPTTENANIEYGIVRNKLINGESVFRIDQNTGKIFAMRSLDREISSEREFIIEVRANDRG--VPSREGFANVTIKVTDMNDNAPFFEKTRYEGSVEETAPIGAAVMSFSAFDADEEAKDNVF-TYQL---SEESDYFYVTTDKDSKQSSVGVLRVKQPLDYEDVTQRDGFHLGIRVSDGRHDAEAAVHVALVDRNDHAPHI-HGATEHRVREDVPRGTSIGRYTATDRDA---GDTARFRINRQSDPKRQFTIDQD-GTLRVAHTLDREDIAVYNLIIEA-----YDNSNNIGRQ-MVAVYLQDVNDNGP 1870          

HSP 4 Score: 97.4413 bits (241), Expect = 4.336e-20
Identity = 131/519 (25.24%), Postives = 217/519 (41.81%), Query Frame = 2
Query:  695 LDREVISEYRFILKAVDRENDDHRDISG-----VEVEIKVGDINDNPPVFDKTFYTANIVE-HSKLVNVISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITAINEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRS--KYQGELIENIPQATVKMIE-PILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYE--KNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNS-----GKLKTIGPIDREKVRSITILITARNEASYQ---NKNLMDSECMVIITIEDVNDNPP 2194
             DRE I  Y   ++A DR        +G     V+V+I + D+NDN P F++  Y   + E   +  +VI+    DLD+  N +  +                 +I F     +G+I + + +D+E +  +Y   LIA+D    R ++T  V I + + ND AP  +  +    V     + E+     ++ ++  +D D    D + S   Y L  E    +E+  +G Y    I  +K LDR+          +  +  D    L     + +N+ DINDN P+F      Y  E  E I    V  ++      D    +NA + Y I  +K       F ID ++GKI + +S+D E    + F   + A D+   +    A + + V D NDNAP F K  Y  +V E  P+   +      D D   ++ +  Y   S  ++Y  +  D++S     G L+   P+D E V       T R+        +    D+E  V + + D ND+ P
Sbjct: 1286 FDREKIDMYILTVEASDRSVSALPGANGPNKDNVKVQIVINDVNDNAPSFEEQKYIGRVKESEGEGHDVITIKAHDLDKHSNLRYHLIGAGGG-----------RIPFGVRTDSGTIFVKEPLDFEASD-QYHLVLIASDG---RHNATTNVYIHIEDVNDNAPQFEQQKYATTV-----IEEDVDIPKVLFNVHATDADQ---DEKSSRIVYRL--EGQGADEVFRIGKYSG-TIELVKALDRDPPAGVPSWNFVVQAIDDDGNGLVGYADVQVNVRDINDNSPIFPERLFGYIEENREPIHSDGVYFMDVQARDFDDPTTENANIEYGIVRNKLINGESVFRIDQNTGKIFAMRSLDREISSEREFIIEVRANDRGVPSREGFANVTIKVTDMNDNAPFFEKTRYEGSVEETAPIGAAVMSFSAFDADEEAKDNVFTY-QLSEESDYFYVTTDKDSKQSSVGVLRVKQPLDYEDV-------TQRDGFHLGIRVSDGRHDAEAAVHVALVDRNDHAP 1770          

HSP 5 Score: 89.7373 bits (221), Expect = 1.093e-17
Identity = 158/624 (25.32%), Postives = 256/624 (41.03%), Query Frame = 2
Query:  440 ILIKVLDENDNSPKFLPFLNPYQTLPENSQINTVILLPSAIDLDSEAFGIK-YYKISKPFLIGNDSHFTLLDKIASGRPQLLLISPLDRE---VISEYRFILKAVDRENDDHRDISG-VEVEIKVGDINDNPPVFDKTFYTANIVE-----HSKLVNVISFYVTDLDEGQNKQVSITIETENDYKKDQI---KRFFQIDFSPSLMTGSIRLIDEIDYE-TNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTD--IECSLDDYHLNFEITAINEIHPLGHYKEFIINTLKPLDRED-DKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAP---IFPKPHYSFTVRENVPVNTEIG--QIETTDLDTR-----------PENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPI---DRE-----KVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDN 2188
            + I + D NDN+P+F         + E+  I  V+    A D D +    +  Y++      G D  F    +I      + L+  LDR+    +  + F+++A+D   DD   + G  +V++ V DINDN P+F +  +   I E     HS  V  +     D D+   +  +I    E    ++++   +  F+ID +    TG I  +  +D E ++  ++   + A D G+P     A V I + + ND AP  +  R    V       E  P    V S    D D    D      L +    F +T   +          ++   +PLD ED  +     + I  SD            +H+ L D ND+ P       +  + E++P+ T   I      D+D G  A   ++I+  + S     FTID D G +    ++D E   +  +N+I    D SN     ++ V++ D NDN P     P+P      REN PVN ++G  +I  TD DT            P  K  +Y +  +  N      D  +G + TI P+   DRE     K+  I +++  R  A  +N      E  V + I D+NDN
Sbjct: 1422 VYIHIEDVNDNAPQFEQQKYATTVIEEDVDIPKVLFNVHATDADQDEKSSRIVYRLEGQ---GADEVF----RIGKYSGTIELVKALDRDPPAGVPSWNFVVQAID---DDGNGLVGYADVQVNVRDINDNSPIFPERLF-GYIEENREPIHSDGVYFMDVQARDFDDPTTENANI----EYGIVRNKLINGESVFRIDQN----TGKIFAMRSLDREISSEREFIIEVRANDRGVPSREGFANVTIKVTDMNDNAPFFEKTRYEGSVE------ETAPIGAAVMSFSAFDADEEAKDNVFTYQLSEESDYFYVTTDKDSK---QSSVGVLRVKQPLDYEDVTQRDGFHLGIRVSDGRH----DAEAAVHVALVDRNDHAP-HIHGATEHRVREDVPRGT--SIGRYTATDRDAGDTA--RFRIN--RQSDPKRQFTIDQD-GTLRVAHTLDRED--IAVYNLIIEAYDNSNNIGRQMVAVYLQDVNDNGPEPYTVPRP---CIFRENTPVN-QLGTCEIRATDRDTAEFGPPFTMEVSPSFKYSQYLNVIFNANG-----DGGNGSM-TITPLQEFDREAPVPGKILEIPLILADR--AGRRN------EASVHVIIGDLNDN 1985          

HSP 6 Score: 80.8777 bits (198), Expect = 4.795e-15
Identity = 76/271 (28.04%), Postives = 136/271 (50.18%), Query Frame = 2
Query: 1484 NLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDY----EKNKLFSFNIIAIDKDQS-NLSSTALIIVHVIDANDNAPIF-PKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYF---HKSYTNNYQVIHVDQNSGKLKTIGPI------DREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIFSLINPAKSSLIFTINKG 2251
            +LTI I+  D+NDN P FTR  Y  ++ E+IP    + I  +  +DKD G N+ +TY +D+         F+I+++ G+IS++  +D     E++ ++ FN+ A D  +  +LSS+A+I +   + ND + +F P   Y+  V E+    T + QI+  D D    +++   F   +   T    +  +D+++G +K    +      + E   ++T+++               S   ++I IEDVN+N P F   + AK S I  I +G
Sbjct:  627 DLTIRID--DVNDNVPTFTRPLYTAQVREDIPLN--QTILKVTAVDKDTGDNSRITYSVDNHN-------FSINSN-GEISAKVRLDADQLNERHFVYRFNVTARDHGEPVSLSSSAMIHIRTENTNDESAVFLPTSQYTAFVAEDAQGGTPVIQIQARDAD---RDEVTYSFMDKNGRSTQKMNLFSIDEHTGLVKLRHGVSAADLAEAENPINLTVIVQDDGSCCVYPSKTHTSYATLLIGIEDVNNNKPEFP--DCAKYSDIAKIMEG 880          

HSP 7 Score: 78.1814 bits (191), Expect = 3.317e-14
Identity = 107/418 (25.60%), Postives = 179/418 (42.82%), Query Frame = 2
Query:  731 LKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKL-VNVISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLP-RLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYH----LNFEITAINEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPL-------TTNLTIHINLFDINDNPPVFTR-SKYQGELIENIPQATVKMIEPIL----TLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSI--DYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEI 1924
            LK   RE  D+R+ S V++ I++ D+NDN P F +  YTA + E   L   ++     D D G N +++ +++  N          F I+ S   ++  +RL D        + Y FN+ A D+G P  LSS+A ++I   N ND++ V        + +   T F  E A+     +Q+  RD+   ++  S  D +        + +I+E   L   +    + +   D  + +N    IN+    QD  +         T+  T+ I + D+N+N P F   +KY    I  I + T K   P +      D D   N  + Y +  ++ S   + F ID  +G ++    +  D E        + A D+    L       V V+D NDN+P F +P Y  +V     V T +
Sbjct:  613 LKVTARE--DNRE-SHVDLTIRIDDVNDNVPTFTRPLYTAQVREDIPLNQTILKVTAVDKDTGDNSRITYSVDNHN----------FSIN-SNGEISAKVRL-DADQLNERHFVYRFNVTARDHGEPVSLSSSAMIHIRTENTNDESAVF-------LPTSQYTAFVAEDAQGGTPVIQIQARDADRDEVTYSFMDKNGRSTQKMNLFSIDEHTGLVKLR----HGVSAADLAEAEN---PINLTVIVQDDGSCCVYPSKTHTSYATLLIGIEDVNNNKPEFPDCAKYSD--IAKIMEGTYKTDPPTIVKVEATDDDSSANGDIVYSLYYTQ-SESRKAFVIDRQTGVLTPSPHVVFDRETRPREDVTVKATDRGDRPLIGFCQFSVEVVDINDNSPQFERPSYETSVSRFEAVGTSV 998          

HSP 8 Score: 61.2326 bits (147), Expect = 4.653e-9
Identity = 61/282 (21.63%), Postives = 123/282 (43.62%), Query Frame = 2
Query: 1478 TTNLTIHINLFDI--NDNPPVFTRSKYQGELIEN--IPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIFSLINPAKSSLIFTINKGFRHENCQMIPYAVSDADHDE 2311
            TT+    + + +I  ++ PP F + +Y+  + E+  +  + V +        +D      +TY ++      + ++F ID  +G I   + +D++   L   + + +   + N  S   + + + D NDN P F +P Y+  VRE++P+N  I ++   D DT   ++I    +    +N+ +    + S K++       E+       +TAR+     +   + S  M+ I  E+ ND   +F L     ++ +    +G       +I     DAD DE
Sbjct:  509 TTSQLSEVAILEILADERPPQFAKQEYEVTVSEDNLVDYSVVDVKAQSFRSFEDGRSKGPITYSLEGDTPEDETKWFRIDPSTGIIHLTRLLDFDDPALPKLHKLKVTAREDNRESHVDLTIRIDDVNDNVPTFTRPLYTAQVREDIPLNQTILKVTAVDKDTGDNSRIT---YSVDNHNFSINSNGEISAKVRLDADQLNERHFVYRFNVTARDHGEPVS---LSSSAMIHIRTENTNDESAVF-LPTSQYTAFVAEDAQG----GTPVIQIQARDADRDE 779          

HSP 9 Score: 57.3806 bits (137), Expect = 8.333e-8
Identity = 125/535 (23.36%), Postives = 220/535 (41.12%), Query Frame = 2
Query:  719 YRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTA-----NIVEHSKLVNVISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEI------VSRSI---TMFENEPARTIVASLQVSDRDSLV-TDIECSLDDYHLNFEITAINEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFT-RSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYK-IDSSKNSTD-WEYFTIDADSGKISSRQSID----YEKNKLFSFNIIAIDKDQSNL------SSTALIIVHVIDANDNAPIFPK-PHYS-------FTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGP---IDREK--VRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIF 2200
            YR   +A+D    D+      EV I     ++ PP F K  Y       N+V++S +V+V +      ++G++K   IT   E D  +D+ K +F+ID  PS  TG I L   +D++             D  LP+L    K+ +     N ++ V   IR  ++       +R +    + E+ P    +  +   D+D+   + I  S+D++  NF I +  EI                 D+ ++++   + N+   D  +   L+++  IHI   + ND   VF   S+Y   + E+    T     P++ +         VTY  +D +  ST     F+ID  +G +  R  +      E     +  +I  D     +      +S A +++ + D N+N P FP    YS        T + + P    I ++E TD D+     IV   + + + + +   +D+ +G L T  P    DRE      +T+  T R +        +   C   + + D+NDN P F
Sbjct:  494 YRISAQAMDLSPSDNTTSQLSEVAILEILADERPPQFAKQEYEVTVSEDNLVDYS-VVDVKAQSFRSFEDGRSKG-PITYSLEGDTPEDETK-WFRID--PS--TGIIHLTRLLDFD-------------DPALPKLH---KLKVTAREDNRESHVDLTIRIDDVNDNVPTFTRPLYTAQVREDIPLNQTILKVTAVDKDTGDNSRITYSVDNH--NFSINSNGEISA---------KVRLDADQLNERHFVYRFNVTARDHGEPVSLSSSAMIHIRTENTNDESAVFLPTSQYTAFVAEDAQGGT-----PVIQIQARDADRDEVTYSFMDKNGRSTQKMNLFSIDEHTGLVKLRHGVSAADLAEAENPINLTVIVQDDGSCCVYPSKTHTSYATLLIGIEDVNNNKPEFPDCAKYSDIAKIMEGTYKTDPPT---IVKVEATDDDSSANGDIVYSLYYTQSESRKAFVIDRQTGVL-TPSPHVVFDRETRPREDVTVKATDRGDRP------LIGFCQFSVEVVDINDNSPQF 979          
BLAST of Protocadherin Fat 1 vs. Ensembl Celegans
Match: hmr-1 (Cadherin-related hmr-1 [Source:UniProtKB/Swiss-Prot;Acc:Q967F4])

HSP 1 Score: 111.694 bits (278), Expect = 2.171e-24
Identity = 167/630 (26.51%), Postives = 273/630 (43.33%), Query Frame = 2
Query:  428 SSFYILIKVLDENDNSPKFL--PFLNPYQTLPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGN--DSHFTLLDKIASGRP--QLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVE------HSKLVN---VISFYVTDLD-EGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSST-------AKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITAINEIHPLG-HYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIE---NIPQATVKMIEPILTLDKDHG-KNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKL---FSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTE---IGQIETTDLD-TRPENKIVKY--FHKSYTNNYQVIHVDQNSGKLKTIGPIDRE--KVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIF 2200
            SS  + + VLD+   +PK+   P   P  T+ EN ++N VIL   A+           YK++     GN  +S F   +K  +G    +++++  LD E ++ Y   L A D  +   R  S     ++V D+ND  P F    +T  I E      H +  N   +++    D D +G   +V   I  E + ++    + F+ID     +TG I   ++ D E     Y   + A+D  +  L           KV I++ + ND AP  +   + + + R   + E+E     V +++  D D      + S   YHL   I A     P G       I   +PLD E   +QY  + I     D     TTN+ IHI   D+NDN P F + KY   +IE   +IP    K++  +   D D   K++ + Y+++        E F I   SG I   +++D +       ++F + AID D + L   A + V+V D NDN+PIFP+  + +      P++++      ++  D D    EN  ++Y        N   V  +DQN+GK+  +  +DRE    R   I + A +      +   +    V I + D+NDN P F
Sbjct: 1075 SSAQVTLNVLDKQQKAPKWQTSPDCKPGITVDENVELNKVILRCRAVSSGDSRNSDVIYKLTASGGPGNKAESKFRQFNKFENGNEWVEVVIMEGLDYEQVNNYTLTLTATDMTS---RVASTKTFVVEVRDVNDVVPQFTVDLFTGTIDEEMTPNEHLEKTNGKPIVTVKAIDTDSDGPQNEVHYRIVGEANGEE---TKHFRID----ELTGEIFPNEKFDREKIDM-YILTVEASDRSVSALPGANGPNKDNVKVQIVINDVNDNAPSFE---EQKYIGR---VKESEGEGHDVITIKAHDLD------KHSNLRYHL---IGAGGGRIPFGVRTDSGTIFVKEPLDFEA-SDQYHLVLIA---SDGRHNATTNVYIHIE--DVNDNAPQFEQQKYATTVIEEDVDIP----KVLFNVHATDADQDEKSSRIVYRLEGQGAD---EVFRIGKYSGTIELVKALDRDPPAGVPSWNFVVQAIDDDGNGLVGYADVQVNVRDINDNSPIFPERLFGYIEENREPIHSDGVYFMDVQARDFDDPTTENANIEYGIVRNKLINGESVFRIDQNTGKIFAMRSLDREISSEREFIIEVRANDRGVPSREGFAN----VTIKVTDMNDNAPFF 1661          

HSP 2 Score: 107.842 bits (268), Expect = 2.731e-23
Identity = 161/643 (25.04%), Postives = 273/643 (42.46%), Query Frame = 2
Query:  377 DECCTVFSFQVDSGIKISSFYILIKVLDENDNSPKFLPFLNPYQTLPENSQIN-----TVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLISP---LDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKL-VNVISFYVTDLDEGQNKQVSITIETENDYKKDQIKR--FFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPR-LSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFEN-EPARTIVASLQVSDRDSLVTDI--ECSLDDYHLNFEITAINEIHPLGHYKEFI-INTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENI------------PQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSST-------ALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIF 2200
            D  C V+     S    S   +LI + D N+N P+F P    Y  + +  +         I+   A D DS A G   Y +   +   ++S    +    +G   +L  SP    DRE        +KA DR   D   I   +  ++V DINDN P F++  Y  ++     +  +VI+ +  D D   N +++ ++E +    ++      FF++    +  +G I LI  I  +T   K+ FN+IA DNG+P  L S+A+V + +++K  +AP  +           IT+ EN E  + I+    VS  DS  +D+  + +      N   +   + +   +  E++ +  ++ LD E   N  L +    +  D  + + +  T  + + D+ND  P FT   + G + E +            P  TVK I+     D D  +N  V Y+I    N  + ++F ID  +G+I   +  D EK  ++   + A D+  S L            + + + D NDNAP F +  Y   V+E+     ++  I+  DLD   ++  ++Y             V  +SG +    P+D E      +++ A +       N       V I IEDVNDN P F
Sbjct:  834 DGSCCVYP----SKTHTSYATLLIGIEDVNNNKPEF-PDCAKYSDIAKIMEGTYKTDPPTIVKVEATDDDSSANGDIVYSL---YYTQSESRKAFVIDRQTG---VLTPSPHVVFDRETRPREDVTVKATDR--GDRPLIGFCQFSVEVVDINDNSPQFERPSYETSVSRFEAVGTSVITVFAFDNDAAHNAEITYSLEIDTTAGEEHQNDLDFFEL---VNRRSGEITLIKPIPMKTQ--KFIFNVIADDNGIPEALQSSAQVTLNVLDKQQKAPKWQTSPD---CKPGITVDENVELNKVILRCRAVSSGDSRNSDVIYKLTASGGPGNKAESKFRQFNKFENGNEWVEVVIMEGLDYEQVNNYTLTL----TATDMTSRVASTKTFVVEVRDVNDVVPQFTVDLFTGTIDEEMTPNEHLEKTNGKPIVTVKAID----TDSDGPQNE-VHYRIVGEANGEETKHFRIDELTGEIFPNEKFDREKIDMYILTVEASDRSVSALPGANGPNKDNVKVQIVINDVNDNAPSFEEQKYIGRVKESEGEGHDVITIKAHDLD---KHSNLRYHLIGAGGGRIPFGVRTDSGTIFVKEPLDFEASDQYHLVLIASDGRHNATTN-------VYIHIEDVNDNAPQF 1436          

HSP 3 Score: 104.375 bits (259), Expect = 3.830e-22
Identity = 143/603 (23.71%), Postives = 248/603 (41.13%), Query Frame = 2
Query:  440 ILIKVLDENDNSPKFLPFLNPYQTLPENSQINTVILLPSAIDLDSEAFGIKYYKISK-----PFLIGNDSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKLVNVISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLI--ATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIE-CSLDDYHLNFEITAINEIHPLGHYK----EFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLT-IHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADS-----GKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPP 2194
            + I + D NDN+P F       +      + + VI +  A DLD  +  ++Y+ I       PF +  DS              + +  PLD E   +Y  +L A      D R  +   V I + D+NDN P F++  Y   ++E    +  + F V   D  Q+++ S  +        D++ R  +        +G+I L+  +D +      S+N +  A D+    L   A V + + + ND +P+      G I          E  R  + S  V   D    D +  + ++ ++ + I     I+    ++       I  ++ LDRE    +   I +  +D+    P       + I + D+NDN P F +++Y+G + E  P     M       D++   N + TY++      +D+ Y T D DS     G +  +Q +DYE         + I        + A + V ++D ND+AP          VRE+VP  T IG+   TD D        ++     ++  +   +DQ+ G L+    +DRE +    ++I A     Y N N +  + MV + ++DVNDN P
Sbjct: 1321 VQIVINDVNDNAPSFEEQKYIGRVKESEGEGHDVITI-KAHDLDKHS-NLRYHLIGAGGGRIPFGVRTDSG------------TIFVKEPLDFEASDQYHLVLIA-----SDGRHNATTNVYIHIEDVNDNAPQFEQQKYATTVIEEDVDIPKVLFNVHATDADQDEKSSRIVYRLEGQGADEVFRIGK-------YSGTIELVKALDRDPPAGVPSWNFVVQAIDDDGNGLVGYADVQVNVRDINDNSPIFPERLFGYI----------EENREPIHSDGVYFMDVQARDFDDPTTENANIEYGIVRNKLINGESVFRIDQNTGKIFAMRSLDREISSEREFIIEVRANDRG--VPSREGFANVTIKVTDMNDNAPFFEKTRYEGSVEETAPIGAAVMSFSAFDADEEAKDNVF-TYQL---SEESDYFYVTTDKDSKQSSVGVLRVKQPLDYEDVTQRDGFHLGIRVSDGRHDAEAAVHVALVDRNDHAPHI-HGATEHRVREDVPRGTSIGRYTATDRDA---GDTARFRINRQSDPKRQFTIDQD-GTLRVAHTLDREDIAVYNLIIEA-----YDNSNNIGRQ-MVAVYLQDVNDNGP 1870          

HSP 4 Score: 97.4413 bits (241), Expect = 4.336e-20
Identity = 131/519 (25.24%), Postives = 217/519 (41.81%), Query Frame = 2
Query:  695 LDREVISEYRFILKAVDRENDDHRDISG-----VEVEIKVGDINDNPPVFDKTFYTANIVE-HSKLVNVISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITAINEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRS--KYQGELIENIPQATVKMIE-PILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYE--KNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNS-----GKLKTIGPIDREKVRSITILITARNEASYQ---NKNLMDSECMVIITIEDVNDNPP 2194
             DRE I  Y   ++A DR        +G     V+V+I + D+NDN P F++  Y   + E   +  +VI+    DLD+  N +  +                 +I F     +G+I + + +D+E +  +Y   LIA+D    R ++T  V I + + ND AP  +  +    V     + E+     ++ ++  +D D    D + S   Y L  E    +E+  +G Y    I  +K LDR+          +  +  D    L     + +N+ DINDN P+F      Y  E  E I    V  ++      D    +NA + Y I  +K       F ID ++GKI + +S+D E    + F   + A D+   +    A + + V D NDNAP F K  Y  +V E  P+   +      D D   ++ +  Y   S  ++Y  +  D++S     G L+   P+D E V       T R+        +    D+E  V + + D ND+ P
Sbjct: 1286 FDREKIDMYILTVEASDRSVSALPGANGPNKDNVKVQIVINDVNDNAPSFEEQKYIGRVKESEGEGHDVITIKAHDLDKHSNLRYHLIGAGGG-----------RIPFGVRTDSGTIFVKEPLDFEASD-QYHLVLIASDG---RHNATTNVYIHIEDVNDNAPQFEQQKYATTV-----IEEDVDIPKVLFNVHATDADQ---DEKSSRIVYRL--EGQGADEVFRIGKYSG-TIELVKALDRDPPAGVPSWNFVVQAIDDDGNGLVGYADVQVNVRDINDNSPIFPERLFGYIEENREPIHSDGVYFMDVQARDFDDPTTENANIEYGIVRNKLINGESVFRIDQNTGKIFAMRSLDREISSEREFIIEVRANDRGVPSREGFANVTIKVTDMNDNAPFFEKTRYEGSVEETAPIGAAVMSFSAFDADEEAKDNVFTY-QLSEESDYFYVTTDKDSKQSSVGVLRVKQPLDYEDV-------TQRDGFHLGIRVSDGRHDAEAAVHVALVDRNDHAP 1770          

HSP 5 Score: 89.7373 bits (221), Expect = 1.093e-17
Identity = 158/624 (25.32%), Postives = 256/624 (41.03%), Query Frame = 2
Query:  440 ILIKVLDENDNSPKFLPFLNPYQTLPENSQINTVILLPSAIDLDSEAFGIK-YYKISKPFLIGNDSHFTLLDKIASGRPQLLLISPLDRE---VISEYRFILKAVDRENDDHRDISG-VEVEIKVGDINDNPPVFDKTFYTANIVE-----HSKLVNVISFYVTDLDEGQNKQVSITIETENDYKKDQI---KRFFQIDFSPSLMTGSIRLIDEIDYE-TNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTD--IECSLDDYHLNFEITAINEIHPLGHYKEFIINTLKPLDRED-DKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAP---IFPKPHYSFTVRENVPVNTEIG--QIETTDLDTR-----------PENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPI---DRE-----KVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDN 2188
            + I + D NDN+P+F         + E+  I  V+    A D D +    +  Y++      G D  F    +I      + L+  LDR+    +  + F+++A+D   DD   + G  +V++ V DINDN P+F +  +   I E     HS  V  +     D D+   +  +I    E    ++++   +  F+ID +    TG I  +  +D E ++  ++   + A D G+P     A V I + + ND AP  +  R    V       E  P    V S    D D    D      L +    F +T   +          ++   +PLD ED  +     + I  SD            +H+ L D ND+ P       +  + E++P+ T   I      D+D G  A   ++I+  + S     FTID D G +    ++D E   +  +N+I    D SN     ++ V++ D NDN P     P+P      REN PVN ++G  +I  TD DT            P  K  +Y +  +  N      D  +G + TI P+   DRE     K+  I +++  R  A  +N      E  V + I D+NDN
Sbjct: 1422 VYIHIEDVNDNAPQFEQQKYATTVIEEDVDIPKVLFNVHATDADQDEKSSRIVYRLEGQ---GADEVF----RIGKYSGTIELVKALDRDPPAGVPSWNFVVQAID---DDGNGLVGYADVQVNVRDINDNSPIFPERLF-GYIEENREPIHSDGVYFMDVQARDFDDPTTENANI----EYGIVRNKLINGESVFRIDQN----TGKIFAMRSLDREISSEREFIIEVRANDRGVPSREGFANVTIKVTDMNDNAPFFEKTRYEGSVE------ETAPIGAAVMSFSAFDADEEAKDNVFTYQLSEESDYFYVTTDKDSK---QSSVGVLRVKQPLDYEDVTQRDGFHLGIRVSDGRH----DAEAAVHVALVDRNDHAP-HIHGATEHRVREDVPRGT--SIGRYTATDRDAGDTA--RFRIN--RQSDPKRQFTIDQD-GTLRVAHTLDRED--IAVYNLIIEAYDNSNNIGRQMVAVYLQDVNDNGPEPYTVPRP---CIFRENTPVN-QLGTCEIRATDRDTAEFGPPFTMEVSPSFKYSQYLNVIFNANG-----DGGNGSM-TITPLQEFDREAPVPGKILEIPLILADR--AGRRN------EASVHVIIGDLNDN 1985          

HSP 6 Score: 80.8777 bits (198), Expect = 4.795e-15
Identity = 76/271 (28.04%), Postives = 136/271 (50.18%), Query Frame = 2
Query: 1484 NLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDY----EKNKLFSFNIIAIDKDQS-NLSSTALIIVHVIDANDNAPIF-PKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYF---HKSYTNNYQVIHVDQNSGKLKTIGPI------DREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIFSLINPAKSSLIFTINKG 2251
            +LTI I+  D+NDN P FTR  Y  ++ E+IP    + I  +  +DKD G N+ +TY +D+         F+I+++ G+IS++  +D     E++ ++ FN+ A D  +  +LSS+A+I +   + ND + +F P   Y+  V E+    T + QI+  D D    +++   F   +   T    +  +D+++G +K    +      + E   ++T+++               S   ++I IEDVN+N P F   + AK S I  I +G
Sbjct:  627 DLTIRID--DVNDNVPTFTRPLYTAQVREDIPLN--QTILKVTAVDKDTGDNSRITYSVDNHN-------FSINSN-GEISAKVRLDADQLNERHFVYRFNVTARDHGEPVSLSSSAMIHIRTENTNDESAVFLPTSQYTAFVAEDAQGGTPVIQIQARDAD---RDEVTYSFMDKNGRSTQKMNLFSIDEHTGLVKLRHGVSAADLAEAENPINLTVIVQDDGSCCVYPSKTHTSYATLLIGIEDVNNNKPEFP--DCAKYSDIAKIMEG 880          

HSP 7 Score: 78.1814 bits (191), Expect = 3.317e-14
Identity = 107/418 (25.60%), Postives = 179/418 (42.82%), Query Frame = 2
Query:  731 LKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKL-VNVISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLP-RLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYH----LNFEITAINEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPL-------TTNLTIHINLFDINDNPPVFTR-SKYQGELIENIPQATVKMIEPIL----TLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSI--DYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEI 1924
            LK   RE  D+R+ S V++ I++ D+NDN P F +  YTA + E   L   ++     D D G N +++ +++  N          F I+ S   ++  +RL D        + Y FN+ A D+G P  LSS+A ++I   N ND++ V        + +   T F  E A+     +Q+  RD+   ++  S  D +        + +I+E   L   +    + +   D  + +N    IN+    QD  +         T+  T+ I + D+N+N P F   +KY    I  I + T K   P +      D D   N  + Y +  ++ S   + F ID  +G ++    +  D E        + A D+    L       V V+D NDN+P F +P Y  +V     V T +
Sbjct:  613 LKVTARE--DNRE-SHVDLTIRIDDVNDNVPTFTRPLYTAQVREDIPLNQTILKVTAVDKDTGDNSRITYSVDNHN----------FSIN-SNGEISAKVRL-DADQLNERHFVYRFNVTARDHGEPVSLSSSAMIHIRTENTNDESAVF-------LPTSQYTAFVAEDAQGGTPVIQIQARDADRDEVTYSFMDKNGRSTQKMNLFSIDEHTGLVKLR----HGVSAADLAEAEN---PINLTVIVQDDGSCCVYPSKTHTSYATLLIGIEDVNNNKPEFPDCAKYSD--IAKIMEGTYKTDPPTIVKVEATDDDSSANGDIVYSLYYTQ-SESRKAFVIDRQTGVLTPSPHVVFDRETRPREDVTVKATDRGDRPLIGFCQFSVEVVDINDNSPQFERPSYETSVSRFEAVGTSV 998          

HSP 8 Score: 61.2326 bits (147), Expect = 4.653e-9
Identity = 61/282 (21.63%), Postives = 123/282 (43.62%), Query Frame = 2
Query: 1478 TTNLTIHINLFDI--NDNPPVFTRSKYQGELIEN--IPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIFSLINPAKSSLIFTINKGFRHENCQMIPYAVSDADHDE 2311
            TT+    + + +I  ++ PP F + +Y+  + E+  +  + V +        +D      +TY ++      + ++F ID  +G I   + +D++   L   + + +   + N  S   + + + D NDN P F +P Y+  VRE++P+N  I ++   D DT   ++I    +    +N+ +    + S K++       E+       +TAR+     +   + S  M+ I  E+ ND   +F L     ++ +    +G       +I     DAD DE
Sbjct:  509 TTSQLSEVAILEILADERPPQFAKQEYEVTVSEDNLVDYSVVDVKAQSFRSFEDGRSKGPITYSLEGDTPEDETKWFRIDPSTGIIHLTRLLDFDDPALPKLHKLKVTAREDNRESHVDLTIRIDDVNDNVPTFTRPLYTAQVREDIPLNQTILKVTAVDKDTGDNSRIT---YSVDNHNFSINSNGEISAKVRLDADQLNERHFVYRFNVTARDHGEPVS---LSSSAMIHIRTENTNDESAVF-LPTSQYTAFVAEDAQG----GTPVIQIQARDADRDE 779          

HSP 9 Score: 57.3806 bits (137), Expect = 8.333e-8
Identity = 125/535 (23.36%), Postives = 220/535 (41.12%), Query Frame = 2
Query:  719 YRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTA-----NIVEHSKLVNVISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEI------VSRSI---TMFENEPARTIVASLQVSDRDSLV-TDIECSLDDYHLNFEITAINEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFT-RSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYK-IDSSKNSTD-WEYFTIDADSGKISSRQSID----YEKNKLFSFNIIAIDKDQSNL------SSTALIIVHVIDANDNAPIFPK-PHYS-------FTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGP---IDREK--VRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIF 2200
            YR   +A+D    D+      EV I     ++ PP F K  Y       N+V++S +V+V +      ++G++K   IT   E D  +D+ K +F+ID  PS  TG I L   +D++             D  LP+L    K+ +     N ++ V   IR  ++       +R +    + E+ P    +  +   D+D+   + I  S+D++  NF I +  EI                 D+ ++++   + N+   D  +   L+++  IHI   + ND   VF   S+Y   + E+    T     P++ +         VTY  +D +  ST     F+ID  +G +  R  +      E     +  +I  D     +      +S A +++ + D N+N P FP    YS        T + + P    I ++E TD D+     IV   + + + + +   +D+ +G L T  P    DRE      +T+  T R +        +   C   + + D+NDN P F
Sbjct:  494 YRISAQAMDLSPSDNTTSQLSEVAILEILADERPPQFAKQEYEVTVSEDNLVDYS-VVDVKAQSFRSFEDGRSKG-PITYSLEGDTPEDETK-WFRID--PS--TGIIHLTRLLDFD-------------DPALPKLH---KLKVTAREDNRESHVDLTIRIDDVNDNVPTFTRPLYTAQVREDIPLNQTILKVTAVDKDTGDNSRITYSVDNH--NFSINSNGEISA---------KVRLDADQLNERHFVYRFNVTARDHGEPVSLSSSAMIHIRTENTNDESAVFLPTSQYTAFVAEDAQGGT-----PVIQIQARDADRDEVTYSFMDKNGRSTQKMNLFSIDEHTGLVKLRHGVSAADLAEAENPINLTVIVQDDGSCCVYPSKTHTSYATLLIGIEDVNNNKPEFPDCAKYSDIAKIMEGTYKTDPPT---IVKVEATDDDSSANGDIVYSLYYTQSESRKAFVIDRQTGVL-TPSPHVVFDRETRPREDVTVKATDRGDRP------LIGFCQFSVEVVDINDNSPQF 979          
BLAST of Protocadherin Fat 1 vs. Ensembl Fly
Match: ds (gene:FBgn0284247 transcript:FBtr0078045)

HSP 1 Score: 184.496 bits (467), Expect = 1.192e-46
Identity = 172/598 (28.76%), Postives = 287/598 (47.99%), Query Frame = 2
Query:  440 ILIKVLDENDNSPKFLPFLNPYQTLPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQ-------LLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKL-VNVISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLV--TDIECSLDDYHLNFEITAI-NEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIF 2200
            +L+ V DENDN+P F P  + +   PEN+       L  A DLD E +  + Y I    +  ND+      +++S R +       L +   LDRE    Y  +++A+D      R    + V I + D+NDN P+F+++ Y A + E++ +  +V+  Y +D D  +N  V   I   N  + D+ ++ F+ID      TG+I +   +D+ET    +   ++A D+G   L +TA V+I + + ND  P I VI   +  S  I+  E+      VA + V D DS     ++  +L+    +F +T   N I        +++    PLDRE   N  L  ++  +D+    PL  + +I + + D+NDNPP F +  Y   ++E     T  +   +L  D+D G N+ +TY +  +   T  ++F ID  +G I++R  ID E   +    ++A D     LSSTA ++V + D NDN PIF +  Y+ +V EN PV   I ++  +D D    N +V Y       +     V   SG++   G +D E+  S    + A       ++  + +  M+ + + DVNDN P+F
Sbjct:  160 VLVTVKDENDNAPTF-PQTSMHIEFPENTPREVKRTLLPARDLDLEPYNTQRYNIVSGNV--NDAF-----RLSSHRERDGVLYLDLQISGFLDRETTPGYSLLIEALDGGTPPLRGF--MTVNITIQDVNDNQPIFNQSRYFATVPENATVGTSVLQVYASDTDADENGLVEYAI---NRRQSDK-EQMFRID----PRTGAIYINKALDFETKEL-HELVVVAKDHGEQPLETTAFVSIRVTDVNDNQPTINVIFLSDDASPKIS--ESAQPGEFVARISVHDPDSKTEYANVNVTLNGGDGHFALTTRDNSI--------YLVIVHLPLDREIVSNYTL--SVVATDKGT-PPLHASKSIFLRITDVNDNPPEFEQDLYHANVMEVADPGTSVL--QVLAHDRDEGLNSALTYSLAETPE-THAQWFQIDPQTGLITTRSHIDCETEPVPQLTVVARDGGVPPLSSTATVLVTIHDVNDNEPIFDQSFYNVSVAENEPVGRCILKVSASDPDCG-VNAMVNYTIGEGFKHLTEFEVRSASGEICIAGELDFERRSSYEFPVLA------TDRGGLSTTAMIKMQLTDVNDNRPVF 715          

HSP 2 Score: 155.221 bits (391), Expect = 1.239e-37
Identity = 187/738 (25.34%), Postives = 329/738 (44.58%), Query Frame = 2
Query:  428 SSFYILIKVLDENDNSPKF-LPFL--NPYQTLPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLIS-PLDREVISEYRFILKAVDRENDD-HRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHS-KLVNVISFYVTDLDEGQNKQVSITI-ETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITAINEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIEN---IPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQS--IDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIFSLINPAKSSLIFTINKGFRHENCQM-IPYAVSDADHDEPNSDSCCILQLDNDQNGMLYLLSNTPNFLCLQNTMNTPGIYRVSL--TATDNKNNPNKSLKAKVSFNIDVRHEVSDN-PFSEKSDNKVHTTKNQYYN 2593
            ++ ++ I+V D NDN P   + FL  +    + E++Q    +   S  D DS+    +Y  ++   L G D HF L  +  S    L+++  PLDRE++S Y   + A D+     H   S   + +++ D+NDNPP F++  Y AN++E +    +V+     D DEG N  ++ ++ ET   + +     +FQID      TG I     ID ET P      ++A D G+P LSSTA V + + + ND  P+       +    ++++ ENEP    +  +  SD D  V     ++ +Y +      + E        E  I      +R   ++ Y +  +  +D+  L+   T   I + L D+NDN PVF   +Y+  L E+     QA+   I  ++  D D+G    V+Y+I +   +     F ID  +G+I   +   +      +   NI A D      ++ A++ + +IDA    PIF K  Y++ V+E++P  T +G +     D    + +    +    + Y    ++ NSG ++   P+D E    + + I A        +  +     V I +EDVNDN P F      ++S++    +    E+ ++  P   + A   +  S       L  +    L+ +      L L   ++     R +L  TATD       SL   ++  +DV+ +V+DN P  EK +  V+ ++++  N
Sbjct:  375 TTAFVSIRVTDVNDNQPTINVIFLSDDASPKISESAQPGEFVARISVHDPDSKT---EYANVNV-TLNGGDGHFALTTRDNS--IYLVIVHLPLDREIVSNYTLSVVATDKGTPPLHASKS---IFLRITDVNDNPPEFEQDLYHANVMEVADPGTSVLQVLAHDRDEGLNSALTYSLAETPETHAQ-----WFQID----PQTGLITTRSHIDCETEPVP-QLTVVARDGGVPPLSSTATVLVTIHDVNDNEPIF------DQSFYNVSVAENEPVGRCILKVSASDPDCGVN----AMVNYTIGEGFKHLTEFEVRSASGEICIAGELDFER---RSSY-EFPVLATDRGGLS---TTAMIKMQLTDVNDNRPVFYPREYKVSLRESPKASSQASSTPIVAVVATDPDYGNFGQVSYRIVAGNEAG---IFRIDRSTGEIFVVRPDMLSVRTQPMHMLNISATDGGNLRSNADAVVFLSIIDAMQRPPIFEKARYNYYVKEDIPRGTVVGSVIAASGDVAHRSPVRYSIYSGDPDGY--FSIETNSGNIRIAKPLDHEAKSQVLLNIQA-----TLGEPPVYGHTQVNIEVEDVNDNAPEF------EASMV----RISVPESAELGAPLYAAHAHDKDSGSSGQVTYSLVKESGKGLFAIDARSGHLILSQHLDYESSQRHTLIVTATDGG---VPSLSTNLTILVDVQ-DVNDNPPVFEKDEYSVNVSESRSIN 1052          

HSP 3 Score: 152.91 bits (385), Expect = 5.997e-37
Identity = 163/611 (26.68%), Postives = 273/611 (44.68%), Query Frame = 2
Query:  446 IKVLDENDNSPKFLPFLNPYQTLPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKL-VNVISFYVTDLDEGQNKQVSITI------ETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITAIN---EIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPL-TTNLTIHINLFDINDNPPVFTRSKYQGELI---ENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRP----ENKIVKYFHK---SYTNN-------YQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPP 2194
            I+V D NDN+P+F   +    ++PE++++   +    A D DS + G   Y + K    G       L  I +    L+L   LD E    +  I+ A D         + + + + V D+NDNPPVF+K  Y+ N+ E   +   +I    +DLD G N +++  I         N      + + F I F  S   G I L   +D ET   +Y   ++ATDNG P   +  +V + +++ ND  P      K +       + EN    ++V  +  SD D          ++  + + +  IN   ++HP+       I+T +PLDRE  +  Y   ++    +D+ TP+ +  + + I++ D+NDN P    +  Q +++   E  P  T   +  +  +D+DHG+NA +TY I   ++S     F+ID  SG I +R  +D+E+  ++   + A D       +  ++ V V+D NDN P F      F VRE+  +   +G I   +   RP     N + + F     +YT N            +D++SG L     +DRE      + I A +  +  + N   S   V I + DVNDN P
Sbjct:  919 IEVEDVNDNAPEFEASMVRI-SVPESAELGAPLYAAHAHDKDSGSSGQVTYSLVKESGKG-------LFAIDARSGHLILSQHLDYESSQRHTLIVTATDGGVPSLS--TNLTILVDVQDVNDNPPVFEKDEYSVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGI-FPNS---GWIYLRAPLDRETRD-RYQLTVLATDNGTPAAHAKTRVIVRVLDANDNDP------KFQKSKYEFRIEENLRRGSVVGVVTASDLDLG--------ENAAIRYSLLPINSSFQVHPVTGE----ISTREPLDREL-RELY---DLVVEARDQGTPVRSARVPVRIHVSDVNDNAPEI--ADPQEDVVSVREEQPPGT--EVVRVRAVDRDHGQNASITYSIVKGRDSDGHGLFSIDPTSGVIRTRVVLDHEERSIYRLGVAASDGGNPPRETVRMLRVEVLDLNDNRPTFTSSSLVFRVREDAALGHVVGSISPIE---RPADVVRNSVEESFEDLRVTYTLNPLTKDLIEAAFDIDRHSGNLVVARLLDREVQSEFRLEIRALDTTA--SNNPQSSAITVKIEVADVNDNAP 1483          

HSP 4 Score: 137.502 bits (345), Expect = 3.582e-32
Identity = 141/553 (25.50%), Postives = 254/553 (45.93%), Query Frame = 2
Query:  677 LLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKLVNVI-SFYVTDLDEGQNKQVS---ITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATD---NGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPART--IVASLQVSDRDSLVTDIECSLDDYHLNFEITAINEIHPLGHYKE-------FIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHG-KNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKD-QSNLSSTAL----------------------IIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIET---TDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIFSL 2206
            L++   LDREV SE+R  ++A+D    ++   S + V+I+V D+NDN P + +      + E + +  +I +F  TD D G N  +    I    + +  ++Q    F++D     +TG++ L   +D+E    +Y   + A D   N   RL ++  V + +++ ND AP    +       ++ ++F ++  R   +VA +   D DS         D+  L +EIT  N     G ++         ++ +L P   + +K     + I   D  +  P  ++L +H+ +   ++NPP F ++ Y+  ++EN+P  +  +    +T    HG +NA ++Y+I +   +   + F +D   G I++R   D E    +   +   D + QS LSS+A+                      I + V D NDN+P F +P   + +  +VP N+E G I T   +DLD  P   ++         N     +D +SG+L +  P+DRE+    T+ I A +    +++      C + I +ED NDN P F L
Sbjct: 1435 LVVARLLDREVQSEFRLEIRALDTTASNNPQSSAITVKIEVADVNDNAPEWPQDPIDLQVSEATPVGTIIHNFTATDADTGTNGDLQYRLIRYFPQLNESQEQAMSLFRMDS----LTGALSLQAPLDFEAV-QEYLLIVQALDQSSNVTERLQTSVTVRLRILDANDHAP--HFVSPNSSGGKTASLFISDATRIGEVVAHIVAVDEDSG--------DNGQLTYEITGGNG---EGRFRINSQTGIIELVKSLPPATEDVEKGGRFNLIIGAKDHGQPEPKKSSLNLHLIVQGSHNNPPRFLQAVYRATILENVPSGSFVL---QVTAKSLHGAENANLSYEIPAGVAN---DLFHVDWQRGIITTRGQFDRESQASYVLPVYVRDANRQSTLSSSAVRKQRSSDSIGDTSNGQHFDVATIYITVGDVNDNSPEF-RPGSCYGL--SVPENSEPGVIHTVVASDLDEGPNADLIYSITGGNLGNK--FSIDSSSGEL-SARPLDREQHSRYTLQIQASDRGQPKSRQ---GHCNITIFVEDQNDNAPRFKL 1954          

HSP 5 Score: 127.872 bits (320), Expect = 3.182e-29
Identity = 138/531 (25.99%), Postives = 248/531 (46.70%), Query Frame = 2
Query:  683 LISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKL-VNVISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLV-TDIECSLDDYHLNFEITAINEIHPLGHYKEF----IINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLT-IHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSF-TVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSY-TNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIFSLINPAKSSLIFTINK 2248
            +  PLD E  S+    ++A   E   +      +V I+V D+NDN P F+ +    ++ E ++L   + + +  D D G + QV+ ++  E+       K  F ID      +G + L   +DYE++  +++  + ATD G+P LS+   + + + + ND  PV +   K E    S+ + E+      +  +  SD D+     I   + D  ++    +I+      H+  F     I    PLDRE  +++Y ++ +  +D    TP     T + + + D NDN P F +SKY+  + EN+ + +V  +  +   D D G+NA + Y +    +S     F +   +G+IS+R+ +D E  +L+   + A D+     S+   + +HV D NDNAP    P     +VRE  P  TE+ ++   D D      I     K   ++ + +  +D  SG ++T   +D E+ RSI  L  A ++     +  +    M+ + + D+NDN P F+      SSL+F + +
Sbjct:  886 IAKPLDHEAKSQVLLNIQATLGEPPVY---GHTQVNIEVEDVNDNAPEFEASMVRISVPESAELGAPLYAAHAHDKDSGSSGQVTYSLVKESG------KGLFAID----ARSGHLILSQHLDYESS-QRHTLIVTATDGGVPSLSTNLTILVDVQDVNDNPPVFE---KDEY---SVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIYLRAPLDRET-RDRY-QLTVLATDNG--TPAAHAKTRVIVRVLDANDNDPKFQKSKYEFRIEENLRRGSVVGV--VTASDLDLGENAAIRYSLLPINSS-----FQVHPVTGEISTREPLDRELRELYDLVVEARDQGTPVRSARVPVRIHVSDVNDNAPEIADPQEDVVSVREEQPPGTEVVRVRAVDRDHGQNASITYSIVKGRDSDGHGLFSIDPTSGVIRTRVVLDHEE-RSIYRLGVAASDGGNPPRETVR---MLRVEVLDLNDNRPTFT-----SSSLVFRVRE 1376          

HSP 6 Score: 124.79 bits (312), Expect = 2.477e-28
Identity = 176/641 (27.46%), Postives = 265/641 (41.34%), Query Frame = 2
Query:  389 TVFSFQVDSGIKISS--FYILIKVLDENDNSPKFLPFLNPYQT-LPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFL--IGND-------SHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKLVNVISFY-VTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRD-----SLVTDIECSLD-DYHLNFEITAINEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQA-TVKMIEPILTLDKDHGKNAY--------VTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSN--LSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPEN----KIVKYF---HKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIF 2200
            T+     D G+   S    IL+ V D NDN P F    + Y   + E+  IN  I+  +A DLD+       Y+I    +  + N         HF +     SG   + L +PLDRE    Y+  + A D  N      +   V ++V D NDN P F K+ Y   I E+ +  +V+     +DLD G+N  +         Y    I   FQ+      +TG I   + +D E     Y   + A D G P  S+   V I + + ND AP I   ++ ++VS    + E +P  T V  ++  DRD     S+   I    D D H  F I   + +          I T   LD E+      ++ +  SD     P  T   + + + D+NDN P FT S     + E+      V  I PI     D  +N+         VTY ++          F ID  SG +   + +D E    F   I A+D   SN   SS   + + V D NDNAP +P+      V E  PV T I     TD DT        ++++YF   ++S      +  +D  +G L    P+D E V+   +++ A +++S   + L  S   V + I D ND+ P F
Sbjct: 1003 TLIVTATDGGVPSLSTNLTILVDVQDVNDNPPVFEK--DEYSVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPN--SG--WIYLRAPLDRETRDRYQLTVLATD--NGTPAAHAKTRVIVRVLDANDNDPKFQKSKYEFRIEENLRRGSVVGVVTASDLDLGENAAIR--------YSLLPINSSFQV----HPVTGEISTREPLDRELREL-YDLVVEARDQGTPVRSARVPVRIHVSDVNDNAPEIADPQE-DVVS----VREEQPPGTEVVRVRAVDRDHGQNASITYSIVKGRDSDGHGLFSIDPTSGV----------IRTRVVLDHEE--RSIYRLGVAASDGGN-PPRETVRMLRVEVLDLNDNRPTFTSSSLVFRVREDAALGHVVGSISPI-ERPADVVRNSVEESFEDLRVTYTLNPLTKDLIEAAFDIDRHSGNLVVARLLDREVQSEFRLEIRALDTTASNNPQSSAITVKIEVADVNDNAPEWPQDPIDLQVSEATPVGTIIHNFTATDADTGTNGDLQYRLIRYFPQLNESQEQAMSLFRMDSLTGALSLQAPLDFEAVQEYLLIVQALDQSSNVTERLQTS-VTVRLRILDANDHAPHF 1602          

HSP 7 Score: 116.316 bits (290), Expect = 9.407e-26
Identity = 177/729 (24.28%), Postives = 305/729 (41.84%), Query Frame = 2
Query:  440 ILIKVLDENDNSPKFLPFLNPY-QTLPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANI---VEHSKLVNVISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTI---VASLQVSDRDSLVT--------DIECSLDDYHLNFEITAINEIHPLGHYKEFIINTLKPLDR--------EDDKNQYLKINIYCSDQDKLTPLTTNLT--------------------------IHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYT---NNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIF-SLINPAKSSLIFTINKGFRHENCQMIPYAVSDADHDEPNSDSCCILQLDNDQNGMLYLLSN---TPNFLCLQNTMNTPGIYRVSLTATD 2458
            I I V D+NDN+P+F   L+ Y  ++ E++ + T ++  SA+D D    G+    +   + + N++ +       SG   +  +  LDRE+ + Y F++ A D    + R  + V V+I V DINDN P+F++  Y   +   ++  +   ++     D D G N ++  ++  EN      +   F+I+ S   ++ S  L  E     +       ++A D G P  SS   + +++       PV++   +    +  + + EN P+ T    V +L+   R   V         D   SLD   L+ EI  +N+ H L  Y  F   ++  L R        E D++     N     Q  LT  +  LT                          + I L D NDN P F++ ++   + E   + T   +  +   D D G NA + Y I    +  D  +    A SG + +   +D E   ++   IIA D+    ++ TA I V ++D NDN P FP P+   TV E   +   I  I   D+DT P   +        T    N  +  +D+ SGKL     +D E  +   + + A + A        ++  ++ + + D NDN P+F +   PA  +++  I++     +       V+  D D   ++S  I  ++  Q G     SN   + N   LQ  +++ G Y V + A D
Sbjct: 1938 ITIFVEDQNDNAPRFK--LSKYTGSVQEDAPLGTSVVQISAVDAD---LGVNARLV---YSLANETQWQFAIDGQSG--LITTVGKLDRELQASYNFMVLATDGGRYEVRSAT-VPVQINVLDINDNRPIFERYPYIGQVPALIQPGQ--TLLKVQALDADLGANAEIVYSLNAEN----SAVSAKFRINPSTGALSASQSLASE-----SGKLLHLEVVARDKGNPPQSSLGLIELLIGEAPQGTPVLRFQNE----TYRVMLKENSPSGTRLLQVVALRSDGRRQKVQFSFGAGNEDGILSLDS--LSGEIR-VNKPHLL-DYDRFSTPSMSALSRGRALHYEEEIDESSEEDPNNSTRSQRALTSSSFALTNSQPNEIRVVLVARTADAPFLASYAELVIELEDENDNSPKFSQKQFVATVSEGNNKGT--FVAQVHAFDSDAGSNARLRYHIVDGNH--DNAFVIEPAFSGIVRTNIVLDREIRDIYKLKIIATDEGVPQMTGTATIRVQIVDVNDNQPTFP-PNNLVTVSEATELGAVITSISANDVDTYP--ALTYRLGAESTVDIENMSIFALDRYSGKLVLKRRLDYELQQEYELDVIASDAA-------HEARTVLTVRVNDENDNAPVFLAQQPPAYFAILPAISEISESLSVDFDLLTVNATDADSEGNNSKVIYIIEPAQEGFSVHPSNGVVSVNMSRLQPAVSSSGDYFVRIIAKD 2622          

HSP 8 Score: 90.5077 bits (223), Expect = 7.063e-18
Identity = 165/651 (25.35%), Postives = 272/651 (41.78%), Query Frame = 2
Query:  440 ILIKVLDENDNSPKFLPFLNPYQTLPENSQ---INTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKL-VNVISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRL-SSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITAIN---EIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLT-IHINLFDINDNPPV--FTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQS--IDYEKNKLFSFN--------------------------------------------------IIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITIL-ITARNEASYQNKNLMDSECMVIITIEDVNDNPPIF 2200
            I I V D NDNSP+F P      ++PENS+   I+TV+    A DLD        Y I+     GN  +   +D  +SG    L   PLDRE  S Y   ++A DR     R      + I V D NDN P F  + YT ++ E + L  +V+     D D G N ++  ++  E  ++       F ID    L+T     + ++D E     Y+F ++ATD G   + S+T  V I +++ ND  P+ +   +   + +   +   +P +T++  +Q  D D L  + E     Y LN E +A++    I+P        ++  + L  E  K  +L++      +DK  P  ++L  I + + +     PV  F    Y+  L EN P  T ++++ ++ L  D G+   V +   +          ++D+ SG+I   +   +DY++    S +                                                  ++A   D   L+S A +++ + D NDN+P F +  +  TV E     T + Q+   D D     ++  +      +N  VI     SG ++T   +DRE +R I  L I A +E   Q    M     + + I DVNDN P F
Sbjct: 1833 IYITVGDVNDNSPEFRPGSCYGLSVPENSEPGVIHTVV----ASDLDEGPNADLIYSITG----GNLGNKFSIDS-SSGE---LSARPLDREQHSRYTLQIQASDRGQPKSRQ-GHCNITIFVEDQNDNAPRFKLSKYTGSVQEDAPLGTSVVQISAVDADLGVNARLVYSLANETQWQ-------FAIDGQSGLIT----TVGKLDRELQ-ASYNFMVLATDGGRYEVRSATVPVQINVLDINDNRPIFE---RYPYIGQVPALI--QPGQTLL-KVQALDAD-LGANAEIV---YSLNAENSAVSAKFRINP----STGALSASQSLASESGKLLHLEV----VARDKGNPPQSSLGLIELLIGEAPQGTPVLRFQNETYRVMLKENSPSGT-RLLQ-VVALRSD-GRRQKVQFSFGAGNEDG---ILSLDSLSGEIRVNKPHLLDYDRFSTPSMSALSRGRALHYEEEIDESSEEDPNNSTRSQRALTSSSFALTNSQPNEIRVVLVARTADAPFLASYAELVIELEDENDNSPKFSQKQFVATVSEGNNKGTFVAQVHAFDSDAGSNARLRYHIVDGNHDNAFVIE-PAFSGIVRTNIVLDRE-IRDIYKLKIIATDEGVPQ----MTGTATIRVQIVDVNDNQPTF 2428          

HSP 9 Score: 90.1225 bits (222), Expect = 9.655e-18
Identity = 148/616 (24.03%), Postives = 260/616 (42.21%), Query Frame = 2
Query:  428 SSFYILIKVLDENDNSPKFL-PFLNPYQT----LPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGN---DSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKLVN-VISFYVTDLDEGQNKQVS--ITIETENDYKKDQIKRFFQIDFSPSLMT--GSIRLIDEIDYETNPY------------------KYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFEN-EPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITAINEIHPLGHYKEFIINT------LKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNL-SSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMV 2158
            +S  + +++LD ND++P F+ P  +  +T    + + ++I  V+    A+D DS   G   Y+I+     G    +S   +++ + S  P     +  D E    +  I+ A D    + +  S + + + V   ++NPP F +  Y A I+E+    + V+      L   +N  +S  I     ND         F +D+   ++T  G      +  Y    Y                  + S ++  T NG  +    A + I + + ND +P     R G     S+   EN EP   ++ ++  SD D      E    D  L + IT  N    LG+  +F I++       +PLDRE      L+I      Q K      N+TI +   D NDN P F  SKY G + E+ P  T   +  I  +D D G NA + Y +    N T W+ F ID  SG I++   +D E    ++F ++A D  +  + S+T  + ++V+D NDN PIF +  Y   V   +     + +++  D D     +IV   +   +       ++ ++G L     +  E  + + + + AR++ +    +L   E ++
Sbjct: 1584 TSVTVRLRILDANDHAPHFVSPNSSGGKTASLFISDATRIGEVVAHIVAVDEDSGDNGQLTYEITGGNGEGRFRINSQTGIIELVKSLPP-----ATEDVEKGGRFNLIIGAKDHGQPEPKK-SSLNLHLIVQGSHNNPPRFLQAVYRATILENVPSGSFVLQVTAKSLHGAENANLSYEIPAGVAND--------LFHVDWQRGIITTRGQFDRESQASYVLPVYVRDANRQSTLSSSAVRKQRSSDSIGDTSNG--QHFDVATIYITVGDVNDNSPEF---RPGSCYGLSVP--ENSEPG--VIHTVVASDLD------EGPNAD--LIYSITGGN----LGN--KFSIDSSSGELSARPLDREQHSRYTLQIQASDRGQPKSRQGHCNITIFVE--DQNDNAPRFKLSKYTGSVQEDAPLGT--SVVQISAVDADLGVNARLVYSL---ANETQWQ-FAIDGQSGLITTVGKLDRELQASYNFMVLATDGGRYEVRSATVPVQINVLDINDNRPIFERYPYIGQVPALIQPGQTLLKVQALDADLGANAEIVYSLNAENSAVSAKFRINPSTGALSASQSLASESGKLLHLEVVARDKGNPPQSSLGLIELLI 2154          

HSP 10 Score: 89.3521 bits (220), Expect = 1.658e-17
Identity = 164/684 (23.98%), Postives = 281/684 (41.08%), Query Frame = 2
Query:  440 ILIKVLDENDNSPKFLPFLNPYQTLPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVF---DKTFYTA---NIVEHSKLVNV----ISFYVTDLD-EGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITAINEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSD-----QDKLTPLTTNLTIHINLFDINDNPPVFTRS-KYQGELIENIP-QATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKN-KLFSFNIIAIDKD-QSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTN--NYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIFS-----LINPAKSSLI-------FTINKGFRHENCQMIPYAVSDADHDEPNSDSCCI-----LQLDNDQNGMLYL 2374
            I ++++D NDN P F P  N   T+ E +++  VI   SA D+D+               I N S F L D+ +    +L+L   LD E+  EY   + A D  ++    ++     ++V D NDN PVF       Y A    I E S+ ++V    ++   TD D EG N +V   IE   +               PS    S+ +       ++   Y   +IA D G P L S+    ++ +  ND         + +  ++   + E  P  ++V              ++   D    +  I A NE       +   I  +KPLDRE  +N   K+ +  S             ++ +++ I + D NDN P+F RS KY+ E+ E  P + ++  ++ I   D+++  N+ V Y I S     D   FTID  +G +     +DY+   K +   I A D   Q  L S     + + D NDN P FP   Y   + EN PV + + +   +DLD  P  ++      + ++  ++++  VD  SG + +    D E+ +   + + A +    +      +   V + IE  ++  P F+      + PA  +L         T        + +++    +   H + N  S  +     L+LD D +G LY+
Sbjct: 2414 IRVQIVDVNDNQPTFPP--NNLVTVSEATELGAVITSISANDVDTYPALTYRLGAESTVDIENMSIFAL-DRYSG---KLVLKRRLDYELQQEYELDVIASDAAHEARTVLT-----VRVNDENDNAPVFLAQQPPAYFAILPAISEISESLSVDFDLLTVNATDADSEGNNSKVIYIIEPAQE----------GFSVHPSNGVVSVNMSRLQPAVSSSGDYFVRIIAKDAGKPALKSS---TLLRVQANDNGSGRSQFLQNQYRAQ---ISEAAPLGSVV--------------LQLGQDALDQSLAIIAGNEESAFELLQSKAIVLVKPLDRE--RNDLYKLRLVLSHPHGPPLISSLNSSSGISVIITILDANDNFPIFDRSAKYEAEISELAPLRYSIAQLQAI-DADQENTPNSEVVYDITSGN---DEHMFTIDLVTGVLFVNNRLDYDSGAKSYELIIRACDSHHQRPLCSLQPFRLELHDENDNEPKFPLTEYVHFLAENEPVGSSVFRAHASDLDKGPFGQLNYSIGPAPSDESSWKMFRVDSESGLVTSAFVFDYEQRQRYDMELLASDMGGKK------ASVAVRVEIESRDEFTPQFTERTYRFVLPAAVALPQGYVVGQVTATDSDSGPDGRVVYQLSAPHSHFKVNRSSGAVLIKRKLKLDGDGDGNLYM 3044          

HSP 11 Score: 81.6481 bits (200), Expect = 3.690e-15
Identity = 150/612 (24.51%), Postives = 255/612 (41.67%), Query Frame = 2
Query:  440 ILIKVLDENDNSPKFLPFLNP--YQTLPENSQINTVI------LLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKLVNVISFYVTDLDEGQNK-QVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATD-NGLPRLSSTAK-----VNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDS-------LVTDIECSLDDYHLNFEITAINEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSS-KNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENV--PVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSG------KLKTIGPIDRE---KVRSITILITARNEASYQNKNLMDSECMVIITIE 2173
            + ++V DENDN+P FL    P  +  LP  S+I+  +      L  +A D DSE    K   I +P   G   H +  + + S     + +S L   V S   + ++ + ++       S   + ++  D       F +  Y A I E + L +V+      L  GQ+    S+ I   N+      +  F++     L + +I L+  +D E N   Y   L+ +  +G P +SS        V I +++ ND  P+     K E       + E  P R  +A LQ  D D        +V DI  S +D H+ F I  +  +        F+ N L   D +     Y ++ I   D     PL +     + L D NDN P F  ++Y   L EN P  +         LDK  G    + Y I  +  + + W+ F +D++SG ++S    DYE+ + +   ++A   D     ++  + V +   ++  P F +  Y F +   V  P    +GQ+  TD D+ P+ ++V      +++      V+++SG      KLK  G  D       R I+++I+    AS    N + S  +V I ++
Sbjct: 2518 LTVRVNDENDNAPVFLAQQPPAYFAILPAISEISESLSVDFDLLTVNATDADSEGNNSKVIYIIEPAQEGFSVHPS--NGVVS-----VNMSRLQPAVSSSGDYFVRIIAKDAGKPALKSSTLLRVQANDNGSGRSQFLQNQYRAQISEAAPLGSVV------LQLGQDALDQSLAIIAGNE------ESAFEL-----LQSKAIVLVKPLDRERNDL-YKLRLVLSHPHGPPLISSLNSSSGISVIITILDANDNFPIFDRSAKYEA-----EISELAPLRYSIAQLQAIDADQENTPNSEVVYDI-TSGNDEHM-FTIDLVTGVL-------FVNNRL---DYDSGAKSY-ELIIRACDSHHQRPLCSLQPFRLELHDENDNEPKFPLTEYVHFLAENEPVGSSVFRAHASDLDK--GPFGQLNYSIGPAPSDESSWKMFRVDSESGLVTSAFVFDYEQRQRYDMELLA--SDMGGKKASVAVRVEIESRDEFTPQFTERTYRFVLPAAVALPQGYVVGQVTATDSDSGPDGRVVYQLSAPHSH----FKVNRSSGAVLIKRKLKLDGDGDGNLYMDGRDISLVIS----ASSGRHNSLSSMAVVEIALD 3074          

HSP 12 Score: 73.9442 bits (180), Expect = 9.858e-13
Identity = 123/509 (24.17%), Postives = 200/509 (39.29%), Query Frame = 2
Query:  695 LDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHS-KLVNVISFYVTDLD-EGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITAINEIHPLGHYKEFI-INTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPP----VFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIF 2200
            LDRE  + Y  +   +   N        + V + V D NDN P F +T       E++ + V        DLD E  N Q    I + N     ++    + D    ++   +++   +D ET P  YS  + A D G P L     VNI + + ND  P+    R         T+ EN    T V  +  SD D+     E  L +Y +N   +   ++  +      I IN  K LD E    +  ++ +   D  +  PL T   + I + D+NDN P    +F       ++ E+      + +  I   D D  K  Y    +  +     +   T D     +     +D E    ++ +++A DK    L ++  I + + D NDN P F +  Y   V E     T + Q+   D D    + +     ++   + Q   +D  +G + T   ID E      + + AR+         + S   V++TI DVNDN PIF
Sbjct:  138 LDRETRASYSLVAIPLSGRN--------IRVLVTVKDENDNAPTFPQTSMHIEFPENTPREVKRTLLPARDLDLEPYNTQ-RYNIVSGNVNDAFRLSSHRERD---GVLYLDLQISGFLDRETTP-GYSLLIEALDGGTPPLRGFMTVNITIQDVNDNQPIFNQSRY------FATVPENATVGTSVLQVYASDTDA----DENGLVEYAINRRQSDKEQMFRIDPRTGAIYIN--KALDFE--TKELHELVVVAKDHGE-QPLETTAFVSIRVTDVNDNQPTINVIFLSDDASPKISESAQPG--EFVARISVHDPD-SKTEYANVNVTLNGGDGHFALTTRDNSIYLVIVHLPLDREIVSNYTLSVVATDKGTPPLHASKSIFLRITDVNDNPPEFEQDLYHANVMEVADPGTSVLQVLAHDRDEGLNSALTYSLAETPETHAQWFQIDPQTGLITTRSHIDCETEPVPQLTVVARDGGVPP----LSSTATVLVTIHDVNDNEPIF 611          

HSP 13 Score: 71.633 bits (174), Expect = 4.001e-12
Identity = 71/286 (24.83%), Postives = 123/286 (43.01%), Query Frame = 2
Query: 1382 INTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDH---------GKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKY-FHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIFSLI 2209
            I T   LDRE  +  Y  + I  S +        N+ + + + D NDN P F ++    E  EN P+   + + P   LD +            N    +++ S +      Y  +     +IS    +D E    +S  I A+D     L     + + + D NDN PIF +  Y  TV EN  V T + Q+  +D D   EN +V+Y  ++  ++  Q+  +D  +G +     +D E      +++ A++      +  +++   V I + DVNDN P  ++I
Sbjct:  132 IRTKVKLDRET-RASYSLVAIPLSGR--------NIRVLVTVKDENDNAPTFPQTSMHIEFPENTPREVKRTLLPARDLDLEPYNTQRYNIVSGNVNDAFRLSSHRERDGVLYLDL-----QISG--FLDRETTPGYSLLIEALDGGTPPLRGFMTVNITIQDVNDNQPIFNQSRYFATVPENATVGTSVLQVYASDTDAD-ENGLVEYAINRRQSDKEQMFRIDPRTGAIYINKALDFETKELHELVVVAKD----HGEQPLETTAFVSIRVTDVNDNQPTINVI 396          

HSP 14 Score: 69.707 bits (169), Expect = 1.722e-11
Identity = 124/521 (23.80%), Postives = 211/521 (40.50%), Query Frame = 2
Query:  716 EYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVE-HSKLVNVISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITAINE---IHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPI------LTLDKD-----------HGKNAYVTYKIDSSKNSTDWEYFTIDADSGKIS---SRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREK--VRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIF 2200
            E R +L  V R  D     S  E+ I++ D NDN P F +  + A + E ++K   V   +  D D G N ++   I   N      I+  F         +G +R    +D E     Y   +IATD G+P+++ TA + + +++ ND  P           +  +T+ E      ++ S+  +D D+           Y L  E T   E   I  L  Y   ++   + LD E    Q  ++++  SD        T LT+ +N  D NDN PVF   +         P A   ++  I      L++D D            G N+ V Y I+ ++     E F++   +G +S   SR       +  +   IIA D  +  L S+ L+ V   D       F +  Y   + E  P+ + + Q+    LD     + +     +  + ++++     S  +  + P+DRE+  +  + ++++  +     +     S   VIITI D NDN PIF
Sbjct: 2287 EIRVVL--VARTADAPFLASYAELVIELEDENDNSPKFSQKQFVATVSEGNNKGTFVAQVHAFDSDAGSNARLRYHIVDGNHDNAFVIEPAF---------SGIVRTNIVLDREIRDI-YKLKIIATDEGVPQMTGTATIRVQIVDVNDNQPTFP-------PNNLVTVSEATELGAVITSISANDVDTYPALT------YRLGAESTVDIENMSIFALDRYSGKLVLKRR-LDYE--LQQEYELDVIASDAAHEA--RTVLTVRVN--DENDNAPVFLAQQ---------PPAYFAILPAISEISESLSVDFDLLTVNATDADSEGNNSKVIYIIEPAQ-----EGFSVHPSNGVVSVNMSRLQPAVSSSGDYFVRIIAKDAGKPALKSSTLLRVQANDNGSGRSQFLQNQYRAQISEAAPLGSVVLQLGQDALD-----QSLAIIAGNEESAFELLQ----SKAIVLVKPLDRERNDLYKLRLVLSHPHGPPLISSLNSSSGISVIITILDANDNFPIF 2752          
BLAST of Protocadherin Fat 1 vs. Ensembl Fly
Match: ds (gene:FBgn0284247 transcript:FBtr0343249)

HSP 1 Score: 184.496 bits (467), Expect = 1.192e-46
Identity = 172/598 (28.76%), Postives = 287/598 (47.99%), Query Frame = 2
Query:  440 ILIKVLDENDNSPKFLPFLNPYQTLPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQ-------LLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKL-VNVISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLV--TDIECSLDDYHLNFEITAI-NEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIF 2200
            +L+ V DENDN+P F P  + +   PEN+       L  A DLD E +  + Y I    +  ND+      +++S R +       L +   LDRE    Y  +++A+D      R    + V I + D+NDN P+F+++ Y A + E++ +  +V+  Y +D D  +N  V   I   N  + D+ ++ F+ID      TG+I +   +D+ET    +   ++A D+G   L +TA V+I + + ND  P I VI   +  S  I+  E+      VA + V D DS     ++  +L+    +F +T   N I        +++    PLDRE   N  L  ++  +D+    PL  + +I + + D+NDNPP F +  Y   ++E     T  +   +L  D+D G N+ +TY +  +   T  ++F ID  +G I++R  ID E   +    ++A D     LSSTA ++V + D NDN PIF +  Y+ +V EN PV   I ++  +D D    N +V Y       +     V   SG++   G +D E+  S    + A       ++  + +  M+ + + DVNDN P+F
Sbjct:  160 VLVTVKDENDNAPTF-PQTSMHIEFPENTPREVKRTLLPARDLDLEPYNTQRYNIVSGNV--NDAF-----RLSSHRERDGVLYLDLQISGFLDRETTPGYSLLIEALDGGTPPLRGF--MTVNITIQDVNDNQPIFNQSRYFATVPENATVGTSVLQVYASDTDADENGLVEYAI---NRRQSDK-EQMFRID----PRTGAIYINKALDFETKEL-HELVVVAKDHGEQPLETTAFVSIRVTDVNDNQPTINVIFLSDDASPKIS--ESAQPGEFVARISVHDPDSKTEYANVNVTLNGGDGHFALTTRDNSI--------YLVIVHLPLDREIVSNYTL--SVVATDKGT-PPLHASKSIFLRITDVNDNPPEFEQDLYHANVMEVADPGTSVL--QVLAHDRDEGLNSALTYSLAETPE-THAQWFQIDPQTGLITTRSHIDCETEPVPQLTVVARDGGVPPLSSTATVLVTIHDVNDNEPIFDQSFYNVSVAENEPVGRCILKVSASDPDCG-VNAMVNYTIGEGFKHLTEFEVRSASGEICIAGELDFERRSSYEFPVLA------TDRGGLSTTAMIKMQLTDVNDNRPVF 715          

HSP 2 Score: 155.221 bits (391), Expect = 1.239e-37
Identity = 187/738 (25.34%), Postives = 329/738 (44.58%), Query Frame = 2
Query:  428 SSFYILIKVLDENDNSPKF-LPFL--NPYQTLPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLIS-PLDREVISEYRFILKAVDRENDD-HRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHS-KLVNVISFYVTDLDEGQNKQVSITI-ETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITAINEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIEN---IPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQS--IDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIFSLINPAKSSLIFTINKGFRHENCQM-IPYAVSDADHDEPNSDSCCILQLDNDQNGMLYLLSNTPNFLCLQNTMNTPGIYRVSL--TATDNKNNPNKSLKAKVSFNIDVRHEVSDN-PFSEKSDNKVHTTKNQYYN 2593
            ++ ++ I+V D NDN P   + FL  +    + E++Q    +   S  D DS+    +Y  ++   L G D HF L  +  S    L+++  PLDRE++S Y   + A D+     H   S   + +++ D+NDNPP F++  Y AN++E +    +V+     D DEG N  ++ ++ ET   + +     +FQID      TG I     ID ET P      ++A D G+P LSSTA V + + + ND  P+       +    ++++ ENEP    +  +  SD D  V     ++ +Y +      + E        E  I      +R   ++ Y +  +  +D+  L+   T   I + L D+NDN PVF   +Y+  L E+     QA+   I  ++  D D+G    V+Y+I +   +     F ID  +G+I   +   +      +   NI A D      ++ A++ + +IDA    PIF K  Y++ V+E++P  T +G +     D    + +    +    + Y    ++ NSG ++   P+D E    + + I A        +  +     V I +EDVNDN P F      ++S++    +    E+ ++  P   + A   +  S       L  +    L+ +      L L   ++     R +L  TATD       SL   ++  +DV+ +V+DN P  EK +  V+ ++++  N
Sbjct:  375 TTAFVSIRVTDVNDNQPTINVIFLSDDASPKISESAQPGEFVARISVHDPDSKT---EYANVNV-TLNGGDGHFALTTRDNS--IYLVIVHLPLDREIVSNYTLSVVATDKGTPPLHASKS---IFLRITDVNDNPPEFEQDLYHANVMEVADPGTSVLQVLAHDRDEGLNSALTYSLAETPETHAQ-----WFQID----PQTGLITTRSHIDCETEPVP-QLTVVARDGGVPPLSSTATVLVTIHDVNDNEPIF------DQSFYNVSVAENEPVGRCILKVSASDPDCGVN----AMVNYTIGEGFKHLTEFEVRSASGEICIAGELDFER---RSSY-EFPVLATDRGGLS---TTAMIKMQLTDVNDNRPVFYPREYKVSLRESPKASSQASSTPIVAVVATDPDYGNFGQVSYRIVAGNEAG---IFRIDRSTGEIFVVRPDMLSVRTQPMHMLNISATDGGNLRSNADAVVFLSIIDAMQRPPIFEKARYNYYVKEDIPRGTVVGSVIAASGDVAHRSPVRYSIYSGDPDGY--FSIETNSGNIRIAKPLDHEAKSQVLLNIQA-----TLGEPPVYGHTQVNIEVEDVNDNAPEF------EASMV----RISVPESAELGAPLYAAHAHDKDSGSSGQVTYSLVKESGKGLFAIDARSGHLILSQHLDYESSQRHTLIVTATDGG---VPSLSTNLTILVDVQ-DVNDNPPVFEKDEYSVNVSESRSIN 1052          

HSP 3 Score: 152.91 bits (385), Expect = 5.997e-37
Identity = 163/611 (26.68%), Postives = 273/611 (44.68%), Query Frame = 2
Query:  446 IKVLDENDNSPKFLPFLNPYQTLPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKL-VNVISFYVTDLDEGQNKQVSITI------ETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITAIN---EIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPL-TTNLTIHINLFDINDNPPVFTRSKYQGELI---ENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRP----ENKIVKYFHK---SYTNN-------YQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPP 2194
            I+V D NDN+P+F   +    ++PE++++   +    A D DS + G   Y + K    G       L  I +    L+L   LD E    +  I+ A D         + + + + V D+NDNPPVF+K  Y+ N+ E   +   +I    +DLD G N +++  I         N      + + F I F  S   G I L   +D ET   +Y   ++ATDNG P   +  +V + +++ ND  P      K +       + EN    ++V  +  SD D          ++  + + +  IN   ++HP+       I+T +PLDRE  +  Y   ++    +D+ TP+ +  + + I++ D+NDN P    +  Q +++   E  P  T   +  +  +D+DHG+NA +TY I   ++S     F+ID  SG I +R  +D+E+  ++   + A D       +  ++ V V+D NDN P F      F VRE+  +   +G I   +   RP     N + + F     +YT N            +D++SG L     +DRE      + I A +  +  + N   S   V I + DVNDN P
Sbjct:  919 IEVEDVNDNAPEFEASMVRI-SVPESAELGAPLYAAHAHDKDSGSSGQVTYSLVKESGKG-------LFAIDARSGHLILSQHLDYESSQRHTLIVTATDGGVPSLS--TNLTILVDVQDVNDNPPVFEKDEYSVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGI-FPNS---GWIYLRAPLDRETRD-RYQLTVLATDNGTPAAHAKTRVIVRVLDANDNDP------KFQKSKYEFRIEENLRRGSVVGVVTASDLDLG--------ENAAIRYSLLPINSSFQVHPVTGE----ISTREPLDREL-RELY---DLVVEARDQGTPVRSARVPVRIHVSDVNDNAPEI--ADPQEDVVSVREEQPPGT--EVVRVRAVDRDHGQNASITYSIVKGRDSDGHGLFSIDPTSGVIRTRVVLDHEERSIYRLGVAASDGGNPPRETVRMLRVEVLDLNDNRPTFTSSSLVFRVREDAALGHVVGSISPIE---RPADVVRNSVEESFEDLRVTYTLNPLTKDLIEAAFDIDRHSGNLVVARLLDREVQSEFRLEIRALDTTA--SNNPQSSAITVKIEVADVNDNAP 1483          

HSP 4 Score: 137.502 bits (345), Expect = 3.582e-32
Identity = 141/553 (25.50%), Postives = 254/553 (45.93%), Query Frame = 2
Query:  677 LLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKLVNVI-SFYVTDLDEGQNKQVS---ITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATD---NGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPART--IVASLQVSDRDSLVTDIECSLDDYHLNFEITAINEIHPLGHYKE-------FIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHG-KNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKD-QSNLSSTAL----------------------IIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIET---TDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIFSL 2206
            L++   LDREV SE+R  ++A+D    ++   S + V+I+V D+NDN P + +      + E + +  +I +F  TD D G N  +    I    + +  ++Q    F++D     +TG++ L   +D+E    +Y   + A D   N   RL ++  V + +++ ND AP    +       ++ ++F ++  R   +VA +   D DS         D+  L +EIT  N     G ++         ++ +L P   + +K     + I   D  +  P  ++L +H+ +   ++NPP F ++ Y+  ++EN+P  +  +    +T    HG +NA ++Y+I +   +   + F +D   G I++R   D E    +   +   D + QS LSS+A+                      I + V D NDN+P F +P   + +  +VP N+E G I T   +DLD  P   ++         N     +D +SG+L +  P+DRE+    T+ I A +    +++      C + I +ED NDN P F L
Sbjct: 1435 LVVARLLDREVQSEFRLEIRALDTTASNNPQSSAITVKIEVADVNDNAPEWPQDPIDLQVSEATPVGTIIHNFTATDADTGTNGDLQYRLIRYFPQLNESQEQAMSLFRMDS----LTGALSLQAPLDFEAV-QEYLLIVQALDQSSNVTERLQTSVTVRLRILDANDHAP--HFVSPNSSGGKTASLFISDATRIGEVVAHIVAVDEDSG--------DNGQLTYEITGGNG---EGRFRINSQTGIIELVKSLPPATEDVEKGGRFNLIIGAKDHGQPEPKKSSLNLHLIVQGSHNNPPRFLQAVYRATILENVPSGSFVL---QVTAKSLHGAENANLSYEIPAGVAN---DLFHVDWQRGIITTRGQFDRESQASYVLPVYVRDANRQSTLSSSAVRKQRSSDSIGDTSNGQHFDVATIYITVGDVNDNSPEF-RPGSCYGL--SVPENSEPGVIHTVVASDLDEGPNADLIYSITGGNLGNK--FSIDSSSGEL-SARPLDREQHSRYTLQIQASDRGQPKSRQ---GHCNITIFVEDQNDNAPRFKL 1954          

HSP 5 Score: 127.872 bits (320), Expect = 3.182e-29
Identity = 138/531 (25.99%), Postives = 248/531 (46.70%), Query Frame = 2
Query:  683 LISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKL-VNVISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLV-TDIECSLDDYHLNFEITAINEIHPLGHYKEF----IINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLT-IHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSF-TVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSY-TNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIFSLINPAKSSLIFTINK 2248
            +  PLD E  S+    ++A   E   +      +V I+V D+NDN P F+ +    ++ E ++L   + + +  D D G + QV+ ++  E+       K  F ID      +G + L   +DYE++  +++  + ATD G+P LS+   + + + + ND  PV +   K E    S+ + E+      +  +  SD D+     I   + D  ++    +I+      H+  F     I    PLDRE  +++Y ++ +  +D    TP     T + + + D NDN P F +SKY+  + EN+ + +V  +  +   D D G+NA + Y +    +S     F +   +G+IS+R+ +D E  +L+   + A D+     S+   + +HV D NDNAP    P     +VRE  P  TE+ ++   D D      I     K   ++ + +  +D  SG ++T   +D E+ RSI  L  A ++     +  +    M+ + + D+NDN P F+      SSL+F + +
Sbjct:  886 IAKPLDHEAKSQVLLNIQATLGEPPVY---GHTQVNIEVEDVNDNAPEFEASMVRISVPESAELGAPLYAAHAHDKDSGSSGQVTYSLVKESG------KGLFAID----ARSGHLILSQHLDYESS-QRHTLIVTATDGGVPSLSTNLTILVDVQDVNDNPPVFE---KDEY---SVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIYLRAPLDRET-RDRY-QLTVLATDNG--TPAAHAKTRVIVRVLDANDNDPKFQKSKYEFRIEENLRRGSVVGV--VTASDLDLGENAAIRYSLLPINSS-----FQVHPVTGEISTREPLDRELRELYDLVVEARDQGTPVRSARVPVRIHVSDVNDNAPEIADPQEDVVSVREEQPPGTEVVRVRAVDRDHGQNASITYSIVKGRDSDGHGLFSIDPTSGVIRTRVVLDHEE-RSIYRLGVAASDGGNPPRETVR---MLRVEVLDLNDNRPTFT-----SSSLVFRVRE 1376          

HSP 6 Score: 124.79 bits (312), Expect = 2.477e-28
Identity = 176/641 (27.46%), Postives = 265/641 (41.34%), Query Frame = 2
Query:  389 TVFSFQVDSGIKISS--FYILIKVLDENDNSPKFLPFLNPYQT-LPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFL--IGND-------SHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKLVNVISFY-VTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRD-----SLVTDIECSLD-DYHLNFEITAINEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQA-TVKMIEPILTLDKDHGKNAY--------VTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSN--LSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPEN----KIVKYF---HKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIF 2200
            T+     D G+   S    IL+ V D NDN P F    + Y   + E+  IN  I+  +A DLD+       Y+I    +  + N         HF +     SG   + L +PLDRE    Y+  + A D  N      +   V ++V D NDN P F K+ Y   I E+ +  +V+     +DLD G+N  +         Y    I   FQ+      +TG I   + +D E     Y   + A D G P  S+   V I + + ND AP I   ++ ++VS    + E +P  T V  ++  DRD     S+   I    D D H  F I   + +          I T   LD E+      ++ +  SD     P  T   + + + D+NDN P FT S     + E+      V  I PI     D  +N+         VTY ++          F ID  SG +   + +D E    F   I A+D   SN   SS   + + V D NDNAP +P+      V E  PV T I     TD DT        ++++YF   ++S      +  +D  +G L    P+D E V+   +++ A +++S   + L  S   V + I D ND+ P F
Sbjct: 1003 TLIVTATDGGVPSLSTNLTILVDVQDVNDNPPVFEK--DEYSVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPN--SG--WIYLRAPLDRETRDRYQLTVLATD--NGTPAAHAKTRVIVRVLDANDNDPKFQKSKYEFRIEENLRRGSVVGVVTASDLDLGENAAIR--------YSLLPINSSFQV----HPVTGEISTREPLDRELREL-YDLVVEARDQGTPVRSARVPVRIHVSDVNDNAPEIADPQE-DVVS----VREEQPPGTEVVRVRAVDRDHGQNASITYSIVKGRDSDGHGLFSIDPTSGV----------IRTRVVLDHEE--RSIYRLGVAASDGGN-PPRETVRMLRVEVLDLNDNRPTFTSSSLVFRVREDAALGHVVGSISPI-ERPADVVRNSVEESFEDLRVTYTLNPLTKDLIEAAFDIDRHSGNLVVARLLDREVQSEFRLEIRALDTTASNNPQSSAITVKIEVADVNDNAPEWPQDPIDLQVSEATPVGTIIHNFTATDADTGTNGDLQYRLIRYFPQLNESQEQAMSLFRMDSLTGALSLQAPLDFEAVQEYLLIVQALDQSSNVTERLQTS-VTVRLRILDANDHAPHF 1602          

HSP 7 Score: 116.316 bits (290), Expect = 9.407e-26
Identity = 177/729 (24.28%), Postives = 305/729 (41.84%), Query Frame = 2
Query:  440 ILIKVLDENDNSPKFLPFLNPY-QTLPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANI---VEHSKLVNVISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTI---VASLQVSDRDSLVT--------DIECSLDDYHLNFEITAINEIHPLGHYKEFIINTLKPLDR--------EDDKNQYLKINIYCSDQDKLTPLTTNLT--------------------------IHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYT---NNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIF-SLINPAKSSLIFTINKGFRHENCQMIPYAVSDADHDEPNSDSCCILQLDNDQNGMLYLLSN---TPNFLCLQNTMNTPGIYRVSLTATD 2458
            I I V D+NDN+P+F   L+ Y  ++ E++ + T ++  SA+D D    G+    +   + + N++ +       SG   +  +  LDRE+ + Y F++ A D    + R  + V V+I V DINDN P+F++  Y   +   ++  +   ++     D D G N ++  ++  EN      +   F+I+ S   ++ S  L  E     +       ++A D G P  SS   + +++       PV++   +    +  + + EN P+ T    V +L+   R   V         D   SLD   L+ EI  +N+ H L  Y  F   ++  L R        E D++     N     Q  LT  +  LT                          + I L D NDN P F++ ++   + E   + T   +  +   D D G NA + Y I    +  D  +    A SG + +   +D E   ++   IIA D+    ++ TA I V ++D NDN P FP P+   TV E   +   I  I   D+DT P   +        T    N  +  +D+ SGKL     +D E  +   + + A + A        ++  ++ + + D NDN P+F +   PA  +++  I++     +       V+  D D   ++S  I  ++  Q G     SN   + N   LQ  +++ G Y V + A D
Sbjct: 1938 ITIFVEDQNDNAPRFK--LSKYTGSVQEDAPLGTSVVQISAVDAD---LGVNARLV---YSLANETQWQFAIDGQSG--LITTVGKLDRELQASYNFMVLATDGGRYEVRSAT-VPVQINVLDINDNRPIFERYPYIGQVPALIQPGQ--TLLKVQALDADLGANAEIVYSLNAEN----SAVSAKFRINPSTGALSASQSLASE-----SGKLLHLEVVARDKGNPPQSSLGLIELLIGEAPQGTPVLRFQNE----TYRVMLKENSPSGTRLLQVVALRSDGRRQKVQFSFGAGNEDGILSLDS--LSGEIR-VNKPHLL-DYDRFSTPSMSALSRGRALHYEEEIDESSEEDPNNSTRSQRALTSSSFALTNSQPNEIRVVLVARTADAPFLASYAELVIELEDENDNSPKFSQKQFVATVSEGNNKGT--FVAQVHAFDSDAGSNARLRYHIVDGNH--DNAFVIEPAFSGIVRTNIVLDREIRDIYKLKIIATDEGVPQMTGTATIRVQIVDVNDNQPTFP-PNNLVTVSEATELGAVITSISANDVDTYP--ALTYRLGAESTVDIENMSIFALDRYSGKLVLKRRLDYELQQEYELDVIASDAA-------HEARTVLTVRVNDENDNAPVFLAQQPPAYFAILPAISEISESLSVDFDLLTVNATDADSEGNNSKVIYIIEPAQEGFSVHPSNGVVSVNMSRLQPAVSSSGDYFVRIIAKD 2622          

HSP 8 Score: 90.5077 bits (223), Expect = 7.063e-18
Identity = 165/651 (25.35%), Postives = 272/651 (41.78%), Query Frame = 2
Query:  440 ILIKVLDENDNSPKFLPFLNPYQTLPENSQ---INTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKL-VNVISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRL-SSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITAIN---EIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLT-IHINLFDINDNPPV--FTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQS--IDYEKNKLFSFN--------------------------------------------------IIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITIL-ITARNEASYQNKNLMDSECMVIITIEDVNDNPPIF 2200
            I I V D NDNSP+F P      ++PENS+   I+TV+    A DLD        Y I+     GN  +   +D  +SG    L   PLDRE  S Y   ++A DR     R      + I V D NDN P F  + YT ++ E + L  +V+     D D G N ++  ++  E  ++       F ID    L+T     + ++D E     Y+F ++ATD G   + S+T  V I +++ ND  P+ +   +   + +   +   +P +T++  +Q  D D L  + E     Y LN E +A++    I+P        ++  + L  E  K  +L++      +DK  P  ++L  I + + +     PV  F    Y+  L EN P  T ++++ ++ L  D G+   V +   +          ++D+ SG+I   +   +DY++    S +                                                  ++A   D   L+S A +++ + D NDN+P F +  +  TV E     T + Q+   D D     ++  +      +N  VI     SG ++T   +DRE +R I  L I A +E   Q    M     + + I DVNDN P F
Sbjct: 1833 IYITVGDVNDNSPEFRPGSCYGLSVPENSEPGVIHTVV----ASDLDEGPNADLIYSITG----GNLGNKFSIDS-SSGE---LSARPLDREQHSRYTLQIQASDRGQPKSRQ-GHCNITIFVEDQNDNAPRFKLSKYTGSVQEDAPLGTSVVQISAVDADLGVNARLVYSLANETQWQ-------FAIDGQSGLIT----TVGKLDRELQ-ASYNFMVLATDGGRYEVRSATVPVQINVLDINDNRPIFE---RYPYIGQVPALI--QPGQTLL-KVQALDAD-LGANAEIV---YSLNAENSAVSAKFRINP----STGALSASQSLASESGKLLHLEV----VARDKGNPPQSSLGLIELLIGEAPQGTPVLRFQNETYRVMLKENSPSGT-RLLQ-VVALRSD-GRRQKVQFSFGAGNEDG---ILSLDSLSGEIRVNKPHLLDYDRFSTPSMSALSRGRALHYEEEIDESSEEDPNNSTRSQRALTSSSFALTNSQPNEIRVVLVARTADAPFLASYAELVIELEDENDNSPKFSQKQFVATVSEGNNKGTFVAQVHAFDSDAGSNARLRYHIVDGNHDNAFVIE-PAFSGIVRTNIVLDRE-IRDIYKLKIIATDEGVPQ----MTGTATIRVQIVDVNDNQPTF 2428          

HSP 9 Score: 90.1225 bits (222), Expect = 9.655e-18
Identity = 148/616 (24.03%), Postives = 260/616 (42.21%), Query Frame = 2
Query:  428 SSFYILIKVLDENDNSPKFL-PFLNPYQT----LPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGN---DSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKLVN-VISFYVTDLDEGQNKQVS--ITIETENDYKKDQIKRFFQIDFSPSLMT--GSIRLIDEIDYETNPY------------------KYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFEN-EPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITAINEIHPLGHYKEFIINT------LKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNL-SSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMV 2158
            +S  + +++LD ND++P F+ P  +  +T    + + ++I  V+    A+D DS   G   Y+I+     G    +S   +++ + S  P     +  D E    +  I+ A D    + +  S + + + V   ++NPP F +  Y A I+E+    + V+      L   +N  +S  I     ND         F +D+   ++T  G      +  Y    Y                  + S ++  T NG  +    A + I + + ND +P     R G     S+   EN EP   ++ ++  SD D      E    D  L + IT  N    LG+  +F I++       +PLDRE      L+I      Q K      N+TI +   D NDN P F  SKY G + E+ P  T   +  I  +D D G NA + Y +    N T W+ F ID  SG I++   +D E    ++F ++A D  +  + S+T  + ++V+D NDN PIF +  Y   V   +     + +++  D D     +IV   +   +       ++ ++G L     +  E  + + + + AR++ +    +L   E ++
Sbjct: 1584 TSVTVRLRILDANDHAPHFVSPNSSGGKTASLFISDATRIGEVVAHIVAVDEDSGDNGQLTYEITGGNGEGRFRINSQTGIIELVKSLPP-----ATEDVEKGGRFNLIIGAKDHGQPEPKK-SSLNLHLIVQGSHNNPPRFLQAVYRATILENVPSGSFVLQVTAKSLHGAENANLSYEIPAGVAND--------LFHVDWQRGIITTRGQFDRESQASYVLPVYVRDANRQSTLSSSAVRKQRSSDSIGDTSNG--QHFDVATIYITVGDVNDNSPEF---RPGSCYGLSVP--ENSEPG--VIHTVVASDLD------EGPNAD--LIYSITGGN----LGN--KFSIDSSSGELSARPLDREQHSRYTLQIQASDRGQPKSRQGHCNITIFVE--DQNDNAPRFKLSKYTGSVQEDAPLGT--SVVQISAVDADLGVNARLVYSL---ANETQWQ-FAIDGQSGLITTVGKLDRELQASYNFMVLATDGGRYEVRSATVPVQINVLDINDNRPIFERYPYIGQVPALIQPGQTLLKVQALDADLGANAEIVYSLNAENSAVSAKFRINPSTGALSASQSLASESGKLLHLEVVARDKGNPPQSSLGLIELLI 2154          

HSP 10 Score: 89.3521 bits (220), Expect = 1.658e-17
Identity = 164/684 (23.98%), Postives = 281/684 (41.08%), Query Frame = 2
Query:  440 ILIKVLDENDNSPKFLPFLNPYQTLPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVF---DKTFYTA---NIVEHSKLVNV----ISFYVTDLD-EGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITAINEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSD-----QDKLTPLTTNLTIHINLFDINDNPPVFTRS-KYQGELIENIP-QATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKN-KLFSFNIIAIDKD-QSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTN--NYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIFS-----LINPAKSSLI-------FTINKGFRHENCQMIPYAVSDADHDEPNSDSCCI-----LQLDNDQNGMLYL 2374
            I ++++D NDN P F P  N   T+ E +++  VI   SA D+D+               I N S F L D+ +    +L+L   LD E+  EY   + A D  ++    ++     ++V D NDN PVF       Y A    I E S+ ++V    ++   TD D EG N +V   IE   +               PS    S+ +       ++   Y   +IA D G P L S+    ++ +  ND         + +  ++   + E  P  ++V              ++   D    +  I A NE       +   I  +KPLDRE  +N   K+ +  S             ++ +++ I + D NDN P+F RS KY+ E+ E  P + ++  ++ I   D+++  N+ V Y I S     D   FTID  +G +     +DY+   K +   I A D   Q  L S     + + D NDN P FP   Y   + EN PV + + +   +DLD  P  ++      + ++  ++++  VD  SG + +    D E+ +   + + A +    +      +   V + IE  ++  P F+      + PA  +L         T        + +++    +   H + N  S  +     L+LD D +G LY+
Sbjct: 2414 IRVQIVDVNDNQPTFPP--NNLVTVSEATELGAVITSISANDVDTYPALTYRLGAESTVDIENMSIFAL-DRYSG---KLVLKRRLDYELQQEYELDVIASDAAHEARTVLT-----VRVNDENDNAPVFLAQQPPAYFAILPAISEISESLSVDFDLLTVNATDADSEGNNSKVIYIIEPAQE----------GFSVHPSNGVVSVNMSRLQPAVSSSGDYFVRIIAKDAGKPALKSS---TLLRVQANDNGSGRSQFLQNQYRAQ---ISEAAPLGSVV--------------LQLGQDALDQSLAIIAGNEESAFELLQSKAIVLVKPLDRE--RNDLYKLRLVLSHPHGPPLISSLNSSSGISVIITILDANDNFPIFDRSAKYEAEISELAPLRYSIAQLQAI-DADQENTPNSEVVYDITSGN---DEHMFTIDLVTGVLFVNNRLDYDSGAKSYELIIRACDSHHQRPLCSLQPFRLELHDENDNEPKFPLTEYVHFLAENEPVGSSVFRAHASDLDKGPFGQLNYSIGPAPSDESSWKMFRVDSESGLVTSAFVFDYEQRQRYDMELLASDMGGKK------ASVAVRVEIESRDEFTPQFTERTYRFVLPAAVALPQGYVVGQVTATDSDSGPDGRVVYQLSAPHSHFKVNRSSGAVLIKRKLKLDGDGDGNLYM 3044          

HSP 11 Score: 81.6481 bits (200), Expect = 3.690e-15
Identity = 150/612 (24.51%), Postives = 255/612 (41.67%), Query Frame = 2
Query:  440 ILIKVLDENDNSPKFLPFLNP--YQTLPENSQINTVI------LLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKLVNVISFYVTDLDEGQNK-QVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATD-NGLPRLSSTAK-----VNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDS-------LVTDIECSLDDYHLNFEITAINEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSS-KNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENV--PVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSG------KLKTIGPIDRE---KVRSITILITARNEASYQNKNLMDSECMVIITIE 2173
            + ++V DENDN+P FL    P  +  LP  S+I+  +      L  +A D DSE    K   I +P   G   H +  + + S     + +S L   V S   + ++ + ++       S   + ++  D       F +  Y A I E + L +V+      L  GQ+    S+ I   N+      +  F++     L + +I L+  +D E N   Y   L+ +  +G P +SS        V I +++ ND  P+     K E       + E  P R  +A LQ  D D        +V DI  S +D H+ F I  +  +        F+ N L   D +     Y ++ I   D     PL +     + L D NDN P F  ++Y   L EN P  +         LDK  G    + Y I  +  + + W+ F +D++SG ++S    DYE+ + +   ++A   D     ++  + V +   ++  P F +  Y F +   V  P    +GQ+  TD D+ P+ ++V      +++      V+++SG      KLK  G  D       R I+++I+    AS    N + S  +V I ++
Sbjct: 2518 LTVRVNDENDNAPVFLAQQPPAYFAILPAISEISESLSVDFDLLTVNATDADSEGNNSKVIYIIEPAQEGFSVHPS--NGVVS-----VNMSRLQPAVSSSGDYFVRIIAKDAGKPALKSSTLLRVQANDNGSGRSQFLQNQYRAQISEAAPLGSVV------LQLGQDALDQSLAIIAGNE------ESAFEL-----LQSKAIVLVKPLDRERNDL-YKLRLVLSHPHGPPLISSLNSSSGISVIITILDANDNFPIFDRSAKYEA-----EISELAPLRYSIAQLQAIDADQENTPNSEVVYDI-TSGNDEHM-FTIDLVTGVL-------FVNNRL---DYDSGAKSY-ELIIRACDSHHQRPLCSLQPFRLELHDENDNEPKFPLTEYVHFLAENEPVGSSVFRAHASDLDK--GPFGQLNYSIGPAPSDESSWKMFRVDSESGLVTSAFVFDYEQRQRYDMELLA--SDMGGKKASVAVRVEIESRDEFTPQFTERTYRFVLPAAVALPQGYVVGQVTATDSDSGPDGRVVYQLSAPHSH----FKVNRSSGAVLIKRKLKLDGDGDGNLYMDGRDISLVIS----ASSGRHNSLSSMAVVEIALD 3074          

HSP 12 Score: 73.9442 bits (180), Expect = 9.858e-13
Identity = 123/509 (24.17%), Postives = 200/509 (39.29%), Query Frame = 2
Query:  695 LDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHS-KLVNVISFYVTDLD-EGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITAINEIHPLGHYKEFI-INTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPP----VFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIF 2200
            LDRE  + Y  +   +   N        + V + V D NDN P F +T       E++ + V        DLD E  N Q    I + N     ++    + D    ++   +++   +D ET P  YS  + A D G P L     VNI + + ND  P+    R         T+ EN    T V  +  SD D+     E  L +Y +N   +   ++  +      I IN  K LD E    +  ++ +   D  +  PL T   + I + D+NDN P    +F       ++ E+      + +  I   D D  K  Y    +  +     +   T D     +     +D E    ++ +++A DK    L ++  I + + D NDN P F +  Y   V E     T + Q+   D D    + +     ++   + Q   +D  +G + T   ID E      + + AR+         + S   V++TI DVNDN PIF
Sbjct:  138 LDRETRASYSLVAIPLSGRN--------IRVLVTVKDENDNAPTFPQTSMHIEFPENTPREVKRTLLPARDLDLEPYNTQ-RYNIVSGNVNDAFRLSSHRERD---GVLYLDLQISGFLDRETTP-GYSLLIEALDGGTPPLRGFMTVNITIQDVNDNQPIFNQSRY------FATVPENATVGTSVLQVYASDTDA----DENGLVEYAINRRQSDKEQMFRIDPRTGAIYIN--KALDFE--TKELHELVVVAKDHGE-QPLETTAFVSIRVTDVNDNQPTINVIFLSDDASPKISESAQPG--EFVARISVHDPD-SKTEYANVNVTLNGGDGHFALTTRDNSIYLVIVHLPLDREIVSNYTLSVVATDKGTPPLHASKSIFLRITDVNDNPPEFEQDLYHANVMEVADPGTSVLQVLAHDRDEGLNSALTYSLAETPETHAQWFQIDPQTGLITTRSHIDCETEPVPQLTVVARDGGVPP----LSSTATVLVTIHDVNDNEPIF 611          

HSP 13 Score: 71.633 bits (174), Expect = 4.001e-12
Identity = 71/286 (24.83%), Postives = 123/286 (43.01%), Query Frame = 2
Query: 1382 INTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDH---------GKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKY-FHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIFSLI 2209
            I T   LDRE  +  Y  + I  S +        N+ + + + D NDN P F ++    E  EN P+   + + P   LD +            N    +++ S +      Y  +     +IS    +D E    +S  I A+D     L     + + + D NDN PIF +  Y  TV EN  V T + Q+  +D D   EN +V+Y  ++  ++  Q+  +D  +G +     +D E      +++ A++      +  +++   V I + DVNDN P  ++I
Sbjct:  132 IRTKVKLDRET-RASYSLVAIPLSGR--------NIRVLVTVKDENDNAPTFPQTSMHIEFPENTPREVKRTLLPARDLDLEPYNTQRYNIVSGNVNDAFRLSSHRERDGVLYLDL-----QISG--FLDRETTPGYSLLIEALDGGTPPLRGFMTVNITIQDVNDNQPIFNQSRYFATVPENATVGTSVLQVYASDTDAD-ENGLVEYAINRRQSDKEQMFRIDPRTGAIYINKALDFETKELHELVVVAKD----HGEQPLETTAFVSIRVTDVNDNQPTINVI 396          

HSP 14 Score: 69.707 bits (169), Expect = 1.722e-11
Identity = 124/521 (23.80%), Postives = 211/521 (40.50%), Query Frame = 2
Query:  716 EYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVE-HSKLVNVISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITAINE---IHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPI------LTLDKD-----------HGKNAYVTYKIDSSKNSTDWEYFTIDADSGKIS---SRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREK--VRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIF 2200
            E R +L  V R  D     S  E+ I++ D NDN P F +  + A + E ++K   V   +  D D G N ++   I   N      I+  F         +G +R    +D E     Y   +IATD G+P+++ TA + + +++ ND  P           +  +T+ E      ++ S+  +D D+           Y L  E T   E   I  L  Y   ++   + LD E    Q  ++++  SD        T LT+ +N  D NDN PVF   +         P A   ++  I      L++D D            G N+ V Y I+ ++     E F++   +G +S   SR       +  +   IIA D  +  L S+ L+ V   D       F +  Y   + E  P+ + + Q+    LD     + +     +  + ++++     S  +  + P+DRE+  +  + ++++  +     +     S   VIITI D NDN PIF
Sbjct: 2287 EIRVVL--VARTADAPFLASYAELVIELEDENDNSPKFSQKQFVATVSEGNNKGTFVAQVHAFDSDAGSNARLRYHIVDGNHDNAFVIEPAF---------SGIVRTNIVLDREIRDI-YKLKIIATDEGVPQMTGTATIRVQIVDVNDNQPTFP-------PNNLVTVSEATELGAVITSISANDVDTYPALT------YRLGAESTVDIENMSIFALDRYSGKLVLKRR-LDYE--LQQEYELDVIASDAAHEA--RTVLTVRVN--DENDNAPVFLAQQ---------PPAYFAILPAISEISESLSVDFDLLTVNATDADSEGNNSKVIYIIEPAQ-----EGFSVHPSNGVVSVNMSRLQPAVSSSGDYFVRIIAKDAGKPALKSSTLLRVQANDNGSGRSQFLQNQYRAQISEAAPLGSVVLQLGQDALD-----QSLAIIAGNEESAFELLQ----SKAIVLVKPLDRERNDLYKLRLVLSHPHGPPLISSLNSSSGISVIITILDANDNFPIF 2752          
BLAST of Protocadherin Fat 1 vs. Ensembl Fly
Match: stan (gene:FBgn0024836 transcript:FBtr0304900)

HSP 1 Score: 166.777 bits (421), Expect = 3.282e-41
Identity = 159/598 (26.59%), Postives = 265/598 (44.31%), Query Frame = 2
Query:  440 ILIKVLDENDNSPKFLPFLNPYQTLPEN----SQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKL-VNVISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITAIN---EIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKI--DSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIFS 2203
            + +KVLD+NDN P+F       Q +PE+    ++ NTV  +  A D D        Y I     IG ++       I S    + L+ PLD E +  YR +++A D  +    + +  ++ + V D NDN P F  + +  +++E+  +  N+I     D DEG N +++ +I   +D         F +   P   TG ++ I  +D E    +++F ++A D G+P  S+++ V I + + ND  P          V       E++P  T V ++  +D D          +D  L++EIT  N              +I   + LD + +K   L +    S     T      T+HIN+ D N+  P+F  + Y   + E+ P  T  ++  +   D D G NA +TY +  +S       + F+I+  +G I +   +D E    +   + A D    +LS T  + + V D NDNAP F  P Y  ++ E+  V T + Q+  +D D     +I KY             +D  SG ++T   +DRE V    +   A ++ S      + S   V I +EDVND+PP F+
Sbjct:  567 VQVKVLDDNDNYPQFSERTYTVQ-VPEDQWGGTEDNTVAHI-RATDADQGNNAAIRYAI-----IGGNTQSQF--SIDSMSGDVSLVKPLDYESVRSYRLVIRAQDGGSPSRSNTT--QLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISERDDN--------FPLAVDPR--TGWVQTIKPLDREEQG-RFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVG------EDQPPGTPVTTVTATDPD----------EDSRLHYEITTGNTRGRFAITSQNGRGLITIAQSLDYKQEKRFLLTVAATDSGGRSDTA-----TVHINITDANNFAPIFENAPYSASVFEDAPVGTTVLV--VSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDALVGTSVIQVAASDPDVGLNGRI-KYLLSDRDIEDGSFVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSPP----LSSTVEVQIRLEDVNDSPPTFA 1114          

HSP 2 Score: 157.147 bits (396), Expect = 3.255e-38
Identity = 155/602 (25.75%), Postives = 263/602 (43.69%), Query Frame = 2
Query:  446 IKVLDENDNSPKFLPFLNPYQTLPENSQINTVILLPSAIDLD-----SEAFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDREN-DDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEH----SKLVNVISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLV-TDIECSLDDYHLNFEITAINEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLD-KDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGK--ISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNY---QVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIF 2200
            + VLD ND+SP F        ++ E + + + ++   A D D        +GI+   ++    +  D    +  +I S    +   S LDRE    Y  ++ A D  +    R  +   V++KV D NDN P F +  YT  + E     ++   V     TD D+G N  +   I   N           Q  FS   M+G + L+  +DYE+    Y   + A D G P  S+T ++ + +I+ ND AP     +  E      ++ EN P    +  +Q  D D     +I  S+ +   NF +     + P   +    + T+KPLDRE+      ++    +    + P + + ++ I + D+NDN P F    Y+  + E+ P  T     P+ T+   D  +++ + Y+I +         F I + +G+  I+  QS+DY++ K F   + A   D    S TA + +++ DAN+ APIF    YS +V E+ PV T +  +  TD D     +I    ++   N         ++  +G + T  P+DRE      + +TA++  +    +  D E    I + DVNDN P F
Sbjct:  452 VNVLDCNDHSPTF-EAEQFEASIREGATVGSTVITLRATDQDIGKNAEIEYGIE--AVTDGAGLAQDQEMPIF-RIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNT----------QSQFSIDSMSGDVSLVKPLDYES-VRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQE------SVLENVPVGYNIIRVQAYDSDEGANAEITYSISERDDNFPLA----VDPRTGW----VQTIKPLDREEQGRFAFQV---VAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGT-----PVTTVTATDPDEDSRLHYEITTGNTRGR---FAITSQNGRGLITIAQSLDYKQEKRFLLTVAA--TDSGGRSDTATVHINITDANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVE----IGVTDVNDNAPAF 1007          

HSP 3 Score: 155.221 bits (391), Expect = 1.231e-37
Identity = 171/602 (28.41%), Postives = 268/602 (44.52%), Query Frame = 2
Query:  440 ILIKVLDENDNSPKFLPFLNPYQ-TLPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKLVNVISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEIT-AINE--IHPLGHYKEFIIN-------TLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLT-IHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKY--FHKSYTNNYQVI-HVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIF 2200
            +L+ V+D NDN+P+F  + + +Q ++ EN  +   I+   A D D  A     Y IS+      D +F L     +G  Q   I PLDRE   + RF  + V ++       +   V I V D+NDN P F+  +Y AN+ E       ++  VT  D  ++ ++   I T N   +  I        +     G I +   +DY+    ++   + ATD+G    S TA V+I + + N+ AP+       E    S ++FE+ P  T V  L VS  DS          D  +N +IT ++NE  I+ LG    F IN       T  PLDRE      L +    + +D   P  ++ T + I + D+NDN P F    YQ  ++E+    T   +  +   D D G N  + Y + S ++  D   F ID  SG I + + +D E   +F    IA+DK    LSST  + + + D ND+ P F     +  V EN PV + +G+I   D D    N +V Y       +N + ++        +L T+  +D E  R    L+        +N    D+   +++T  DVNDN P+ 
Sbjct:  675 LLVNVIDANDNAPRF--YTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISE-----RDDNFPLAVDPRTGWVQT--IKPLDRE--EQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVT-TVTATDPDEDSRLHYEITTGNTRGRFAI--------TSQNGRGLITIAQSLDYKQEK-RFLLTVAATDSG--GRSDTATVHINITDANNFAPIF------ENAPYSASVFEDAPVGTTV--LVVSATDS----------DVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTV----TAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDALVGT--SVIQVAASDPDVGLNGRIKYLL-SDRDIEDGS-FVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRLEDVNDSPPTFASDKITLYVPENSPVGSVVGEIHAHDPD-EGVNAVVHYSIIGGDDSNAFSLVTRPGSERAQLLTMTELDYESTRKRFELVVRAASPPLRN----DAHIEILVT--DVNDNAPVL 1220          

HSP 4 Score: 130.183 bits (326), Expect = 6.094e-30
Identity = 122/493 (24.75%), Postives = 221/493 (44.83%), Query Frame = 2
Query:  761 HRDISGVEVEIKVG-DINDNPPVFDKTFYTANIVEHSKLVNVISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITAINEIHPLGHYKEF----------IINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATV-KMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIFS 2203
            H++ +  ++  +V  ++ +  P F++  Y A+++E       ++         ++ + S  + +       + +  F++D    ++T S  L    D E     Y F ++ATD+  P  S T  + + +++ ND +P  +     E    SI   E     + V +L+ +D+D           +  + + I A+ +   L   +E           +I+T   LDRE   + +L +        +    T   ++ + + D NDN P F+   Y  ++ E+    T    +  I   D D G NA + Y I      +    F+ID+ SG +S  + +DYE  + +   I A D    + S+T  ++V+VIDANDNAP F    +  +V ENVPV   I +++  D D    N  + Y      +N+  + VD  +G ++TI P+DRE+       + A+ +     K+   S   V+IT++DVNDN P F+
Sbjct:  336 HQEFNDTDIARRVRRELRNQSPYFEQALYVASVLEEQPAGAAVTTV-----RARDPEDSPVVYSMVSLLDSRSQSLFKVDSRTGVVTTSASL----DRELMDVHY-FRVVATDDSFPPRSGTTTLQVNVLDCNDHSPTFE----AEQFEASIR--EGATVGSTVITLRATDQDIG--------KNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNTQSQ---FSIDSMSGDVSLVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSD-EGANAEITYSISERDDNFP-LAVDPRTGWVQTIKPLDREEQGRFAFQVVAK-DGGVPPKSASSS---VVITVQDVNDNDPAFN 795          

HSP 5 Score: 113.235 bits (282), Expect = 8.368e-25
Identity = 156/564 (27.66%), Postives = 246/564 (43.62%), Query Frame = 2
Query:  395 FSFQV---DSGI--KISSFYILIKVLDENDNSPKFLPFL---NPYQTLPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGND-SHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKL-VNVISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQID-FSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRD-SLVTDIECSLDDYHLNFEITAINEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFT-IDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSF-TVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKL 2044
            F+FQV   D G+  K +S  ++I V D NDN P F P     N  +  P  + + TV    +A D D ++    +Y+I+     GN    F +  +  +GR  + +   LD +   E RF+L     ++    D + V + I   D N+  P+F+   Y+A++ E + +   V+    TD D G N Q++ ++  E+      I      D FS +  TG+I     +D ET    Y   + A D G P LS T  V I + + ND AP      K  +   SI   E+    T V  +  SD D  L   I+  L D  +      I+            I T K LDRE        +     D+    PL++ + + I L D+ND+PP F   K    + EN P  +V  +  I   D D G NA V Y I    +S  +   T   ++  ++ +   +DYE  +   F ++ +      L + A I + V D NDNAP+       F   R++ P + EIG+I   D D    +K+  ++     NN  ++ ++ +SG L
Sbjct:  760 FAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTV----TATDPDEDSR--LHYEITT----GNTRGRFAITSQ--NGRGLITIAQSLDYK--QEKRFLLTVAATDSGGRSDTATVHINIT--DANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEES------INGLGSPDPFSINPQTGAIVTNAPLDRETTS-GYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAF----KSPLYQASI--LEDALVGTSVIQVAASDPDVGLNGRIKYLLSDRDIEDGSFVIDPTSG-------TIRTNKGLDRE--SVAVFHLTAIAVDKGS-PPLSSTVEVQIRLEDVNDSPPTFASDKITLYVPENSPVGSV--VGEIHAHDPDEGVNAVVHYSIIGGDDSNAFSLVTRPGSERAQLLTMTELDYESTRK-RFELV-VRAASPPLRNDAHIEILVTDVNDNAPVLRDFQVIFNNFRDHFP-SGEIGRIPAFDADV--SDKL--HYRILSGNNANLLRLNSSSGGL 1275          
BLAST of Protocadherin Fat 1 vs. Ensembl Fly
Match: stan (gene:FBgn0024836 transcript:FBtr0304899)

HSP 1 Score: 166.777 bits (421), Expect = 3.698e-41
Identity = 159/598 (26.59%), Postives = 265/598 (44.31%), Query Frame = 2
Query:  440 ILIKVLDENDNSPKFLPFLNPYQTLPEN----SQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKL-VNVISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITAIN---EIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKI--DSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIFS 2203
            + +KVLD+NDN P+F       Q +PE+    ++ NTV  +  A D D        Y I     IG ++       I S    + L+ PLD E +  YR +++A D  +    + +  ++ + V D NDN P F  + +  +++E+  +  N+I     D DEG N +++ +I   +D         F +   P   TG ++ I  +D E    +++F ++A D G+P  S+++ V I + + ND  P          V       E++P  T V ++  +D D          +D  L++EIT  N              +I   + LD + +K   L +    S     T      T+HIN+ D N+  P+F  + Y   + E+ P  T  ++  +   D D G NA +TY +  +S       + F+I+  +G I +   +D E    +   + A D    +LS T  + + V D NDNAP F  P Y  ++ E+  V T + Q+  +D D     +I KY             +D  SG ++T   +DRE V    +   A ++ S      + S   V I +EDVND+PP F+
Sbjct:  567 VQVKVLDDNDNYPQFSERTYTVQ-VPEDQWGGTEDNTVAHI-RATDADQGNNAAIRYAI-----IGGNTQSQF--SIDSMSGDVSLVKPLDYESVRSYRLVIRAQDGGSPSRSNTT--QLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISERDDN--------FPLAVDPR--TGWVQTIKPLDREEQG-RFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVG------EDQPPGTPVTTVTATDPD----------EDSRLHYEITTGNTRGRFAITSQNGRGLITIAQSLDYKQEKRFLLTVAATDSGGRSDTA-----TVHINITDANNFAPIFENAPYSASVFEDAPVGTTVLV--VSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDALVGTSVIQVAASDPDVGLNGRI-KYLLSDRDIEDGSFVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSPP----LSSTVEVQIRLEDVNDSPPTFA 1114          

HSP 2 Score: 156.762 bits (395), Expect = 3.730e-38
Identity = 155/602 (25.75%), Postives = 263/602 (43.69%), Query Frame = 2
Query:  446 IKVLDENDNSPKFLPFLNPYQTLPENSQINTVILLPSAIDLD-----SEAFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDREN-DDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEH----SKLVNVISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLV-TDIECSLDDYHLNFEITAINEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLD-KDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGK--ISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNY---QVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIF 2200
            + VLD ND+SP F        ++ E + + + ++   A D D        +GI+   ++    +  D    +  +I S    +   S LDRE    Y  ++ A D  +    R  +   V++KV D NDN P F +  YT  + E     ++   V     TD D+G N  +   I   N           Q  FS   M+G + L+  +DYE+    Y   + A D G P  S+T ++ + +I+ ND AP     +  E      ++ EN P    +  +Q  D D     +I  S+ +   NF +     + P   +    + T+KPLDRE+      ++    +    + P + + ++ I + D+NDN P F    Y+  + E+ P  T     P+ T+   D  +++ + Y+I +         F I + +G+  I+  QS+DY++ K F   + A   D    S TA + +++ DAN+ APIF    YS +V E+ PV T +  +  TD D     +I    ++   N         ++  +G + T  P+DRE      + +TA++  +    +  D E    I + DVNDN P F
Sbjct:  452 VNVLDCNDHSPTF-EAEQFEASIREGATVGSTVITLRATDQDIGKNAEIEYGIE--AVTDGAGLAQDQEMPIF-RIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNT----------QSQFSIDSMSGDVSLVKPLDYES-VRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQE------SVLENVPVGYNIIRVQAYDSDEGANAEITYSISERDDNFPLA----VDPRTGW----VQTIKPLDREEQGRFAFQV---VAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGT-----PVTTVTATDPDEDSRLHYEITTGNTRGR---FAITSQNGRGLITIAQSLDYKQEKRFLLTVAA--TDSGGRSDTATVHINITDANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVE----IGVTDVNDNAPAF 1007          

HSP 3 Score: 155.221 bits (391), Expect = 1.422e-37
Identity = 171/602 (28.41%), Postives = 268/602 (44.52%), Query Frame = 2
Query:  440 ILIKVLDENDNSPKFLPFLNPYQ-TLPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKLVNVISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEIT-AINE--IHPLGHYKEFIIN-------TLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLT-IHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKY--FHKSYTNNYQVI-HVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIF 2200
            +L+ V+D NDN+P+F  + + +Q ++ EN  +   I+   A D D  A     Y IS+      D +F L     +G  Q   I PLDRE   + RF  + V ++       +   V I V D+NDN P F+  +Y AN+ E       ++  VT  D  ++ ++   I T N   +  I        +     G I +   +DY+    ++   + ATD+G    S TA V+I + + N+ AP+       E    S ++FE+ P  T V  L VS  DS          D  +N +IT ++NE  I+ LG    F IN       T  PLDRE      L +    + +D   P  ++ T + I + D+NDN P F    YQ  ++E+    T   +  +   D D G N  + Y + S ++  D   F ID  SG I + + +D E   +F    IA+DK    LSST  + + + D ND+ P F     +  V EN PV + +G+I   D D    N +V Y       +N + ++        +L T+  +D E  R    L+        +N    D+   +++T  DVNDN P+ 
Sbjct:  675 LLVNVIDANDNAPRF--YTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISE-----RDDNFPLAVDPRTGWVQT--IKPLDRE--EQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVT-TVTATDPDEDSRLHYEITTGNTRGRFAI--------TSQNGRGLITIAQSLDYKQEK-RFLLTVAATDSG--GRSDTATVHINITDANNFAPIF------ENAPYSASVFEDAPVGTTV--LVVSATDS----------DVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTV----TAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDALVGT--SVIQVAASDPDVGLNGRIKYLL-SDRDIEDGS-FVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRLEDVNDSPPTFASDKITLYVPENSPVGSVVGEIHAHDPD-EGVNAVVHYSIIGGDDSNAFSLVTRPGSERAQLLTMTELDYESTRKRFELVVRAASPPLRN----DAHIEILVT--DVNDNAPVL 1220          

HSP 4 Score: 130.183 bits (326), Expect = 6.576e-30
Identity = 122/493 (24.75%), Postives = 221/493 (44.83%), Query Frame = 2
Query:  761 HRDISGVEVEIKVG-DINDNPPVFDKTFYTANIVEHSKLVNVISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITAINEIHPLGHYKEF----------IINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATV-KMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIFS 2203
            H++ +  ++  +V  ++ +  P F++  Y A+++E       ++         ++ + S  + +       + +  F++D    ++T S  L    D E     Y F ++ATD+  P  S T  + + +++ ND +P  +     E    SI   E     + V +L+ +D+D           +  + + I A+ +   L   +E           +I+T   LDRE   + +L +        +    T   ++ + + D NDN P F+   Y  ++ E+    T    +  I   D D G NA + Y I      +    F+ID+ SG +S  + +DYE  + +   I A D    + S+T  ++V+VIDANDNAP F    +  +V ENVPV   I +++  D D    N  + Y      +N+  + VD  +G ++TI P+DRE+       + A+ +     K+   S   V+IT++DVNDN P F+
Sbjct:  336 HQEFNDTDIARRVRRELRNQSPYFEQALYVASVLEEQPAGAAVTTV-----RARDPEDSPVVYSMVSLLDSRSQSLFKVDSRTGVVTTSASL----DRELMDVHY-FRVVATDDSFPPRSGTTTLQVNVLDCNDHSPTFE----AEQFEASIR--EGATVGSTVITLRATDQDIG--------KNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNTQSQ---FSIDSMSGDVSLVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSD-EGANAEITYSISERDDNFP-LAVDPRTGWVQTIKPLDREEQGRFAFQVVAK-DGGVPPKSASSS---VVITVQDVNDNDPAFN 795          

HSP 5 Score: 113.235 bits (282), Expect = 8.581e-25
Identity = 156/564 (27.66%), Postives = 246/564 (43.62%), Query Frame = 2
Query:  395 FSFQV---DSGI--KISSFYILIKVLDENDNSPKFLPFL---NPYQTLPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGND-SHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKL-VNVISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQID-FSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRD-SLVTDIECSLDDYHLNFEITAINEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFT-IDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSF-TVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKL 2044
            F+FQV   D G+  K +S  ++I V D NDN P F P     N  +  P  + + TV    +A D D ++    +Y+I+     GN    F +  +  +GR  + +   LD +   E RF+L     ++    D + V + I   D N+  P+F+   Y+A++ E + +   V+    TD D G N Q++ ++  E+      I      D FS +  TG+I     +D ET    Y   + A D G P LS T  V I + + ND AP      K  +   SI   E+    T V  +  SD D  L   I+  L D  +      I+            I T K LDRE        +     D+    PL++ + + I L D+ND+PP F   K    + EN P  +V  +  I   D D G NA V Y I    +S  +   T   ++  ++ +   +DYE  +   F ++ +      L + A I + V D NDNAP+       F   R++ P + EIG+I   D D    +K+  ++     NN  ++ ++ +SG L
Sbjct:  760 FAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTV----TATDPDEDSR--LHYEITT----GNTRGRFAITSQ--NGRGLITIAQSLDYK--QEKRFLLTVAATDSGGRSDTATVHINIT--DANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEES------INGLGSPDPFSINPQTGAIVTNAPLDRETTS-GYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAF----KSPLYQASI--LEDALVGTSVIQVAASDPDVGLNGRIKYLLSDRDIEDGSFVIDPTSG-------TIRTNKGLDRE--SVAVFHLTAIAVDKGS-PPLSSTVEVQIRLEDVNDSPPTFASDKITLYVPENSPVGSV--VGEIHAHDPDEGVNAVVHYSIIGGDDSNAFSLVTRPGSERAQLLTMTELDYESTRK-RFELV-VRAASPPLRNDAHIEILVTDVNDNAPVLRDFQVIFNNFRDHFP-SGEIGRIPAFDADV--SDKL--HYRILSGNNANLLRLNSSSGGL 1275          
BLAST of Protocadherin Fat 1 vs. Ensembl Fly
Match: stan (gene:FBgn0024836 transcript:FBtr0300578)

HSP 1 Score: 166.777 bits (421), Expect = 3.698e-41
Identity = 159/598 (26.59%), Postives = 265/598 (44.31%), Query Frame = 2
Query:  440 ILIKVLDENDNSPKFLPFLNPYQTLPEN----SQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKL-VNVISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITAIN---EIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKI--DSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIFS 2203
            + +KVLD+NDN P+F       Q +PE+    ++ NTV  +  A D D        Y I     IG ++       I S    + L+ PLD E +  YR +++A D  +    + +  ++ + V D NDN P F  + +  +++E+  +  N+I     D DEG N +++ +I   +D         F +   P   TG ++ I  +D E    +++F ++A D G+P  S+++ V I + + ND  P          V       E++P  T V ++  +D D          +D  L++EIT  N              +I   + LD + +K   L +    S     T      T+HIN+ D N+  P+F  + Y   + E+ P  T  ++  +   D D G NA +TY +  +S       + F+I+  +G I +   +D E    +   + A D    +LS T  + + V D NDNAP F  P Y  ++ E+  V T + Q+  +D D     +I KY             +D  SG ++T   +DRE V    +   A ++ S      + S   V I +EDVND+PP F+
Sbjct:  567 VQVKVLDDNDNYPQFSERTYTVQ-VPEDQWGGTEDNTVAHI-RATDADQGNNAAIRYAI-----IGGNTQSQF--SIDSMSGDVSLVKPLDYESVRSYRLVIRAQDGGSPSRSNTT--QLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISERDDN--------FPLAVDPR--TGWVQTIKPLDREEQG-RFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVG------EDQPPGTPVTTVTATDPD----------EDSRLHYEITTGNTRGRFAITSQNGRGLITIAQSLDYKQEKRFLLTVAATDSGGRSDTA-----TVHINITDANNFAPIFENAPYSASVFEDAPVGTTVLV--VSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDALVGTSVIQVAASDPDVGLNGRI-KYLLSDRDIEDGSFVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSPP----LSSTVEVQIRLEDVNDSPPTFA 1114          

HSP 2 Score: 156.762 bits (395), Expect = 3.730e-38
Identity = 155/602 (25.75%), Postives = 263/602 (43.69%), Query Frame = 2
Query:  446 IKVLDENDNSPKFLPFLNPYQTLPENSQINTVILLPSAIDLD-----SEAFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDREN-DDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEH----SKLVNVISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLV-TDIECSLDDYHLNFEITAINEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLD-KDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGK--ISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNY---QVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIF 2200
            + VLD ND+SP F        ++ E + + + ++   A D D        +GI+   ++    +  D    +  +I S    +   S LDRE    Y  ++ A D  +    R  +   V++KV D NDN P F +  YT  + E     ++   V     TD D+G N  +   I   N           Q  FS   M+G + L+  +DYE+    Y   + A D G P  S+T ++ + +I+ ND AP     +  E      ++ EN P    +  +Q  D D     +I  S+ +   NF +     + P   +    + T+KPLDRE+      ++    +    + P + + ++ I + D+NDN P F    Y+  + E+ P  T     P+ T+   D  +++ + Y+I +         F I + +G+  I+  QS+DY++ K F   + A   D    S TA + +++ DAN+ APIF    YS +V E+ PV T +  +  TD D     +I    ++   N         ++  +G + T  P+DRE      + +TA++  +    +  D E    I + DVNDN P F
Sbjct:  452 VNVLDCNDHSPTF-EAEQFEASIREGATVGSTVITLRATDQDIGKNAEIEYGIE--AVTDGAGLAQDQEMPIF-RIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNT----------QSQFSIDSMSGDVSLVKPLDYES-VRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQE------SVLENVPVGYNIIRVQAYDSDEGANAEITYSISERDDNFPLA----VDPRTGW----VQTIKPLDREEQGRFAFQV---VAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGT-----PVTTVTATDPDEDSRLHYEITTGNTRGR---FAITSQNGRGLITIAQSLDYKQEKRFLLTVAA--TDSGGRSDTATVHINITDANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVE----IGVTDVNDNAPAF 1007          

HSP 3 Score: 155.221 bits (391), Expect = 1.422e-37
Identity = 171/602 (28.41%), Postives = 268/602 (44.52%), Query Frame = 2
Query:  440 ILIKVLDENDNSPKFLPFLNPYQ-TLPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKLVNVISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEIT-AINE--IHPLGHYKEFIIN-------TLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLT-IHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKY--FHKSYTNNYQVI-HVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIF 2200
            +L+ V+D NDN+P+F  + + +Q ++ EN  +   I+   A D D  A     Y IS+      D +F L     +G  Q   I PLDRE   + RF  + V ++       +   V I V D+NDN P F+  +Y AN+ E       ++  VT  D  ++ ++   I T N   +  I        +     G I +   +DY+    ++   + ATD+G    S TA V+I + + N+ AP+       E    S ++FE+ P  T V  L VS  DS          D  +N +IT ++NE  I+ LG    F IN       T  PLDRE      L +    + +D   P  ++ T + I + D+NDN P F    YQ  ++E+    T   +  +   D D G N  + Y + S ++  D   F ID  SG I + + +D E   +F    IA+DK    LSST  + + + D ND+ P F     +  V EN PV + +G+I   D D    N +V Y       +N + ++        +L T+  +D E  R    L+        +N    D+   +++T  DVNDN P+ 
Sbjct:  675 LLVNVIDANDNAPRF--YTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISE-----RDDNFPLAVDPRTGWVQT--IKPLDRE--EQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVT-TVTATDPDEDSRLHYEITTGNTRGRFAI--------TSQNGRGLITIAQSLDYKQEK-RFLLTVAATDSG--GRSDTATVHINITDANNFAPIF------ENAPYSASVFEDAPVGTTV--LVVSATDS----------DVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTV----TAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDALVGT--SVIQVAASDPDVGLNGRIKYLL-SDRDIEDGS-FVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRLEDVNDSPPTFASDKITLYVPENSPVGSVVGEIHAHDPD-EGVNAVVHYSIIGGDDSNAFSLVTRPGSERAQLLTMTELDYESTRKRFELVVRAASPPLRN----DAHIEILVT--DVNDNAPVL 1220          

HSP 4 Score: 130.183 bits (326), Expect = 6.576e-30
Identity = 122/493 (24.75%), Postives = 221/493 (44.83%), Query Frame = 2
Query:  761 HRDISGVEVEIKVG-DINDNPPVFDKTFYTANIVEHSKLVNVISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITAINEIHPLGHYKEF----------IINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATV-KMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIFS 2203
            H++ +  ++  +V  ++ +  P F++  Y A+++E       ++         ++ + S  + +       + +  F++D    ++T S  L    D E     Y F ++ATD+  P  S T  + + +++ ND +P  +     E    SI   E     + V +L+ +D+D           +  + + I A+ +   L   +E           +I+T   LDRE   + +L +        +    T   ++ + + D NDN P F+   Y  ++ E+    T    +  I   D D G NA + Y I      +    F+ID+ SG +S  + +DYE  + +   I A D    + S+T  ++V+VIDANDNAP F    +  +V ENVPV   I +++  D D    N  + Y      +N+  + VD  +G ++TI P+DRE+       + A+ +     K+   S   V+IT++DVNDN P F+
Sbjct:  336 HQEFNDTDIARRVRRELRNQSPYFEQALYVASVLEEQPAGAAVTTV-----RARDPEDSPVVYSMVSLLDSRSQSLFKVDSRTGVVTTSASL----DRELMDVHY-FRVVATDDSFPPRSGTTTLQVNVLDCNDHSPTFE----AEQFEASIR--EGATVGSTVITLRATDQDIG--------KNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNTQSQ---FSIDSMSGDVSLVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSD-EGANAEITYSISERDDNFP-LAVDPRTGWVQTIKPLDREEQGRFAFQVVAK-DGGVPPKSASSS---VVITVQDVNDNDPAFN 795          

HSP 5 Score: 113.235 bits (282), Expect = 8.581e-25
Identity = 156/564 (27.66%), Postives = 246/564 (43.62%), Query Frame = 2
Query:  395 FSFQV---DSGI--KISSFYILIKVLDENDNSPKFLPFL---NPYQTLPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGND-SHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKL-VNVISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQID-FSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRD-SLVTDIECSLDDYHLNFEITAINEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFT-IDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSF-TVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKL 2044
            F+FQV   D G+  K +S  ++I V D NDN P F P     N  +  P  + + TV    +A D D ++    +Y+I+     GN    F +  +  +GR  + +   LD +   E RF+L     ++    D + V + I   D N+  P+F+   Y+A++ E + +   V+    TD D G N Q++ ++  E+      I      D FS +  TG+I     +D ET    Y   + A D G P LS T  V I + + ND AP      K  +   SI   E+    T V  +  SD D  L   I+  L D  +      I+            I T K LDRE        +     D+    PL++ + + I L D+ND+PP F   K    + EN P  +V  +  I   D D G NA V Y I    +S  +   T   ++  ++ +   +DYE  +   F ++ +      L + A I + V D NDNAP+       F   R++ P + EIG+I   D D    +K+  ++     NN  ++ ++ +SG L
Sbjct:  760 FAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTV----TATDPDEDSR--LHYEITT----GNTRGRFAITSQ--NGRGLITIAQSLDYK--QEKRFLLTVAATDSGGRSDTATVHINIT--DANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEES------INGLGSPDPFSINPQTGAIVTNAPLDRETTS-GYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAF----KSPLYQASI--LEDALVGTSVIQVAASDPDVGLNGRIKYLLSDRDIEDGSFVIDPTSG-------TIRTNKGLDRE--SVAVFHLTAIAVDKGS-PPLSSTVEVQIRLEDVNDSPPTFASDKITLYVPENSPVGSV--VGEIHAHDPDEGVNAVVHYSIIGGDDSNAFSLVTRPGSERAQLLTMTELDYESTRK-RFELV-VRAASPPLRNDAHIEILVTDVNDNAPVLRDFQVIFNNFRDHFP-SGEIGRIPAFDADV--SDKL--HYRILSGNNANLLRLNSSSGGL 1275          
BLAST of Protocadherin Fat 1 vs. Ensembl Zebrafish
Match: LO018022.1 (FAT atypical cadherin 4 [Source:NCBI gene;Acc:101882648])

HSP 1 Score: 200.675 bits (509), Expect = 1.342e-51
Identity = 181/603 (30.02%), Postives = 298/603 (49.42%), Query Frame = 2
Query:  440 ILIKVLDENDNSPKFLPFLNPYQTLPENSQINTVILLPSAIDLDSEAFGIKY--YKISKPFLIGNDSHFTLLDKIA--SGRPQLL-LIS--PLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKL-VNVISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITAINE-----IHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKD-QSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYT--NNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIF 2200
            + I VLD NDN+P F P  +   +  E++     ++L +A D D  + G+ +  Y+I    + GND     LD     SG    L L+S   LDRE    Y+ +++  D+   + +    ++V + + DINDNPP FD   Y  ++ E + +  +V+    +DLDEG N +++  ++             FQID       G++ + + +DYET   +YS  + A DNG+P L +  +  + L++ ND  PV+K  R     S+  ++ EN    T+VA L VSD DS       S  + +++  I   NE     +H        +I     LDRE   +  L +++  SD  K    ++  ++ I + DIND+PP+F  + Y+ ++ E+IP+ +   I+ +   D D G+NA + Y +  S NS  W  F I  +SG ++S   ++ E       NI A D+  Q  +S T L IV++ D ND  P F +  Y  ++ E+ P  +E+  +  TD D  P N  +++   S T  ++     +D  SG+L T   +DRE+  S  + I A +  +      + S C V IT++DVNDN P+F
Sbjct:  107 VRIVVLDINDNAPVF-PDASIVVSFKEDASSGRQVILDTATDADIGSNGVDHTTYRI----ISGNDQRKFRLDITVNPSGEGAFLHLVSTGGLDRETTPFYQLLIQVEDK--GEPKKFGYLQVNVTIQDINDNPPSFDHEQYQTSVFEDAAVGSSVLQIAASDLDEGANAEITYLLDEGTP---------FQID----PKAGTVVIKEGLDYETK-REYSLTIHAVDNGVPSLYTRTEATVKLLDVNDNDPVVK-FRYFPTTSKFASVDENAQVGTVVALLTVSDSDS-------STANGNISVSILGGNEQRHFDVHSSPVPNLSLIKVASVLDRERISSYNLTVSV--SDNGKPLARSSFASLVIFVNDINDHPPIFQEAVYRVDISEDIPKGS--YIKGVSATDGDSGQNANLRYSL-VSGNSLGW--FAISENSGLVTSAAELNRETASEIVLNISAKDQGLQPKISYTKL-IVNITDVNDQVPTFTQNTYHVSITEHSPAGSELVVLSATDSDLGP-NGTIRFSFDSETPVSDQNKFRLDSTSGRLSTSTELDREEESSYLLYIRATDSGAPP----LHSVCKVNITLKDVNDNSPVF 667          

HSP 2 Score: 172.17 bits (435), Expect = 1.189e-42
Identity = 174/608 (28.62%), Postives = 272/608 (44.74%), Query Frame = 2
Query:  446 IKVLDENDNSP----KFLPFLNPYQTLPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDS-HFTLLDKIASGRPQLLLI---SPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEH-SKLVNVISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGL-PRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRD-------SLVTDIECSLDDYHLNFEITAINEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNS------GKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIF 2200
            +K+LD NDN P    ++ P  + + ++ EN+Q+ TV+ L +  D DS         IS   L GN+  HF   D  +S  P L LI   S LDRE IS Y   +   D      R  S   + I V DIND+PP+F +  Y  +I E   K   +     TD D GQN  +  ++ + N         +F I  +  L+T +  L  E   E        N+ A D GL P++S T K+ + + + NDQ P           +  +++ E+ PA + +  L  +D D           D E  + D +  F + + +            ++T   LDRE++ +  L I    +      PL +   ++I L D+NDN PVF   +Y   + EN P  +   +  +   D D G+N  V Y I +  +S     F I + SGK+++  ++D E+   +   + A D       + A++ V V+D  DN  +F +  YSF + ENVPV T IG +  T +D           H + T  Y +   DQ S      G++  +G IDRE+     + + AR          +  E +V IT++D+NDN P F
Sbjct:  326 VKLLDVNDNDPVVKFRYFPTTSKFASVDENAQVGTVVALLTVSDSDSST---ANGNISVSILGGNEQRHF---DVHSSPVPNLSLIKVASVLDRERISSYNLTVSVSDNGKPLARS-SFASLVIFVNDINDHPPIFQEAVYRVDISEDIPKGSYIKGVSATDGDSGQNANLRYSLVSGNSLG------WFAISENSGLVTSAAELNRETASEI-----VLNISAKDQGLQPKISYT-KLIVNITDVNDQVPTFTQ------NTYHVSITEHSPAGSELVVLSATDSDLGPNGTIRFSFDSETPVSDQN-KFRLDSTSGR----------LSTSTELDREEESSYLLYIR---ATDSGAPPLHSVCKVNITLKDVNDNSPVFYPMQYFANIKENEPSGS--SVTTVTASDPDLGRNGTVKYAITAGDSSK----FHISSTSGKVTTLVALDREEKTAYQLQVTATDGGGLRSHTPAIVTVTVVDTQDNPLVFGQKDYSFVMFENVPVGTIIGTVSATTVD----------LHTNIT--YLIASGDQRSLFGIKAGQITALGLIDREEQAFYQLRVIAR-------AGEVTGETLVNITVKDLNDNAPNF 869          

HSP 3 Score: 166.007 bits (419), Expect = 7.276e-41
Identity = 166/594 (27.95%), Postives = 266/594 (44.78%), Query Frame = 2
Query:  446 IKVLDENDNSPKFLPFLNPYQTLPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKLVNVISFYV--TDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPAR-TIVASLQVSDRD-SLVTDIECSLDDYHLNFEITAINEIHPLGHYKEFIINTLKPLDREDDKNQ----YLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIFS 2203
            I V D NDN+P F+  +     + EN      I    A D D    G+  Y + +        +   L  I      + L  PL+   ++   + L+ V  +    +  S + + I V D+NDN PVFD+  Y   I+E S+ VN   F V  TD D G N ++   I + N       +  F I        G + +  ++D E    +YS  ++A D  +  LS++  V+I+L + ND  P+          +  +  FE E  R  +V  +   D+D    +++  S +    NFE+ AI  +         + +TL+ LDRE    Q         +  SDQ    PL     + + + DINDNPP FT+  YQ  + E+  Q   +++  +   D D  KN  V Y I       + + F+ID++SG+++    +DYE    +S  IIA D     LSST ++ + V+D NDN+P FPK   S  V EN+ +   +  +  TD D+     I   +  S TNN+    +  N+G +  +  +D E      + +TA++      +    S   VII + D NDNPP+F+
Sbjct:  857 ITVKDLNDNAPNFMHSVEHVSAV-ENWATGHHIFQAKASDPDEATNGMIVYSLKQ--------NPKGLFHIHEKHGLISLTGPLE---VTTSSYQLEVVASDLGVPQRTSSLFLTISVYDVNDNAPVFDQLSYEVTILE-SEPVNSRFFRVEATDKDSGVNGEIVYDIISGN------TRDVFGI-----FPDGQLYIKADLDREVQD-RYSLLVVAKDRAVESLSASVNVSILLDDINDNRPLFNS-------TNYVFHFEEEQERGALVGRVFAEDKDFGPNSEVRYSFETPQSNFELNAITGV---------LTSTLQ-LDRESLMRQRGAAVFSFTVLSSDQGLPKPLKDQAKVQVYIQDINDNPPKFTKDIYQASIAESA-QNMTQLLR-VSASDVDENKNGLVHYDI---TEGNEEKQFSIDSNSGQVTLVGKLDYETTPSYSLKIIAEDSGSVPLSSTCVLSISVLDDNDNSPSFPKSTLSVDVLENMRIGELVASVTATDSDSGSNADIT--YSISATNNHGTFSISPNTGSIFLVKKLDYETQSLYKLNVTAKDSG----RPSRSSSIPVIIHVRDFNDNPPVFT 1397          

HSP 4 Score: 160.999 bits (406), Expect = 2.561e-39
Identity = 168/623 (26.97%), Postives = 283/623 (45.43%), Query Frame = 2
Query:  410 DSGIKISSFYILIKVLDENDNSPKFLPFLNP--YQTLPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLISPLDREV--------ISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFY----TANIVEHSKLVNVISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRD------SLVT-DIECSLDDYHLNFEITAINEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQAT--VKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKY--FHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIFS 2203
            DSG  +S+  + I V D NDN+P+F     P  Y   PE ++I +++   SA D D    G  +Y     F+     +F    +I S   ++ +   L  +         ++ + FI+ A DR       +S   V I V D NDNPP F+   Y    T ++   ++L+ V ++   D   G N ++   I   N   K      F++D      TGS+ +   +  +TN   Y   + A+D G P LS    V I +  +N   P     +    VS ++T+       T + +L   D+D       L+T +I    DD   +             H +  +++  K LD E  +   L+++   +        T+ +T++I + D+NDNPPVF   +Y   + EN+P  T  VKM       DKD G NA + Y I SS    D + F ID ++G I+++  +DYE  +++   + A +       S A + + +  AN+  P F    Y F + E  P  T +G++  +D D   E+ +V Y  F +S    +    +++ +G++   G +DREK   I++ + A+N  S +  ++   E +V IT+ D ND PP+F+
Sbjct: 2396 DSGWTVST-DVTIFVTDINDNAPRFS---KPSYYLDYPELTEIGSIVTQVSATDPDEGFNGKIFY-----FIRSQTEYF----RINSSSGEIFIKQQLRYQNSSGHNNINVNRHSFIVTASDRGIKPL--MSETTVMINVVDSNDNPPTFESPSYFTPVTKSVKVGTRLLKVTAYDKKDF--GLNSEIEYAISGGNSSNK------FRLD----KQTGSVTVASSLAADTNKV-YLLEITASDKGNPPLSDRTTVKIAVTEENHHTPEFSQNQVTVTVSEALTV------GTAIRTLSARDKDKDKQMNGLITYNISSGNDDGLFSV------------HSQTGVLSLAKTLDYETKQKHELRVS---ATDGGWIAKTSYVTVNIQVTDVNDNPPVFDPVEYFPVVQENVPSGTTVVKMN----ATDKDSGSNALMAYVIQSS----DSDLFIIDPNTGIITTQGFLDYEAKQVYHLTVKAFNVPDEERCSFAYVNIQLKGANEYVPRFVSKQYYFEISEAAPKGTVVGEVFASDRDLG-EDGVVYYLIFGRSRKRGFS---INKKTGQIYVSGSLDREKEEKISLKVLAKNAGSIRGADI--DEVLVNITVLDAND-PPVFT 2954          

HSP 5 Score: 155.606 bits (392), Expect = 1.293e-37
Identity = 169/607 (27.84%), Postives = 281/607 (46.29%), Query Frame = 2
Query:  422 KISSFYILIKVLDENDNSPKFLPFLNPYQTLPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKLVNVIS-FYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDE-IDYETNPYKYSFNLIATDNGLPR-LSSTAKVNIILINKNDQAP-VIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITAINEIHPLGHYKEFIINT-------LKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNE---ASYQNKNLMDSECMVIITIEDVNDNPPIF 2200
            + SS ++ I V D NDN+P F   L+   T+ E+  +N+      A D DS   G   Y I    + GN     +      G  QL + + LDREV   Y  ++ A DR  +     + V V I + DINDN P+F+ T Y  +  E  +   ++   +  D D G N +V  + ET         +  F+++    ++T +++L  E +  +     +SF ++++D GLP+ L   AKV + + + ND  P   K I +  I          E A+ +   L+VS  D  V + +  L    ++++IT  NE       K+F I++       +  LD E   +  LKI    ++     PL++   + I++ D NDN P F +S    +++EN+     +++  +   D D G NA +TY I ++ N      F+I  ++G I   + +DYE   L+  N+ A D  + + SS+  +I+HV D NDN P+F       ++ EN+P++T +  I   D D    N +++Y     T       +D  SG + T   IDRE      + I A ++   A ++   L +    V I + D NDN P F
Sbjct:  952 RTSSLFLTISVYDVNDNAPVF-DQLSYEVTILESEPVNSRFFRVEATDKDSGVNGEIVYDI----ISGNTRD--VFGIFPDG--QLYIKADLDREVQDRYSLLVVAKDRAVESLS--ASVNVSILLDDINDNRPLFNSTNYVFHFEEEQERGALVGRVFAEDKDFGPNSEVRYSFETP--------QSNFELNAITGVLTSTLQLDRESLMRQRGAAVFSFTVLSSDQGLPKPLKDQAKVQVYIQDINDNPPKFTKDIYQASIA---------ESAQNMTQLLRVSASD--VDENKNGL----VHYDITEGNE------EKQFSIDSNSGQVTLVGKLDYETTPSYSLKI---IAEDSGSVPLSSTCVLSISVLDDNDNSPSFPKSTLSVDVLENMRIG--ELVASVTATDSDSGSNADITYSISATNNHGT---FSISPNTGSIFLVKKLDYETQSLYKLNVTAKDSGRPSRSSSIPVIIHVRDFNDNPPVFTPGDIFKSIPENLPISTSVMSITAHDTDAD-INGLLEYSIALQTPRGGHFRIDSVSGVIYTNKDIDREFSNLFELTIKATDQAVPAEFRRFALKN----VTIWVTDQNDNIPTF 1505          

HSP 6 Score: 144.821 bits (364), Expect = 2.860e-34
Identity = 150/607 (24.71%), Postives = 271/607 (44.65%), Query Frame = 2
Query:  422 KISSFYILIKVLDENDNSPKFLPFLNPYQT-LPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPV-----FDKTFYTANIVEHSKLVNVISFY-VTDLDEG-QNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINK-NDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITAINEIHPLGHYK----EFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIFS 2203
            K     + + + D NDN P F      YQT + E++ + + +L  +A DLD  A           +L+   + F +  K  +    +++   LD E   EY   + AVD  N      +  E  +K+ D+NDN PV     F  T   A++ E++++  V++   V+D D    N  +S++I   N+      +R F +  SP      I++   +D E     Y+  +  +DNG P   S+    +I +N  ND  P+ +     E V R + + E+ P  + +  +  +D DS          + +L + + + N    LG +       ++ +   L+RE      + +NI   DQ  L P  +   + +N+ D+ND  P FT++ Y   + E+ P  +  ++  +   D D G N  + +  DS    +D   F +D+ SG++S+   +D E+   +   I A D     L S   + + + D NDN+P+F    Y   ++EN P  + +  +  +D D    N  VKY   +   +    H+   SGK+ T+  +DRE+  +  + +TA +    ++     +  +V +T+ D  DNP +F 
Sbjct:  216 KFGYLQVNVTIQDINDNPPSF--DHEQYQTSVFEDAAVGSSVLQIAASDLDEGA------NAEITYLLDEGTPFQIDPKAGT----VVIKEGLDYETKREYSLTIHAVD--NGVPSLYTRTEATVKLLDVNDNDPVVKFRYFPTTSKFASVDENAQVGTVVALLTVSDSDSSTANGNISVSILGGNE------QRHFDVHSSPVPNLSLIKVASVLDRE-RISSYNLTVSVSDNGKPLARSSFASLVIFVNDINDHPPIFQ-----EAVYR-VDISEDIPKGSYIKGVSATDGDSG--------QNANLRYSLVSGNS---LGWFAISENSGLVTSAAELNRETASE--IVLNISAKDQ-GLQPKISYTKLIVNITDVNDQVPTFTQNTYHVSITEHSPAGSELVV--LSATDSDLGPNGTIRFSFDSETPVSDQNKFRLDSTSGRLSTSTELDREEESSYLLYIRATDSGAPPLHSVCKVNITLKDVNDNSPVFYPMQYFANIKENEPSGSSVTTVTASDPDLG-RNGTVKYAITA--GDSSKFHISSTSGKVTTLVALDREEKTAYQLQVTATDGGGLRSH----TPAIVTVTVVDTQDNPLVFG 772          

HSP 7 Score: 135.961 bits (341), Expect = 1.262e-31
Identity = 164/608 (26.97%), Postives = 257/608 (42.27%), Query Frame = 2
Query:  407 VDSGIKISSFYILIKVLDENDNSPKFLPFLNPYQTLPENSQINTVILLPSAIDLD----SEAFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLI---SPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKLVN-VISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITAINEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKI-DSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIFS 2203
             D G + SS  +   +LD ND+ P F   +     L E+      +L  SA D D    S      +Y +S     G D  F++        P   LI   S LDRE  + Y+ ++ A D         S     +   DINDNPP F    Y  +I   +   + V +  VTD D G N Q+  ++   N  K       F+ID     +T S +L       T   + +F +   D G    + +  V +  +   D  P IK+  K      + T  EN+P  TIV  +  S   +       +  +    F I  ++         E  I   KPLD E+ +   L I     DQ    P +    + I + D+NDN PVF +  +  E++EN+    V ++     LD+D G N  + Y I D +K ++    F I+  +G+I + + +D EK   +S  + A D+     S+   +++ V+D NDNAP F K  +S TV EN PV   + ++ TTD D    N I +Y   S T+      +  ++G +    P++RE        ++A +     + +       V I + D+NDN P FS
Sbjct: 1880 ADGGGRSSSVRVYFNLLDVNDHPPLFNSSVYTTSIL-ESLSAGASVLTVSAADRDHGNSSTLLNSVHYSLS-----GGDGQFSI-------NPSTGLIITSSLLDRETRASYQLLVVASDGGQPTPLSSSATVSVVVA-DINDNPPRFHHHPYVTHIPASTSTGSLVFAVTVTDEDSGSNSQLHYSLTGRNSEK-------FKIDPIRGAITASEKL-------TGSSEVTFTVHVKDGGTNPKTDSTTVTVRFVTGGD-FPHIKLKDK------AFTFPENQPTNTIVTKVTGSSPRAGPLSYYIASGNLDNAFHIDQLS--------GELSIR--KPLDYENIEKYVLWIE--ARDQ-GFPPYSAYEKVEIAVLDVNDNHPVFEQEPFHAEILENLSPQRVLVVS---ALDQDSGPNGQLEYAIIDGNKENS----FNINRATGEIRTTRPLDREKVAQYSLRVKATDRGMPPKSTAVKVLISVLDVNDNAPRFSK-IFSATVPENAPVGFTVTRVTTTDEDAG-ANAISRY---SITDASLPFIIHPSTGDITISRPLNREDTDHYIAKVSAHDSGWTVSTD-------VTIFVTDINDNAPRFS 2420          

HSP 8 Score: 134.42 bits (337), Expect = 4.585e-31
Identity = 158/606 (26.07%), Postives = 253/606 (41.75%), Query Frame = 2
Query:  410 DSGI--KISSFYILIKVLDENDNSPKFLPFLNPYQ-TLPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHS-KLVNVISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFE-ITAINEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIFSLIN 2212
            D G+  KIS   +++ + D ND  P F    N Y  ++ E+S   + +++ SA D D    G   +       + + + F L     SGR  L   + LDRE  S Y   ++A D        +  V + +K  D+NDN PVF    Y ANI E+     +V +   +D D G+N  V   I T  D  K          F  S  +G +  +  +D E     Y   + ATD G  R  + A V + +++  D  P++   +       S  MFEN P  TI+ +            +  +  D H N   + A  +   L   K   I  L  +DRE+     L++     +      +T    ++I + D+NDN P F  S      +EN   AT   I      D D   N  + Y +  +        F I    G IS    ++   +  +   ++A D      +S+  + + V D NDNAP+F +  Y  T+ E+ PVN+   ++E TD D+    +IV       T +   I  D   G+L     +DRE     ++L+ A++ A       + +   V I ++D+NDN P+F+  N
Sbjct:  533 DQGLQPKISYTKLIVNITDVNDQVPTFTQ--NTYHVSITEHSPAGSELVVLSATDSDLGPNGTIRFSFDSETPVSDQNKFRL--DSTSGR--LSTSTELDREEESSYLLYIRATDSGAPPLHSVCKVNITLK--DVNDNSPVFYPMQYFANIKENEPSGSSVTTVTASDPDLGRNGTVKYAI-TAGDSSK----------FHISSTSGKVTTLVALDREEK-TAYQLQVTATDGGGLRSHTPAIVTVTVVDTQDN-PLVFGQKD-----YSFVMFENVPVGTIIGT------------VSATTVDLHTNITYLIASGDQRSLFGIKAGQITALGLIDREEQAFYQLRVIARAGE------VTGETLVNITVKDLNDNAPNFMHSVEHVSAVEN--WATGHHIFQAKASDPDEATNGMIVYSLKQNPKG----LFHIHEKHGLISLTGPLEVTTSS-YQLEVVASDLGVPQRTSSLFLTISVYDVNDNAPVFDQLSYEVTILESEPVNSRFFRVEATDKDSGVNGEIVYDIISGNTRDVFGIFPD---GQLYIKADLDREVQDRYSLLVVAKDRAVES----LSASVNVSILLDDINDNRPLFNSTN 1080          

HSP 9 Score: 126.331 bits (316), Expect = 1.116e-28
Identity = 170/616 (27.60%), Postives = 263/616 (42.69%), Query Frame = 2
Query:  410 DSG--IKISSFYILIKVLDENDNSPKFLPFLNPYQTLPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRE-NDDHRDISGVEVEIKVGDINDNPPVF---DKTFYTANIVEHSKLVNVISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYK--YSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMF-ENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITAINEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSK--YQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNS--------GKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIF 2200
            DSG   + SS  ++I V D NDN P F P  + ++++PEN  I+T ++  +A D D++  G+  Y I+     G   HF    +I S    +     +DRE  + +   +KA D+    + R  +   V I V D NDN P F   +     +NIV  S L  V++F   D DEG N +V      E +  +     F    +S     G IRL  ++     P K  YS  + ATD+G  R SS  ++ IIL  +    PV           + IT+  E +PA T V SL  S      T +E  +       +  A   +  +G +   +I T   LDRE   + YL +++Y  + D   P T +  +   LFD       F +     +G L E+I Q   +            G NA VTY I S  + +    F ID +SG++S+ + +D E+   +S  + A D  Q   SS   + + V D ND+ P F +  YSF + E++   + +  I  +D D+    +I           Y V   D++S        G       +D E      + + A +           S   V   + DVND+PP+F
Sbjct: 1370 DSGRPSRSSSIPVIIHVRDFNDNPPVFTPG-DIFKSIPENLPISTSVMSITAHDTDADINGLLEYSIALQTPRGG--HF----RIDSVSGVIYTNKDIDREFSNLFELTIKATDQAVPAEFRRFALKNVTIWVTDQNDNIPTFISQNALVAESNIVIGSILTTVLAF---DPDEGANGEV------EYELVRGDSDTFIMDRYS-----GDIRLASQLI----PSKLIYSLMVSATDHGTDRKSSRTELTIIL--QGTDGPVFS-------QPKYITILKEGQPAGTNVISLDASSPRGAGTKVEYFIVSVRSGGK--AAGRLFTIGRHSG-VIQTAAELDREQGSDLYL-LDVYAIETDAKQPRTQHAEVSF-LFDF------FFKVMLLLKGNLREHISQTCAE------------GANALVTYAIISGADDS----FRIDPESGELSATRRLDRERRSKYSLLVRADDGQQ---SSDIWVNITVSDINDHTPTFSRSVYSFDIPEDMSPGSIVAAILASDGDSGVNGEIT----------YSVEEDDEDSTFLLNPITGVFNVTRALDFETQPFFILTVRAADGGG------RSSSVRVYFNLLDVNDHPPLF 1905          

HSP 10 Score: 122.479 bits (306), Expect = 2.058e-27
Identity = 137/515 (26.60%), Postives = 231/515 (44.85%), Query Frame = 2
Query:  695 LDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKLVNVI-SFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRD-----SLVTDIECSLDDYHLNFEITAINEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATV--KMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEA-----SYQNKNLMDSECMVIITIEDVNDNPPIF 2200
            LDRE  S+Y  +++A     DD +  S + V I V DIND+ P F ++ Y+ +I E     +++ +   +D D G N +++ ++E     + D+   F     +P  +TG   +   +D+ET P+ +   + A D G    SS+ +V   L++ ND  P+        + + SI   E+  A   V ++  +DRD     +L+  +  SL      F I               +I T   LDRE   +  L   +  SD  + TPL+++ T+ + + DINDNPP F    Y    + +IP +T    ++  +   D+D G N+ + Y + + +NS   E F ID   G I++ + +       F+ ++   D   +  + +  + V  +   D  P       +FT  EN P NT    I T    + P    + Y+  S  N     H+DQ SG+L    P+D E +    + I AR++      +Y+          V I + DVNDN P+F
Sbjct: 1763 LDRERRSKYSLLVRA-----DDGQQSSDIWVNITVSDINDHTPTFSRSVYSFDIPEDMSPGSIVAAILASDGDSGVNGEITYSVE-----EDDEDSTFL---LNP--ITGVFNVTRALDFETQPF-FILTVRAADGG--GRSSSVRVYFNLLDVNDHPPLF----NSSVYTTSI--LESLSAGASVLTVSAADRDHGNSSTLLNSVHYSLSGGDGQFSINP----------STGLIITSSLLDRETRASYQLL--VVASDGGQPTPLSSSATVSVVVADINDNPPRFHHHPY----VTHIPASTSTGSLVFAVTVTDEDSGSNSQLHYSL-TGRNS---EKFKIDPIRGAITASEKLTGSSEVTFTVHV--KDGGTNPKTDSTTVTVRFVTGGD-FPHIKLKDKAFTFPENQPTNT----IVTKVTGSSPRAGPLSYYIAS-GNLDNAFHIDQLSGELSIRKPLDYENIEKYVLWIEARDQGFPPYSAYEK---------VEIAVLDVNDNHPVF 2216          

HSP 11 Score: 118.242 bits (295), Expect = 3.453e-26
Identity = 133/503 (26.44%), Postives = 216/503 (42.94%), Query Frame = 2
Query:  695 LDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKLVN-VISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITAINEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIF 2200
            L+RE  SE   +L    ++      IS  ++ + + D+ND  P F +  Y  +I EHS   + ++    TD D G N  +  + ++E     DQ K  F++D +    +G +    E+D E     Y   + ATD+G P L S  KVNI L + ND +PV   ++          + ENEP+ + V ++  SD D              + + ITA +            + TL  LDRE+ K  Y ++ +  +D   L   T  + + + + D  DNP VF +  Y   + EN+P  T+       T+D     +  +TY I S    +    F I A  G+I++   ID E+   +   +IA       ++   L+ + V D NDNAP F       +  EN      I Q + +D D      IV    +   N   + H+ +  G +   GP++     S  + + A +    Q      S   + I++ DVNDN P+F
Sbjct:  517 LNRETASE--IVLNISAKDQGLQPKISYTKLIVNITDVNDQVPTFTQNTYHVSITEHSPAGSELVVLSATDSDLGPNGTIRFSFDSETPVS-DQNK--FRLDST----SGRLSTSTELDREEES-SYLLYIRATDSGAPPLHSVCKVNITLKDVNDNSPVFYPMQ------YFANIKENEPSGSSVTTVTASDPDLGRNGT--------VKYAITAGDSSKFHISSTSGKVTTLVALDREE-KTAY-QLQVTATDGGGLRSHTPAI-VTVTVVDTQDNPLVFGQKDYSFVMFENVPVGTIIGTVSATTVDL----HTNITYLIASGDQRS---LFGIKA--GQITALGLIDREEQAFYQLRVIA---RAGEVTGETLVNITVKDLNDNAPNFMHSVEHVSAVENWATGHHIFQAKASDPDEATNGMIVYSLKQ---NPKGLFHIHEKHGLISLTGPLEV-TTSSYQLEVVASDLGVPQRT----SSLFLTISVYDVNDNAPVF 972          

HSP 12 Score: 113.62 bits (283), Expect = 1.020e-24
Identity = 155/612 (25.33%), Postives = 252/612 (41.18%), Query Frame = 2
Query:  410 DSGIK--ISSFYILIKVLDENDNSPKFLPFLNPYQTLPENSQINTVILLPSAIDLDSEAFGIKY---YKISKPFLIGNDSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEH---SKLVNVISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITAINEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIY-CSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSST----ALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQ--VIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIF 2200
            D GIK  +S   ++I V+D NDN P F    +P    P    +     L      D + FG+     Y IS     GN S+   LDK       + + S L  +    Y   + A D+ N    D +   V+I V + N + P F +   T  + E       +  +S    D D+  N  ++  I + ND   D +       FS    TG + L   +DYET   K+   + ATD G    +S   VNI + + ND  PV   +    +V       EN P+ T V  +  +D+DS       +L  Y +    + +  I P       II T   LD E  +  +L +  +   D+++ +    N    I L   N+  P F   +Y  E+ E  P+ TV  +  +   D+D G++  V Y I           F+I+  +G+I    S+D EK +  S  ++A  K+  ++        L+ + V+DAND  P+F +  Y   V E +     +  +   D D+ P      Y   +   N++     ++  +G++     +DRE V    + I A +  S           ++I+T+ED+NDN P  
Sbjct: 2504 DRGIKPLMSETTVMINVVDSNDNPPTFE---SPSYFTPVTKSVKVGTRLLKVTAYDKKDFGLNSEIEYAISG----GNSSNKFRLDKQTG---SVTVASSLAADTNKVYLLEITASDKGNPPLSDRT--TVKIAVTEENHHTPEFSQNQVTVTVSEALTVGTAIRTLSARDKDKDKQMNGLITYNISSGND---DGL-------FSVHSQTGVLSLAKTLDYETK-QKHELRVSATDGGWIAKTSYVTVNIQVTDVNDNPPVFDPVEYFPVVQ------ENVPSGTTVVKMNATDKDSGSN----ALMAYVIQSSDSDLFIIDP----NTGIITTQGFLDYEAKQVYHLTVKAFNVPDEERCSFAYVN----IQLKGANEYVPRFVSKQYYFEISEAAPKGTV--VGEVFASDRDLGEDGVVYYLIFGRSRKRG---FSINKKTGQIYVSGSLDREKEEKISLKVLA--KNAGSIRGADIDEVLVNITVLDAND-PPVFTQELYDVQVNEGLSPGGLVTFVSAEDSDSVPSWSRFTY---AIAANHERNTFTINPQTGQVSVASELDRETVPVYNLTILAVDSGS----PAATGSAILIVTLEDINDNGPTL 3059          

HSP 13 Score: 102.064 bits (253), Expect = 3.541e-21
Identity = 164/606 (27.06%), Postives = 252/606 (41.58%), Query Frame = 2
Query:  440 ILIKVLDENDNSPKFLPFLNPYQTLPENSQINTVILLPSAIDLDS--EAFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEH-SKLVNVISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLP--RLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRS--ITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEIT-----AINEIHPLGHYKEFIINTLKPLDREDDKNQYLKI------NIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENI-PQATVKMIEPILTLDKDHGKN-AYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKY--FHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNP 2191
            + I V +EN ++P+F        T+ E   + T I   SA D D   +  G+  Y IS     GND     L  + S    L L   LD E   ++   + A D         S V V I+V D+NDNPPVFD   Y   + E+      V+    TD D G N  ++  I++ +          F ID  P+  TG I     +DYE    K  ++L      +P     S A VNI L   N+  P          VS+     + E  P  T+V  +  SDRD L  D       Y+L F  +     +IN+       K   I     LDRE ++   LK+      +I  +D D++        ++I + D ND PPVFT+  Y  ++ E + P   V  +      D D   + +  TY I ++    +   FTI+  +G++S    +D E   +++  I+A+D      + +A++IV + D NDN P     +    V EN    T +  + + D D  P      Y        ++Y  I     +G+L T   +DRE++    + +  ++    Q    M S   V I + D NDNP
Sbjct: 2622 VKIAVTEENHHTPEFSQN-QVTVTVSEALTVGTAIRTLSARDKDKDKQMNGLITYNISS----GNDDG---LFSVHSQTGVLSLAKTLDYETKQKHELRVSATD--GGWIAKTSYVTVNIQVTDVNDNPPVFDPVEYFPVVQENVPSGTTVVKMNATDKDSGSNALMAYVIQSSD-------SDLFIID--PN--TGIITTQGFLDYEA---KQVYHLTVKAFNVPDEERCSFAYVNIQLKGANEYVP--------RFVSKQYYFEISEAAPKGTVVGEVFASDRD-LGEDGVV----YYLIFGRSRKRGFSINK-------KTGQIYVSGSLDREKEEKISLKVLAKNAGSIRGADIDEVL-------VNITVLDAND-PPVFTQELYDVQVNEGLSPGGLVTFVS---AEDSDSVPSWSRFTYAIAANH---ERNTFTINPQTGQVSVASELDRETVPVYNLTILAVDSGSPAATGSAILIVTLEDINDNGPTLVTTYGE--VMENQRAGTPVMTLSSRDPDLAPNQGPFTYSLVSTGAASSYFTI---SPTGELTTSREVDREQISDFYLSVLIKDSGIPQ----MSSTGTVHIKVNDQNDNP 3160          

HSP 14 Score: 95.9005 bits (237), Expect = 2.441e-19
Identity = 185/735 (25.17%), Postives = 296/735 (40.27%), Query Frame = 2
Query:  458 DENDNSPKFLPFLNPYQT-LPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKLVNVISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFEN-EPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITAINEIHPLG-HYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEY-FTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDRE--------KVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIF---SLINPAKSSL--------IFTINK---GFRHENCQMIPYAVSDADHDEPNSDSCCILQLDNDQNGMLYLLSNTPNFLCLQNTMNTPGIYRVSLTATDNKNNPNKSLKAKVSFNIDVRHEVSDNPFSEKSDNKVHTTKNQ 2584
            D NDN P+F    +PY T +P ++   +++   +  D DS +    +Y      L G +S    +D I   R  +     L     SE  F +   D   +   D + V V    G    +  + DK F        ++  N I   VT     +   +S  I + N      +   F ID     ++G + +   +DYE N  KY   + A D G P  S+  KV I +++ ND  PV       E       + EN  P R +V S    D+DS          +  L + I   N+ +    +     I T +PLDRE      L++    +    + P +T + + I++ D+NDN P F++  +   + EN P      +  + T D+D G NA   Y I      TD    F I   +G I+  + ++ E    +   I  +    S  + +  + + V D NDNAP F KP Y     E   + + + Q+  TD D     KI  YF +S T  ++   ++ +SG++     +  +         V   + ++TA +      K LM SE  V+I + D NDNPP F   S   P   S+        +   +K   G   E    I YA+S         +S    +LD  Q G + + S+           +T  +Y + +TA+D  N P   L  + +  I V  E    P  E S N+V  T ++
Sbjct: 2005 DINDNPPRF--HHHPYVTHIPASTSTGSLVFAVTVTDEDSGSNSQLHYS-----LTGRNSEKFKIDPI---RGAITASEKLTGS--SEVTFTVHVKDGGTNPKTDSTTVTVRFVTGGDFPHIKLKDKAF----TFPENQPTNTIVTKVTG-SSPRAGPLSYYIASGN------LDNAFHID----QLSGELSIRKPLDYE-NIEKYVLWIEARDQGFPPYSAYEKVEIAVLDVNDNHPVF------EQEPFHAEILENLSPQRVLVVS--ALDQDSG--------PNGQLEYAIIDGNKENSFNINRATGEIRTTRPLDREKVAQYSLRVK---ATDRGMPPKSTAVKVLISVLDVNDNAPRFSK-IFSATVPENAPVGFT--VTRVTTTDEDAGANAISRYSI------TDASLPFIIHPSTGDITISRPLNREDTDHY---IAKVSAHDSGWTVSTDVTIFVTDINDNAPRFSKPSYYLDYPELTEIGSIVTQVSATDPDEGFNGKIF-YFIRSQTEYFR---INSSSGEIFIKQQLRYQNSSGHNNINVNRHSFIVTASDRGI---KPLM-SETTVMINVVDSNDNPPTFESPSYFTPVTKSVKVGTRLLKVTAYDKKDFGLNSE----IEYAIS-------GGNSSNKFRLDK-QTGSVTVASSL--------AADTNKVYLLEITASDKGNPP---LSDRTTVKIAVTEENHHTP--EFSQNQVTVTVSE 2647          

HSP 15 Score: 94.7449 bits (234), Expect = 5.447e-19
Identity = 157/636 (24.69%), Postives = 264/636 (41.51%), Query Frame = 2
Query:  404 QVDSGIKISSFYILIKVLDENDNSPKFLPFLNPYQTLPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEH-SKLVNVISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPR-LSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITAINEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNP-----PVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEY----------FTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPP----IFSLINPAKSSLIFTINK 2248
            + D G + S  ++ I V D ND++P F   +  +  +PE+    +++    A D DS   G   Y + +      DS F LL+ I        +   LD E  ++  FIL    R  D     S V V   + D+ND+PP+F+ + YT +I+E  S   +V++    D D G     S T+     Y        F I+ S  L+  S  L    D ET    Y   ++A+D G P  LSS+A V++++ + ND  P                 F + P                VT I  S     L F +T  +E         + +       R  +K +   I    +  +KLT  ++ +T  +++ D   NP      V  R    G+         +K+ +   T  ++   N  VT    SS  +    Y          F ID  SG++S R+ +DYE  + +   I A D+     S+   + + V+D NDN P+F +  +   + EN+     +  +   D D+ P  ++         N     ++++ +G+++T  P+DREKV   ++    R +A+ +      +   V+I++ DVNDN P    IFS   P  + + FT+ +
Sbjct: 1776 RADDGQQSSDIWVNITVSDINDHTPTFSRSVYSFD-IPEDMSPGSIVAAILASDGDSGVNGEITYSVEED---DEDSTF-LLNPITG---VFNVTRALDFE--TQPFFILTV--RAADGGGRSSSVRVYFNLLDVNDHPPLFNSSVYTTSILESLSAGASVLTVSAADRDHGN----SSTLLNSVHYSLSGGDGQFSINPSTGLIITSSLL----DRETRA-SYQLLVVASDGGQPTPLSSSATVSVVVADINDNPP----------------RFHHHP---------------YVTHIPASTSTGSLVFAVTVTDEDSGSNSQLHYSLT-----GRNSEKFKIDPIRGAITASEKLTG-SSEVTFTVHVKDGGTNPKTDSTTVTVRFVTGGDFPH------IKLKDKAFTFPENQPTNTIVTKVTGSSPRAGPLSYYIASGNLDNAFHIDQLSGELSIRKPLDYENIEKYVLWIEARDQGFPPYSAYEKVEIAVLDVNDNHPVFEQEPFHAEILENLSPQ-RVLVVSALDQDSGPNGQLEYAIIDG--NKENSFNINRATGEIRTTRPLDREKVAQYSL----RVKATDRGMPPKSTAVKVLISVLDVNDNAPRFSKIFSATVPENAPVGFTVTR 2340          

HSP 16 Score: 81.6481 bits (200), Expect = 5.784e-15
Identity = 129/494 (26.11%), Postives = 210/494 (42.51%), Query Frame = 2
Query:  782 EVEIKVGDINDNPPVF-DKTFYTANIVEHSKLVNVISFYVTDLDEGQNK--QVSITIETENDYKKDQIKRFFQIDFS--PSLMTGSIRLI--DEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEIT-AINEIHPLG-HYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVF------TRSKYQGELIENIPQATVKMIEPILTL-DKDHG-KNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSN---LSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIFS 2203
            EV I V DINDN PVF D +   +   + S    VI    TD D G N     +  I + ND +K      F++D +  PS     + L+    +D ET P+ Y   +   D G P+     +VN+ + + ND  P                 F++E  +T V   + +   S V  I  S  D   N EIT  ++E  P     K   +   + LD E  +   L I+      + +  L T     + L D+NDN PV       T SK+   + EN   A V  +  +LT+ D D    N  ++  I        ++  +    +  +    S+  ++ ++ S+N+     D       SS A +++ V D ND+ PIF +  Y   + E++P  + I  +  TD D+  +N  ++Y   S  N+     + +NSG + +   ++RE    I + I+A++    Q      S   +I+ I DVND  P F+
Sbjct:  106 EVRIVVLDINDNAPVFPDASIVVSFKEDASSGRQVILDTATDADIGSNGVDHTTYRIISGNDQRK------FRLDITVNPSGEGAFLHLVSTGGLDRETTPF-YQLLIQVEDKGEPKKFGYLQVNVTIQDINDNPP----------------SFDHEQYQTSV--FEDAAVGSSVLQIAASDLDEGANAEITYLLDEGTPFQIDPKAGTVVIKEGLDYETKREYSLTIHAV---DNGVPSLYTRTEATVKLLDVNDNDPVVKFRYFPTTSKF-ASVDEN---AQVGTVVALLTVSDSDSSTANGNISVSILGGNEQRHFDVHSSPVPNLSLIKVASV-LDRERISSYNLTVSVSDNGKPLARSSFASLVIFVNDINDHPPIFQEAVYRVDISEDIPKGSYIKGVSATDGDSG-QNANLRYSLVS-GNSLGWFAISENSGLVTSAAELNRETASEIVLNISAKD----QGLQPKISYTKLIVNITDVNDQVPTFT 560          

HSP 17 Score: 73.559 bits (179), Expect = 1.393e-12
Identity = 102/387 (26.36%), Postives = 167/387 (43.15%), Query Frame = 2
Query:  389 TVFSFQVDSGIKISSFYILIKVLDENDNSPKFLPFLNPYQTLPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHR--DISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKLVNVISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITAINE----IHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTP-LTTNLTIHINLFDINDNP 1528
            TV +F V    + S  Y+ I++   N+  P+F+     Y  + E +   TV+    A D D    G+ YY I   F       F++  K      Q+ +   LDRE   E +  LK + +     R  DI  V V I V D ND PPVF +  Y   + E      +++F   +  +        T     +++++         F+ +  TG + +  E+D ET P  Y+  ++A D+G P  + +A + + L + ND  P + V   GE++       EN+ A T V +L  S RD    D+  +   +  +   T        I P G      + T + +DRE   + YL + I    +D   P +++  T+HI + D NDNP
Sbjct: 2816 TVKAFNVPDEERCSFAYVNIQLKGANEYVPRFVS-KQYYFEISEAAPKGTVVGEVFASDRDLGEDGVVYYLI---FGRSRKRGFSINKKTG----QIYVSGSLDRE--KEEKISLKVLAKNAGSIRGADIDEVLVNITVLDAND-PPVFTQELYDVQVNEGLSPGGLVTFVSAEDSDSVPSWSRFTYAIAANHERNT--------FTINPQTGQVSVASELDRETVPV-YNLTILAVDSGSPAATGSAILIVTLEDINDNGPTL-VTTYGEVM-------ENQRAGTPVMTL--SSRDP---DLAPNQGPFTYSLVSTGAASSYFTISPTGE-----LTTSREVDREQISDFYLSVLI----KDSGIPQMSSTGTVHIKVNDQNDNP 3160          

HSP 18 Score: 51.9878 bits (123), Expect = 5.064e-6
Identity = 75/347 (21.61%), Postives = 127/347 (36.60%), Query Frame = 2
Query: 1178 VIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITAINEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNA--YVTYKIDSSKNSTDWEYFTIDADSGK-----ISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPI 2197
            V++ G+ + +   + E +P  T V +++                + H  F I A   +          I T   +DRE      + + +  S        T    + I + DINDN PVF  +       E+       +++     D D G N   + TY+I S  +   +        SG+     + S   +D E    +   I   DK +        + V + D NDN P F    Y  +V E+  V + + QI  +DLD    N  + Y     T       +D  +G +     +D E  R  ++ I A +         + +     + + DVNDN P+
Sbjct:   24 VLQVGQWIRQEFEVLEEQPVGTYVGTIETKPA------FTYRFSEQHKLFSINATTGV----------IYTSSVIDREVLPGNIINVVVLSSQP------TYPTEVRIVVLDINDNAPVFPDASIVVSFKEDASSGRQVILD--TATDADIGSNGVDHTTYRIISGNDQRKFRLDITVNPSGEGAFLHLVSTGGLDRETTPFYQLLIQVEDKGEPKKFGYLQVNVTIQDINDNPPSFDHEQYQTSVFEDAAVGSSVLQIAASDLD-EGANAEITYLLDEGTP----FQIDPKAGTVVIKEGLDYETKREYSLTIHAVDNGVPS----LYTRTEATVKLLDVNDNDPV 337          
BLAST of Protocadherin Fat 1 vs. Ensembl Zebrafish
Match: LO018022.1 (FAT atypical cadherin 4 [Source:NCBI gene;Acc:101882648])

HSP 1 Score: 200.29 bits (508), Expect = 1.818e-51
Identity = 181/603 (30.02%), Postives = 298/603 (49.42%), Query Frame = 2
Query:  440 ILIKVLDENDNSPKFLPFLNPYQTLPENSQINTVILLPSAIDLDSEAFGIKY--YKISKPFLIGNDSHFTLLDKIA--SGRPQLL-LIS--PLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKL-VNVISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITAINE-----IHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKD-QSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYT--NNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIF 2200
            + I VLD NDN+P F P  +   +  E++     ++L +A D D  + G+ +  Y+I    + GND     LD     SG    L L+S   LDRE    Y+ +++  D+   + +    ++V + + DINDNPP FD   Y  ++ E + +  +V+    +DLDEG N +++  ++             FQID       G++ + + +DYET   +YS  + A DNG+P L +  +  + L++ ND  PV+K  R     S+  ++ EN    T+VA L VSD DS       S  + +++  I   NE     +H        +I     LDRE   +  L +++  SD  K    ++  ++ I + DIND+PP+F  + Y+ ++ E+IP+ +   I+ +   D D G+NA + Y +  S NS  W  F I  +SG ++S   ++ E       NI A D+  Q  +S T L IV++ D ND  P F +  Y  ++ E+ P  +E+  +  TD D  P N  +++   S T  ++     +D  SG+L T   +DRE+  S  + I A +  +      + S C V IT++DVNDN P+F
Sbjct:  115 VRIVVLDINDNAPVF-PDASIVVSFKEDASSGRQVILDTATDADIGSNGVDHTTYRI----ISGNDQRKFRLDITVNPSGEGAFLHLVSTGGLDRETTPFYQLLIQVEDK--GEPKKFGYLQVNVTIQDINDNPPSFDHEQYQTSVFEDAAVGSSVLQIAASDLDEGANAEITYLLDEGTP---------FQID----PKAGTVVIKEGLDYETK-REYSLTIHAVDNGVPSLYTRTEATVKLLDVNDNDPVVK-FRYFPTTSKFASVDENAQVGTVVALLTVSDSDS-------STANGNISVSILGGNEQRHFDVHSSPVPNLSLIKVASVLDRERISSYNLTVSV--SDNGKPLARSSFASLVIFVNDINDHPPIFQEAVYRVDISEDIPKGS--YIKGVSATDGDSGQNANLRYSL-VSGNSLGW--FAISENSGLVTSAAELNRETASEIVLNISAKDQGLQPKISYTKL-IVNITDVNDQVPTFTQNTYHVSITEHSPAGSELVVLSATDSDLGP-NGTIRFSFDSETPVSDQNKFRLDSTSGRLSTSTELDREEESSYLLYIRATDSGAPP----LHSVCKVNITLKDVNDNSPVF 675          

HSP 2 Score: 171.4 bits (433), Expect = 1.632e-42
Identity = 174/608 (28.62%), Postives = 272/608 (44.74%), Query Frame = 2
Query:  446 IKVLDENDNSP----KFLPFLNPYQTLPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDS-HFTLLDKIASGRPQLLLI---SPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEH-SKLVNVISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGL-PRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRD-------SLVTDIECSLDDYHLNFEITAINEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNS------GKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIF 2200
            +K+LD NDN P    ++ P  + + ++ EN+Q+ TV+ L +  D DS         IS   L GN+  HF   D  +S  P L LI   S LDRE IS Y   +   D      R  S   + I V DIND+PP+F +  Y  +I E   K   +     TD D GQN  +  ++ + N         +F I  +  L+T +  L  E   E        N+ A D GL P++S T K+ + + + NDQ P           +  +++ E+ PA + +  L  +D D           D E  + D +  F + + +            ++T   LDRE++ +  L I    +      PL +   ++I L D+NDN PVF   +Y   + EN P  +   +  +   D D G+N  V Y I +  +S     F I + SGK+++  ++D E+   +   + A D       + A++ V V+D  DN  +F +  YSF + ENVPV T IG +  T +D           H + T  Y +   DQ S      G++  +G IDRE+     + + AR          +  E +V IT++D+NDN P F
Sbjct:  334 VKLLDVNDNDPVVKFRYFPTTSKFASVDENAQVGTVVALLTVSDSDSST---ANGNISVSILGGNEQRHF---DVHSSPVPNLSLIKVASVLDRERISSYNLTVSVSDNGKPLARS-SFASLVIFVNDINDHPPIFQEAVYRVDISEDIPKGSYIKGVSATDGDSGQNANLRYSLVSGNSLG------WFAISENSGLVTSAAELNRETASEI-----VLNISAKDQGLQPKISYT-KLIVNITDVNDQVPTFTQ------NTYHVSITEHSPAGSELVVLSATDSDLGPNGTIRFSFDSETPVSDQN-KFRLDSTSGR----------LSTSTELDREEESSYLLYIR---ATDSGAPPLHSVCKVNITLKDVNDNSPVFYPMQYFANIKENEPSGS--SVTTVTASDPDLGRNGTVKYAITAGDSSK----FHISSTSGKVTTLVALDREEKTAYQLQVTATDGGGLRSHTPAIVTVTVVDTQDNPLVFGQKDYSFVMFENVPVGTIIGTVSATTVD----------LHTNIT--YLIASGDQRSLFGIKAGQITALGLIDREEQAFYQLRVIAR-------AGEVTGETLVNITVKDLNDNAPNF 877          

HSP 3 Score: 165.622 bits (418), Expect = 1.007e-40
Identity = 166/594 (27.95%), Postives = 266/594 (44.78%), Query Frame = 2
Query:  446 IKVLDENDNSPKFLPFLNPYQTLPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKLVNVISFYV--TDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPAR-TIVASLQVSDRD-SLVTDIECSLDDYHLNFEITAINEIHPLGHYKEFIINTLKPLDREDDKNQ----YLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIFS 2203
            I V D NDN+P F+  +     + EN      I    A D D    G+  Y + +        +   L  I      + L  PL+   ++   + L+ V  +    +  S + + I V D+NDN PVFD+  Y   I+E S+ VN   F V  TD D G N ++   I + N       +  F I        G + +  ++D E    +YS  ++A D  +  LS++  V+I+L + ND  P+          +  +  FE E  R  +V  +   D+D    +++  S +    NFE+ AI  +         + +TL+ LDRE    Q         +  SDQ    PL     + + + DINDNPP FT+  YQ  + E+  Q   +++  +   D D  KN  V Y I       + + F+ID++SG+++    +DYE    +S  IIA D     LSST ++ + V+D NDN+P FPK   S  V EN+ +   +  +  TD D+     I   +  S TNN+    +  N+G +  +  +D E      + +TA++      +    S   VII + D NDNPP+F+
Sbjct:  865 ITVKDLNDNAPNFMHSVEHVSAV-ENWATGHHIFQAKASDPDEATNGMIVYSLKQ--------NPKGLFHIHEKHGLISLTGPLE---VTTSSYQLEVVASDLGVPQRTSSLFLTISVYDVNDNAPVFDQLSYEVTILE-SEPVNSRFFRVEATDKDSGVNGEIVYDIISGN------TRDVFGI-----FPDGQLYIKADLDREVQD-RYSLLVVAKDRAVESLSASVNVSILLDDINDNRPLFNS-------TNYVFHFEEEQERGALVGRVFAEDKDFGPNSEVRYSFETPQSNFELNAITGV---------LTSTLQ-LDRESLMRQRGAAVFSFTVLSSDQGLPKPLKDQAKVQVYIQDINDNPPKFTKDIYQASIAESA-QNMTQLLR-VSASDVDENKNGLVHYDI---TEGNEEKQFSIDSNSGQVTLVGKLDYETTPSYSLKIIAEDSGSVPLSSTCVLSISVLDDNDNSPSFPKSTLSVDVLENMRIGELVASVTATDSDSGSNADIT--YSISATNNHGTFSISPNTGSIFLVKKLDYETQSLYKLNVTAKDSG----RPSRSSSIPVIIHVRDFNDNPPVFT 1405          

HSP 4 Score: 160.614 bits (405), Expect = 3.572e-39
Identity = 168/623 (26.97%), Postives = 283/623 (45.43%), Query Frame = 2
Query:  410 DSGIKISSFYILIKVLDENDNSPKFLPFLNP--YQTLPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLISPLDREV--------ISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFY----TANIVEHSKLVNVISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRD------SLVT-DIECSLDDYHLNFEITAINEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQAT--VKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKY--FHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIFS 2203
            DSG  +S+  + I V D NDN+P+F     P  Y   PE ++I +++   SA D D    G  +Y     F+     +F    +I S   ++ +   L  +         ++ + FI+ A DR       +S   V I V D NDNPP F+   Y    T ++   ++L+ V ++   D   G N ++   I   N   K      F++D      TGS+ +   +  +TN   Y   + A+D G P LS    V I +  +N   P     +    VS ++T+       T + +L   D+D       L+T +I    DD   +             H +  +++  K LD E  +   L+++   +        T+ +T++I + D+NDNPPVF   +Y   + EN+P  T  VKM       DKD G NA + Y I SS    D + F ID ++G I+++  +DYE  +++   + A +       S A + + +  AN+  P F    Y F + E  P  T +G++  +D D   E+ +V Y  F +S    +    +++ +G++   G +DREK   I++ + A+N  S +  ++   E +V IT+ D ND PP+F+
Sbjct: 2402 DSGWTVST-DVTIFVTDINDNAPRFS---KPSYYLDYPELTEIGSIVTQVSATDPDEGFNGKIFY-----FIRSQTEYF----RINSSSGEIFIKQQLRYQNSSGHNNINVNRHSFIVTASDRGIKPL--MSETTVMINVVDSNDNPPTFESPSYFTPVTKSVKVGTRLLKVTAYDKKDF--GLNSEIEYAISGGNSSNK------FRLD----KQTGSVTVASSLAADTNKV-YLLEITASDKGNPPLSDRTTVKIAVTEENHHTPEFSQNQVTVTVSEALTV------GTAIRTLSARDKDKDKQMNGLITYNISSGNDDGLFSV------------HSQTGVLSLAKTLDYETKQKHELRVS---ATDGGWIAKTSYVTVNIQVTDVNDNPPVFDPVEYFPVVQENVPSGTTVVKMN----ATDKDSGSNALMAYVIQSS----DSDLFIIDPNTGIITTQGFLDYEAKQVYHLTVKAFNVPDEERCSFAYVNIQLKGANEYVPRFVSKQYYFEISEAAPKGTVVGEVFASDRDLG-EDGVVYYLIFGRSRKRGFS---INKKTGQIYVSGSLDREKEEKISLKVLAKNAGSIRGADI--DEVLVNITVLDAND-PPVFT 2960          

HSP 5 Score: 154.836 bits (390), Expect = 2.015e-37
Identity = 169/607 (27.84%), Postives = 281/607 (46.29%), Query Frame = 2
Query:  422 KISSFYILIKVLDENDNSPKFLPFLNPYQTLPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKLVNVIS-FYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDE-IDYETNPYKYSFNLIATDNGLPR-LSSTAKVNIILINKNDQAP-VIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITAINEIHPLGHYKEFIINT-------LKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNE---ASYQNKNLMDSECMVIITIEDVNDNPPIF 2200
            + SS ++ I V D NDN+P F   L+   T+ E+  +N+      A D DS   G   Y I    + GN     +      G  QL + + LDREV   Y  ++ A DR  +     + V V I + DINDN P+F+ T Y  +  E  +   ++   +  D D G N +V  + ET         +  F+++    ++T +++L  E +  +     +SF ++++D GLP+ L   AKV + + + ND  P   K I +  I          E A+ +   L+VS  D  V + +  L    ++++IT  NE       K+F I++       +  LD E   +  LKI    ++     PL++   + I++ D NDN P F +S    +++EN+     +++  +   D D G NA +TY I ++ N      F+I  ++G I   + +DYE   L+  N+ A D  + + SS+  +I+HV D NDN P+F       ++ EN+P++T +  I   D D    N +++Y     T       +D  SG + T   IDRE      + I A ++   A ++   L +    V I + D NDN P F
Sbjct:  960 RTSSLFLTISVYDVNDNAPVF-DQLSYEVTILESEPVNSRFFRVEATDKDSGVNGEIVYDI----ISGNTRD--VFGIFPDG--QLYIKADLDREVQDRYSLLVVAKDRAVESLS--ASVNVSILLDDINDNRPLFNSTNYVFHFEEEQERGALVGRVFAEDKDFGPNSEVRYSFETP--------QSNFELNAITGVLTSTLQLDRESLMRQRGAAVFSFTVLSSDQGLPKPLKDQAKVQVYIQDINDNPPKFTKDIYQASIA---------ESAQNMTQLLRVSASD--VDENKNGL----VHYDITEGNE------EKQFSIDSNSGQVTLVGKLDYETTPSYSLKI---IAEDSGSVPLSSTCVLSISVLDDNDNSPSFPKSTLSVDVLENMRIG--ELVASVTATDSDSGSNADITYSISATNNHGT---FSISPNTGSIFLVKKLDYETQSLYKLNVTAKDSGRPSRSSSIPVIIHVRDFNDNPPVFTPGDIFKSIPENLPISTSVMSITAHDTDAD-INGLLEYSIALQTPRGGHFRIDSVSGVIYTNKDIDREFSNLFELTIKATDQAVPAEFRRFALKN----VTIWVTDQNDNIPTF 1513          

HSP 6 Score: 144.436 bits (363), Expect = 3.820e-34
Identity = 150/607 (24.71%), Postives = 271/607 (44.65%), Query Frame = 2
Query:  422 KISSFYILIKVLDENDNSPKFLPFLNPYQT-LPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPV-----FDKTFYTANIVEHSKLVNVISFY-VTDLDEG-QNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINK-NDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITAINEIHPLGHYK----EFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIFS 2203
            K     + + + D NDN P F      YQT + E++ + + +L  +A DLD  A           +L+   + F +  K  +    +++   LD E   EY   + AVD  N      +  E  +K+ D+NDN PV     F  T   A++ E++++  V++   V+D D    N  +S++I   N+      +R F +  SP      I++   +D E     Y+  +  +DNG P   S+    +I +N  ND  P+ +     E V R + + E+ P  + +  +  +D DS          + +L + + + N    LG +       ++ +   L+RE      + +NI   DQ  L P  +   + +N+ D+ND  P FT++ Y   + E+ P  +  ++  +   D D G N  + +  DS    +D   F +D+ SG++S+   +D E+   +   I A D     L S   + + + D NDN+P+F    Y   ++EN P  + +  +  +D D    N  VKY   +   +    H+   SGK+ T+  +DRE+  +  + +TA +    ++     +  +V +T+ D  DNP +F 
Sbjct:  224 KFGYLQVNVTIQDINDNPPSF--DHEQYQTSVFEDAAVGSSVLQIAASDLDEGA------NAEITYLLDEGTPFQIDPKAGT----VVIKEGLDYETKREYSLTIHAVD--NGVPSLYTRTEATVKLLDVNDNDPVVKFRYFPTTSKFASVDENAQVGTVVALLTVSDSDSSTANGNISVSILGGNE------QRHFDVHSSPVPNLSLIKVASVLDRE-RISSYNLTVSVSDNGKPLARSSFASLVIFVNDINDHPPIFQ-----EAVYR-VDISEDIPKGSYIKGVSATDGDSG--------QNANLRYSLVSGNS---LGWFAISENSGLVTSAAELNRETASE--IVLNISAKDQ-GLQPKISYTKLIVNITDVNDQVPTFTQNTYHVSITEHSPAGSELVV--LSATDSDLGPNGTIRFSFDSETPVSDQNKFRLDSTSGRLSTSTELDREEESSYLLYIRATDSGAPPLHSVCKVNITLKDVNDNSPVFYPMQYFANIKENEPSGSSVTTVTASDPDLG-RNGTVKYAITA--GDSSKFHISSTSGKVTTLVALDREEKTAYQLQVTATDGGGLRSH----TPAIVTVTVVDTQDNPLVFG 780          

HSP 7 Score: 136.732 bits (343), Expect = 8.839e-32
Identity = 163/604 (26.99%), Postives = 256/604 (42.38%), Query Frame = 2
Query:  407 VDSGIKISSFYILIKVLDENDNSPKFLPFLNPYQTLPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLI---SPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKLVN-VISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITAINEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKI-DSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIFS 2203
             D G + SS  +   +LD ND+ P F   +     L E+      +L  SA D D    G     ++   L G D  F++        P   LI   S LDRE  + Y+ ++ A D         S     +   DINDNPP F    Y  +I   +   + V +  VTD D G N Q+  ++   N  K       F+ID     +T S +L       T   + +F +   D G    + +  V +  +   D  P IK+  K      + T  EN+P  TIV  +  S   +       +  +    F I  ++         E  I   KPLD E+ +   L I     DQ    P +    + I + D+NDN PVF +  +  E++EN+    V ++     LD+D G N  + Y I D +K ++    F I+  +G+I + + +D EK   +S  + A D+     S+   +++ V+D NDNAP F K  +S TV EN PV   + ++ TTD D    N I +Y   S T+      +  ++G +    P++RE        ++A +     + +       V I + D+NDN P FS
Sbjct: 1888 ADGGGRSSSVRVYFNLLDVNDHPPLFNSSVYTTSIL-ESLSAGASVLTVSAADRD---HGNSSTLLNSVHLSGGDGQFSI-------NPSTGLIITSSLLDRETRASYQLLVVASDGGQPTPLSSSATVSVVVA-DINDNPPRFHHHPYVTHIPASTSTGSLVFAVTVTDEDSGSNSQLHYSLTGRNSEK-------FKIDPIRGAITASEKL-------TGSSEVTFTVHVKDGGTNPKTDSTTVTVRFVTGGD-FPHIKLKDK------AFTFPENQPTNTIVTKVTGSSPRAGPLSYYIASGNLDNAFHIDQLS--------GELSIR--KPLDYENIEKYVLWIE--ARDQ-GFPPYSAYEKVEIAVLDVNDNHPVFEQEPFHAEILENLSPQRVLVVS---ALDQDSGPNGQLEYAIIDGNKENS----FNINRATGEIRTTRPLDREKVAQYSLRVKATDRGMPPKSTAVKVLISVLDVNDNAPRFSK-IFSATVPENAPVGFTVTRVTTTDEDAG-ANAISRY---SITDASLPFIIHPSTGDITISRPLNREDTDHYIAKVSAHDSGWTVSTD-------VTIFVTDINDNAPRFS 2426          

HSP 8 Score: 133.65 bits (335), Expect = 6.604e-31
Identity = 158/606 (26.07%), Postives = 253/606 (41.75%), Query Frame = 2
Query:  410 DSGI--KISSFYILIKVLDENDNSPKFLPFLNPYQ-TLPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHS-KLVNVISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFE-ITAINEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIFSLIN 2212
            D G+  KIS   +++ + D ND  P F    N Y  ++ E+S   + +++ SA D D    G   +       + + + F L     SGR  L   + LDRE  S Y   ++A D        +  V + +K  D+NDN PVF    Y ANI E+     +V +   +D D G+N  V   I T  D  K          F  S  +G +  +  +D E     Y   + ATD G  R  + A V + +++  D  P++   +       S  MFEN P  TI+ +            +  +  D H N   + A  +   L   K   I  L  +DRE+     L++     +      +T    ++I + D+NDN P F  S      +EN   AT   I      D D   N  + Y +  +        F I    G IS    ++   +  +   ++A D      +S+  + + V D NDNAP+F +  Y  T+ E+ PVN+   ++E TD D+    +IV       T +   I  D   G+L     +DRE     ++L+ A++ A       + +   V I ++D+NDN P+F+  N
Sbjct:  541 DQGLQPKISYTKLIVNITDVNDQVPTFTQ--NTYHVSITEHSPAGSELVVLSATDSDLGPNGTIRFSFDSETPVSDQNKFRL--DSTSGR--LSTSTELDREEESSYLLYIRATDSGAPPLHSVCKVNITLK--DVNDNSPVFYPMQYFANIKENEPSGSSVTTVTASDPDLGRNGTVKYAI-TAGDSSK----------FHISSTSGKVTTLVALDREEK-TAYQLQVTATDGGGLRSHTPAIVTVTVVDTQDN-PLVFGQKD-----YSFVMFENVPVGTIIGT------------VSATTVDLHTNITYLIASGDQRSLFGIKAGQITALGLIDREEQAFYQLRVIARAGE------VTGETLVNITVKDLNDNAPNFMHSVEHVSAVEN--WATGHHIFQAKASDPDEATNGMIVYSLKQNPKG----LFHIHEKHGLISLTGPLEVTTSS-YQLEVVASDLGVPQRTSSLFLTISVYDVNDNAPVFDQLSYEVTILESEPVNSRFFRVEATDKDSGVNGEIVYDIISGNTRDVFGIFPD---GQLYIKADLDREVQDRYSLLVVAKDRAVES----LSASVNVSILLDDINDNRPLFNSTN 1088          

HSP 9 Score: 125.946 bits (315), Expect = 1.427e-28
Identity = 169/614 (27.52%), Postives = 262/614 (42.67%), Query Frame = 2
Query:  410 DSG--IKISSFYILIKVLDENDNSPKFLPFLNPYQTLPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRE-NDDHRDISGVEVEIKVGDINDNPPVF---DKTFYTANIVEHSKLVNVISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYK--YSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMF-ENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITAINEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNS--------GKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIF 2200
            DSG   + SS  ++I V D NDN P F P  + ++++PEN  I+T ++  +A D D++  G+  Y I+     G   HF    +I S    +     +DRE  + +   +KA D+    + R  +   V I V D NDN P F   +     +NIV  S L  V++F   D DEG N +V      E +  +     F    +S     G IRL  ++     P K  YS  + ATD+G  R SS  ++ IIL  +    PV           + IT+  E +PA T V SL  S      T +E  +       +  A   +  +G +   +I T   LDRE   + YL +++Y  + D   P T +  +   LFD      +  +    G L E+I Q   +            G NA VTY I S  + +    F ID +SG++S+ + +D E+   +S  + A D  Q   SS   + + V D ND+ P F +  YSF + E++   + +  I  +D D+    +I           Y V   D++S        G       +D E      + + A +           S   V   + DVND+PP+F
Sbjct: 1378 DSGRPSRSSSIPVIIHVRDFNDNPPVFTPG-DIFKSIPENLPISTSVMSITAHDTDADINGLLEYSIALQTPRGG--HF----RIDSVSGVIYTNKDIDREFSNLFELTIKATDQAVPAEFRRFALKNVTIWVTDQNDNIPTFISQNALVAESNIVIGSILTTVLAF---DPDEGANGEV------EYELVRGDSDTFIMDRYS-----GDIRLASQLI----PSKLIYSLMVSATDHGTDRKSSRTELTIIL--QGTDGPVFS-------QPKYITILKEGQPAGTNVISLDASSPRGAGTKVEYFIVSVRSGGK--AAGRLFTIGRHSG-VIQTAAELDREQGSDLYL-LDVYAIETDAKQPRTQHAEVSF-LFDFFFKVMLLLK----GNLREHISQTCAE------------GANALVTYAIISGADDS----FRIDPESGELSATRRLDRERRSKYSLLVRADDGQQ---SSDIWVNITVSDINDHTPTFSRSVYSFDIPEDMSPGSIVAAILASDGDSGVNGEIT----------YSVEEDDEDSTFLLNPITGVFNVTRALDFETQPFFILTVRAADGGG------RSSSVRVYFNLLDVNDHPPLF 1913          

HSP 10 Score: 125.946 bits (315), Expect = 1.607e-28
Identity = 140/517 (27.08%), Postives = 233/517 (45.07%), Query Frame = 2
Query:  695 LDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKLVNVI-SFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITAINEIHPLGHYKEFIIN-------TLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATV--KMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEA-----SYQNKNLMDSECMVIITIEDVNDNPPIF 2200
            LDRE  S+Y  +++A     DD +  S + V I V DIND+ P F ++ Y+ +I E     +++ +   +D D G N +++ ++E     + D+   F     +P  +TG   +   +D+ET P+ +   + A D G    SS+ +V   L++ ND  P+        + + SI   E+  A   V ++  +DRD             H N   T +N +H  G   +F IN       T   LDRE   +  L   +  SD  + TPL+++ T+ + + DINDNPP F    Y    + +IP +T    ++  +   D+D G N+ + Y + + +NS   E F ID   G I++ + +       F+ ++   D   +  + +  + V  +   D  P       +FT  EN P NT    I T    + P    + Y+  S  N     H+DQ SG+L    P+D E +    + I AR++      +Y+          V I + DVNDN P+F
Sbjct: 1771 LDRERRSKYSLLVRA-----DDGQQSSDIWVNITVSDINDHTPTFSRSVYSFDIPEDMSPGSIVAAILASDGDSGVNGEITYSVE-----EDDEDSTFL---LNP--ITGVFNVTRALDFETQPF-FILTVRAADGG--GRSSSVRVYFNLLDVNDHPPLF----NSSVYTTSI--LESLSAGASVLTVSAADRD-------------HGNSS-TLLNSVHLSGGDGQFSINPSTGLIITSSLLDRETRASYQLL--VVASDGGQPTPLSSSATVSVVVADINDNPPRFHHHPY----VTHIPASTSTGSLVFAVTVTDEDSGSNSQLHYSL-TGRNS---EKFKIDPIRGAITASEKLTGSSEVTFTVHV--KDGGTNPKTDSTTVTVRFVTGGD-FPHIKLKDKAFTFPENQPTNT----IVTKVTGSSPRAGPLSYYIAS-GNLDNAFHIDQLSGELSIRKPLDYENIEKYVLWIEARDQGFPPYSAYEK---------VEIAVLDVNDNHPVF 2222          

HSP 11 Score: 117.857 bits (294), Expect = 4.886e-26
Identity = 133/503 (26.44%), Postives = 216/503 (42.94%), Query Frame = 2
Query:  695 LDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKLVN-VISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITAINEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIF 2200
            L+RE  SE   +L    ++      IS  ++ + + D+ND  P F +  Y  +I EHS   + ++    TD D G N  +  + ++E     DQ K  F++D +    +G +    E+D E     Y   + ATD+G P L S  KVNI L + ND +PV   ++          + ENEP+ + V ++  SD D              + + ITA +            + TL  LDRE+ K  Y ++ +  +D   L   T  + + + + D  DNP VF +  Y   + EN+P  T+       T+D     +  +TY I S    +    F I A  G+I++   ID E+   +   +IA       ++   L+ + V D NDNAP F       +  EN      I Q + +D D      IV    +   N   + H+ +  G +   GP++     S  + + A +    Q      S   + I++ DVNDN P+F
Sbjct:  525 LNRETASE--IVLNISAKDQGLQPKISYTKLIVNITDVNDQVPTFTQNTYHVSITEHSPAGSELVVLSATDSDLGPNGTIRFSFDSETPVS-DQNK--FRLDST----SGRLSTSTELDREEES-SYLLYIRATDSGAPPLHSVCKVNITLKDVNDNSPVFYPMQ------YFANIKENEPSGSSVTTVTASDPDLGRNGT--------VKYAITAGDSSKFHISSTSGKVTTLVALDREE-KTAY-QLQVTATDGGGLRSHTPAI-VTVTVVDTQDNPLVFGQKDYSFVMFENVPVGTIIGTVSATTVDL----HTNITYLIASGDQRS---LFGIKA--GQITALGLIDREEQAFYQLRVIA---RAGEVTGETLVNITVKDLNDNAPNFMHSVEHVSAVENWATGHHIFQAKASDPDEATNGMIVYSLKQ---NPKGLFHIHEKHGLISLTGPLEV-TTSSYQLEVVASDLGVPQRT----SSLFLTISVYDVNDNAPVF 980          

HSP 12 Score: 112.849 bits (281), Expect = 1.680e-24
Identity = 155/612 (25.33%), Postives = 252/612 (41.18%), Query Frame = 2
Query:  410 DSGIK--ISSFYILIKVLDENDNSPKFLPFLNPYQTLPENSQINTVILLPSAIDLDSEAFGIKY---YKISKPFLIGNDSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEH---SKLVNVISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITAINEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIY-CSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSST----ALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQ--VIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIF 2200
            D GIK  +S   ++I V+D NDN P F    +P    P    +     L      D + FG+     Y IS     GN S+   LDK       + + S L  +    Y   + A D+ N    D +   V+I V + N + P F +   T  + E       +  +S    D D+  N  ++  I + ND   D +       FS    TG + L   +DYET   K+   + ATD G    +S   VNI + + ND  PV   +    +V       EN P+ T V  +  +D+DS       +L  Y +    + +  I P       II T   LD E  +  +L +  +   D+++ +    N    I L   N+  P F   +Y  E+ E  P+ TV  +  +   D+D G++  V Y I           F+I+  +G+I    S+D EK +  S  ++A  K+  ++        L+ + V+DAND  P+F +  Y   V E +     +  +   D D+ P      Y   +   N++     ++  +G++     +DRE V    + I A +  S           ++I+T+ED+NDN P  
Sbjct: 2510 DRGIKPLMSETTVMINVVDSNDNPPTFE---SPSYFTPVTKSVKVGTRLLKVTAYDKKDFGLNSEIEYAISG----GNSSNKFRLDKQTG---SVTVASSLAADTNKVYLLEITASDKGNPPLSDRT--TVKIAVTEENHHTPEFSQNQVTVTVSEALTVGTAIRTLSARDKDKDKQMNGLITYNISSGND---DGL-------FSVHSQTGVLSLAKTLDYETK-QKHELRVSATDGGWIAKTSYVTVNIQVTDVNDNPPVFDPVEYFPVVQ------ENVPSGTTVVKMNATDKDSGSN----ALMAYVIQSSDSDLFIIDP----NTGIITTQGFLDYEAKQVYHLTVKAFNVPDEERCSFAYVN----IQLKGANEYVPRFVSKQYYFEISEAAPKGTV--VGEVFASDRDLGEDGVVYYLIFGRSRKRG---FSINKKTGQIYVSGSLDREKEEKISLKVLA--KNAGSIRGADIDEVLVNITVLDAND-PPVFTQELYDVQVNEGLSPGGLVTFVSAEDSDSVPSWSRFTY---AIAANHERNTFTINPQTGQVSVASELDRETVPVYNLTILAVDSGS----PAATGSAILIVTLEDINDNGPTL 3065          

HSP 13 Score: 101.293 bits (251), Expect = 5.180e-21
Identity = 164/606 (27.06%), Postives = 252/606 (41.58%), Query Frame = 2
Query:  440 ILIKVLDENDNSPKFLPFLNPYQTLPENSQINTVILLPSAIDLDS--EAFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEH-SKLVNVISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLP--RLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRS--ITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEIT-----AINEIHPLGHYKEFIINTLKPLDREDDKNQYLKI------NIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENI-PQATVKMIEPILTLDKDHGKN-AYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKY--FHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNP 2191
            + I V +EN ++P+F        T+ E   + T I   SA D D   +  G+  Y IS     GND     L  + S    L L   LD E   ++   + A D         S V V I+V D+NDNPPVFD   Y   + E+      V+    TD D G N  ++  I++ +          F ID  P+  TG I     +DYE    K  ++L      +P     S A VNI L   N+  P          VS+     + E  P  T+V  +  SDRD L  D       Y+L F  +     +IN+       K   I     LDRE ++   LK+      +I  +D D++        ++I + D ND PPVFT+  Y  ++ E + P   V  +      D D   + +  TY I ++    +   FTI+  +G++S    +D E   +++  I+A+D      + +A++IV + D NDN P     +    V EN    T +  + + D D  P      Y        ++Y  I     +G+L T   +DRE++    + +  ++    Q    M S   V I + D NDNP
Sbjct: 2628 VKIAVTEENHHTPEFSQN-QVTVTVSEALTVGTAIRTLSARDKDKDKQMNGLITYNISS----GNDDG---LFSVHSQTGVLSLAKTLDYETKQKHELRVSATD--GGWIAKTSYVTVNIQVTDVNDNPPVFDPVEYFPVVQENVPSGTTVVKMNATDKDSGSNALMAYVIQSSD-------SDLFIID--PN--TGIITTQGFLDYEA---KQVYHLTVKAFNVPDEERCSFAYVNIQLKGANEYVP--------RFVSKQYYFEISEAAPKGTVVGEVFASDRD-LGEDGVV----YYLIFGRSRKRGFSINK-------KTGQIYVSGSLDREKEEKISLKVLAKNAGSIRGADIDEVL-------VNITVLDAND-PPVFTQELYDVQVNEGLSPGGLVTFVS---AEDSDSVPSWSRFTYAIAANH---ERNTFTINPQTGQVSVASELDRETVPVYNLTILAVDSGSPAATGSAILIVTLEDINDNGPTLVTTYGE--VMENQRAGTPVMTLSSRDPDLAPNQGPFTYSLVSTGAASSYFTI---SPTGELTTSREVDREQISDFYLSVLIKDSGIPQ----MSSTGTVHIKVNDQNDNP 3166          

HSP 14 Score: 95.5153 bits (236), Expect = 3.452e-19
Identity = 185/735 (25.17%), Postives = 296/735 (40.27%), Query Frame = 2
Query:  458 DENDNSPKFLPFLNPYQT-LPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKLVNVISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFEN-EPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITAINEIHPLG-HYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEY-FTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDRE--------KVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIF---SLINPAKSSL--------IFTINK---GFRHENCQMIPYAVSDADHDEPNSDSCCILQLDNDQNGMLYLLSNTPNFLCLQNTMNTPGIYRVSLTATDNKNNPNKSLKAKVSFNIDVRHEVSDNPFSEKSDNKVHTTKNQ 2584
            D NDN P+F    +PY T +P ++   +++   +  D DS +    +Y      L G +S    +D I   R  +     L     SE  F +   D   +   D + V V    G    +  + DK F        ++  N I   VT     +   +S  I + N      +   F ID     ++G + +   +DYE N  KY   + A D G P  S+  KV I +++ ND  PV       E       + EN  P R +V S    D+DS          +  L + I   N+ +    +     I T +PLDRE      L++    +    + P +T + + I++ D+NDN P F++  +   + EN P      +  + T D+D G NA   Y I      TD    F I   +G I+  + ++ E    +   I  +    S  + +  + + V D NDNAP F KP Y     E   + + + Q+  TD D     KI  YF +S T  ++   ++ +SG++     +  +         V   + ++TA +      K LM SE  V+I + D NDNPP F   S   P   S+        +   +K   G   E    I YA+S         +S    +LD  Q G + + S+           +T  +Y + +TA+D  N P   L  + +  I V  E    P  E S N+V  T ++
Sbjct: 2011 DINDNPPRF--HHHPYVTHIPASTSTGSLVFAVTVTDEDSGSNSQLHYS-----LTGRNSEKFKIDPI---RGAITASEKLTGS--SEVTFTVHVKDGGTNPKTDSTTVTVRFVTGGDFPHIKLKDKAF----TFPENQPTNTIVTKVTG-SSPRAGPLSYYIASGN------LDNAFHID----QLSGELSIRKPLDYE-NIEKYVLWIEARDQGFPPYSAYEKVEIAVLDVNDNHPVF------EQEPFHAEILENLSPQRVLVVS--ALDQDSG--------PNGQLEYAIIDGNKENSFNINRATGEIRTTRPLDREKVAQYSLRVK---ATDRGMPPKSTAVKVLISVLDVNDNAPRFSK-IFSATVPENAPVGFT--VTRVTTTDEDAGANAISRYSI------TDASLPFIIHPSTGDITISRPLNREDTDHY---IAKVSAHDSGWTVSTDVTIFVTDINDNAPRFSKPSYYLDYPELTEIGSIVTQVSATDPDEGFNGKIF-YFIRSQTEYFR---INSSSGEIFIKQQLRYQNSSGHNNINVNRHSFIVTASDRGI---KPLM-SETTVMINVVDSNDNPPTFESPSYFTPVTKSVKVGTRLLKVTAYDKKDFGLNSE----IEYAIS-------GGNSSNKFRLDK-QTGSVTVASSL--------AADTNKVYLLEITASDKGNPP---LSDRTTVKIAVTEENHHTP--EFSQNQVTVTVSE 2653          

HSP 15 Score: 94.3597 bits (233), Expect = 7.702e-19
Identity = 154/636 (24.21%), Postives = 264/636 (41.51%), Query Frame = 2
Query:  404 QVDSGIKISSFYILIKVLDENDNSPKFLPFLNPYQTLPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEH-SKLVNVISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPR-LSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITAINEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNP-----PVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEY----------FTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPP----IFSLINPAKSSLIFTINK 2248
            + D G + S  ++ I V D ND++P F   +  +  +PE+    +++    A D DS   G   Y + +      DS F LL+ I        +   LD E  ++  FIL    R  D     S V V   + D+ND+PP+F+ + YT +I+E  S   +V++    D D G +  +  ++               Q   +PS  TG I     +D ET    Y   ++A+D G P  LSS+A V++++ + ND  P                 F + P                VT I  S     L F +T  +E         + +       R  +K +   I    +  +KLT  ++ +T  +++ D   NP      V  R    G+         +K+ +   T  ++   N  VT    SS  +    Y          F ID  SG++S R+ +DYE  + +   I A D+     S+   + + V+D NDN P+F +  +   + EN+     +  +   D D+ P  ++         N     ++++ +G+++T  P+DREKV   ++    R +A+ +      +   V+I++ DVNDN P    IFS   P  + + FT+ +
Sbjct: 1784 RADDGQQSSDIWVNITVSDINDHTPTFSRSVYSFD-IPEDMSPGSIVAAILASDGDSGVNGEITYSVEED---DEDSTF-LLNPITG---VFNVTRALDFE--TQPFFILTV--RAADGGGRSSSVRVYFNLLDVNDHPPLFNSSVYTTSILESLSAGASVLTVSAADRDHGNSSTLLNSVHLSGGDG--------QFSINPS--TGLIITSSLLDRETRA-SYQLLVVASDGGQPTPLSSSATVSVVVADINDNPP----------------RFHHHP---------------YVTHIPASTSTGSLVFAVTVTDEDSGSNSQLHYSLT-----GRNSEKFKIDPIRGAITASEKLTG-SSEVTFTVHVKDGGTNPKTDSTTVTVRFVTGGDFPH------IKLKDKAFTFPENQPTNTIVTKVTGSSPRAGPLSYYIASGNLDNAFHIDQLSGELSIRKPLDYENIEKYVLWIEARDQGFPPYSAYEKVEIAVLDVNDNHPVFEQEPFHAEILENLSPQ-RVLVVSALDQDSGPNGQLEYAIIDG--NKENSFNINRATGEIRTTRPLDREKVAQYSL----RVKATDRGMPPKSTAVKVLISVLDVNDNAPRFSKIFSATVPENAPVGFTVTR 2346          

HSP 16 Score: 81.2629 bits (199), Expect = 7.643e-15
Identity = 129/494 (26.11%), Postives = 210/494 (42.51%), Query Frame = 2
Query:  782 EVEIKVGDINDNPPVF-DKTFYTANIVEHSKLVNVISFYVTDLDEGQNK--QVSITIETENDYKKDQIKRFFQIDFS--PSLMTGSIRLI--DEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEIT-AINEIHPLG-HYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVF------TRSKYQGELIENIPQATVKMIEPILTL-DKDHG-KNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSN---LSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIFS 2203
            EV I V DINDN PVF D +   +   + S    VI    TD D G N     +  I + ND +K      F++D +  PS     + L+    +D ET P+ Y   +   D G P+     +VN+ + + ND  P                 F++E  +T V   + +   S V  I  S  D   N EIT  ++E  P     K   +   + LD E  +   L I+      + +  L T     + L D+NDN PV       T SK+   + EN   A V  +  +LT+ D D    N  ++  I        ++  +    +  +    S+  ++ ++ S+N+     D       SS A +++ V D ND+ PIF +  Y   + E++P  + I  +  TD D+  +N  ++Y   S  N+     + +NSG + +   ++RE    I + I+A++    Q      S   +I+ I DVND  P F+
Sbjct:  114 EVRIVVLDINDNAPVFPDASIVVSFKEDASSGRQVILDTATDADIGSNGVDHTTYRIISGNDQRK------FRLDITVNPSGEGAFLHLVSTGGLDRETTPF-YQLLIQVEDKGEPKKFGYLQVNVTIQDINDNPP----------------SFDHEQYQTSV--FEDAAVGSSVLQIAASDLDEGANAEITYLLDEGTPFQIDPKAGTVVIKEGLDYETKREYSLTIHAV---DNGVPSLYTRTEATVKLLDVNDNDPVVKFRYFPTTSKF-ASVDEN---AQVGTVVALLTVSDSDSSTANGNISVSILGGNEQRHFDVHSSPVPNLSLIKVASV-LDRERISSYNLTVSVSDNGKPLARSSFASLVIFVNDINDHPPIFQEAVYRVDISEDIPKGSYIKGVSATDGDSG-QNANLRYSLVS-GNSLGWFAISENSGLVTSAAELNRETASEIVLNISAKD----QGLQPKISYTKLIVNITDVNDQVPTFT 568          

HSP 17 Score: 73.559 bits (179), Expect = 1.691e-12
Identity = 102/387 (26.36%), Postives = 167/387 (43.15%), Query Frame = 2
Query:  389 TVFSFQVDSGIKISSFYILIKVLDENDNSPKFLPFLNPYQTLPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHR--DISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKLVNVISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITAINE----IHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTP-LTTNLTIHINLFDINDNP 1528
            TV +F V    + S  Y+ I++   N+  P+F+     Y  + E +   TV+    A D D    G+ YY I   F       F++  K      Q+ +   LDRE   E +  LK + +     R  DI  V V I V D ND PPVF +  Y   + E      +++F   +  +        T     +++++         F+ +  TG + +  E+D ET P  Y+  ++A D+G P  + +A + + L + ND  P + V   GE++       EN+ A T V +L  S RD    D+  +   +  +   T        I P G      + T + +DRE   + YL + I    +D   P +++  T+HI + D NDNP
Sbjct: 2822 TVKAFNVPDEERCSFAYVNIQLKGANEYVPRFVS-KQYYFEISEAAPKGTVVGEVFASDRDLGEDGVVYYLI---FGRSRKRGFSINKKTG----QIYVSGSLDRE--KEEKISLKVLAKNAGSIRGADIDEVLVNITVLDAND-PPVFTQELYDVQVNEGLSPGGLVTFVSAEDSDSVPSWSRFTYAIAANHERNT--------FTINPQTGQVSVASELDRETVPV-YNLTILAVDSGSPAATGSAILIVTLEDINDNGPTL-VTTYGEVM-------ENQRAGTPVMTL--SSRDP---DLAPNQGPFTYSLVSTGAASSYFTISPTGE-----LTTSREVDREQISDFYLSVLI----KDSGIPQMSSTGTVHIKVNDQNDNP 3166          
BLAST of Protocadherin Fat 1 vs. Ensembl Zebrafish
Match: pcdh11 (protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-21])

HSP 1 Score: 194.126 bits (492), Expect = 3.951e-50
Identity = 196/653 (30.02%), Postives = 308/653 (47.17%), Query Frame = 2
Query:  257 LSVVSNIDRESICPIKNSLNDYDQSAETYNSQQSSHSCKYDECCTVFSFQVDSGIKISSFYILIKVLDENDNSPKFLPFLNPYQTLPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIASGR----PQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKL-VNVISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITAINEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIF 2200
            L+  + IDRE +C            +  +N ++    C Y+    V   ++   +KI     LI+  D NDN+P F   +    ++PEN+ IN+   +PSA D D    GI++Y++ K       S F L D I +      PQL++   LDRE  ++  F++K    +  +    S   +++ V D+NDN PVF  +    N+ E++ +  +V   + TD D G N Q+  +   +        KR F ID +    TG I +   +D E NP  +   ++A+D       +T  VN+  IN  D  P I       +V+ ++ + EN P  T +A + V+DRDS +        D+ + F +  +          +F++ T  PLD E  + +Y  I I  SD  K  PL T+  + I + D NDN PVF + + Q  + EN    T ++I+ I   D D G NA + Y +    ++ D   F ID+ SG +S  + +D EK + +SF +IA D   + L S   + + V D NDN+P F  P Y+F V EN+P+   +G I  TD D   +N +V     S  N      +D  +G +K     DRE+  S T ++ A +    Q      S   V I + DVNDN P+F
Sbjct:   85 LTTANRIDREKLC------------SGVFNEKR----CYYEIEVAVLPDEIFRLVKIR---FLIE--DINDNAPLFQSTVINI-SIPENTAINSRYPVPSAFDPDIGINGIQHYELVKSV-----SEFGL-DIIETPEGDKWPQLIVQQSLDRE--TKDTFVMKIKVEDGGNPPKSSTAILQVTVSDVNDNRPVFKDSEVEVNVPENAPMGTSVTHLHATDADLGSNAQIHFSFSNQ---ISPSTKRHFAIDST----TGLITVKQPLDREVNPV-HKLIVLASDGSSTPSRATVIVNVTDIN--DNVPSIDTRYIMNLVNGTVLLSENAPLNTKIALITVTDRDSDLNGKVTCYTDHDVPFRLKPV-------FNDQFLLETAAPLDYETTR-EY-AIRIVASDSGK-PPLNTSAMVLIKIKDENDNVPVFPQPEIQLSIPENNDPGT-QLIK-ISATDADSGSNALIIYSL--GPDAPDG--FNIDSRSGILSVVKRLDREKQEKYSFTVIARDNGTTPLQSNVTVKLIVQDQNDNSPAFTHPEYNFYVPENLPLYGTVGLITVTDADAG-DNAVVTL---SIINGKDNFIIDPKTGVIKPNITFDREQQSSYTFVVKAVDAGLMQTT----SYAKVTINVVDVNDNRPVF 673          

HSP 2 Score: 127.102 bits (318), Expect = 4.252e-29
Identity = 153/533 (28.71%), Postives = 243/533 (45.59%), Query Frame = 2
Query:  392 VFSFQVDSGI---KISSFYILIKVLDENDNSPKFLPFLNPYQTLPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKLVN--------VISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITAINEIHPLGH---YKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQ-ATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIF--PKPHYSFTVRENVPVNTEIGQIET 1939
            V   +V+ G    K S+  + + V D NDN P F         +PEN+ + T +    A D D  +    ++  S         HF     I S    + +  PLDREV   ++ I+ A D  +   R      V + V DINDN P  D T Y  N+V  + L++        +    VTD D   N +V+   + +  ++   +K  F   F   L T +      +DYET   +Y+  ++A+D+G P L+++A V I + ++ND  PV     + EI    +++ EN    T +  +  +D DS       +L  Y L  +        P G     +  I++ +K LDRE  K +     +   D +  TPL +N+T+ + + D NDN P FT  +Y   + EN+P   TV +I      D D G NA VT  I + K++     F ID  +G I    + D E+   ++F + A+D      +S A + ++V+D NDN P+F  P  +YS+ +   VP NT  G + T
Sbjct:  216 VMKIKVEDGGNPPKSSTAILQVTVSDVNDNRPVFKDS-EVEVNVPENAPMGTSVTHLHATDADLGSNAQIHFSFSNQISPSTKRHFA----IDSTTGLITVKQPLDREVNPVHKLIVLASDGSSTPSR----ATVIVNVTDINDNVPSID-TRYIMNLVNGTVLLSENAPLNTKIALITVTDRDSDLNGKVTCYTDHDVPFR---LKPVFNDQFL--LETAA-----PLDYETT-REYAIRIVASDSGKPPLNTSAMVLIKIKDENDNVPVFP---QPEI---QLSIPENNDPGTQLIKISATDADSG----SNALIIYSLGPD-------APDGFNIDSRSGILSVVKRLDRE--KQEKYSFTVIARD-NGTTPLQSNVTVKLIVQDQNDNSPAFTHPEYNFYVPENLPLYGTVGLIT---VTDADAGDNAVVTLSIINGKDN-----FIIDPKTGVIKPNITFDREQQSSYTFVVKAVDAGLMQTTSYAKVTINVVDVNDNRPVFVIPSSNYSYDL---VPSNTSPGSVVT 696          

HSP 3 Score: 107.457 bits (267), Expect = 3.811e-23
Identity = 129/488 (26.43%), Postives = 218/488 (44.67%), Query Frame = 2
Query:  779 VEVEIKVGDINDNPPVFDKTFYTANIVEHSKLVN---VISFYVTDLDEGQNK-QVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNF--EITAINEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELI-------ENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIFS 2203
            V++   + DINDN P+F  T    +I E++ + +   V S +  D D G N  Q    +++ +++  D I+   + D  P L+         +D ET    +   +   D G P  SSTA + + + + ND  PV K     E+    + + EN P  T V  L  +D D        S    H +F  +I+   + H        +I   +PLDRE   N   K+ +  SD    TP  +  T+ +N+ DINDN P    ++Y   L+       EN P  T   I  I   D+D   N  VT   D   +   +    +  D   + +   +DYE  + ++  I+A D  +  L+++A++++ + D NDN P+FP+P    ++ EN    T++ +I  TD D+     I+        + +   ++D  SG L  +  +DREK    +  + AR+  +      + S   V + ++D NDN P F+
Sbjct:  123 VKIRFLIEDINDNAPLFQSTVINISIPENTAINSRYPVPSAF--DPDIGINGIQHYELVKSVSEFGLDIIETP-EGDKWPQLIVQQ-----SLDRETKD-TFVMKIKVEDGGNPPKSSTAILQVTVSDVNDNRPVFK---DSEV---EVNVPENAPMGTSVTHLHATDADL------GSNAQIHFSFSNQISPSTKRHFAIDSTTGLITVKQPLDRE--VNPVHKLIVLASDGSS-TP--SRATVIVNVTDINDNVPSI-DTRYIMNLVNGTVLLSENAPLNT--KIALITVTDRDSDLNGKVTCYTD---HDVPFRLKPVFNDQFLLETAAPLDYETTREYAIRIVASDSGKPPLNTSAMVLIKIKDENDNVPVFPQPEIQLSIPENNDPGTQLIKISATDADSGSNALIIYSLGPDAPDGF---NIDSRSGILSVVKRLDREKQEKYSFTVIARDNGTTP----LQSNVTVKLIVQDQNDNSPAFT 571          

HSP 4 Score: 51.6026 bits (122), Expect = 5.799e-6
Identity = 65/234 (27.78%), Postives = 97/234 (41.45%), Query Frame = 2
Query:  428 SSFYILIKVLDENDNSPKFL-PFLNPYQTLPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVF--DKTFYTANIVEH--SKLVNVISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRL 1114
            S+  + + V D+NDNSP F  P  N Y  +PEN  +   + L +  D D+    +    I     I    +F +  K    +P +      DRE  S Y F++KAVD      +  S  +V I V D+NDN PVF    + Y+ ++V    S    V   +  D D G N ++                         S++ GS+R +  ID  T        ++A D GL RL
Sbjct:  552 SNVTVKLIVQDQNDNSPAFTHPEYNFY--VPENLPLYGTVGLITVTDADAGDNAVVTLSI-----INGKDNFIIDPKTGVIKPNITF----DREQQSSYTFVVKAVDA--GLMQTTSYAKVTINVVDVNDNRPVFVIPSSNYSYDLVPSNTSPGSVVTRVFAIDNDTGMNAELQY-----------------------SIIGGSLRGLFTIDKTTGNITLQEKIVAADQGLHRL 749          
BLAST of Protocadherin Fat 1 vs. Ensembl Zebrafish
Match: pcdh11 (protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-21])

HSP 1 Score: 194.512 bits (493), Expect = 4.231e-50
Identity = 195/652 (29.91%), Postives = 304/652 (46.63%), Query Frame = 2
Query:  257 LSVVSNIDRESICPIKNSLNDYDQSAETYNSQQSSHSCKYDECCTVFSFQVDSGIKISSFYILIKVLDENDNSPKFLPFLNPYQTLPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTL-LDKIASG--RPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKL-VNVISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITAINEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIF 2200
            L+  + IDRE +C            +  +N ++    C Y+    V   ++   +KI     LI+  D NDN+P F   +    ++PEN+ IN+   +PSA D D    GI++Y+     L+ + S F L + +   G   PQL++   LDRE    +   +K  D  N      S   +++ V D+NDN PVF  +    N+ E++ +  +V   + TD D G N Q+  +   +        KR F ID +    TG I +   +D E NP  +   ++A+D       +T  VN+  IN  D  P I       +V+ ++ + EN P  T +A + V+DRDS +        D+ + F +  +          +F++ T  PLD E  +     I I  SD  K  PL T+  + I + D NDN PVF + + Q  + EN    T ++I+ I   D D G NA + Y +    ++ D   F ID+ SG +S  + +D EK + +SF +IA D   + L S   + + V D NDN+P F  P Y+F V EN+P+   +G I  TD D   +N +V     S  N      +D  +G +K     DRE+  S T ++ A +    Q      S   V I + DVNDN P+F
Sbjct:   85 LTTANRIDREKLC------------SGVFNEKR----CYYEIEVAVLPDEIFRLVKIR---FLIE--DINDNAPLFQSTVINI-SIPENTAINSRYPVPSAFDPDIGINGIQHYE-----LVKSVSEFGLDIIETPEGDKWPQLIVQQSLDRETKDTFVMKIKVEDGGNPPKS--STAILQVTVSDVNDNRPVFKDSEVEVNVPENAPMGTSVTHLHATDADLGSNAQIHFSFSNQ---ISPSTKRHFAIDST----TGLITVKQPLDREVNPV-HKLIVLASDGSSTPSRATVIVNVTDIN--DNVPSIDTRYIMNLVNGTVLLSENAPLNTKIALITVTDRDSDLNGKVTCYTDHDVPFRLKPV-------FNDQFLLETAAPLDYETTRE--YAIRIVASDSGK-PPLNTSAMVLIKIKDENDNVPVFPQPEIQLSIPENNDPGT-QLIK-ISATDADSGSNALIIYSL--GPDAPDG--FNIDSRSGILSVVKRLDREKQEKYSFTVIARDNGTTPLQSNVTVKLIVQDQNDNSPAFTHPEYNFYVPENLPLYGTVGLITVTDADAG-DNAVVTL---SIINGKDNFIIDPKTGVIKPNITFDREQQSSYTFVVKAVDAGLMQTT----SYAKVTINVVDVNDNRPVF 673          

HSP 2 Score: 127.487 bits (319), Expect = 3.455e-29
Identity = 154/532 (28.95%), Postives = 243/532 (45.68%), Query Frame = 2
Query:  392 VFSFQVDSG---IKISSFYILIKVLDENDNSPKFLPFLNPYQTLPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKLVN--------VISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTD-IECSLD-DYHLNFEITAINEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQ-ATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIF--PKPHYSFTVRENVPVNTEIGQIET 1939
            V   +V+ G    K S+  + + V D NDN P F         +PEN+ + T +    A D D  +    ++  S         HF     I S    + +  PLDREV   ++ I+ A D  +   R      V + V DINDN P  D T Y  N+V  + L++        +    VTD D   N +V+   + +  ++   +K  F   F   L+  +  L    DYET   +Y+  ++A+D+G P L+++A V I + ++ND  PV     + EI    +++ EN    T +  +  +D DS     I  SL  D    F I +          +  I++ +K LDRE  K +     +   D +  TPL +N+T+ + + D NDN P FT  +Y   + EN+P   TV +I      D D G NA VT  I + K++     F ID  +G I    + D E+   ++F + A+D      +S A + ++V+D NDN P+F  P  +YS+ +   VP NT  G + T
Sbjct:  216 VMKIKVEDGGNPPKSSTAILQVTVSDVNDNRPVFKDS-EVEVNVPENAPMGTSVTHLHATDADLGSNAQIHFSFSNQISPSTKRHFA----IDSTTGLITVKQPLDREVNPVHKLIVLASDGSSTPSR----ATVIVNVTDINDNVPSID-TRYIMNLVNGTVLLSENAPLNTKIALITVTDRDSDLNGKVTCYTDHDVPFR---LKPVFNDQF---LLETAAPL----DYETT-REYAIRIVASDSGKPPLNTSAMVLIKIKDENDNVPVFP---QPEI---QLSIPENNDPGTQLIKISATDADSGSNALIIYSLGPDAPDGFNIDS----------RSGILSVVKRLDRE--KQEKYSFTVIARD-NGTTPLQSNVTVKLIVQDQNDNSPAFTHPEYNFYVPENLPLYGTVGLIT---VTDADAGDNAVVTLSIINGKDN-----FIIDPKTGVIKPNITFDREQQSSYTFVVKAVDAGLMQTTSYAKVTINVVDVNDNRPVFVIPSSNYSYDL---VPSNTSPGSVVT 696          

HSP 3 Score: 107.842 bits (268), Expect = 3.433e-23
Identity = 129/488 (26.43%), Postives = 219/488 (44.88%), Query Frame = 2
Query:  779 VEVEIKVGDINDNPPVFDKTFYTANIVEHSKLVN---VISFYVTDLDEGQNK-QVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNF--EITAINEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELI-------ENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIFS 2203
            V++   + DINDN P+F  T    +I E++ + +   V S +  D D G N  Q    +++ +++  D I+   + D  P L+     +   +D ET    +   +   D G P  SSTA + + + + ND  PV K     E+    + + EN P  T V  L  +D D        S    H +F  +I+   + H        +I   +PLDRE   N   K+ +  SD    TP  +  T+ +N+ DINDN P    ++Y   L+       EN P  T   I  I   D+D   N  VT   D   +   +    +  D   + +   +DYE  + ++  I+A D  +  L+++A++++ + D NDN P+FP+P    ++ EN    T++ +I  TD D+     I+        + +   ++D  SG L  +  +DREK    +  + AR+  +      + S   V + ++D NDN P F+
Sbjct:  123 VKIRFLIEDINDNAPLFQSTVINISIPENTAINSRYPVPSAF--DPDIGINGIQHYELVKSVSEFGLDIIETP-EGDKWPQLI-----VQQSLDRETK-DTFVMKIKVEDGGNPPKSSTAILQVTVSDVNDNRPVFK---DSEV---EVNVPENAPMGTSVTHLHATDADL------GSNAQIHFSFSNQISPSTKRHFAIDSTTGLITVKQPLDRE--VNPVHKLIVLASDGSS-TP--SRATVIVNVTDINDNVPSI-DTRYIMNLVNGTVLLSENAPLNT--KIALITVTDRDSDLNGKVTCYTD---HDVPFRLKPVFNDQFLLETAAPLDYETTREYAIRIVASDSGKPPLNTSAMVLIKIKDENDNVPVFPQPEIQLSIPENNDPGTQLIKISATDADSGSNALIIYSLGPDAPDGF---NIDSRSGILSVVKRLDREKQEKYSFTVIARDNGTTP----LQSNVTVKLIVQDQNDNSPAFT 571          

HSP 4 Score: 51.9878 bits (123), Expect = 5.252e-6
Identity = 65/234 (27.78%), Postives = 97/234 (41.45%), Query Frame = 2
Query:  428 SSFYILIKVLDENDNSPKFL-PFLNPYQTLPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVF--DKTFYTANIVEH--SKLVNVISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRL 1114
            S+  + + V D+NDNSP F  P  N Y  +PEN  +   + L +  D D+    +    I     I    +F +  K    +P +      DRE  S Y F++KAVD      +  S  +V I V D+NDN PVF    + Y+ ++V    S    V   +  D D G N ++                         S++ GS+R +  ID  T        ++A D GL RL
Sbjct:  552 SNVTVKLIVQDQNDNSPAFTHPEYNFY--VPENLPLYGTVGLITVTDADAGDNAVVTLSI-----INGKDNFIIDPKTGVIKPNITF----DREQQSSYTFVVKAVDA--GLMQTTSYAKVTINVVDVNDNRPVFVIPSSNYSYDLVPSNTSPGSVVTRVFAIDNDTGMNAELQY-----------------------SIIGGSLRGLFTIDKTTGNITLQEKIVAADQGLHRL 749          
BLAST of Protocadherin Fat 1 vs. Ensembl Zebrafish
Match: pcdh7b (protocadherin 7b [Source:ZFIN;Acc:ZDB-GENE-081104-299])

HSP 1 Score: 193.741 bits (491), Expect = 6.091e-50
Identity = 183/624 (29.33%), Postives = 294/624 (47.12%), Query Frame = 2
Query:  446 IKVLDENDNSPKFLPFLNPYQTLP--ENSQINTVILLPSAIDLDSEAFGIKYYKI------SKPFLIGN------DSHFT--LLDKIAS----------------GRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSK-LVNVISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRS--ITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITAINEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNL------MDSECMVIITIEDVNDNPP 2194
            + +LD NDN+P    F +P  TL   EN  I T+ LLP+A D D    GI+ Y++      S    IG       DSH      D+ AS                 +PQL++   LDRE    Y   L+   R+  D    S   + + + D+NDN P F+K+ Y A++ E+S     ++     D D G N Q    IE       + ++R  ++D S    TG + ++  ID E +  +  F ++A D G P  +  A V I + ++ND  P I + + G I  +     + E+    T +A +QVSDRD     I        + F++   +E+    + K++ ++T  PLD E    Q   + I   D    +  + N  I + + D+NDNPPVF++S  +    EN   A  + +  ++ LD D GKNA ++Y +DSS N      F+IDAD+G I     +D E+ + + F +IA DK    L  +A ++V V D NDN P F +  ++F ++EN+  N+ +G I   D D + +N  +  + +   N   +  +D N+G + +    DRE+          RN  S++ K +        +   V +++ DVNDNPP
Sbjct:  125 VIILDINDNTPS---FPSPVLTLSVEENRPIGTLYLLPTATDRDFGRNGIERYELIQDNGESTVRRIGTSGSGSVDSHSGKRRFDEGASRSSVFELQVADTTDGEKQPQLIIKGALDREQRDSYELTLRV--RDGGDPPRSSQAILRVMITDVNDNTPRFEKSVYEADLPENSSPGAPILQLKAGDTDVGVNGQ----IEYVFGAATESVRRLLRLDES----TGWLSVLHRIDRE-DVSQLRFTVMARDRGQPPKTDKATVIINIKDENDNVPNIDIRKIGRIFLKDGVANVAEDVIVDTPIALVQVSDRDKGPNGIVTCTVVGDVPFQLKPASEVEGDMNKKKYFLHTSAPLDYE--AVQEYNVVIVAVDSGSPSLSSNNSLI-VKVGDMNDNPPVFSKSTVEVSFPEN--NAPGERVVTVVALDADSGKNAEISYSLDSSVNGI----FSIDADTGDIRVNTILDREQTERYEFKVIAKDKGMPVLQGSATVVVLVADKNDNEPKFMQDVFTFYIQENLQPNSPVGMITVMDAD-KGQNADMSLYIEEEEN---IFSIDNNTGTIFSNMAFDREQ----------RNNYSFRVKAVDGGDPPRSATATVSLSVMDVNDNPP 711          

HSP 2 Score: 100.138 bits (248), Expect = 7.774e-21
Identity = 152/579 (26.25%), Postives = 254/579 (43.87%), Query Frame = 2
Query:  428 SSFYILIKVLDENDNSPKFLPFLNPYQT-LPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFD-----KTFY---TANIVEHSKLVNVISFY-VTDLDEGQNKQVSITI------------ETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFE----NEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITAINEIHPL-GHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTP-LTTNLTIHINLFDINDNPPVFTRSKYQGELIENI-PQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAP--IFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDRE 2071
            S   + + + D NDN+P+F   +  Y+  LPENS     IL   A D D    G    +I   F    +S   LL ++      L ++  +DRE +S+ RF + A DR      D + V + IK  D NDN P  D     + F     AN+ E   +   I+   V+D D+G N  V+ T+            E E D  K   K++F    +P            +DYE    +Y+  ++A D+G P LSS   + + + + ND  PV          S+S         N P   +V  + +        +I  SLD        +++N I  +     +  +NT+  LDRE  +    K+      +DK  P L  + T+ + + D NDN P F +  +   + EN+ P + V M   I  +D D G+NA ++  I+  +N      F+ID ++G I S  + D E+   +SF + A+D      S+TA + + V+D NDN P  +FP  +    +  +  + T +  +  TD DT     +   +     N +++  +D  +G +  +G ++++
Sbjct:  261 SQAILRVMITDVNDNTPRFEKSV--YEADLPENSSPGAPILQLKAGDTDVGVNG----QIEYVFGAATESVRRLL-RLDESTGWLSVLHRIDREDVSQLRFTVMARDRGQPPKTDKATVIINIK--DENDNVPNIDIRKIGRIFLKDGVANVAEDVIVDTPIALVQVSDRDKGPNGIVTCTVVGDVPFQLKPASEVEGDMNK---KKYFLHTSAP------------LDYEA-VQEYNVVIVAVDSGSPSLSSNNSLIVKVGDMNDNPPVF---------SKSTVEVSFPENNAPGERVVTVVALDADSGKNAEISYSLD--------SSVNGIFSIDADTGDIRVNTI--LDREQTERYEFKVIA----KDKGMPVLQGSATVVVLVADKNDNEPKFMQDVFTFYIQENLQPNSPVGM---ITVMDADKGQNADMSLYIEEEEN-----IFSIDNNTGTIFSNMAFDREQRNNYSFRVKAVDGGDPPRSATATVSLSVMDVNDNPPTVLFPMNNSYTLLPPSSNIRTVVRTVSATDTDTGVNANL--SYRIVGGNPFKLFDMDAWTGVISLVGKLEQK 781          

HSP 3 Score: 70.0922 bits (170), Expect = 1.352e-11
Identity = 148/647 (22.87%), Postives = 242/647 (37.40%), Query Frame = 2
Query:  782 EVEIKVGDINDNPPVFDKTFYTANIVEHSKLV---------------NVISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPY-------------KYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLV-TDIECSLDDYHLNFEITAINEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPP---------VFTR---SKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGK----ISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIFSLINPAKSSLIFTINKGFRHENCQMIPYAVSDADHDEPNSDSCCILQLDND--QNGMLYL-LSNTPNFLCLQNTMNTPGI-------------YRVSLTATDNKNNPNKSLKAKVSFNIDVRHEVSDNP 2539
            E ++ + DINDN P F     T ++ E+  +                N I  Y    D G++    I             KR F    S S +   +++ D  D E  P               Y   L   D G P  SS A + +++ + ND  P      + E       + EN      +  L+  D D  V   IE     Y       ++  +  L     + ++ L  +DRED     L+  +   D+ +  P T   T+ IN+ D NDN P         +F +   +    ++I + P A V++       D+D G N  VT  +             ++ D  K    + +   +DYE  + ++  I+A+D    +LSS   +IV V D NDN P+F K     +  EN      +  +   D D+  +N  + Y   S  N   +  +D ++G ++    +DRE+       + A+++       ++     V++ + D NDN P F          +FT    +  EN Q             PNS    I  +D D  QN  + L +    N   + N  NT  I             Y   + A D   +P +S  A VS ++    +V+DNP
Sbjct:  122 EGKVIILDINDNTPSFPSPVLTLSVEENRPIGTLYLLPTATDRDFGRNGIERYELIQDNGESTVRRIGTSGSGSVDSHSGKRRFDEGASRSSVF-ELQVADTTDGEKQPQLIIKGALDREQRDSYELTLRVRDGGDPPRSSQAILRVMITDVNDNTP------RFEKSVYEADLPENSSPGAPILQLKAGDTDVGVNGQIE-----YVFGAATESVRRLLRLDESTGW-LSVLHRIDREDVSQ--LRFTVMARDRGQ-PPKTDKATVIINIKDENDNVPNIDIRKIGRIFLKDGVANVAEDVIVDTPIALVQV------SDRDKGPNGIVTCTVVGDVPFQLKPASEVEGDMNKKKYFLHTSAPLDYEAVQEYNVVIVAVDSGSPSLSSNNSLIVKVGDMNDNPPVFSKSTVEVSFPENNAPGERVVTVVALDADSG-KNAEISYSLDSSVNG--IFSIDADTGDIRVNTILDREQTERYEFKVIAKDKG----MPVLQGSATVVVLVADKNDNEPKF-------MQDVFTF---YIQENLQ-------------PNSPVGMITVMDADKGQNADMSLYIEEEENIFSIDN--NTGTIFSNMAFDREQRNNYSFRVKAVDG-GDPPRSATATVSLSV---MDVNDNP 710          
BLAST of Protocadherin Fat 1 vs. Ensembl Xenopus
Match: ENSXETT00000039438.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:3:18370669:18374036:1 gene:ENSXETG00000012646.1 transcript:ENSXETT00000039438.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 192.971 bits (489), Expect = 5.847e-50
Identity = 181/624 (29.01%), Postives = 300/624 (48.08%), Query Frame = 2
Query:  215 VTEKASPFSLIDNRLSVVSNIDRESICPIKNSLNDYDQSAETYNSQQSSHSCKYDECCTVFSFQVDSGIKISSFYILIKVLDENDNSPKFLPFLNPYQTLPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIAS-GR--PQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKL-VNVISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITAINEIHPLGHYKEFI-INTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIEN-IPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNS--TDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAP--IFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIH--VDQNSGKLKT 2050
            ++EK    +L +  L+V   IDRE++C  +                         EC   F   +++ + I  F++ + + D NDN P+F+P  N ++ + E++       L +A DLD     I  YK+S       + HF L +K ++ GR  P+L+L + LDRE  S    IL A D  N      +   ++I V D NDN PVF +  Y  NI E+  +  +V+    +D DEG N Q++ +  T        + R F ++  P    G I+ I  +D+E   Y Y  ++ A D+G   L + AKV I +I++ND AP I V       S S  + E+    T+VA ++  D DS         ++  +N EI  +     +     F  I T   LDRE  ++ +  I I  +D+    PL+ + TI +++ DINDN PVF RS +     EN  P A++  I+ I   DKD  +N  + Y I +S     +   Y +I+  +G I +++S DYE+++ F   I+A D     L+S+A++ + V+D NDN+P  ++P P       E VP ++E G + T  +    ++    +    +  + +  H  +DQ +G+++T
Sbjct:   75 LSEKYFSINLGNGNLNVADRIDREALCGTRG------------------------ECFLKFDTVIENPLNI--FHVRVDIKDINDNLPRFIPETNEFE-ISESTSSGAKFTLQNAEDLDVGMNSIVTYKLSA------NKHFVLGEKKSTNGRTFPELILQTSLDRETQSNLELILTASDGGNPVQTGTT--LIKITVTDFNDNVPVFTQEVYKVNIHENIPINSSVLQVNASDKDEGINAQITYSFST----AATNVLRLFTVN--PD--NGEIKTIGNVDFEEEKY-YDISVQAKDSG--GLVANAKVLIEIIDENDNAPEISV------TSISTPISEDSAPGTVVALIKAHDLDSG--------ENGEVNCEIIGVGPFKLMSSSGNFYKIVTTSTLDRE--RSSHYNITIQATDKGS-PPLSFSKTIRLDVLDINDNQPVFERSTFMAYAPENNQPGASIYSIQAI---DKDTEENGKLFYSIITSNTEEISSTSYISINPVTGVIYAQRSFDYEQDREFEIQIMAKDSGSPPLNSSAIVRICVVDQNDNSPTVLYPSPDVGSAAYEMVPFSSEQGTLVTKVVAVDADSGHNAWLSYHFLQDSETSHFIIDQYTGEIRT 632          

HSP 2 Score: 88.5817 bits (218), Expect = 4.014e-17
Identity = 94/384 (24.48%), Postives = 170/384 (44.27%), Query Frame = 2
Query: 1493 IHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADS-GKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIFSLINPAKSSLIFTINKGFRHENCQMIPYAV---SDADHDEPNSDSCCILQLDNDQNGMLYLLSNTPNFLCLQNT----MNTPGIYRVSLTATDNKNNPNKSLKAKVSFNIDVRHEVSD----NPFSEKSDNKVHTTKNQYYNPSRFS 2608
            + +++ DINDN P F     + E+ E+        ++     D D G N+ VTYK+ ++K+    E  + +  +  ++  + S+D E        + A D      + T LI + V D NDN P+F +  Y   + EN+P+N+ + Q+  +D D     +I   F  + TN  ++  V+ ++G++KTIG +D E+ +   I + A++         + +   V+I I D NDN P  S         + +I+     ++      A+    D D  E    +C I+ +     G   L+S++ NF  +  T          Y +++ ATD  + P       +SF+  +R +V D     P  E+S    +  +N     S +S
Sbjct:  124 VRVDIKDINDNLPRFIPETNEFEISESTSSGAKFTLQN--AEDLDVGMNSIVTYKLSANKHFVLGEKKSTNGRTFPELILQTSLDRETQSNLELILTASDGGNPVQTGTTLIKITVTDFNDNVPVFTQEVYKVNIHENIPINSSVLQVNASDKDEGINAQITYSFSTAATNVLRLFTVNPDNGEIKTIGNVDFEEEKYYDISVQAKDSGG------LVANAKVLIEIIDENDNAPEIS---------VTSISTPISEDSAPGTVVALIKAHDLDSGENGEVNCEIIGV-----GPFKLMSSSGNFYKIVTTSTLDRERSSHYNITIQATDKGSPP-------LSFSKTIRLDVLDINDNQPVFERSTFMAYAPENNQPGASIYS 478          

HSP 3 Score: 79.7221 bits (195), Expect = 1.770e-14
Identity = 143/569 (25.13%), Postives = 224/569 (39.37%), Query Frame = 2
Query:  665 GRPQLLLISPLDREVISEYRF-ILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKLVNVISFY-VTDLDEGQNKQVSITIETENDY----KKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITAINEIHPLGHYKEFIIN-------TLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSG---KISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQ------VIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIFSLINPAKSSLIFTINKGFRHENCQMIPYAVS-DAD 2302
            G   L +   +DRE +   R       D   ++  +I  V V+IK  DINDN P F        I E +      +     DLD G N  V+  +     +    KK    R F     P L+     L   +D ET        L A+D G P  + T  + I + + ND  PV       E+    + + EN P  + V  +  SD+D              +N +IT           + F +N       T+  +D E++K  Y  I++   D   L     N  + I + D NDN P  + +     + E+    TV  +  I   D D G+N  V  +I           F + + SG   KI +  ++D E++  ++  I A DK    LS +  I + V+D NDN P+F +  +     EN      I  I+  D DT    K+   F+   T+N +       I ++  +G +      D E+ R   I I A++  S      ++S  +V I + D NDN P     +P   S  + +   F  E   ++   V+ DAD
Sbjct:   85 GNGNLNVADRIDREALCGTRGECFLKFDTVIENPLNIFHVRVDIK--DINDNLPRFIPETNEFEISESTSSGAKFTLQNAEDLDVGMNSIVTYKLSANKHFVLGEKKSTNGRTF-----PELI-----LQTSLDRETQS-NLELILTASDGGNPVQTGTTLIKITVTDFNDNVPVFT----QEVYK--VNIHENIPINSSVLQVNASDKDE------------GINAQITYSFSTAATNVLRLFTVNPDNGEIKTIGNVDFEEEK--YYDISVQAKDSGGLV---ANAKVLIEIIDENDNAPEISVTSISTPISEDSAPGTV--VALIKAHDLDSGENGEVNCEI------IGVGPFKLMSSSGNFYKIVTTSTLDRERSSHYNITIQATDKGSPPLSFSKTIRLDVLDINDNQPVFERSTFMAYAPENNQPGASIYSIQAIDKDTEENGKL---FYSIITSNTEEISSTSYISINPVTGVIYAQRSFDYEQDREFEIQIMAKDSGSPP----LNSSAIVRICVVDQNDNSPTVLYPSPDVGSAAYEMVP-FSSEQGTLVTKVVAVDAD 601          
BLAST of Protocadherin Fat 1 vs. Ensembl Xenopus
Match: ENSXETT00000047801.1 (protocadherin 11 X-linked [Source:NCBI gene;Acc:100493938])

HSP 1 Score: 192.971 bits (489), Expect = 1.537e-49
Identity = 182/624 (29.17%), Postives = 292/624 (46.79%), Query Frame = 2
Query:  383 CCTVFS-----FQVDSGIKISSFYILIKVL----DENDNSPKFLPFLNPYQTLPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIASGR----PQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKL-VNVISFYVTDLDEGQNKQVSITIETENDYKKDQI----KRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITAINEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIF 2200
            C  +F+     ++V+  +     + L+K+     D NDNSP F P      ++PEN+ +N+   +PSAID D    GI++Y++ K        +   LD I +      PQL++   LDRE    Y   +K  D  N      S   +++ V D+NDN PVF +     NI E + +  +V   + TD D G N ++         Y  +QI    KR F ID +    TG I + + +D E +PY +   ++A+D       +T  +NI  IN  D  P I        V+ ++ + E  P  T +A + V+D+D+ +        D+ + F +  + +        +F++ T  PLD E  +   +KI    SD  K  PL  +  + I + D NDN PVFT        +EN P  T   +  I   D D G+NA ++Y +  +  +     F +D  +G +++ + +D EK   ++F +IA D    +L +   + + V+D NDN+P F    Y+F V EN+P+   +G I  TD D+  EN +V     S  N      +D  +G ++     DRE+  S T  + A ++ S Q      S   V I +EDVNDN P+F
Sbjct:  115 CSGIFTENKCFYEVEVAVLPDEVFRLVKIRFLIEDINDNSPLF-PSTVINISIPENTAVNSRYSVPSAIDPDVGVNGIQHYELLK------GQNVFGLDVIETPEGDKWPQLIVQQSLDREQKDTYVMKIKVEDGGNPARS--STAILQVTVTDVNDNRPVFKEKDIEVNIPEDAAVGTSVTQLHATDADLGSNAKIHF-------YFGNQITNLAKRHFAIDNN----TGLITVKEPLDREESPY-HKLTVLASDGSSTPSRATVTINITDIN--DNIPSIDTRYIINPVNGTVQLSEKAPLNTKIALITVTDKDADLNGKVTCFTDHDVPFRLKPVFD-------NQFLLETAAPLDYESTREYAIKI--VASDSGK-PPLNQSAMLLIKIKDENDNAPVFTLPMIGLSFVENNPPGT--ELTKISATDADSGRNAELSYMLGPNAPT----IFNLDRRTGILTAVRKLDREKQDRYTFTVIAKDNGNPSLQTNTTVTLSVLDQNDNSPSFTHNEYNFYVPENLPMYGTVGLITVTDADSG-ENAVVTL---SLVNARDNFIIDPLTGVIRPNITFDREQQGSYTFQVKALDKGSPQKS----STVKVTIFVEDVNDNKPVF 691          

HSP 2 Score: 115.546 bits (288), Expect = 2.050e-25
Identity = 142/520 (27.31%), Postives = 235/520 (45.19%), Query Frame = 2
Query:  392 VFSFQVDSG---IKISSFYILIKVLDENDNSPKFLPFLNPYQTLPENSQINTVI--LLPSAIDLDSEA-----FGIKYYKISKP-FLIGNDSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFY------TANIVEHSKLVNVISFY-VTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITAINEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQ-ATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIF--PKPHYSF 1888
            V   +V+ G    + S+  + + V D NDN P F    +    +PE++ + T +  L  +  DL S A     FG +   ++K  F I N++    + +            PLDRE    ++  + A D  +   R      V I + DINDN P  D  +       T  + E + L   I+   VTD D   N +V+   + +  ++   +K  F   F   L T +      +DYE+   +Y+  ++A+D+G P L+ +A + I + ++ND APV  +   G      ++  EN P  T +  +  +D DS   + E S   Y L      I  +      +  I+  ++ LDRE  K       +   D    + L TN T+ +++ D NDN P FT ++Y   + EN+P   TV +I      D D G+NA VT  + +++++     F ID  +G I    + D E+   ++F + A+DK     SST  + + V D NDN P+F  P  +YS+
Sbjct:  234 VMKIKVEDGGNPARSSTAILQVTVTDVNDNRPVFKE-KDIEVNIPEDAAVGTSVTQLHATDADLGSNAKIHFYFGNQITNLAKRHFAIDNNTGLITVKE------------PLDREESPYHKLTVLASDGSSTPSR----ATVTINITDINDNIPSIDTRYIINPVNGTVQLSEKAPLNTKIALITVTDKDADLNGKVTCFTDHDVPFR---LKPVFDNQFL--LETAA-----PLDYEST-REYAIKIVASDSGKPPLNQSAMLLIKIKDENDNAPVFTLPMIG------LSFVENNPPGTELTKISATDADS-GRNAELS---YMLGPNAPTIFNLD----RRTGILTAVRKLDRE--KQDRYTFTVIAKDNGNPS-LQTNTTVTLSVLDQNDNSPSFTHNEYNFYVPENLPMYGTVGLIT---VTDADSGENAVVTLSLVNARDN-----FIIDPLTGVIRPNITFDREQQGSYTFQVKALDKGSPQKSSTVKVTIFVEDVNDNKPVFVIPSNNYSY 700          

HSP 3 Score: 87.8113 bits (216), Expect = 7.206e-17
Identity = 75/278 (26.98%), Postives = 128/278 (46.04%), Query Frame = 2
Query: 1400 LDREDDKNQYLKINIYCSDQDKLTPLTTNLTI-HINLFDINDNPPVFTRSKYQGELIENIPQ--ATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAP------IFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIFSL 2206
            LDRE      +KI +    +D   P  ++  I  + + D+NDN PVF     +     NIP+  A    +  +   D D G NA + +   +   +    +F ID ++G I+ ++ +D E++      ++A   D S+  S A + +++ D NDN P      I    + +  + E  P+NT+I  I  TD D     K+  +    +   +++  V  N   L+T  P+D E  R   I I A +      K  ++   M++I I+D NDN P+F+L
Sbjct:  225 LDREQKDTYVMKIKV----EDGGNPARSSTAILQVTVTDVNDNRPVFKEKDIE----VNIPEDAAVGTSVTQLHATDADLGSNAKIHFYFGNQITNLAKRHFAIDNNTGLITVKEPLDREESPYHKLTVLA--SDGSSTPSRATVTINITDINDNIPSIDTRYIINPVNGTVQLSEKAPLNTKIALITVTDKDADLNGKVTCF--TDHDVPFRLKPVFDNQFLLETAAPLDYESTREYAIKIVASDSG----KPPLNQSAMLLIKIKDENDNAPVFTL 486          
BLAST of Protocadherin Fat 1 vs. Ensembl Xenopus
Match: ENSXETT00000047798.1 (protocadherin 11 X-linked [Source:NCBI gene;Acc:100493938])

HSP 1 Score: 192.586 bits (488), Expect = 1.904e-49
Identity = 182/624 (29.17%), Postives = 292/624 (46.79%), Query Frame = 2
Query:  383 CCTVFS-----FQVDSGIKISSFYILIKVL----DENDNSPKFLPFLNPYQTLPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIASGR----PQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKL-VNVISFYVTDLDEGQNKQVSITIETENDYKKDQI----KRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITAINEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIF 2200
            C  +F+     ++V+  +     + L+K+     D NDNSP F P      ++PEN+ +N+   +PSAID D    GI++Y++ K        +   LD I +      PQL++   LDRE    Y   +K  D  N      S   +++ V D+NDN PVF +     NI E + +  +V   + TD D G N ++         Y  +QI    KR F ID +    TG I + + +D E +PY +   ++A+D       +T  +NI  IN  D  P I        V+ ++ + E  P  T +A + V+D+D+ +        D+ + F +  + +        +F++ T  PLD E  +   +KI    SD  K  PL  +  + I + D NDN PVFT        +EN P  T   +  I   D D G+NA ++Y +  +  +     F +D  +G +++ + +D EK   ++F +IA D    +L +   + + V+D NDN+P F    Y+F V EN+P+   +G I  TD D+  EN +V     S  N      +D  +G ++     DRE+  S T  + A ++ S Q      S   V I +EDVNDN P+F
Sbjct:   95 CSGIFTENKCFYEVEVAVLPDEVFRLVKIRFLIEDINDNSPLF-PSTVINISIPENTAVNSRYSVPSAIDPDVGVNGIQHYELLK------GQNVFGLDVIETPEGDKWPQLIVQQSLDREQKDTYVMKIKVEDGGNPARS--STAILQVTVTDVNDNRPVFKEKDIEVNIPEDAAVGTSVTQLHATDADLGSNAKIHF-------YFGNQITNLAKRHFAIDNN----TGLITVKEPLDREESPY-HKLTVLASDGSSTPSRATVTINITDIN--DNIPSIDTRYIINPVNGTVQLSEKAPLNTKIALITVTDKDADLNGKVTCFTDHDVPFRLKPVFD-------NQFLLETAAPLDYESTREYAIKI--VASDSGK-PPLNQSAMLLIKIKDENDNAPVFTLPMIGLSFVENNPPGT--ELTKISATDADSGRNAELSYMLGPNAPT----IFNLDRRTGILTAVRKLDREKQDRYTFTVIAKDNGNPSLQTNTTVTLSVLDQNDNSPSFTHNEYNFYVPENLPMYGTVGLITVTDADSG-ENAVVTL---SLVNARDNFIIDPLTGVIRPNITFDREQQGSYTFQVKALDKGSPQKS----STVKVTIFVEDVNDNKPVF 671          

HSP 2 Score: 115.546 bits (288), Expect = 2.014e-25
Identity = 142/520 (27.31%), Postives = 235/520 (45.19%), Query Frame = 2
Query:  392 VFSFQVDSG---IKISSFYILIKVLDENDNSPKFLPFLNPYQTLPENSQINTVI--LLPSAIDLDSEA-----FGIKYYKISKP-FLIGNDSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFY------TANIVEHSKLVNVISFY-VTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITAINEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQ-ATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIF--PKPHYSF 1888
            V   +V+ G    + S+  + + V D NDN P F    +    +PE++ + T +  L  +  DL S A     FG +   ++K  F I N++    + +            PLDRE    ++  + A D  +   R      V I + DINDN P  D  +       T  + E + L   I+   VTD D   N +V+   + +  ++   +K  F   F   L T +      +DYE+   +Y+  ++A+D+G P L+ +A + I + ++ND APV  +   G      ++  EN P  T +  +  +D DS   + E S   Y L      I  +      +  I+  ++ LDRE  K       +   D    + L TN T+ +++ D NDN P FT ++Y   + EN+P   TV +I      D D G+NA VT  + +++++     F ID  +G I    + D E+   ++F + A+DK     SST  + + V D NDN P+F  P  +YS+
Sbjct:  214 VMKIKVEDGGNPARSSTAILQVTVTDVNDNRPVFKE-KDIEVNIPEDAAVGTSVTQLHATDADLGSNAKIHFYFGNQITNLAKRHFAIDNNTGLITVKE------------PLDREESPYHKLTVLASDGSSTPSR----ATVTINITDINDNIPSIDTRYIINPVNGTVQLSEKAPLNTKIALITVTDKDADLNGKVTCFTDHDVPFR---LKPVFDNQFL--LETAA-----PLDYEST-REYAIKIVASDSGKPPLNQSAMLLIKIKDENDNAPVFTLPMIG------LSFVENNPPGTELTKISATDADS-GRNAELS---YMLGPNAPTIFNLD----RRTGILTAVRKLDRE--KQDRYTFTVIAKDNGNPS-LQTNTTVTLSVLDQNDNSPSFTHNEYNFYVPENLPMYGTVGLIT---VTDADSGENAVVTLSLVNARDN-----FIIDPLTGVIRPNITFDREQQGSYTFQVKALDKGSPQKSSTVKVTIFVEDVNDNKPVFVIPSNNYSY 680          

HSP 3 Score: 87.4261 bits (215), Expect = 8.820e-17
Identity = 75/278 (26.98%), Postives = 128/278 (46.04%), Query Frame = 2
Query: 1400 LDREDDKNQYLKINIYCSDQDKLTPLTTNLTI-HINLFDINDNPPVFTRSKYQGELIENIPQ--ATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAP------IFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIFSL 2206
            LDRE      +KI +    +D   P  ++  I  + + D+NDN PVF     +     NIP+  A    +  +   D D G NA + +   +   +    +F ID ++G I+ ++ +D E++      ++A   D S+  S A + +++ D NDN P      I    + +  + E  P+NT+I  I  TD D     K+  +    +   +++  V  N   L+T  P+D E  R   I I A +      K  ++   M++I I+D NDN P+F+L
Sbjct:  205 LDREQKDTYVMKIKV----EDGGNPARSSTAILQVTVTDVNDNRPVFKEKDIE----VNIPEDAAVGTSVTQLHATDADLGSNAKIHFYFGNQITNLAKRHFAIDNNTGLITVKEPLDREESPYHKLTVLA--SDGSSTPSRATVTINITDINDNIPSIDTRYIINPVNGTVQLSEKAPLNTKIALITVTDKDADLNGKVTCF--TDHDVPFRLKPVFDNQFLLETAAPLDYESTREYAIKIVASDSG----KPPLNQSAMLLIKIKDENDNAPVFTL 466          
BLAST of Protocadherin Fat 1 vs. Ensembl Xenopus
Match: ENSXETT00000047804.1 (protocadherin 11 X-linked [Source:NCBI gene;Acc:100493938])

HSP 1 Score: 192.586 bits (488), Expect = 1.908e-49
Identity = 182/624 (29.17%), Postives = 292/624 (46.79%), Query Frame = 2
Query:  383 CCTVFS-----FQVDSGIKISSFYILIKVL----DENDNSPKFLPFLNPYQTLPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIASGR----PQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKL-VNVISFYVTDLDEGQNKQVSITIETENDYKKDQI----KRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITAINEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIF 2200
            C  +F+     ++V+  +     + L+K+     D NDNSP F P      ++PEN+ +N+   +PSAID D    GI++Y++ K        +   LD I +      PQL++   LDRE    Y   +K  D  N      S   +++ V D+NDN PVF +     NI E + +  +V   + TD D G N ++         Y  +QI    KR F ID +    TG I + + +D E +PY +   ++A+D       +T  +NI  IN  D  P I        V+ ++ + E  P  T +A + V+D+D+ +        D+ + F +  + +        +F++ T  PLD E  +   +KI    SD  K  PL  +  + I + D NDN PVFT        +EN P  T   +  I   D D G+NA ++Y +  +  +     F +D  +G +++ + +D EK   ++F +IA D    +L +   + + V+D NDN+P F    Y+F V EN+P+   +G I  TD D+  EN +V     S  N      +D  +G ++     DRE+  S T  + A ++ S Q      S   V I +EDVNDN P+F
Sbjct:  115 CSGIFTENKCFYEVEVAVLPDEVFRLVKIRFLIEDINDNSPLF-PSTVINISIPENTAVNSRYSVPSAIDPDVGVNGIQHYELLK------GQNVFGLDVIETPEGDKWPQLIVQQSLDREQKDTYVMKIKVEDGGNPARS--STAILQVTVTDVNDNRPVFKEKDIEVNIPEDAAVGTSVTQLHATDADLGSNAKIHF-------YFGNQITNLAKRHFAIDNN----TGLITVKEPLDREESPY-HKLTVLASDGSSTPSRATVTINITDIN--DNIPSIDTRYIINPVNGTVQLSEKAPLNTKIALITVTDKDADLNGKVTCFTDHDVPFRLKPVFD-------NQFLLETAAPLDYESTREYAIKI--VASDSGK-PPLNQSAMLLIKIKDENDNAPVFTLPMIGLSFVENNPPGT--ELTKISATDADSGRNAELSYMLGPNAPT----IFNLDRRTGILTAVRKLDREKQDRYTFTVIAKDNGNPSLQTNTTVTLSVLDQNDNSPSFTHNEYNFYVPENLPMYGTVGLITVTDADSG-ENAVVTL---SLVNARDNFIIDPLTGVIRPNITFDREQQGSYTFQVKALDKGSPQKS----STVKVTIFVEDVNDNKPVF 691          

HSP 2 Score: 115.161 bits (287), Expect = 2.345e-25
Identity = 142/520 (27.31%), Postives = 235/520 (45.19%), Query Frame = 2
Query:  392 VFSFQVDSG---IKISSFYILIKVLDENDNSPKFLPFLNPYQTLPENSQINTVI--LLPSAIDLDSEA-----FGIKYYKISKP-FLIGNDSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFY------TANIVEHSKLVNVISFY-VTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITAINEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQ-ATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIF--PKPHYSF 1888
            V   +V+ G    + S+  + + V D NDN P F    +    +PE++ + T +  L  +  DL S A     FG +   ++K  F I N++    + +            PLDRE    ++  + A D  +   R      V I + DINDN P  D  +       T  + E + L   I+   VTD D   N +V+   + +  ++   +K  F   F   L T +      +DYE+   +Y+  ++A+D+G P L+ +A + I + ++ND APV  +   G      ++  EN P  T +  +  +D DS   + E S   Y L      I  +      +  I+  ++ LDRE  K       +   D    + L TN T+ +++ D NDN P FT ++Y   + EN+P   TV +I      D D G+NA VT  + +++++     F ID  +G I    + D E+   ++F + A+DK     SST  + + V D NDN P+F  P  +YS+
Sbjct:  234 VMKIKVEDGGNPARSSTAILQVTVTDVNDNRPVFKE-KDIEVNIPEDAAVGTSVTQLHATDADLGSNAKIHFYFGNQITNLAKRHFAIDNNTGLITVKE------------PLDREESPYHKLTVLASDGSSTPSR----ATVTINITDINDNIPSIDTRYIINPVNGTVQLSEKAPLNTKIALITVTDKDADLNGKVTCFTDHDVPFR---LKPVFDNQFL--LETAA-----PLDYEST-REYAIKIVASDSGKPPLNQSAMLLIKIKDENDNAPVFTLPMIG------LSFVENNPPGTELTKISATDADS-GRNAELS---YMLGPNAPTIFNLD----RRTGILTAVRKLDRE--KQDRYTFTVIAKDNGNPS-LQTNTTVTLSVLDQNDNSPSFTHNEYNFYVPENLPMYGTVGLIT---VTDADSGENAVVTLSLVNARDN-----FIIDPLTGVIRPNITFDREQQGSYTFQVKALDKGSPQKSSTVKVTIFVEDVNDNKPVFVIPSNNYSY 700          

HSP 3 Score: 87.8113 bits (216), Expect = 7.182e-17
Identity = 75/278 (26.98%), Postives = 128/278 (46.04%), Query Frame = 2
Query: 1400 LDREDDKNQYLKINIYCSDQDKLTPLTTNLTI-HINLFDINDNPPVFTRSKYQGELIENIPQ--ATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAP------IFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIFSL 2206
            LDRE      +KI +    +D   P  ++  I  + + D+NDN PVF     +     NIP+  A    +  +   D D G NA + +   +   +    +F ID ++G I+ ++ +D E++      ++A   D S+  S A + +++ D NDN P      I    + +  + E  P+NT+I  I  TD D     K+  +    +   +++  V  N   L+T  P+D E  R   I I A +      K  ++   M++I I+D NDN P+F+L
Sbjct:  225 LDREQKDTYVMKIKV----EDGGNPARSSTAILQVTVTDVNDNRPVFKEKDIE----VNIPEDAAVGTSVTQLHATDADLGSNAKIHFYFGNQITNLAKRHFAIDNNTGLITVKEPLDREESPYHKLTVLA--SDGSSTPSRATVTINITDINDNIPSIDTRYIINPVNGTVQLSEKAPLNTKIALITVTDKDADLNGKVTCF--TDHDVPFRLKPVFDNQFLLETAAPLDYESTREYAIKIVASDSG----KPPLNQSAMLLIKIKDENDNAPVFTL 486          
BLAST of Protocadherin Fat 1 vs. Ensembl Xenopus
Match: ENSXETT00000027730.1 (uncharacterized LOC100145174 [Source:Xenbase;Acc:XB-GENE-5789558])

HSP 1 Score: 187.963 bits (476), Expect = 3.584e-48
Identity = 177/624 (28.37%), Postives = 304/624 (48.72%), Query Frame = 2
Query:  215 VTEKASPFSLIDNRLSVVSNIDRESICPIKNSLNDYDQSAETYNSQQSSHSCKYDECCTVFSFQVDSGIKISSFYILIKVLDENDNSPKFLPFLNPYQTLPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIAS-GR--PQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKL-VNVISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITAINEIHPLGHYKEFI-INTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIE-NIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNS--TDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAP--IFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIH--VDQNSGKLKT 2050
            ++EK    +L +  L+V   ID+E++C  +                        +EC   F   +++ + I  F++ + + D NDN P+F+   N ++ + E++      +L +A DLD     I  YK+S       + HF L +K ++ GR  P+L+L + LDRE  S +  IL A D  N      +   ++I V D NDN PVF +  Y  NI E+  +  +++    +D DEG N Q++ +  T        + R F I+  P+   G I+ +  +D+E   Y Y  ++ A D+G   L + AKV I +I++ND AP I V       S +  + E+    T+VA ++  D D        S ++  ++ EI  +     +     F  I T   LDRE  ++ +  I I  +D+    PL+   TI +++ DINDNPPVF +S Y   + E N P A++  I+ I   DKD  +N  + Y I +S     +   Y +I+  +G I +++S DYE+++ F   I+A D     L+S+A++ + V+D NDN+P  ++P P       E VP ++E G + T  +    ++    +    +  + +  H  +DQ +G+++T
Sbjct:   69 LSEKYFSINLGNGNLNVADRIDKEALCGAR------------------------EECFLTFDAVIENPLNI--FHVRVDIKDINDNPPRFIHDTNEFE-ISEHTSPGARFILQNAEDLDVGMNSIVTYKLSA------NKHFVLGEKKSTNGRTFPELILQTSLDRETQSNHELILTASDGGNPVQTGTT--LIKIIVTDFNDNFPVFTQEVYKVNIHENIPINSSILHVNASDKDEGINAQITYSFST----AATNVLRMFTIN--PN--NGEIKTVGNVDFEEEKY-YDISVQAKDSG--GLVANAKVLIEIIDENDNAPEISV------TSITTPISEDSAPGTVVALIKAHDLD--------SGENGEVDCEIIGVAPFKLMSSSGNFYKIVTTSTLDRE--RSSHYNITIQATDKGS-PPLSFRKTIRLDVLDINDNPPVFVKSTYIAYIPENNQPGASIYSIQAI---DKDTEENGKLFYSIITSNTEEISSTSYISINPVTGVIYAQRSFDYEQDREFEIQIVAKDSGSPPLNSSAIVRICVVDQNDNSPSVLYPSPDVGSAAYEMVPFSSEQGTLVTKVVAVDADSGHNAWLSYHFLQDSETSHFIIDQYTGEIRT 626          

HSP 2 Score: 90.1225 bits (222), Expect = 1.383e-17
Identity = 131/492 (26.63%), Postives = 198/492 (40.24%), Query Frame = 2
Query:  782 EVEIKVGDINDNPPVFDKTFYTANIVEH-SKLVNVISFYVTDLDEGQNKQVSITIETENDY----KKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITAINEIHPLGHYKEFIIN-------TLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSG---KISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQ------VIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPP 2194
             V + + DINDNPP F        I EH S     I     DLD G N  V+  +     +    KK    R F     P L+     L   +D ET    +   L A+D G P  + T  + II+ + ND  PV       E+    + + EN P  + +  +  SD+D              +N +IT           + F IN       T+  +D E++K  Y  I++   D   L     N  + I + D NDN P  + +     + E+    TV  +  I   D D G+N  V  +I           F + + SG   KI +  ++D E++  ++  I A DK    LS    I + V+D NDN P+F K  Y   + EN      I  I+  D DT    K+   F+   T+N +       I ++  +G +      D E+ R   I I A++  S      ++S  +V I + D NDN P
Sbjct:  117 HVRVDIKDINDNPPRFIHDTNEFEISEHTSPGARFILQNAEDLDVGMNSIVTYKLSANKHFVLGEKKSTNGRTF-----PELI-----LQTSLDRETQS-NHELILTASDGGNPVQTGTTLIKIIVTDFNDNFPVFT----QEV--YKVNIHENIPINSSILHVNASDKDE------------GINAQITYSFSTAATNVLRMFTINPNNGEIKTVGNVDFEEEK--YYDISVQAKDSGGLV---ANAKVLIEIIDENDNAPEISVTSITTPISEDSAPGTVVAL--IKAHDLDSGENGEVDCEI------IGVAPFKLMSSSGNFYKIVTTSTLDRERSSHYNITIQATDKGSPPLSFRKTIRLDVLDINDNPPVFVKSTYIAYIPENNQPGASIYSIQAIDKDTEENGKL---FYSIITSNTEEISSTSYISINPVTGVIYAQRSFDYEQDREFEIQIVAKDSGSPP----LNSSAIVRICVVDQNDNSP 559          

HSP 3 Score: 88.1965 bits (217), Expect = 5.189e-17
Identity = 88/354 (24.86%), Postives = 163/354 (46.05%), Query Frame = 2
Query: 1493 IHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADS-GKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIFSLINPAKSSLIFTINKGFRHENCQMIPYAVSDADHDEPNSDSCCILQLDNDQNGMLYLLSNTPNFLCLQNT----MNTPGIYRVSLTATDNKNNPNKSLKAKVSFNIDVRHEVSDNP 2539
            + +++ DINDNPP F     + E+ E+       +++     D D G N+ VTYK+ ++K+    E  + +  +  ++  + S+D E        + A D      + T LI + V D NDN P+F +  Y   + EN+P+N+ I  +  +D D     +I   F  + TN  ++  ++ N+G++KT+G +D E+ +   I + A++         + +   V+I I D NDN P  S+     +S+   I++         +  A  D D  E     C I+ +         L+S++ NF  +  T          Y +++ ATD K +P  S +  +  ++    +++DNP
Sbjct:  118 VRVDIKDINDNPPRFIHDTNEFEISEHTSPGARFILQN--AEDLDVGMNSIVTYKLSANKHFVLGEKKSTNGRTFPELILQTSLDRETQSNHELILTASDGGNPVQTGTTLIKIIVTDFNDNFPVFTQEVYKVNIHENIPINSSILHVNASDKDEGINAQITYSFSTAATNVLRMFTINPNNGEIKTVGNVDFEEEKYYDISVQAKDSGG------LVANAKVLIEIIDENDNAPEISV-----TSITTPISEDSAPGTVVALIKA-HDLDSGENGEVDCEIIGV-----APFKLMSSSGNFYKIVTTSTLDRERSSHYNITIQATD-KGSPPLSFRKTIRLDV---LDINDNP 448          
BLAST of Protocadherin Fat 1 vs. Ensembl Mouse
Match: Fat4 (FAT atypical cadherin 4 [Source:MGI Symbol;Acc:MGI:3045256])

HSP 1 Score: 192.586 bits (488), Expect = 6.091e-49
Identity = 181/610 (29.67%), Postives = 284/610 (46.56%), Query Frame = 2
Query:  440 ILIKVLDENDNSPKFLPFLNPYQTLPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKI--ASGRPQLL-LIS--PLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKL-VNVISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIECSL------DDYHLNFEITAINEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLT--------TNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKI--SSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPH-YSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIF 2200
            + + V D NDN+P F P  +   T  E+S     ++L +A D D  + G+ ++  S   + GN++    LD     SG    L L+S   LDREV  +Y+ +++  D+     R    ++V + V DINDNPPVF  + Y A + E + +  +V+     D DEG N  +   ++ E           FQ+D      TG I + + +D+E    +YS  + ATD G+P L+  A+  I L++ ND  PV+K  R     SR  ++ EN    T+VA L V+D DS   +   S+      +  H   + + +  +         +I     LDRE   +  L +++  SD     P           +L I +N  DIND+PPVF +  Y+  L E +P  +   +  +   D D G NA + Y I  S N   W  F I   SG +  S+   +D E       NI A D+      S A ++V V+D ND  P+F +P  Y  +V EN P  TE+  +  TD D   +N  V++  +   N+ ++  +D  SG+L T   +DRE+     + I A +  S        S   V +++ D+NDN P+F
Sbjct:  121 VRVLVRDLNDNAPVF-PDPSIVVTFKEDSGSGRQVILDTATDSDIGSNGVDHH--SYRIVSGNEAGRFRLDITLNPSGEGAFLHLVSKGGLDREVTPQYQLLVEVEDKGEPKRRGY--LQVNVTVQDINDNPPVFGSSHYQAGVPEDAVVGSSVLQVAAADADEGTNADIRYRLQDEGTP--------FQMDPE----TGLITVREPLDFEAR-RQYSLTVQATDRGVPSLTGRAEAFIQLLDVNDNDPVVK-FRYFPATSRYASVDENAQVGTVVALLTVTDADSPAANGNISVQILGGNEQRHFEVQRSKVPNLS--------LIKVASALDRERIPSYNLTVSV--SDNSGAPPTAEVQARSSVASLVIFVN--DINDHPPVFEQQVYRVNLSEEVPPGS--YVSGVSATDGDSGLNANLRYSI-VSGNGLGW--FHISEHSGLVTTSAAGGLDRELASQIVLNISARDQGVHPKVSYAQLVVTVLDVNDEKPVFSQPEGYEVSVVENAPTGTELLVLGATDRDLG-DNGTVRFSLQEAENDQRLFRLDPVSGRLSTASSLDREEQAFYCLSILATDLGSPPQS----STAQVNVSLLDINDNSPVF 689          

HSP 2 Score: 186.808 bits (473), Expect = 3.535e-47
Identity = 184/654 (28.13%), Postives = 294/654 (44.95%), Query Frame = 2
Query:  440 ILIKVLDENDNSPKFLPFLNPYQTLPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKLVNVIS-FYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITAINEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKI-DSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIFSLINPAKSSLIFTINKGFRHENCQMIPYA----VSDADHDEPNSDSCCILQLDNDQNGMLYLLSN 2383
            + I + D NDN P F P      T+ EN    + I+  +A+D D  A  +  Y +    + G D  F    +I      L+    LDRE  S+Y  +++A     DD    S + + I + D+ND+ P F +  Y+ +I E +   ++++    TD D G N ++S  +E     + D    FF      +L+TG   L   +DYET  Y Y   + A D G    S+T +    +++ ND  PV        + S S ++ EN P  + V    V+D D  V        +  L++ I + + +      K  ++ TLK LDRE      L I ++   Q   +  T+   + I L D+NDNPP+F   K    + EN P  TV  +      D D G N+Y+ Y + + S N      F+I    G++     +D E+   +S  ++A DK Q  LSS+  ++V V+D NDN P+F +  Y   ++EN+   T+I Q+   D D    N  V+Y      N +Q   +D  +G +     +DRE   + T+ + A +  S    +     C V IT+ D+ND  P+F L +P      +++N     EN   +P A    V+  D   PNS    +L   N+ N  +   S 
Sbjct: 1726 VEITLQDINDNPPVF-PTDTLDLTVEENIGDGSKIMQLTAMDADEGANALVTYAL----ISGADDSF----RIDPESGDLIATKRLDREHRSKYSLLVRA-----DDGLQSSDMRINITISDVNDHTPRFSRPVYSFDIPEDTTPGSLVAAILATDDDSGVNGEISYVVE-----EDDGDGVFFL-----NLVTGVFNLTRALDYETQQY-YILTVRAEDGG--GQSTTIRAYFNILDVNDNPPVFS------MSSYSTSLMENLPLGSTVLVFNVTDADDGV--------NSQLSYSIASGDSLGQFAVDKHGVLKTLKALDRESQSFYNLVIQVHDLPQPPTSRFTSTAQVSIILLDVNDNPPMFLSPKLT-YIPENTPIDTV--VFKAQATDPDSGPNSYIEYTLLNPSGNK-----FSIGTIDGEVHLTGELDREEVSNYSLTVVATDKGQPPLSSSTEVVVMVLDINDNNPVFAQAMYRVQIKENILTGTDIIQVSAADND-EGTNGQVRYGIVG-GNTHQEFRIDSVTGAITVAKSLDRETTPAYTLTVQATDRGSSPRTD----SCTVAITLLDMNDFVPVFEL-SP------YSVNV---PENLGTLPRAILQVVARDDDQGPNSQLSYVLLGGNEDNAFVLTASG 2314          

HSP 3 Score: 176.022 bits (445), Expect = 7.727e-44
Identity = 169/603 (28.03%), Postives = 273/603 (45.27%), Query Frame = 2
Query:  443 LIKVLDENDNSP----KFLPFLNPYQTLPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDS-HFTLLDKIASGRPQLLLI---SPLDREVISEYRFILKAVDREN-----DDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKLVNVIS-FYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTD---IECSLDDYHLNFEITAINEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIF 2200
             I++LD NDN P    ++ P  + Y ++ EN+Q+ TV+ L +  D DS A       IS   L GN+  HF +     S  P L LI   S LDRE I  Y   +   D        +     S   + I V DIND+PPVF++  Y  N+ E     + +S    TD D G N  +  +I + N         +F I     L+T S      +D E    +   N+ A D G+    S A++ + +++ ND+ PV       E+     ++ EN P  T +  L  +DRD  + D   +  SL +   +  +  ++ +          ++T   LDRE+    +  ++I  +D     P ++   ++++L DINDN PVF   +Y   + EN P  +   +  +   D D G N  V Y I +     D   F I A SG IS++ ++D E+   +   ++A D       + A++ V V+D  DN P+F +  YSF V ENV +   +G +  T +D    N  + Y   +  +   +  ++  +G+L T   IDRE+     + I A   A       +  + +V IT++D+NDN P F
Sbjct:  340 FIQLLDVNDNDPVVKFRYFPATSRYASVDENAQVGTVVALLTVTDADSPA---ANGNISVQILGGNEQRHFEVQ---RSKVPNLSLIKVASALDRERIPSYNLTVSVSDNSGAPPTAEVQARSSVASLVIFVNDINDHPPVFEQQVYRVNLSEEVPPGSYVSGVSATDGDSGLNANLRYSIVSGNGLG------WFHISEHSGLVTTSA--AGGLDREL-ASQIVLNISARDQGVHPKVSYAQLVVTVLDVNDEKPVFSQPEGYEV-----SVVENAPTGTELLVLGATDRD--LGDNGTVRFSLQEAENDQRLFRLDPVSGR-------LSTASSLDREEQA--FYCLSILATDLGS-PPQSSTAQVNVSLLDINDNSPVFYPVQYFAHIQENEPGGS--YVTTVSATDPDMGPNGTVKYSISAG----DRSRFQIHAKSGVISTKMALDREEKTAYQLQVVATDGGNLQSPNQAIVTVTVLDTQDNPPVFSQAAYSFVVFENVALGYHVGSVSATTMDL---NANISYLITT-GDQRGMFAMNPVTGQLTTASVIDREEQSFYQLKIVASGGA-------VTGDTVVNITVKDLNDNAPHF 893          

HSP 4 Score: 162.155 bits (409), Expect = 1.326e-39
Identity = 164/611 (26.84%), Postives = 284/611 (46.48%), Query Frame = 2
Query:  404 QVDSGIKISSFYILIKVLDENDNSPKFLPFLNPYQTLPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKLVN-VISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLP-----RLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMF-ENEPARTIVASLQVSDRDSLVTD-IECSLDDYHLN-FEITAI-NEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVP-VNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIFS 2203
            + D G++ S   I I + D ND++P+F   +  +  +PE++   +++    A D DS   G   Y + +     +D        + +G     L   LD E    Y   ++A D         + +     + D+NDNPPVF  + Y+ +++E+  L + V+ F VTD D+G N Q+S +I + +   +      F +D       G ++ +  +D E+  +   +NL+   + LP     R +STA+V+IIL++ ND  P+         +S  +T   EN P  T+V   Q +D DS     IE +L +   N F I  I  E+H  G            LDRE+  N  L   +  +D+ +  PL+++  + + + DINDN PVF ++ Y+ ++ ENI   T  +I+ +   D D G N  V Y I       +   F ID+ +G I+  +S+D E    ++  + A D+  S  + +  + + ++D ND  P+F    YS  V EN+  +   I Q+   D D  P +++         +N  V+     SG+L+    +DRE      +++TA +  S      +     + I ++D+NDN P F+
Sbjct: 1815 RADDGLQSSDMRINITISDVNDHTPRFSRPVYSFD-IPEDTTPGSLVAAILATDDDSGVNGEISYVVEE-----DDGDGVFFLNLVTG--VFNLTRALDYETQQYYILTVRAEDGGGQS----TTIRAYFNILDVNDNPPVFSMSSYSTSLMENLPLGSTVLVFNVTDADDGVNSQLSYSIASGDSLGQ------FAVD-----KHGVLKTLKALDRESQSF---YNLVIQVHDLPQPPTSRFTSTAQVSIILLDVNDNPPM--------FLSPKLTYIPENTPIDTVVFKAQATDPDSGPNSYIEYTLLNPSGNKFSIGTIDGEVHLTGE-----------LDREEVSNYSL--TVVATDKGQ-PPLSSSTEVVVMVLDINDNNPVFAQAMYRVQIKENILTGT-DIIQ-VSAADNDEGTNGQVRYGIVGGNTHQE---FRIDSVTGAITVAKSLDRETTPAYTLTVQATDRGSSPRTDSCTVAITLLDMNDFVPVFELSPYSVNVPENLGTLPRAILQVVARDDDQGPNSQLSYVLLGGNEDNAFVLTA---SGELRVTQSLDREARDHFVLVVTAADAGS----PALTGTGTINIIVDDINDNVPTFA 2365          

HSP 5 Score: 144.436 bits (363), Expect = 3.619e-34
Identity = 158/608 (25.99%), Postives = 259/608 (42.60%), Query Frame = 2
Query:  407 VDSGIKISSFYIL-IKVLDENDNSPKFLPFLNPYQTLPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKLVNVISFYV--TDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMF--ENEPARTIVASLQVSDRD-SLVTDIECSLDDYHLNFEITAINEIHPLGHYKEFIINTLKPLDRED----DKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIF 2200
            V SG  ++   ++ I V D NDN+P FL  +     + EN Q    I    A+D D    G   Y + +       + FT+ ++  +    + L+  LD    S Y+  + A D         S + + + V D+NDNPPVFD+  Y   + E S+ VN   F V  +D D G N +++ TI   N+     I              G + +  E+D E    +Y   ++A+D  +  LS+T  V ++L + ND  P+          S + T +  E + A + V  +   D+D     ++  + +    NFE+ A+      G      I +    DRE              +   D+    PL    T+H+ + DINDN P F +  YQ  + E     T   +  +   D D G N  + Y I       +   F ID+ SG+++    +DYE    +S  I A+D     L+ST  + + ++D NDN P FPK      V EN+ +   +  +  TD D+     +  ++  + +NN+    +  N+G +     +D E      + ITA++    Q +    S   V+I + D NDNPP F
Sbjct:  867 VASGGAVTGDTVVNITVKDLNDNAPHFLQAVESINAV-ENWQAGHSIFQAKAVDPDEGVNGRVLYSLKQ----NPKNLFTINEQNGN----ISLLGALDVHAGS-YQVEIVASDMGVPQLS--SSILLTVYVHDVNDNPPVFDQISYEVTLSE-SEPVNSRFFKVQASDKDSGANGEIAYTITDGNNGDAFGI-----------FPDGQLYIKSELDRELQD-RYVLLVVASDRAVEPLSATVNVTVLLEDVNDNRPLFN--------STNYTFYFEEEQRAGSFVGKVSAVDKDFGPNGEVRYAFEVTQPNFELHAVT-----GE-----ITSTHKFDRESLMRRRGTAVFSFTVTAMDRGLPQPLKDQATVHVYMKDINDNAPKFLKDFYQATVSETATNLT--QVLRVSASDVDEGSNGLIHYSI---LKGNEERQFAIDSFSGQVTLVGKLDYEATSAYSLLIQAVDSGAIPLNSTCTLSIDILDENDNTPSFPKSTLFVDVLENMRIGELVSSVTATDSDSGVNADL--HYTITGSNNHGTFSISPNTGSIFLAKKLDFETQSLYKLNITAKD----QGRPPRSSTMSVVIQVRDFNDNPPSF 1420          

HSP 6 Score: 141.354 bits (355), Expect = 3.159e-33
Identity = 168/671 (25.04%), Postives = 293/671 (43.67%), Query Frame = 2
Query:  422 KISSFYILIKVLDENDNSPKFLPFLNPYQTLPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDREND-DHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKLVNVI--SFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLI--ATDNGLPRLSSTAKVNIILINKND----QAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITAINEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIFSLIN---------PAKSS-LIFTINKGFRHENCQMIPYAVSDADHDEPNSDSCCILQLDNDQNGMLYLL 2377
            + S+  ++I+V D NDN P F P  + ++++ EN  + T ++  +A D D++  G   Y I +    GN  HF++ D++   +  +   + +DRE  + +   +KA D+    + R  +   V I V D+NDN P+F      A   + S ++  +  +    D DEG N +V   I    D     + R+          +G +R+   +     P +  +NLI  ATD G  R  ST ++ +IL   +     Q   I ++++GE +  ++   E    R   A ++       +  + C         E   +  +  +G  +  +I T   LDRE     YL +++Y  ++    P T    + I L DINDNPPVF        + ENI   + K+++ +  +D D G NA VTY + S  + +    F ID +SG + + + +D E    +S  + A D  Q   SS   I + + D ND+ P F +P YSF + E+    + +  I  TD D+    +I     +   +   V  ++  +G       +D E  +   + + A +           +       I DVNDNPP+FS+ +         P  S+ L+F +       N Q+  Y+++  D          + Q   D++G+L  L
Sbjct: 1400 RSSTMSVVIQVRDFNDNPPSFPPG-DIFKSIVENIPLGTSVISVTAHDPDADINGQLSYAIIQQMPRGN--HFSI-DEV---KGTIYTSAEIDREFANLFELTVKANDQAVPIETRRYALKNVTILVTDLNDNVPMFISQ--NALAADPSAMIGSVLTTIMAADPDEGANGEVEYEI-LNGDTDTFTVDRY----------SGDLRVASAL----VPSQLIYNLIVSATDLGPERRKSTTELTVILQGLDGPVFTQTKYITILKEGEPIGTNVISIEAASPRGSEAPVEY-----YIVSVRC---------EEKTVGRLFTIGR-QTGVIQTAAILDREQGACLYL-VDVYAIEKSSAFPRTQRAEVEITLQDINDNPPVFPTDTLDLTVEENIGDGS-KIMQ-LTAMDADEGANALVTYALISGADDS----FRIDPESGDLIATKRLDREHRSKYSLLVRADDGLQ---SSDMRINITISDVNDHTPRFSRPVYSFDIPEDTTPGSLVAAILATDDDSGVNGEISYVVEED--DGDGVFFLNLVTGVFNLTRALDYETQQYYILTVRAEDGGG------QSTTIRAYFNILDVNDNPPVFSMSSYSTSLMENLPLGSTVLVFNVTDADDGVNSQL-SYSIASGD---------SLGQFAVDKHGVLKTL 2003          

HSP 7 Score: 140.969 bits (354), Expect = 4.912e-33
Identity = 152/608 (25.00%), Postives = 272/608 (44.74%), Query Frame = 2
Query:  440 ILIKVLDENDNSPKF---LPFLNPYQTLPENSQINTVILLPSAIDLDS-----------EAFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDK-TFYTANIVEHSKL-VNVISFYVTDLDEGQNKQVSITI-ETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITAINEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIFSLIN 2212
            ++I V D ND+ P F   +  +N  + +P  S ++ V    SA D DS              G+ ++ IS+        H  L+   A+G         LDRE+ S+   +L    R+   H  +S  ++ + V D+ND  PVF +   Y  ++VE++     ++    TD D G N  V  ++ E END      +R F++D     ++G +     +D E   + Y  +++ATD G P  SSTA+VN+ L++ ND +PV   ++    +       ENEP  + V ++  +D D           +  + + I+A +      H K  +I+T   LDRE+ K  Y ++ +  +D   L      + + + + D  DNPPVF+++ Y   + EN+            T+D     NA ++Y I +         F ++  +G++++   ID E+   +   I+A       ++   ++ + V D NDNAP F +   S    EN      I Q +  D D     +++    ++  N   +  +++ +G +  +G +D     S  + I A +    Q    + S  ++ + + DVNDNPP+F  I+
Sbjct:  461 LVIFVNDINDHPPVFEQQVYRVNLSEEVPPGSYVSGV----SATDGDSGLNANLRYSIVSGNGLGWFHISE--------HSGLVTTSAAGG--------LDRELASQ--IVLNISARDQGVHPKVSYAQLVVTVLDVNDEKPVFSQPEGYEVSVVENAPTGTELLVLGATDRDLGDNGTVRFSLQEAEND------QRLFRLD----PVSGRLSTASSLDREEQAF-YCLSILATDLGSPPQSSTAQVNVSLLDINDNSPVFYPVQYFAHIQ------ENEPGGSYVTTVSATDPDMG--------PNGTVKYSISAGDRSRFQIHAKSGVISTKMALDREE-KTAY-QLQVVATDGGNLQSPNQAI-VTVTVLDTQDNPPVFSQAAYSFVVFENVALGYHVGSVSATTMDL----NANISYLITTGDQRG---MFAMNPVTGQLTTASVIDREEQSFYQLKIVA---SGGAVTGDTVVNITVKDLNDNAPHFLQAVESINAVENWQAGHSIFQAKAVDPDEGVNGRVLYSLKQNPKN---LFTINEQNGNISLLGALDVH-AGSYQVEIVASDMGVPQ----LSSSILLTVYVHDVNDNPPVFDQIS 1000          

HSP 8 Score: 138.658 bits (348), Expect = 2.466e-32
Identity = 156/574 (27.18%), Postives = 264/574 (45.99%), Query Frame = 2
Query:  512 LPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVE-VEIKVGDINDNPPVFDKTFYTANIVEHSKLVNVISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDI-ECSLDDYHLNFEITAINEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLF--------SFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIFS 2203
             PEN  + T++   +   L  E   + YY  S     GN      +D +     Q+ +  PLD E I +Y   ++A D         S  E ++I V DINDN P F++  + + I+E+     +++   TD D G N Q+   I   N           +  F+ +  TG IR I  +D E   + Y   + ++D G P  S++ KV I ++++ND AP     R  +I S  ++  EN P    V  +  SD D  +  I   S+ D  L F I          +  + +I+  +PL+RED     +++    S  D    ++T++TI +   DINDN P F+R  Y  +  E +P+   ++ + +   D D G N  V Y I S       EYF I+A +G+I ++Q + Y+    F        SF + A D+   +L S   + ++ +D+NDN P F +  Y   V +NV V T++ ++   D      N  V+YF  S  N+     +D ++G +     +  +  ++  I +TA+++ +      + S+ +V IT+ + N + P FS
Sbjct: 2578 FPENQPVGTLVTTITGSSLRGET--LSYYIAS-----GNLGDTFQIDPLTG---QVSISQPLDFEKIQKYVVWIEARD---GGFPPFSSYEKLDITVLDINDNAPTFEEDPFVSEILENLSPRKILTVSATDKDSGPNGQLDYEIVNGNQ----------ESSFTINHATGEIRSIRPLDREKISH-YELTVKSSDKGSPSQSTSVKVIISILDENDNAP-----RFSQIFSAYVS--ENSPLGYTVTRVTTSDEDIGINAISRYSIVDTSLPFTINP--------NTGDIVIS--RPLNREDTDRYRIRV----SAHDSGWTVSTDVTIFVT--DINDNTPRFSRPSYYLDCPE-LPELGSRVTQ-VSATDPDEGSNGQVFYFIKSQS-----EYFRINATTGEIFNKQVLKYQNVSGFSNVNINRHSFIVTASDRGNPSLLSETTVTINTVDSNDNPPQFLQNKYFTPVTKNVKVGTKLIKVTAVDDKDFGLNSEVEYF-VSDGNHLGKFKLDNDTGWISIASSLVSDLNQNFLIRVTAKDKGNPP----LSSQAVVHITVTEENYHTPEFS 3092          

HSP 9 Score: 134.42 bits (337), Expect = 4.847e-31
Identity = 165/614 (26.87%), Postives = 260/614 (42.35%), Query Frame = 2
Query:  428 SSFYILIKVLDENDNSPKFLPFLNPYQ-TLPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKLVNVIS-FYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYET-----NPYKYSFNLIATDNGLPR-LSSTAKVNIILINKNDQAP-VIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITAINEIHPLGHYKEFIINT-------LKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKI-VKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEA------SYQNKNLMDSECMVIITIEDVNDNPPIF 2200
            SS  + + V D NDN P F      Y+ TL E+  +N+      A D DS A G   Y I+      N   F +         QL + S LDRE+   Y  ++ A DR  +     + V V + + D+NDN P+F+ T YT    E  +  + +      D D G N +V    E              Q +F    +TG I    + D E+         +SF + A D GLP+ L   A V++ + + ND AP  +K   +  +         +E A  +   L+VS  D  V +    L    +++ I   NE       ++F I++       +  LD E      L I    S      PL +  T+ I++ D NDN P F +S    +++EN+     +++  +   D D G NA + Y I  S N      F+I  ++G I   + +D+E   L+  NI A D+ +   SST  +++ V D NDN P FP      ++ EN+P+ T +  +   D D     ++      +    N+    +D+  G + T   IDRE      + + A ++A       Y  KN       V I + D+NDN P+F
Sbjct:  978 SSILLTVYVHDVNDNPPVFDQI--SYEVTLSESEPVNSRFFKVQASDKDSGANGEIAYTITDG---NNGDAFGIFPD-----GQLYIKSELDRELQDRYVLLVVASDRAVEPLS--ATVNVTVLLEDVNDNRPLFNSTNYTFYFEEEQRAGSFVGKVSAVDKDFGPNGEVRYAFEVT------------QPNFELHAVTGEITSTHKFDRESLMRRRGTAVFSFTVTAMDRGLPQPLKDQATVHVYMKDINDNAPKFLKDFYQATV---------SETATNLTQVLRVSASD--VDEGSNGL----IHYSILKGNE------ERQFAIDSFSGQVTLVGKLDYEATSAYSLLIQAVDSGA---IPLNSTCTLSIDILDENDNTPSFPKSTLFVDVLENMRIG--ELVSSVTATDSDSGVNADLHYTITGSNNHGT---FSISPNTGSIFLAKKLDFETQSLYKLNITAKDQGRPPRSSTMSVVIQVRDFNDNPPSFPPGDIFKSIVENIPLGTSVISVTAHDPDADINGQLSYAIIQQMPRGNH--FSIDEVKGTIYTSAEIDREFANLFELTVKANDQAVPIETRRYALKN-------VTILVTDLNDNVPMF 1529          

HSP 10 Score: 130.183 bits (326), Expect = 9.194e-30
Identity = 155/604 (25.66%), Postives = 256/604 (42.38%), Query Frame = 2
Query:  410 DSGI--KISSFYILIKVLDENDNSPKFLPFLNPYQTLPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKLVN-VISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITAINEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIFSLIN 2212
            D G+  K+S   +++ VLD ND  P F        ++ EN+   T +L+  A D D    G   + + +     ND     LD + SGR  L   S LDRE  + Y   + A D  +      S  +V + + DINDN PVF    Y A+I E+    + V +   TD D G N  V  +I   +       +  FQI     +++  + L  E         Y   ++ATD G  +  + A V + +++  D  PV          + S  +FEN     +     V    +   D+  ++       +   +  ++P+       + T   +DRE+     LKI            +T +  ++I + D+NDN P F ++      +EN  QA   + +    +D D G N  V Y +  +  +     FTI+  +G IS   ++D      +   I+A D     LSS+ L+ V+V D NDN P+F +  Y  T+ E+ PVN+   +++ +D D+    +I          +   I  D   G+L     +DRE      +L+ A + A       + +   V + +EDVNDN P+F+  N
Sbjct:  556 DQGVHPKVSYAQLVVTVLDVNDEKPVFSQPEGYEVSVVENAPTGTELLVLGATDRDLGDNGTVRFSLQE---AENDQRLFRLDPV-SGR--LSTASSLDREEQAFYCLSILATDLGSPPQS--STAQVNVSLLDINDNSPVFYPVQYFAHIQENEPGGSYVTTVSATDPDMGPNGTVKYSISAGD-------RSRFQIHAKSGVISTKMALDRE-----EKTAYQLQVVATDGGNLQSPNQAIVTVTVLDTQDNPPVFSQ------AAYSFVVFEN-----VALGYHVGSVSATTMDLNANISYLITTGDQRGMFAMNPVTGQ----LTTASVIDREEQSFYQLKIVASGG------AVTGDTVVNITVKDLNDNAPHFLQAVESINAVENW-QAGHSIFQ-AKAVDPDEGVNGRVLYSLKQNPKN----LFTINEQNGNISLLGALDVHAGS-YQVEIVASDMGVPQLSSSILLTVYVHDVNDNPPVFDQISYEVTLSESEPVNSRFFKVQASDKDSGANGEIAYTITDGNNGDAFGIFPD---GQLYIKSELDRELQDRYVLLVVASDRA----VEPLSATVNVTVLLEDVNDNRPLFNSTN 1104          

HSP 11 Score: 130.183 bits (326), Expect = 1.001e-29
Identity = 150/577 (26.00%), Postives = 256/577 (44.37%), Query Frame = 2
Query:  428 SSFYILIKVLDENDNSPKFLPFLNPYQTLPENSQINTVILLPSAIDLDSEAFGIKYYKI---SKPFLIGNDSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKLVN-VISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYE-------TNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITA-INEIHPLGHYK----EFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARN 2110
            +S  ++I +LDENDN+P+F    + Y  + ENS +   +   +  D D     I  Y I   S PF I  ++              +++  PL+RE    YR  + A    +D    +S  +V I V DINDN P F +  Y  +  E  +L + V     TD DEG N QV   I+++++Y        F+I+ +    TG I     + Y+        N  ++SF + A+D G P L S   V I  ++ ND  P                  +N+    +  +++V  +   VT ++    D+ LN E+   +++ + LG +K       I+    L    D NQ   I +   D+    PL++   +HI + + N + P F+++     + E+   +   ++  +   D+D   N  ++Y I S     +   F I++ +G ++  +++DYE +      I A D      +    + V VID NDN+P+F    +  TV EN P  T +  +  TD D+   N ++ Y  +S  ++  VI  D N G + T G +D E  +S  + + A N
Sbjct: 2757 TSVKVIISILDENDNAPRFSQIFSAY--VSENSPLGYTVTRVTTSDEDIGINAISRYSIVDTSLPFTINPNTG------------DIVISRPLNREDTDRYRIRVSA----HDSGWTVS-TDVTIFVTDINDNTPRFSRPSYYLDCPELPELGSRVTQVSATDPDEGSNGQVFYFIKSQSEY--------FRINAT----TGEIFNKQVLKYQNVSGFSNVNINRHSFIVTASDRGNPSLLSETTVTINTVDSNDNPP---------------QFLQNKYFTPVTKNVKVGTKLIKVTAVDDK--DFGLNSEVEYFVSDGNHLGKFKLDNDTGWISIASSL--VSDLNQNFLIRVTAKDKGN-PPLSSQAVVHITVTEENYHTPEFSQNHISATIPES--HSIGSVVRTVSARDRDTAMNGLISYNIISGN---EEGIFAINSSTGVVTLAKALDYEMSSKHEMTISATDGGWVARTGYCSLTVSVIDVNDNSPVFVPDEFFPTVMENAPSGTTVIHLNATDADSG-ANAVIAYTVQSSDSDLFVI--DPNMGVITTQGFLDFETKQSYHLTVKAFN 3274          

HSP 12 Score: 124.79 bits (312), Expect = 4.535e-28
Identity = 162/613 (26.43%), Postives = 269/613 (43.88%), Query Frame = 2
Query:  410 DSGIKISSFYILIKVLDENDNSPKFLPFLNPYQT-LPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGN---DSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDR-ENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKLVNVI-SFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITAINEIHPLGHYKEFIINTL-------KPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENI---PQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIF 2200
            D G + ++      +LD NDN P F   ++ Y T L EN  + + +L+ +  D D        Y I+    +G    D H  L             +  LDRE  S Y  +++  D  +    R  S  +V I + D+NDNPP+F     T  I E++ +  V+     TD D G N  +  T+   +  K           FS   + G + L  E+D E     YS  ++ATD G P LSS+ +V +++++ ND  PV       + + R + + EN    T +  +  +D D           +  + + I   N       ++EF I+++       K LDRE      L +    +D+   +P T + T+ I L D+ND  PVF  S Y   + EN+   P+A ++    ++  D D G N+ ++Y +       +   F + A SG++   QS+D E    F   + A D     L+ T  I + V D NDN P F    Y  ++ E+    T++  +  +D D    N ++ Y   S         ++ ++G++ T   +DRE   + T+++ A +  S ++ +   S  +   TI DVNDNPP F
Sbjct: 1920 DGGGQSTTIRAYFNILDVNDNPPVF--SMSSYSTSLMENLPLGSTVLVFNVTDADDGVNSQLSYSIASGDSLGQFAVDKHGVLK-----------TLKALDRESQSFYNLVIQVHDLPQPPTSRFTSTAQVSIILLDVNDNPPMFLSPKLTY-IPENTPIDTVVFKAQATDPDSGPNSYIEYTLLNPSGNK-----------FSIGTIDGEVHLTGELDRE-EVSNYSLTVVATDKGQPPLSSSTEVVVMVLDINDNNPVFA-----QAMYR-VQIKENILTGTDIIQVSAADNDEGT--------NGQVRYGIVGGNT------HQEFRIDSVTGAITVAKSLDRETTPAYTLTVQ--ATDRGS-SPRTDSCTVAITLLDMNDFVPVFELSPYSVNVPENLGTLPRAILQ----VVARDDDQGPNSQLSYVL---LGGNEDNAFVLTA-SGELRVTQSLDREARDHFVLVVTAADAGSPALTGTGTINIIVDDINDNVPTFANNMYLTSIAEDARTGTDVLLVNASDADAA-ANAVISY---SIIGGNSQFTINPSTGQIITSALLDRETKDNYTLVVVASDAGSPESLSSSTSVLV---TITDVNDNPPRF 2468          

HSP 13 Score: 122.479 bits (306), Expect = 2.325e-27
Identity = 156/570 (27.37%), Postives = 246/570 (43.16%), Query Frame = 2
Query:  428 SSFYILIKVLDENDNSPKFLPFLNPYQT-LPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEH-SKLVNVISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITAINEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTP-LTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVI-DANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTN-NYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASY 2122
            S+  + I +LD NDN P FL   +P  T +PEN+ I+TV+    A D DS       Y +  P   GN      +D       ++ L   LDRE +S Y   + A D+        S  EV + V DINDN PVF +  Y   I E+     ++I     D DEG N QV   I   N +++      F+ID     +TG+I +   +D ET P  Y+  + ATD G    + +  V I L++ ND  PV       E+   S+ + EN       A LQV  RD      +    +  L++ +   NE +         +   + LDRE   +  L +    +  D  +P LT   TI+I + DINDN P F  + Y   + E+    T  ++  +   D D   NA ++Y I    +      FTI+  +G+I +   +D E    ++  ++A D       S++  ++  I D NDN P F    Y   +    P  + +  +  TD D    +++    H S +  N +  H+D   G +   GP+       +T  +  ++  S+
Sbjct: 2033 STAQVSIILLDVNDNPPMFL---SPKLTYIPENTPIDTVVFKAQATDPDSGPNSYIEYTLLNPS--GNKFSIGTIDG------EVHLTGELDREEVSNYSLTVVATDKGQPPLS--SSTEVVVMVLDINDNNPVFAQAMYRVQIKENILTGTDIIQVSAADNDEGTNGQVRYGIVGGNTHQE------FRIDS----VTGAITVAKSLDRETTP-AYTLTVQATDRGSSPRTDSCTVAITLLDMNDFVPVF------ELSPYSVNVPENL-GTLPRAILQVVARD------DDQGPNSQLSYVLLGGNEDNAFVLTASGELRVTQSLDREARDHFVLVV----TAADAGSPALTGTGTINIIVDDINDNVPTFANNMYLTSIAEDARTGTDVLL--VNASDADAAANAVISYSIIGGNSQ-----FTINPSTGQIITSALLDRETKDNYTLVVVASDAGSPESLSSSTSVLVTITDVNDNPPRFQHHPYVTHIPSPTPPGSFVFAVTVTDADIGSNSEL----HYSLSGRNSEKFHIDPLRGAIMAAGPL--SGASEVTFSVHVKDGGSF 2548          

HSP 14 Score: 120.939 bits (302), Expect = 5.378e-27
Identity = 161/620 (25.97%), Postives = 262/620 (42.26%), Query Frame = 2
Query:  383 CCTVFSFQVDSGIKISSFYILIKVLDENDNSPKFLP---FLNPYQTLPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKL---VNVISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAP-VIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTD-IECSLDDYHLNFEITAINEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKV---RSITIL---ITARNEASYQNKNLMDSECMVIITIEDVNDNPPIF 2200
            C ++ +  + S  + S+  + + +LD NDNSP F P   F +  +  P  S + TV    SA D D    G   Y IS     G+ S F +  K      ++     LDRE  + Y+  + A D  N   +  +   V + V D  DNPPVF +  Y+  + E+  L   V  +S    DL    N  +S  I T      DQ   F     +  L T S+     ID E   + Y   ++A+      ++    VNI + + ND AP  ++ +        SI   EN  A   +   +  D D  V   +  SL     N  +  INE       +   I+ L  LD      Q   + I  SD   +  L++++ + + + D+NDNPPVF +  Y+  L E+ P  +      +   DKD G N  + Y I    N   +  F      G++  +  +D E    +   ++A D+    LS+T  + V + D NDN P+F   +Y+F   E     + +G++   D D  P N  V+Y  +    N+++  V   +G++ +    DRE +   R   +    +TA +    Q    +  +  V + ++D+NDN P F
Sbjct:  656 CLSILATDLGSPPQSSTAQVNVSLLDINDNSPVFYPVQYFAHIQENEPGGSYVTTV----SATDPDMGPNGTVKYSISA----GDRSRFQIHAKSGVISTKMA----LDREEKTAYQLQVVATDGGN--LQSPNQAIVTVTVLDTQDNPPVFSQAAYSFVVFENVALGYHVGSVSATTMDL----NANISYLITT-----GDQRGMFAMNPVTGQLTTASV-----IDREEQSF-YQLKIVASGGA---VTGDTVVNITVKDLNDNAPHFLQAV-------ESINAVENWQAGHSIFQAKAVDPDEGVNGRVLYSLKQNPKN--LFTINE-------QNGNISLLGALDVHAGSYQ---VEIVASDM-GVPQLSSSILLTVYVHDVNDNPPVFDQISYEVTLSESEPVNS--RFFKVQASDKDSGANGEIAYTITDGNNGDAFGIFP----DGQLYIKSELDRELQDRYVLLVVASDRAVEPLSATVNVTVLLEDVNDNRPLFNSTNYTFYFEEEQRAGSFVGKVSAVDKDFGP-NGEVRYAFEVTQPNFELHAV---TGEITSTHKFDRESLMRRRGTAVFSFTVTAMDRGLPQP---LKDQATVHVYMKDINDNAPKF 1210          

HSP 15 Score: 116.701 bits (291), Expect = 1.086e-25
Identity = 161/615 (26.18%), Postives = 264/615 (42.93%), Query Frame = 2
Query:  428 SSFYILIKVLDENDNSPKFLPFLNPYQTLPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHS-KLVNVISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLP--RLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPAR---TIVASLQVSDRDSLVTDIECSLDDYHLNFEITAINEIHPL----GHYKEFIINTLKP-------LDREDDKNQYLKI------NIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKN-AYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKS---YTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNP 2191
            S   + I V +EN ++P+F    +   T+PE+  I +V+   SA D D+   G+  Y I    + GN+     +  I S    + L   LD E+ S++   + A D           + V +   D+NDN PVF    +   ++E++     VI    TD D G N  ++ T+++ +          F ID  P++  G I     +D+ET   K S++L      +P     S A V+I L   N+  P          VS+ +  FE   A    T V  +  SDRD                  + A  E+H L       K F IN +         LDRE ++   LK+      NI  +D D++T       ++I + D ND PPVF+ S Y+ ++ E +P  T   +  +   D D   + +  +Y I S   +     F+I+  +G+I+    +D E   +++  ++A+D    + + +A ++V + D NDN P+         V EN    T +  +++TD D  P      Y+  S    TN + +      +G L T   IDRE++    + +  R+  + Q    M S   V IT+ D NDNP
Sbjct: 3073 SQAVVHITVTEENYHTPEFSQN-HISATIPESHSIGSVVRTVSARDRDTAMNGLISYNI----ISGNEEG---IFAINSSTGVVTLAKALDYEMSSKHEMTISATDGGWVARTGYCSLTVSVI--DVNDNSPVFVPDEFFPTVMENAPSGTTVIHLNATDADSGANAVIAYTVQSSD-------SDLFVID--PNM--GVITTQGFLDFET---KQSYHLTVKAFNVPDEEKCSFATVDIQLKGTNEYVP--------RFVSK-LYYFEVSEAASRGTAVGEVFASDRD------------------MGADGEVHYLIFGNSRKKGFQINKMTGQIYVSGLLDREKEERVSLKVLAKNFGNIRGADIDEVT-------VNITVLDAND-PPVFSLSTYRVQISEGVPIGT--HVTFVSAFDSDSIPSWSRFSYFIGSGNENG---AFSINPQTGQITVTSGLDRESLPVYNLTVLAVDSGTPSATGSASLVVTLEDINDNGPVLTVSEGE--VLENKRPGTLVMTLQSTDPDLPPNQGPFNYYLLSTGPATNYFSL----STAGVLSTTREIDREQIADFYLSVVTRDSGAPQ----MSSTGTVHITVLDQNDNP 3613          

HSP 16 Score: 111.694 bits (278), Expect = 4.200e-24
Identity = 173/619 (27.95%), Postives = 264/619 (42.65%), Query Frame = 2
Query:  407 VDSG-IKISSFYIL-IKVLDENDNSPKFLPFLNPYQTLPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKL-VNVISFYVTDLDEGQNKQVSITIETE----NDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLP---RLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLV-TDIECSLDDYHLNFEITAINEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTP----LTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQAT-VKMIEPILTLDKDHGKNAYVTYKIDSSK--NSTDWEYFTIDADSGKISSRQSIDYEKNK-LFSFNIIAIDKDQS-NLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIFS 2203
            VDSG I ++S   L I +LDENDN+P F P    +  + EN +I  ++   +A D DS      +Y I+     G+++H T    I+     + L   LD E  S Y+  + A D+        S + V I+V D NDNPP F       +IVE+  L  +VIS    D D   N Q+S  I  +    N +  D++K             G+I    EID E     +   + A D  +P   R  +   V I++ + ND  P+   I +  + +    M       +++ ++  +D D     ++E  +    LN +          G  +  + + L P          L  N+  S  D L P     TT LT+ +   D     PVFT++KY   L E  P  T V  IE         G  A V Y I S +    T    FTI   +G I +   +D E+   L+  ++ AI+K  +   +  A + + + D NDN P+FP      TV EN+   ++I Q+   D D    N +V Y   S  ++     +D  SG L     +DRE     ++L+ A       +  L  S+  + ITI DVND+ P FS
Sbjct: 1288 VDSGAIPLNSTCTLSIDILDENDNTPSF-PKSTLFVDVLENMRIGELVSSVTATDSDSGVNADLHYTIT-----GSNNHGTF--SISPNTGSIFLAKKLDFETQSLYKLNITAKDQGRPPRS--STMSVVIQVRDFNDNPPSFPPGDIFKSIVENIPLGTSVISVTAHDPDADINGQLSYAIIQQMPRGNHFSIDEVK-------------GTIYTSAEIDREFANL-FELTVKANDQAVPIETRRYALKNVTILVTDLNDNVPMF--ISQNALAADPSAMI-----GSVLTTIMAADPDEGANGEVEYEI----LNGDTDTFTVDRYSGDLR--VASALVP--------SQLIYNLIVSATD-LGPERRKSTTELTVILQGLD----GPVFTQTKYITILKEGEPIGTNVISIEAA----SPRGSEAPVEYYIVSVRCEEKTVGRLFTIGRQTGVIQTAAILDREQGACLYLVDVYAIEKSSAFPRTQRAEVEITLQDINDNPPVFPTDTLDLTVEENIGDGSKIMQLTAMDAD-EGANALVTYALISGADDS--FRIDPESGDLIATKRLDREHRSKYSLLVRA-------DDGLQSSDMRINITISDVNDHTPRFS 1842          

HSP 17 Score: 108.227 bits (269), Expect = 4.838e-23
Identity = 151/614 (24.59%), Postives = 267/614 (43.49%), Query Frame = 2
Query:  425 ISSFYILIKVLDENDNSPKFLPFLNPYQT-LPENSQINTVILLPSAID-----LDSEAFGIKYY-----KISKPFLIGNDSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKLVNVI-SFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITAINEIHP-LGHYKEFIINTLKPLDREDDKNQYLKINIY-CSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTAL----IIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREK--VRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIFSL 2206
            +S   + I  +D NDN P+FL   N Y T + +N ++ T ++  +A+D     L+SE   ++Y+      + K F + ND+ +     IAS      L+S L++       F+++   ++  +    S   V I V + N + P F +   +A I E   + +V+ +    D D   N  +S  I + N+      +  F I+ S    TG + L   +DYE +  K+   + ATD G    +    + + +I+ ND +PV       E      T+ EN P+ T V  L  +D DS    +      Y +    + +  I P +G     +I T   LD E  ++ +L +  +   D++K +      T+ I L   N+  P F    Y  E+ E   + T   +  +   D+D G +  V Y I  +      + F I+  +G+I     +D EK +  S  ++A  K+  N+    +    + + V+DAND  P+F    Y   + E VP+ T +  +   D D+ P      YF  S   N     ++  +G++     +DRE   V ++T+L       S            +++T+ED+NDN P+ ++
Sbjct: 2966 LSETTVTINTVDSNDNPPQFL--QNKYFTPVTKNVKVGTKLIKVTAVDDKDFGLNSE---VEYFVSDGNHLGK-FKLDNDTGWI---SIASS-----LVSDLNQN------FLIRVTAKDKGNPPLSSQAVVHITVTEENYHTPEFSQNHISATIPESHSIGSVVRTVSARDRDTAMNGLISYNIISGNE------EGIFAINSS----TGVVTLAKALDYEMS-SKHEMTISATDGGWVARTGYCSLTVSVIDVNDNSPVFV---PDEFFP---TVMENAPSGTTVIHLNATDADSGANAVIA----YTVQSSDSDLFVIDPNMG-----VITTQGFLDFETKQSYHLTVKAFNVPDEEKCS----FATVDIQLKGTNEYVPRFVSKLYYFEVSEAASRGTA--VGEVFASDRDMGADGEVHYLIFGNSRK---KGFQINKMTGQIYVSGLLDREKEERVSLKVLA--KNFGNIRGADIDEVTVNITVLDAND-PPVFSLSTYRVQISEGVPIGTHVTFVSAFDSDSIPSWSRFSYFIGSGNEN-GAFSINPQTGQITVTSGLDRESLPVYNLTVLAVDSGTPS------ATGSASLVVTLEDINDNGPVLTV 3514          

HSP 18 Score: 105.531 bits (262), Expect = 2.832e-22
Identity = 162/602 (26.91%), Postives = 266/602 (44.19%), Query Frame = 2
Query:  446 IKVLDENDNSPKFL--PFLNPYQTLPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGN-DSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKLVNVISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQID----FSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITAINEIHPLGHYKEFIINTLKPLDREDDKNQ----YLKINI-----YCSDQDKLTP-LTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIF 2200
            I VLD NDN+P F   PF++    + EN      IL  SA D DS   G   Y+I      GN +S FT+    A+G  ++  I PLDRE IS Y   +K+ D+ +      + V+V I + D NDN P F + F +A + E+S L   ++  VT  DE              D   + I R+  +D    F+ +  TG I +   ++ E +  +Y   + A D+G    + +  V I + + ND  P           SR  + + + P        ++ +  S VT +  +  D   N ++     I     Y      T +  +++  K Q    +  +NI       +  D+  P L +  T+ IN  D NDNPP F ++KY   + +N+   T K+I+     DKD G N+ V Y +    +      F +D D+G IS   S+  + N+ F   + A DK    LSS A++ + V + N + P F + H S T+ E+  + + +  +   D DT   N ++ Y   S  N   +  ++ ++G +     +D E      + I+A +             C + +++ DVNDN P+F
Sbjct: 2659 ITVLDINDNAPTFEEDPFVS---EILENLSPRK-ILTVSATDKDSGPNGQLDYEIVN----GNQESSFTI--NHATG--EIRSIRPLDREKISHYELTVKSSDKGSPSQS--TSVKVIISILDENDNAPRFSQIF-SAYVSENSPLGYTVT-RVTTSDE--------------DIGINAISRYSIVDTSLPFTINPNTGDIVISRPLNRE-DTDRYRIRVSAHDSG---WTVSTDVTIFVTDINDNTPRF---------SRP-SYYLDCP--------ELPELGSRVTQVSATDPDEGSNGQVFYF--IKSQSEYFRINATTGEIFNKQVLKYQNVSGFSNVNINRHSFIVTASDRGNPSLLSETTVTINTVDSNDNPPQFLQNKYFTPVTKNVKVGT-KLIKVTAVDDKDFGLNSEVEYFV---SDGNHLGKFKLDNDTGWISIASSLVSDLNQNFLIRVTAKDKGNPPLSSQAVVHITVTEENYHTPEFSQNHISATIPESHSIGSVVRTVSARDRDTA-MNGLISYNIIS-GNEEGIFAINSSTGVVTLAKALDYEMSSKHEMTISATDGGWVARTGY----CSLTVSVIDVNDNSPVF 3196          

HSP 19 Score: 99.3673 bits (246), Expect = 2.073e-20
Identity = 111/442 (25.11%), Postives = 194/442 (43.89%), Query Frame = 2
Query:  959 YKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSST----AKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITAINE---------IHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTN-LTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPI-----FPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENK--IVKYFHKSYTNNYQVIHVD-QNSGKLKTIGPIDREKVRSITILIT------ARNEASYQNKNLMDSECMVIITIEDVNDNPPIF 2200
            Y+  +    F I+ S    TG++     ID E+ P     NL+        LSS+     +V +++ + ND APV        IV   +T  E+  +   V     +D     +DI  +  D+H ++ I + NE         ++P G      + +   LDRE      L + +    +DK  P     L +++ + DINDNPPVF  S YQ  + E+        +  +   D D G NA + Y++           F +D ++G I+ R+ +D+E  + +S  + A D+   +L+  A   + ++D NDN P+     FP      +V EN  V T +  +  TD D+   N    V+    +   +++V      N   +K    +DRE++ S  + ++      A   A  Q ++ + S   ++I + D+ND+PP+F
Sbjct:   72 YRLSESHALFAINSS----TGALYTTATIDRESLPSDV-VNLVV-------LSSSPTYPTEVRVLVRDLNDNAPVFP---DPSIV---VTFKEDSGSGRQVILDTATD-----SDIGSNGVDHH-SYRIVSGNEAGRFRLDITLNPSGEGAFLHLVSKGGLDREVTPQYQLLVEV----EDKGEPKRRGYLQVNVTVQDINDNPPVFGSSHYQAGVPED--AVVGSSVLQVAAADADEGTNADIRYRLQDEGTP-----FQMDPETGLITVREPLDFEARRQYSLTVQATDRGVPSLTGRAEAFIQLLDVNDNDPVVKFRYFPATSRYASVDENAQVGTVVALLTVTDADSPAANGNISVQILGGNEQRHFEVQRSKVPNLSLIKVASALDRERIPSYNLTVSVSDNSGAPPTAEVQARSSVAS---LVIFVNDINDHPPVF 475          

HSP 20 Score: 91.6633 bits (226), Expect = 4.940e-18
Identity = 148/609 (24.30%), Postives = 251/609 (41.22%), Query Frame = 2
Query:  782 EVEIKVGDINDNPPVFDKTFYTANIVEHSKLV-NVISFYVTDLDEGQNKQVSITIETENDYKKDQIKRF-FQIDFSPSLMTGSIRLIDE--IDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVAS--LQVSDRDS---LVTDIECSLDDYHLNFEITAINEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPV-----FTRSKYQGELIENIPQATVKMIEPILTL-DKDH-GKNAYVTYKIDSSKNSTDWEYFTIDADS----GKISSRQSIDYEKNKLFSFNIIAIDKDQSNL---------SSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKT--IGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIFSLINPAKSSLIFTINKGFRHENCQMIPYAVSDADHDEPNSDSCCILQLDNDQNGMLYLLSNTPNFLCLQNTMNTP--GIYRVSLTATDNKNNPNKSLKAKVSFNI 2509
            EV + V D+NDN PVF          E S     VI    TD D G N    +   +      ++  RF   I  +PS     + L+ +  +D E  P +Y   +   D G P+     +VN+ + + ND  PV            S       P   +V S  LQV+  D+      DI   L D    F++            +  +I   +PLD E  + QY  + +  +D+  +  LT      I L D+NDN PV     F  +     + EN   A V  +  +LT+ D D    N  ++ +I       +  +F +          I    ++D E  ++ S+N+     D S           SS A +++ V D ND+ P+F +  Y   + E VP  + +  +  TD D+   N  ++Y   S  N     H+ ++SG + T   G +DRE    I + I+AR++  +       S   +++T+ DVND  P+FS     + S++     G      +++    +D D  +  +    + + +NDQ   L+ L      L   ++++      Y +S+ ATD   +P +S  A+V+ ++
Sbjct:  120 EVRVLVRDLNDNAPVFPDPSIVVTFKEDSGSGRQVILDTATDSDIGSN---GVDHHSYRIVSGNEAGRFRLDITLNPSGEGAFLHLVSKGGLDREVTP-QYQLLVEVEDKGEPKRRGYLQVNVTVQDINDNPPVFG----------SSHYQAGVPEDAVVGSSVLQVAAADADEGTNADIRYRLQDEGTPFQMDP----------ETGLITVREPLDFE-ARRQY-SLTVQATDR-GVPSLTGRAEAFIQLLDVNDNDPVVKFRYFPATSRYASVDEN---AQVGTVVALLTVTDADSPAANGNISVQI---LGGNEQRHFEVQRSKVPNLSLIKVASALDRE--RIPSYNLTVSVSDNSGAPPTAEVQARSSVASLVIFVNDINDHPPVFEQQVYRVNLSEEVPPGSYVSGVSATDGDSG-LNANLRYSIVS-GNGLGWFHISEHSGLVTTSAAGGLDRELASQIVLNISARDQGVHPKV----SYAQLVVTVLDVNDEKPVFSQPEGYEVSVVENAPTG-----TELLVLGATDRDLGDNGTVRFSLQEAENDQR--LFRLDPVSGRLSTASSLDREEQAFYCLSILATD-LGSPPQSSTAQVNVSL 679          

HSP 21 Score: 86.2705 bits (212), Expect = 2.360e-16
Identity = 178/717 (24.83%), Postives = 300/717 (41.84%), Query Frame = 2
Query:  173 IIPYDKHQRYKIYAVTEKASPFSLIDNRLSVVSNIDRESICPIKNSLNDYDQSAETYNSQQSSHSCKYDECCTVFSFQVDSGIKISSFYILIKVLDENDNSPKFLPFLNPYQT-LPEN-SQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGN-DSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVE-VEIKVGDINDNPPVFDKTFYTANIVEHSKL-VNVISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINK-NDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRD-SLVTDIECSL-----DDYHLNFEITAINEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELI-ENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNS--------GKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIFSLINPA----KSSLIFTINK 2248
            I+  + HQ ++I +VT            ++V  ++DRE+      ++   D+ +          S + D C                  + I +LD ND  P F   L+PY   +PEN   +   IL   A D D         ++S   L GN D+ F L    ASG  +L +   LDRE    +  ++ A D  +     ++G   + I V DINDN P F    Y  +I E ++   +V+    +D D   N  +S +I   N           Q   +PS  TG I     +D ET    Y+  ++A+D G P   S++   ++ I   ND  P  +       V+    +    P  + V ++ V+D D    +++  SL     + +H++    AI    PL    E                  +  +++  D     P T + T+ +   +  D P V  R+K Q  +  EN P  T+     + T+     +   ++Y I +S N  D   F ID  +G++S  Q +D+EK + +   I A D      SS   + + V+D NDNAP F +  +   + EN+    +I  +  TD D+ P  ++          +Y++++ +Q S        G++++I P+DREK+    + + + ++ S        +   VII+I D NDN P FS I  A     S L +T+ +
Sbjct: 2193 IVGGNTHQEFRIDSVT----------GAITVAKSLDRETTPAYTLTVQATDRGS----------SPRTDSCT-----------------VAITLLDMNDFVPVFE--LSPYSVNVPENLGTLPRAILQVVARDDDQG----PNSQLSYVLLGGNEDNAFVL---TASG--ELRVTQSLDREARDHFVLVVTAADAGSPA---LTGTGTINIIVDDINDNVPTFANNMYLTSIAEDARTGTDVLLVNASDADAAANAVISYSIIGGNS----------QFTINPS--TGQIITSALLDRETKD-NYTLVVVASDAGSPESLSSSTSVLVTITDVNDNPPRFQ---HHPYVTH---IPSPTPPGSFVFAVTVTDADIGSNSELHYSLSGRNSEKFHIDPLRGAIMAAGPLSGASE------------------VTFSVHVKDGGSF-PKTDSTTVTVRFANKADFPKV--RAKEQTFMFPENQPVGTL-----VTTITGSSLRGETLSYYI-ASGNLGDT--FQIDPLTGQVSISQPLDFEKIQKYVVWIEARDGGFPPFSSYEKLDITVLDINDNAPTFEEDPFVSEILENLSPR-KILTVSATDKDSGPNGQL----------DYEIVNGNQESSFTINHATGEIRSIRPLDREKISHYELTVKSSDKGSPSQS----TSVKVIISILDENDNAPRFSQIFSAYVSENSPLGYTVTR 2795          
BLAST of Protocadherin Fat 1 vs. Ensembl Mouse
Match: Celsr3 (cadherin, EGF LAG seven-pass G-type receptor 3 [Source:MGI Symbol;Acc:MGI:1858236])

HSP 1 Score: 191.045 bits (484), Expect = 1.604e-48
Identity = 184/711 (25.88%), Postives = 322/711 (45.29%), Query Frame = 2
Query:  104 SVKENIYYSQPLLDLEKVLKNRTIIPYDKHQRYKIY---AVTEKASPFSLIDNRLSVVSN---IDRESICPIKNSLNDYDQSAETYNSQQSSHSCKYDECCTVFSFQVDSGIKISSFYILIKVLDENDNSPKFLPFLNPYQTLPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKL-VNVISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPAR--TIVASLQVSDRDSLVTDIECSLDDYHLNFEITAINEIHPLGHYKEF---IINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIF 2200
            +++EN+    P+L L     +    P + + RY+     AV   A+    ID R  ++S    +DRE        +  Y+   E  +  Q                  + G + ++  + I VLDENDN+P+F       Q + E+ + +TV+L  +A D D +A G+ +Y I    + GN      +D +     ++ +++PLD E   EY   ++A D       + +G+   I+V DIND+ P+F  T +  +++E++ L  +VI     D D G+N ++  ++                  F  +  TG + +   +D E+  + Y F + A D+G P LS++A V + +++ ND  P        E   +   +  NE A   T V S+   DRD+          +  ++++IT  N  +      +    ++    PLD + ++  Y K+ +  SD+     L  +  +HIN+ D N + PVF  + Y   + E+ P  +  ++  I   D D G+NA +TY ++      +   F IDADSG I+ +  +DYE    ++  I A D      + T  + V V D NDNAP F   HY+  V E+ P  T + QI  TD D     + V+Y  ++  +      ++  SG ++T+  +DRE V    +   A +         + +   + +T++DVNDN P+F
Sbjct:  432 TLRENVEEGYPILQLRATDGD---APPNANLRYRFVGSPAVRTAAAAAFEIDPRSGLISTSGRVDREH-------MESYELVVEASDQGQ------------------EPGPRSATVRVHITVLDENDNAPQFSEKRYVAQ-VREDVRPHTVVLRVTATDKDKDANGLVHYNI----ISGNSRGHFAIDSLTG---EIQVMAPLDFEAEREYALRIRAQDAGRPPLSNNTGL-ASIQVVDINDHAPIFVSTPFQVSVLENAPLGHSVIHIQAVDADHGENSRLEYSLTGVAS----------DTPFVINSATGWVSVSGPLDRESVEH-YFFGVEARDHGSPPLSASASVTVTVLDVNDNRP--------EFTMKEYHLRLNEDAAVGTSVVSVTAVDRDA----------NSAISYQITGGNTRNRFAISTQGGVGLVTLALPLDYKQER--YFKLVLTASDR----ALHDHCYVHINITDANTHRPVFQSAHYSVSMNEDRPVGSTVVV--ISASDDDVGENARITYLLED-----NLPQFRIDADSGAITLQAPLDYEDQVTYTLAITARDNGIPQKADTTYVEVMVNDVNDNAPQFVASHYTGLVSEDAPPFTSVLQISATDRDAHANGR-VQYTFQNGEDGDGDFTIEPTSGIVRTVRRLDREAVPVYELTAYAVDRGVPP----LRTPVSIQVTVQDVNDNAPVF 1058          

HSP 2 Score: 143.665 bits (361), Expect = 6.794e-34
Identity = 154/590 (26.10%), Postives = 252/590 (42.71%), Query Frame = 2
Query:  446 IKVLDENDNSPKFLPFLNPYQ-TLPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKL-VNVISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRD-SLVTDIECSLDDYHLNFEITAINEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLT-IHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIFS 2203
            I+V+D ND++P F+    P+Q ++ EN+ +   ++   A+D D        Y ++    + +D+ F     I S    + +  PLDRE +  Y F ++A  R++      +   V + V D+NDN P F    Y   + E + +  +V+S  VT +D   N  +S  I   N   +  I        S     G + L   +DY+   Y +   L A+D  L        V+I + + N   PV +          S++M E+ P  + V  +  SD D      I   L+D    F I A              I    PLD ED     L I    + +D   P   + T + + + D+NDN P F  S Y G + E+ P  T   +  I   D+D   N  V Y   + ++  D + FTI+  SG + + + +D E   ++     A+D+    L +   I V V D NDNAP+FP   +   V+EN  V + + QI   D D  P   I+  +     N  ++  +D  SG+L  +  +D E  +   I++ A +         + S   V + + D NDN P+ +
Sbjct:  630 IQVVDINDHAPIFVS--TPFQVSVLENAPLGHSVIHIQAVDADHGENSRLEYSLTG---VASDTPFV----INSATGWVSVSGPLDRESVEHYFFGVEA--RDHGSPPLSASASVTVTVLDVNDNRPEFTMKEYHLRLNEDAAVGTSVVS--VTAVDRDANSAISYQITGGNTRNRFAI--------STQGGVGLVTLALPLDYKQERY-FKLVLTASDRAL---HDHCYVHINITDANTHRPVFQS------AHYSVSMNEDRPVGSTVVVISASDDDVGENARITYLLEDNLPQFRIDA----------DSGAITLQAPLDYEDQVTYTLAI----TARDNGIPQKADTTYVEVMVNDVNDNAPQFVASHYTGLVSEDAPPFT--SVLQISATDRDAHANGRVQYTFQNGEDG-DGD-FTIEPTSGIVRTVRRLDREAVPVYELTAYAVDRGVPPLRTPVSIQVTVQDVNDNAPVFPAEEFEVRVKENSIVGSVVAQITAVDPDDGPNAHIM--YQIVEGNIPELFQMDIFSGELTALIDLDYEARQEYVIVVQATSAP-------LVSRATVHVRLVDQNDNSPVLN 1161          

HSP 3 Score: 141.739 bits (356), Expect = 2.159e-33
Identity = 184/717 (25.66%), Postives = 297/717 (41.42%), Query Frame = 2
Query:  476 PKFLPFLNPYQTL-PENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLI---SPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEH-SKLVNVISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGL---PRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITAINEIHPLGHYK----EFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLT--IHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKY-FHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIFSLINPAKSSLIFTINKGFRHENCQMIPYAVSDADHDEPNSDSCCILQLDNDQNG----MLYLLS-NTPNF--------LCLQNTMNTPG--IYRVSLTATDNKNNPNKSLKAKVSFNIDVRHEVSDN 2536
            P+F P  N YQTL PEN    T +L   A D D    G   Y ++    + N     L     S  PQ  LI   + LDRE  S  R  L+   +++   R  +   V + V D ND+ PVF++  Y   + E+  +   ++    TD D   N  +       +   +      F+ID    L++ S R +D    E+    Y   + A+D G    PR S+T +V+I ++++ND AP     R    V       E+    T+V  +  +D+D     +        +++ I + N     GH+        I  + PLD E ++   L+I      QD   P  +N T    I + DIND+ P+F  + +Q  ++EN P      +  I  +D DHG+N+ + Y +    + T    F I++ +G +S    +D E  + + F + A D     LS++A + V V+D NDN P F    Y   + E+  V T +  +   D D    N  + Y      T N   I      G +    P+D ++ R   +++TA + A       +   C V I I D N + P+F                       Q   Y+VS  + D P   +  ++   +D  G    + YLL  N P F        + LQ  ++      Y +++TA DN   P K+    V   ++   +V+DN
Sbjct:  314 PQF-PQYN-YQTLVPENEAAGTSVLRVVAQDPDPGEAGRLIYSLAA---LMNSRSLELF----SIDPQSGLIRTAAALDRE--SMERHYLRVTAQDHGSPRLSATTMVAVTVADRNDHAPVFEQAQYRETLRENVEEGYPILQLRATDGDAPPNANLRYRF-VGSPAVRTAAAAAFEIDPRSGLISTSGR-VDREHMES----YELVVEASDQGQEPGPR-SATVRVHITVLDENDNAPQFSEKRYVAQVR------EDVRPHTVVLRVTATDKDKDANGL--------VHYNIISGNS---RGHFAIDSLTGEIQVMAPLDFEAEREYALRIRA----QDAGRPPLSNNTGLASIQVVDINDHAPIFVSTPFQVSVLENAPLG--HSVIHIQAVDADHGENSRLEYSLTGVASDTP---FVINSATGWVSVSGPLDRESVEHYFFGVEARDHGSPPLSASASVTVTVLDVNDNRPEFTMKEYHLRLNEDAAVGTSVVSVTAVDRDA---NSAISYQITGGNTRNRFAISTQGGVGLVTLALPLDYKQERYFKLVLTASDRA-------LHDHCYVHINITDANTHRPVF-----------------------QSAHYSVS-MNEDRPVGSTVVVISASDDDVGENARITYLLEDNLPQFRIDADSGAITLQAPLDYEDQVTYTLAITARDN-GIPQKADTTYVEVMVN---DVNDN 948          
BLAST of Protocadherin Fat 1 vs. Ensembl Mouse
Match: Celsr3 (cadherin, EGF LAG seven-pass G-type receptor 3 [Source:MGI Symbol;Acc:MGI:1858236])

HSP 1 Score: 191.045 bits (484), Expect = 1.604e-48
Identity = 184/711 (25.88%), Postives = 322/711 (45.29%), Query Frame = 2
Query:  104 SVKENIYYSQPLLDLEKVLKNRTIIPYDKHQRYKIY---AVTEKASPFSLIDNRLSVVSN---IDRESICPIKNSLNDYDQSAETYNSQQSSHSCKYDECCTVFSFQVDSGIKISSFYILIKVLDENDNSPKFLPFLNPYQTLPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKL-VNVISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPAR--TIVASLQVSDRDSLVTDIECSLDDYHLNFEITAINEIHPLGHYKEF---IINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIF 2200
            +++EN+    P+L L     +    P + + RY+     AV   A+    ID R  ++S    +DRE        +  Y+   E  +  Q                  + G + ++  + I VLDENDN+P+F       Q + E+ + +TV+L  +A D D +A G+ +Y I    + GN      +D +     ++ +++PLD E   EY   ++A D       + +G+   I+V DIND+ P+F  T +  +++E++ L  +VI     D D G+N ++  ++                  F  +  TG + +   +D E+  + Y F + A D+G P LS++A V + +++ ND  P        E   +   +  NE A   T V S+   DRD+          +  ++++IT  N  +      +    ++    PLD + ++  Y K+ +  SD+     L  +  +HIN+ D N + PVF  + Y   + E+ P  +  ++  I   D D G+NA +TY ++      +   F IDADSG I+ +  +DYE    ++  I A D      + T  + V V D NDNAP F   HY+  V E+ P  T + QI  TD D     + V+Y  ++  +      ++  SG ++T+  +DRE V    +   A +         + +   + +T++DVNDN P+F
Sbjct:  432 TLRENVEEGYPILQLRATDGD---APPNANLRYRFVGSPAVRTAAAAAFEIDPRSGLISTSGRVDREH-------MESYELVVEASDQGQ------------------EPGPRSATVRVHITVLDENDNAPQFSEKRYVAQ-VREDVRPHTVVLRVTATDKDKDANGLVHYNI----ISGNSRGHFAIDSLTG---EIQVMAPLDFEAEREYALRIRAQDAGRPPLSNNTGL-ASIQVVDINDHAPIFVSTPFQVSVLENAPLGHSVIHIQAVDADHGENSRLEYSLTGVAS----------DTPFVINSATGWVSVSGPLDRESVEH-YFFGVEARDHGSPPLSASASVTVTVLDVNDNRP--------EFTMKEYHLRLNEDAAVGTSVVSVTAVDRDA----------NSAISYQITGGNTRNRFAISTQGGVGLVTLALPLDYKQER--YFKLVLTASDR----ALHDHCYVHINITDANTHRPVFQSAHYSVSMNEDRPVGSTVVV--ISASDDDVGENARITYLLED-----NLPQFRIDADSGAITLQAPLDYEDQVTYTLAITARDNGIPQKADTTYVEVMVNDVNDNAPQFVASHYTGLVSEDAPPFTSVLQISATDRDAHANGR-VQYTFQNGEDGDGDFTIEPTSGIVRTVRRLDREAVPVYELTAYAVDRGVPP----LRTPVSIQVTVQDVNDNAPVF 1058          

HSP 2 Score: 143.665 bits (361), Expect = 6.794e-34
Identity = 154/590 (26.10%), Postives = 252/590 (42.71%), Query Frame = 2
Query:  446 IKVLDENDNSPKFLPFLNPYQ-TLPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKL-VNVISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRD-SLVTDIECSLDDYHLNFEITAINEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLT-IHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIFS 2203
            I+V+D ND++P F+    P+Q ++ EN+ +   ++   A+D D        Y ++    + +D+ F     I S    + +  PLDRE +  Y F ++A  R++      +   V + V D+NDN P F    Y   + E + +  +V+S  VT +D   N  +S  I   N   +  I        S     G + L   +DY+   Y +   L A+D  L        V+I + + N   PV +          S++M E+ P  + V  +  SD D      I   L+D    F I A              I    PLD ED     L I    + +D   P   + T + + + D+NDN P F  S Y G + E+ P  T   +  I   D+D   N  V Y   + ++  D + FTI+  SG + + + +D E   ++     A+D+    L +   I V V D NDNAP+FP   +   V+EN  V + + QI   D D  P   I+  +     N  ++  +D  SG+L  +  +D E  +   I++ A +         + S   V + + D NDN P+ +
Sbjct:  630 IQVVDINDHAPIFVS--TPFQVSVLENAPLGHSVIHIQAVDADHGENSRLEYSLTG---VASDTPFV----INSATGWVSVSGPLDRESVEHYFFGVEA--RDHGSPPLSASASVTVTVLDVNDNRPEFTMKEYHLRLNEDAAVGTSVVS--VTAVDRDANSAISYQITGGNTRNRFAI--------STQGGVGLVTLALPLDYKQERY-FKLVLTASDRAL---HDHCYVHINITDANTHRPVFQS------AHYSVSMNEDRPVGSTVVVISASDDDVGENARITYLLEDNLPQFRIDA----------DSGAITLQAPLDYEDQVTYTLAI----TARDNGIPQKADTTYVEVMVNDVNDNAPQFVASHYTGLVSEDAPPFT--SVLQISATDRDAHANGRVQYTFQNGEDG-DGD-FTIEPTSGIVRTVRRLDREAVPVYELTAYAVDRGVPPLRTPVSIQVTVQDVNDNAPVFPAEEFEVRVKENSIVGSVVAQITAVDPDDGPNAHIM--YQIVEGNIPELFQMDIFSGELTALIDLDYEARQEYVIVVQATSAP-------LVSRATVHVRLVDQNDNSPVLN 1161          

HSP 3 Score: 141.739 bits (356), Expect = 2.159e-33
Identity = 184/717 (25.66%), Postives = 297/717 (41.42%), Query Frame = 2
Query:  476 PKFLPFLNPYQTL-PENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLI---SPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEH-SKLVNVISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGL---PRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITAINEIHPLGHYK----EFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLT--IHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKY-FHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIFSLINPAKSSLIFTINKGFRHENCQMIPYAVSDADHDEPNSDSCCILQLDNDQNG----MLYLLS-NTPNF--------LCLQNTMNTPG--IYRVSLTATDNKNNPNKSLKAKVSFNIDVRHEVSDN 2536
            P+F P  N YQTL PEN    T +L   A D D    G   Y ++    + N     L     S  PQ  LI   + LDRE  S  R  L+   +++   R  +   V + V D ND+ PVF++  Y   + E+  +   ++    TD D   N  +       +   +      F+ID    L++ S R +D    E+    Y   + A+D G    PR S+T +V+I ++++ND AP     R    V       E+    T+V  +  +D+D     +        +++ I + N     GH+        I  + PLD E ++   L+I      QD   P  +N T    I + DIND+ P+F  + +Q  ++EN P      +  I  +D DHG+N+ + Y +    + T    F I++ +G +S    +D E  + + F + A D     LS++A + V V+D NDN P F    Y   + E+  V T +  +   D D    N  + Y      T N   I      G +    P+D ++ R   +++TA + A       +   C V I I D N + P+F                       Q   Y+VS  + D P   +  ++   +D  G    + YLL  N P F        + LQ  ++      Y +++TA DN   P K+    V   ++   +V+DN
Sbjct:  314 PQF-PQYN-YQTLVPENEAAGTSVLRVVAQDPDPGEAGRLIYSLAA---LMNSRSLELF----SIDPQSGLIRTAAALDRE--SMERHYLRVTAQDHGSPRLSATTMVAVTVADRNDHAPVFEQAQYRETLRENVEEGYPILQLRATDGDAPPNANLRYRF-VGSPAVRTAAAAAFEIDPRSGLISTSGR-VDREHMES----YELVVEASDQGQEPGPR-SATVRVHITVLDENDNAPQFSEKRYVAQVR------EDVRPHTVVLRVTATDKDKDANGL--------VHYNIISGNS---RGHFAIDSLTGEIQVMAPLDFEAEREYALRIRA----QDAGRPPLSNNTGLASIQVVDINDHAPIFVSTPFQVSVLENAPLG--HSVIHIQAVDADHGENSRLEYSLTGVASDTP---FVINSATGWVSVSGPLDRESVEHYFFGVEARDHGSPPLSASASVTVTVLDVNDNRPEFTMKEYHLRLNEDAAVGTSVVSVTAVDRDA---NSAISYQITGGNTRNRFAISTQGGVGLVTLALPLDYKQERYFKLVLTASDRA-------LHDHCYVHINITDANTHRPVF-----------------------QSAHYSVS-MNEDRPVGSTVVVISASDDDVGENARITYLLEDNLPQFRIDADSGAITLQAPLDYEDQVTYTLAITARDN-GIPQKADTTYVEVMVN---DVNDN 948          
BLAST of Protocadherin Fat 1 vs. Ensembl Mouse
Match: Celsr3 (cadherin, EGF LAG seven-pass G-type receptor 3 [Source:MGI Symbol;Acc:MGI:1858236])

HSP 1 Score: 191.045 bits (484), Expect = 1.605e-48
Identity = 184/711 (25.88%), Postives = 322/711 (45.29%), Query Frame = 2
Query:  104 SVKENIYYSQPLLDLEKVLKNRTIIPYDKHQRYKIY---AVTEKASPFSLIDNRLSVVSN---IDRESICPIKNSLNDYDQSAETYNSQQSSHSCKYDECCTVFSFQVDSGIKISSFYILIKVLDENDNSPKFLPFLNPYQTLPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKL-VNVISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPAR--TIVASLQVSDRDSLVTDIECSLDDYHLNFEITAINEIHPLGHYKEF---IINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIF 2200
            +++EN+    P+L L     +    P + + RY+     AV   A+    ID R  ++S    +DRE        +  Y+   E  +  Q                  + G + ++  + I VLDENDN+P+F       Q + E+ + +TV+L  +A D D +A G+ +Y I    + GN      +D +     ++ +++PLD E   EY   ++A D       + +G+   I+V DIND+ P+F  T +  +++E++ L  +VI     D D G+N ++  ++                  F  +  TG + +   +D E+  + Y F + A D+G P LS++A V + +++ ND  P        E   +   +  NE A   T V S+   DRD+          +  ++++IT  N  +      +    ++    PLD + ++  Y K+ +  SD+     L  +  +HIN+ D N + PVF  + Y   + E+ P  +  ++  I   D D G+NA +TY ++      +   F IDADSG I+ +  +DYE    ++  I A D      + T  + V V D NDNAP F   HY+  V E+ P  T + QI  TD D     + V+Y  ++  +      ++  SG ++T+  +DRE V    +   A +         + +   + +T++DVNDN P+F
Sbjct:  432 TLRENVEEGYPILQLRATDGD---APPNANLRYRFVGSPAVRTAAAAAFEIDPRSGLISTSGRVDREH-------MESYELVVEASDQGQ------------------EPGPRSATVRVHITVLDENDNAPQFSEKRYVAQ-VREDVRPHTVVLRVTATDKDKDANGLVHYNI----ISGNSRGHFAIDSLTG---EIQVMAPLDFEAEREYALRIRAQDAGRPPLSNNTGL-ASIQVVDINDHAPIFVSTPFQVSVLENAPLGHSVIHIQAVDADHGENSRLEYSLTGVAS----------DTPFVINSATGWVSVSGPLDRESVEH-YFFGVEARDHGSPPLSASASVTVTVLDVNDNRP--------EFTMKEYHLRLNEDAAVGTSVVSVTAVDRDA----------NSAISYQITGGNTRNRFAISTQGGVGLVTLALPLDYKQER--YFKLVLTASDR----ALHDHCYVHINITDANTHRPVFQSAHYSVSMNEDRPVGSTVVV--ISASDDDVGENARITYLLED-----NLPQFRIDADSGAITLQAPLDYEDQVTYTLAITARDNGIPQKADTTYVEVMVNDVNDNAPQFVASHYTGLVSEDAPPFTSVLQISATDRDAHANGR-VQYTFQNGEDGDGDFTIEPTSGIVRTVRRLDREAVPVYELTAYAVDRGVPP----LRTPVSIQVTVQDVNDNAPVF 1058          

HSP 2 Score: 143.665 bits (361), Expect = 6.797e-34
Identity = 154/590 (26.10%), Postives = 252/590 (42.71%), Query Frame = 2
Query:  446 IKVLDENDNSPKFLPFLNPYQ-TLPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKL-VNVISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRD-SLVTDIECSLDDYHLNFEITAINEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLT-IHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIFS 2203
            I+V+D ND++P F+    P+Q ++ EN+ +   ++   A+D D        Y ++    + +D+ F     I S    + +  PLDRE +  Y F ++A  R++      +   V + V D+NDN P F    Y   + E + +  +V+S  VT +D   N  +S  I   N   +  I        S     G + L   +DY+   Y +   L A+D  L        V+I + + N   PV +          S++M E+ P  + V  +  SD D      I   L+D    F I A              I    PLD ED     L I    + +D   P   + T + + + D+NDN P F  S Y G + E+ P  T   +  I   D+D   N  V Y   + ++  D + FTI+  SG + + + +D E   ++     A+D+    L +   I V V D NDNAP+FP   +   V+EN  V + + QI   D D  P   I+  +     N  ++  +D  SG+L  +  +D E  +   I++ A +         + S   V + + D NDN P+ +
Sbjct:  630 IQVVDINDHAPIFVS--TPFQVSVLENAPLGHSVIHIQAVDADHGENSRLEYSLTG---VASDTPFV----INSATGWVSVSGPLDRESVEHYFFGVEA--RDHGSPPLSASASVTVTVLDVNDNRPEFTMKEYHLRLNEDAAVGTSVVS--VTAVDRDANSAISYQITGGNTRNRFAI--------STQGGVGLVTLALPLDYKQERY-FKLVLTASDRAL---HDHCYVHINITDANTHRPVFQS------AHYSVSMNEDRPVGSTVVVISASDDDVGENARITYLLEDNLPQFRIDA----------DSGAITLQAPLDYEDQVTYTLAI----TARDNGIPQKADTTYVEVMVNDVNDNAPQFVASHYTGLVSEDAPPFT--SVLQISATDRDAHANGRVQYTFQNGEDG-DGD-FTIEPTSGIVRTVRRLDREAVPVYELTAYAVDRGVPPLRTPVSIQVTVQDVNDNAPVFPAEEFEVRVKENSIVGSVVAQITAVDPDDGPNAHIM--YQIVEGNIPELFQMDIFSGELTALIDLDYEARQEYVIVVQATSAP-------LVSRATVHVRLVDQNDNSPVLN 1161          

HSP 3 Score: 141.739 bits (356), Expect = 2.160e-33
Identity = 184/717 (25.66%), Postives = 297/717 (41.42%), Query Frame = 2
Query:  476 PKFLPFLNPYQTL-PENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLI---SPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEH-SKLVNVISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGL---PRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITAINEIHPLGHYK----EFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLT--IHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKY-FHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIFSLINPAKSSLIFTINKGFRHENCQMIPYAVSDADHDEPNSDSCCILQLDNDQNG----MLYLLS-NTPNF--------LCLQNTMNTPG--IYRVSLTATDNKNNPNKSLKAKVSFNIDVRHEVSDN 2536
            P+F P  N YQTL PEN    T +L   A D D    G   Y ++    + N     L     S  PQ  LI   + LDRE  S  R  L+   +++   R  +   V + V D ND+ PVF++  Y   + E+  +   ++    TD D   N  +       +   +      F+ID    L++ S R +D    E+    Y   + A+D G    PR S+T +V+I ++++ND AP     R    V       E+    T+V  +  +D+D     +        +++ I + N     GH+        I  + PLD E ++   L+I      QD   P  +N T    I + DIND+ P+F  + +Q  ++EN P      +  I  +D DHG+N+ + Y +    + T    F I++ +G +S    +D E  + + F + A D     LS++A + V V+D NDN P F    Y   + E+  V T +  +   D D    N  + Y      T N   I      G +    P+D ++ R   +++TA + A       +   C V I I D N + P+F                       Q   Y+VS  + D P   +  ++   +D  G    + YLL  N P F        + LQ  ++      Y +++TA DN   P K+    V   ++   +V+DN
Sbjct:  314 PQF-PQYN-YQTLVPENEAAGTSVLRVVAQDPDPGEAGRLIYSLAA---LMNSRSLELF----SIDPQSGLIRTAAALDRE--SMERHYLRVTAQDHGSPRLSATTMVAVTVADRNDHAPVFEQAQYRETLRENVEEGYPILQLRATDGDAPPNANLRYRF-VGSPAVRTAAAAAFEIDPRSGLISTSGR-VDREHMES----YELVVEASDQGQEPGPR-SATVRVHITVLDENDNAPQFSEKRYVAQVR------EDVRPHTVVLRVTATDKDKDANGL--------VHYNIISGNS---RGHFAIDSLTGEIQVMAPLDFEAEREYALRIRA----QDAGRPPLSNNTGLASIQVVDINDHAPIFVSTPFQVSVLENAPLG--HSVIHIQAVDADHGENSRLEYSLTGVASDTP---FVINSATGWVSVSGPLDRESVEHYFFGVEARDHGSPPLSASASVTVTVLDVNDNRPEFTMKEYHLRLNEDAAVGTSVVSVTAVDRDA---NSAISYQITGGNTRNRFAISTQGGVGLVTLALPLDYKQERYFKLVLTASDRA-------LHDHCYVHINITDANTHRPVF-----------------------QSAHYSVS-MNEDRPVGSTVVVISASDDDVGENARITYLLEDNLPQFRIDADSGAITLQAPLDYEDQVTYTLAITARDN-GIPQKADTTYVEVMVN---DVNDN 948          
BLAST of Protocadherin Fat 1 vs. Ensembl Mouse
Match: Celsr3 (cadherin, EGF LAG seven-pass G-type receptor 3 [Source:MGI Symbol;Acc:MGI:1858236])

HSP 1 Score: 191.045 bits (484), Expect = 1.605e-48
Identity = 184/711 (25.88%), Postives = 322/711 (45.29%), Query Frame = 2
Query:  104 SVKENIYYSQPLLDLEKVLKNRTIIPYDKHQRYKIY---AVTEKASPFSLIDNRLSVVSN---IDRESICPIKNSLNDYDQSAETYNSQQSSHSCKYDECCTVFSFQVDSGIKISSFYILIKVLDENDNSPKFLPFLNPYQTLPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKL-VNVISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPAR--TIVASLQVSDRDSLVTDIECSLDDYHLNFEITAINEIHPLGHYKEF---IINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIF 2200
            +++EN+    P+L L     +    P + + RY+     AV   A+    ID R  ++S    +DRE        +  Y+   E  +  Q                  + G + ++  + I VLDENDN+P+F       Q + E+ + +TV+L  +A D D +A G+ +Y I    + GN      +D +     ++ +++PLD E   EY   ++A D       + +G+   I+V DIND+ P+F  T +  +++E++ L  +VI     D D G+N ++  ++                  F  +  TG + +   +D E+  + Y F + A D+G P LS++A V + +++ ND  P        E   +   +  NE A   T V S+   DRD+          +  ++++IT  N  +      +    ++    PLD + ++  Y K+ +  SD+     L  +  +HIN+ D N + PVF  + Y   + E+ P  +  ++  I   D D G+NA +TY ++      +   F IDADSG I+ +  +DYE    ++  I A D      + T  + V V D NDNAP F   HY+  V E+ P  T + QI  TD D     + V+Y  ++  +      ++  SG ++T+  +DRE V    +   A +         + +   + +T++DVNDN P+F
Sbjct:  432 TLRENVEEGYPILQLRATDGD---APPNANLRYRFVGSPAVRTAAAAAFEIDPRSGLISTSGRVDREH-------MESYELVVEASDQGQ------------------EPGPRSATVRVHITVLDENDNAPQFSEKRYVAQ-VREDVRPHTVVLRVTATDKDKDANGLVHYNI----ISGNSRGHFAIDSLTG---EIQVMAPLDFEAEREYALRIRAQDAGRPPLSNNTGL-ASIQVVDINDHAPIFVSTPFQVSVLENAPLGHSVIHIQAVDADHGENSRLEYSLTGVAS----------DTPFVINSATGWVSVSGPLDRESVEH-YFFGVEARDHGSPPLSASASVTVTVLDVNDNRP--------EFTMKEYHLRLNEDAAVGTSVVSVTAVDRDA----------NSAISYQITGGNTRNRFAISTQGGVGLVTLALPLDYKQER--YFKLVLTASDR----ALHDHCYVHINITDANTHRPVFQSAHYSVSMNEDRPVGSTVVV--ISASDDDVGENARITYLLED-----NLPQFRIDADSGAITLQAPLDYEDQVTYTLAITARDNGIPQKADTTYVEVMVNDVNDNAPQFVASHYTGLVSEDAPPFTSVLQISATDRDAHANGR-VQYTFQNGEDGDGDFTIEPTSGIVRTVRRLDREAVPVYELTAYAVDRGVPP----LRTPVSIQVTVQDVNDNAPVF 1058          

HSP 2 Score: 143.665 bits (361), Expect = 6.797e-34
Identity = 154/590 (26.10%), Postives = 252/590 (42.71%), Query Frame = 2
Query:  446 IKVLDENDNSPKFLPFLNPYQ-TLPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKL-VNVISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRD-SLVTDIECSLDDYHLNFEITAINEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLT-IHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIFS 2203
            I+V+D ND++P F+    P+Q ++ EN+ +   ++   A+D D        Y ++    + +D+ F     I S    + +  PLDRE +  Y F ++A  R++      +   V + V D+NDN P F    Y   + E + +  +V+S  VT +D   N  +S  I   N   +  I        S     G + L   +DY+   Y +   L A+D  L        V+I + + N   PV +          S++M E+ P  + V  +  SD D      I   L+D    F I A              I    PLD ED     L I    + +D   P   + T + + + D+NDN P F  S Y G + E+ P  T   +  I   D+D   N  V Y   + ++  D + FTI+  SG + + + +D E   ++     A+D+    L +   I V V D NDNAP+FP   +   V+EN  V + + QI   D D  P   I+  +     N  ++  +D  SG+L  +  +D E  +   I++ A +         + S   V + + D NDN P+ +
Sbjct:  630 IQVVDINDHAPIFVS--TPFQVSVLENAPLGHSVIHIQAVDADHGENSRLEYSLTG---VASDTPFV----INSATGWVSVSGPLDRESVEHYFFGVEA--RDHGSPPLSASASVTVTVLDVNDNRPEFTMKEYHLRLNEDAAVGTSVVS--VTAVDRDANSAISYQITGGNTRNRFAI--------STQGGVGLVTLALPLDYKQERY-FKLVLTASDRAL---HDHCYVHINITDANTHRPVFQS------AHYSVSMNEDRPVGSTVVVISASDDDVGENARITYLLEDNLPQFRIDA----------DSGAITLQAPLDYEDQVTYTLAI----TARDNGIPQKADTTYVEVMVNDVNDNAPQFVASHYTGLVSEDAPPFT--SVLQISATDRDAHANGRVQYTFQNGEDG-DGD-FTIEPTSGIVRTVRRLDREAVPVYELTAYAVDRGVPPLRTPVSIQVTVQDVNDNAPVFPAEEFEVRVKENSIVGSVVAQITAVDPDDGPNAHIM--YQIVEGNIPELFQMDIFSGELTALIDLDYEARQEYVIVVQATSAP-------LVSRATVHVRLVDQNDNSPVLN 1161          

HSP 3 Score: 141.739 bits (356), Expect = 2.160e-33
Identity = 184/717 (25.66%), Postives = 297/717 (41.42%), Query Frame = 2
Query:  476 PKFLPFLNPYQTL-PENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLI---SPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEH-SKLVNVISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGL---PRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITAINEIHPLGHYK----EFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLT--IHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKY-FHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIFSLINPAKSSLIFTINKGFRHENCQMIPYAVSDADHDEPNSDSCCILQLDNDQNG----MLYLLS-NTPNF--------LCLQNTMNTPG--IYRVSLTATDNKNNPNKSLKAKVSFNIDVRHEVSDN 2536
            P+F P  N YQTL PEN    T +L   A D D    G   Y ++    + N     L     S  PQ  LI   + LDRE  S  R  L+   +++   R  +   V + V D ND+ PVF++  Y   + E+  +   ++    TD D   N  +       +   +      F+ID    L++ S R +D    E+    Y   + A+D G    PR S+T +V+I ++++ND AP     R    V       E+    T+V  +  +D+D     +        +++ I + N     GH+        I  + PLD E ++   L+I      QD   P  +N T    I + DIND+ P+F  + +Q  ++EN P      +  I  +D DHG+N+ + Y +    + T    F I++ +G +S    +D E  + + F + A D     LS++A + V V+D NDN P F    Y   + E+  V T +  +   D D    N  + Y      T N   I      G +    P+D ++ R   +++TA + A       +   C V I I D N + P+F                       Q   Y+VS  + D P   +  ++   +D  G    + YLL  N P F        + LQ  ++      Y +++TA DN   P K+    V   ++   +V+DN
Sbjct:  314 PQF-PQYN-YQTLVPENEAAGTSVLRVVAQDPDPGEAGRLIYSLAA---LMNSRSLELF----SIDPQSGLIRTAAALDRE--SMERHYLRVTAQDHGSPRLSATTMVAVTVADRNDHAPVFEQAQYRETLRENVEEGYPILQLRATDGDAPPNANLRYRF-VGSPAVRTAAAAAFEIDPRSGLISTSGR-VDREHMES----YELVVEASDQGQEPGPR-SATVRVHITVLDENDNAPQFSEKRYVAQVR------EDVRPHTVVLRVTATDKDKDANGL--------VHYNIISGNS---RGHFAIDSLTGEIQVMAPLDFEAEREYALRIRA----QDAGRPPLSNNTGLASIQVVDINDHAPIFVSTPFQVSVLENAPLG--HSVIHIQAVDADHGENSRLEYSLTGVASDTP---FVINSATGWVSVSGPLDRESVEHYFFGVEARDHGSPPLSASASVTVTVLDVNDNRPEFTMKEYHLRLNEDAAVGTSVVSVTAVDRDA---NSAISYQITGGNTRNRFAISTQGGVGLVTLALPLDYKQERYFKLVLTASDRA-------LHDHCYVHINITDANTHRPVF-----------------------QSAHYSVS-MNEDRPVGSTVVVISASDDDVGENARITYLLEDNLPQFRIDADSGAITLQAPLDYEDQVTYTLAITARDN-GIPQKADTTYVEVMVN---DVNDN 948          
BLAST of Protocadherin Fat 1 vs. UniProt/SwissProt
Match: sp|Q2PZL6|FAT4_MOUSE (Protocadherin Fat 4 OS=Mus musculus OX=10090 GN=Fat4 PE=1 SV=2)

HSP 1 Score: 192.586 bits (488), Expect = 4.261e-48
Identity = 181/610 (29.67%), Postives = 284/610 (46.56%), Query Frame = 2
Query:  440 ILIKVLDENDNSPKFLPFLNPYQTLPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKI--ASGRPQLL-LIS--PLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKL-VNVISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIECSL------DDYHLNFEITAINEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLT--------TNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKI--SSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPH-YSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIF 2200
            + + V D NDN+P F P  +   T  E+S     ++L +A D D  + G+ ++  S   + GN++    LD     SG    L L+S   LDREV  +Y+ +++  D+     R    ++V + V DINDNPPVF  + Y A + E + +  +V+     D DEG N  +   ++ E           FQ+D      TG I + + +D+E    +YS  + ATD G+P L+  A+  I L++ ND  PV+K  R     SR  ++ EN    T+VA L V+D DS   +   S+      +  H   + + +  +         +I     LDRE   +  L +++  SD     P           +L I +N  DIND+PPVF +  Y+  L E +P  +   +  +   D D G NA + Y I  S N   W  F I   SG +  S+   +D E       NI A D+      S A ++V V+D ND  P+F +P  Y  +V EN P  TE+  +  TD D   +N  V++  +   N+ ++  +D  SG+L T   +DRE+     + I A +  S        S   V +++ D+NDN P+F
Sbjct:  121 VRVLVRDLNDNAPVF-PDPSIVVTFKEDSGSGRQVILDTATDSDIGSNGVDHH--SYRIVSGNEAGRFRLDITLNPSGEGAFLHLVSKGGLDREVTPQYQLLVEVEDKGEPKRRGY--LQVNVTVQDINDNPPVFGSSHYQAGVPEDAVVGSSVLQVAAADADEGTNADIRYRLQDEGTP--------FQMDPE----TGLITVREPLDFEAR-RQYSLTVQATDRGVPSLTGRAEAFIQLLDVNDNDPVVK-FRYFPATSRYASVDENAQVGTVVALLTVTDADSPAANGNISVQILGGNEQRHFEVQRSKVPNLS--------LIKVASALDRERIPSYNLTVSV--SDNSGAPPTAEVQARSSVASLVIFVN--DINDHPPVFEQQVYRVNLSEEVPPGS--YVSGVSATDGDSGLNANLRYSI-VSGNGLGW--FHISEHSGLVTTSAAGGLDRELASQIVLNISARDQGVHPKVSYAQLVVTVLDVNDEKPVFSQPEGYEVSVVENAPTGTELLVLGATDRDLG-DNGTVRFSLQEAENDQRLFRLDPVSGRLSTASSLDREEQAFYCLSILATDLGSPPQS----STAQVNVSLLDINDNSPVF 689          

HSP 2 Score: 186.808 bits (473), Expect = 2.473e-46
Identity = 184/654 (28.13%), Postives = 294/654 (44.95%), Query Frame = 2
Query:  440 ILIKVLDENDNSPKFLPFLNPYQTLPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKLVNVIS-FYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITAINEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKI-DSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIFSLINPAKSSLIFTINKGFRHENCQMIPYA----VSDADHDEPNSDSCCILQLDNDQNGMLYLLSN 2383
            + I + D NDN P F P      T+ EN    + I+  +A+D D  A  +  Y +    + G D  F    +I      L+    LDRE  S+Y  +++A     DD    S + + I + D+ND+ P F +  Y+ +I E +   ++++    TD D G N ++S  +E     + D    FF      +L+TG   L   +DYET  Y Y   + A D G    S+T +    +++ ND  PV        + S S ++ EN P  + V    V+D D  V        +  L++ I + + +      K  ++ TLK LDRE      L I ++   Q   +  T+   + I L D+NDNPP+F   K    + EN P  TV  +      D D G N+Y+ Y + + S N      F+I    G++     +D E+   +S  ++A DK Q  LSS+  ++V V+D NDN P+F +  Y   ++EN+   T+I Q+   D D    N  V+Y      N +Q   +D  +G +     +DRE   + T+ + A +  S    +     C V IT+ D+ND  P+F L +P      +++N     EN   +P A    V+  D   PNS    +L   N+ N  +   S 
Sbjct: 1726 VEITLQDINDNPPVF-PTDTLDLTVEENIGDGSKIMQLTAMDADEGANALVTYAL----ISGADDSF----RIDPESGDLIATKRLDREHRSKYSLLVRA-----DDGLQSSDMRINITISDVNDHTPRFSRPVYSFDIPEDTTPGSLVAAILATDDDSGVNGEISYVVE-----EDDGDGVFFL-----NLVTGVFNLTRALDYETQQY-YILTVRAEDGG--GQSTTIRAYFNILDVNDNPPVFS------MSSYSTSLMENLPLGSTVLVFNVTDADDGV--------NSQLSYSIASGDSLGQFAVDKHGVLKTLKALDRESQSFYNLVIQVHDLPQPPTSRFTSTAQVSIILLDVNDNPPMFLSPKLT-YIPENTPIDTV--VFKAQATDPDSGPNSYIEYTLLNPSGNK-----FSIGTIDGEVHLTGELDREEVSNYSLTVVATDKGQPPLSSSTEVVVMVLDINDNNPVFAQAMYRVQIKENILTGTDIIQVSAADND-EGTNGQVRYGIVG-GNTHQEFRIDSVTGAITVAKSLDRETTPAYTLTVQATDRGSSPRTD----SCTVAITLLDMNDFVPVFEL-SP------YSVNV---PENLGTLPRAILQVVARDDDQGPNSQLSYVLLGGNEDNAFVLTASG 2314          

HSP 3 Score: 176.022 bits (445), Expect = 5.405e-43
Identity = 169/603 (28.03%), Postives = 273/603 (45.27%), Query Frame = 2
Query:  443 LIKVLDENDNSP----KFLPFLNPYQTLPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDS-HFTLLDKIASGRPQLLLI---SPLDREVISEYRFILKAVDREN-----DDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKLVNVIS-FYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTD---IECSLDDYHLNFEITAINEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIF 2200
             I++LD NDN P    ++ P  + Y ++ EN+Q+ TV+ L +  D DS A       IS   L GN+  HF +     S  P L LI   S LDRE I  Y   +   D        +     S   + I V DIND+PPVF++  Y  N+ E     + +S    TD D G N  +  +I + N         +F I     L+T S      +D E    +   N+ A D G+    S A++ + +++ ND+ PV       E+     ++ EN P  T +  L  +DRD  + D   +  SL +   +  +  ++ +          ++T   LDRE+    +  ++I  +D     P ++   ++++L DINDN PVF   +Y   + EN P  +   +  +   D D G N  V Y I +     D   F I A SG IS++ ++D E+   +   ++A D       + A++ V V+D  DN P+F +  YSF V ENV +   +G +  T +D    N  + Y   +  +   +  ++  +G+L T   IDRE+     + I A   A       +  + +V IT++D+NDN P F
Sbjct:  340 FIQLLDVNDNDPVVKFRYFPATSRYASVDENAQVGTVVALLTVTDADSPA---ANGNISVQILGGNEQRHFEVQ---RSKVPNLSLIKVASALDRERIPSYNLTVSVSDNSGAPPTAEVQARSSVASLVIFVNDINDHPPVFEQQVYRVNLSEEVPPGSYVSGVSATDGDSGLNANLRYSIVSGNGLG------WFHISEHSGLVTTSA--AGGLDREL-ASQIVLNISARDQGVHPKVSYAQLVVTVLDVNDEKPVFSQPEGYEV-----SVVENAPTGTELLVLGATDRD--LGDNGTVRFSLQEAENDQRLFRLDPVSGR-------LSTASSLDREEQA--FYCLSILATDLGS-PPQSSTAQVNVSLLDINDNSPVFYPVQYFAHIQENEPGGS--YVTTVSATDPDMGPNGTVKYSISAG----DRSRFQIHAKSGVISTKMALDREEKTAYQLQVVATDGGNLQSPNQAIVTVTVLDTQDNPPVFSQAAYSFVVFENVALGYHVGSVSATTMDL---NANISYLITT-GDQRGMFAMNPVTGQLTTASVIDREEQSFYQLKIVASGGA-------VTGDTVVNITVKDLNDNAPHF 893          

HSP 4 Score: 162.155 bits (409), Expect = 9.274e-39
Identity = 164/611 (26.84%), Postives = 284/611 (46.48%), Query Frame = 2
Query:  404 QVDSGIKISSFYILIKVLDENDNSPKFLPFLNPYQTLPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKLVN-VISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLP-----RLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMF-ENEPARTIVASLQVSDRDSLVTD-IECSLDDYHLN-FEITAI-NEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVP-VNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIFS 2203
            + D G++ S   I I + D ND++P+F   +  +  +PE++   +++    A D DS   G   Y + +     +D        + +G     L   LD E    Y   ++A D         + +     + D+NDNPPVF  + Y+ +++E+  L + V+ F VTD D+G N Q+S +I + +   +      F +D       G ++ +  +D E+  +   +NL+   + LP     R +STA+V+IIL++ ND  P+         +S  +T   EN P  T+V   Q +D DS     IE +L +   N F I  I  E+H  G            LDRE+  N  L   +  +D+ +  PL+++  + + + DINDN PVF ++ Y+ ++ ENI   T  +I+ +   D D G N  V Y I       +   F ID+ +G I+  +S+D E    ++  + A D+  S  + +  + + ++D ND  P+F    YS  V EN+  +   I Q+   D D  P +++         +N  V+     SG+L+    +DRE      +++TA +  S      +     + I ++D+NDN P F+
Sbjct: 1815 RADDGLQSSDMRINITISDVNDHTPRFSRPVYSFD-IPEDTTPGSLVAAILATDDDSGVNGEISYVVEE-----DDGDGVFFLNLVTG--VFNLTRALDYETQQYYILTVRAEDGGGQS----TTIRAYFNILDVNDNPPVFSMSSYSTSLMENLPLGSTVLVFNVTDADDGVNSQLSYSIASGDSLGQ------FAVD-----KHGVLKTLKALDRESQSF---YNLVIQVHDLPQPPTSRFTSTAQVSIILLDVNDNPPM--------FLSPKLTYIPENTPIDTVVFKAQATDPDSGPNSYIEYTLLNPSGNKFSIGTIDGEVHLTGE-----------LDREEVSNYSL--TVVATDKGQ-PPLSSSTEVVVMVLDINDNNPVFAQAMYRVQIKENILTGT-DIIQ-VSAADNDEGTNGQVRYGIVGGNTHQE---FRIDSVTGAITVAKSLDRETTPAYTLTVQATDRGSSPRTDSCTVAITLLDMNDFVPVFELSPYSVNVPENLGTLPRAILQVVARDDDQGPNSQLSYVLLGGNEDNAFVLTA---SGELRVTQSLDREARDHFVLVVTAADAGS----PALTGTGTINIIVDDINDNVPTFA 2365          

HSP 5 Score: 144.436 bits (363), Expect = 2.532e-33
Identity = 158/608 (25.99%), Postives = 259/608 (42.60%), Query Frame = 2
Query:  407 VDSGIKISSFYIL-IKVLDENDNSPKFLPFLNPYQTLPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKLVNVISFYV--TDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMF--ENEPARTIVASLQVSDRD-SLVTDIECSLDDYHLNFEITAINEIHPLGHYKEFIINTLKPLDRED----DKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIF 2200
            V SG  ++   ++ I V D NDN+P FL  +     + EN Q    I    A+D D    G   Y + +       + FT+ ++  +    + L+  LD    S Y+  + A D         S + + + V D+NDNPPVFD+  Y   + E S+ VN   F V  +D D G N +++ TI   N+     I              G + +  E+D E    +Y   ++A+D  +  LS+T  V ++L + ND  P+          S + T +  E + A + V  +   D+D     ++  + +    NFE+ A+      G      I +    DRE              +   D+    PL    T+H+ + DINDN P F +  YQ  + E     T   +  +   D D G N  + Y I       +   F ID+ SG+++    +DYE    +S  I A+D     L+ST  + + ++D NDN P FPK      V EN+ +   +  +  TD D+     +  ++  + +NN+    +  N+G +     +D E      + ITA++    Q +    S   V+I + D NDNPP F
Sbjct:  867 VASGGAVTGDTVVNITVKDLNDNAPHFLQAVESINAV-ENWQAGHSIFQAKAVDPDEGVNGRVLYSLKQ----NPKNLFTINEQNGN----ISLLGALDVHAGS-YQVEIVASDMGVPQLS--SSILLTVYVHDVNDNPPVFDQISYEVTLSE-SEPVNSRFFKVQASDKDSGANGEIAYTITDGNNGDAFGI-----------FPDGQLYIKSELDRELQD-RYVLLVVASDRAVEPLSATVNVTVLLEDVNDNRPLFN--------STNYTFYFEEEQRAGSFVGKVSAVDKDFGPNGEVRYAFEVTQPNFELHAVT-----GE-----ITSTHKFDRESLMRRRGTAVFSFTVTAMDRGLPQPLKDQATVHVYMKDINDNAPKFLKDFYQATVSETATNLT--QVLRVSASDVDEGSNGLIHYSI---LKGNEERQFAIDSFSGQVTLVGKLDYEATSAYSLLIQAVDSGAIPLNSTCTLSIDILDENDNTPSFPKSTLFVDVLENMRIGELVSSVTATDSDSGVNADL--HYTITGSNNHGTFSISPNTGSIFLAKKLDFETQSLYKLNITAKD----QGRPPRSSTMSVVIQVRDFNDNPPSF 1420          

HSP 6 Score: 141.354 bits (355), Expect = 2.209e-32
Identity = 168/671 (25.04%), Postives = 293/671 (43.67%), Query Frame = 2
Query:  422 KISSFYILIKVLDENDNSPKFLPFLNPYQTLPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDREND-DHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKLVNVI--SFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLI--ATDNGLPRLSSTAKVNIILINKND----QAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITAINEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIFSLIN---------PAKSS-LIFTINKGFRHENCQMIPYAVSDADHDEPNSDSCCILQLDNDQNGMLYLL 2377
            + S+  ++I+V D NDN P F P  + ++++ EN  + T ++  +A D D++  G   Y I +    GN  HF++ D++   +  +   + +DRE  + +   +KA D+    + R  +   V I V D+NDN P+F      A   + S ++  +  +    D DEG N +V   I    D     + R+          +G +R+   +     P +  +NLI  ATD G  R  ST ++ +IL   +     Q   I ++++GE +  ++   E    R   A ++       +  + C         E   +  +  +G  +  +I T   LDRE     YL +++Y  ++    P T    + I L DINDNPPVF        + ENI   + K+++ +  +D D G NA VTY + S  + +    F ID +SG + + + +D E    +S  + A D  Q   SS   I + + D ND+ P F +P YSF + E+    + +  I  TD D+    +I     +   +   V  ++  +G       +D E  +   + + A +           +       I DVNDNPP+FS+ +         P  S+ L+F +       N Q+  Y+++  D          + Q   D++G+L  L
Sbjct: 1400 RSSTMSVVIQVRDFNDNPPSFPPG-DIFKSIVENIPLGTSVISVTAHDPDADINGQLSYAIIQQMPRGN--HFSI-DEV---KGTIYTSAEIDREFANLFELTVKANDQAVPIETRRYALKNVTILVTDLNDNVPMFISQ--NALAADPSAMIGSVLTTIMAADPDEGANGEVEYEI-LNGDTDTFTVDRY----------SGDLRVASAL----VPSQLIYNLIVSATDLGPERRKSTTELTVILQGLDGPVFTQTKYITILKEGEPIGTNVISIEAASPRGSEAPVEY-----YIVSVRC---------EEKTVGRLFTIGR-QTGVIQTAAILDREQGACLYL-VDVYAIEKSSAFPRTQRAEVEITLQDINDNPPVFPTDTLDLTVEENIGDGS-KIMQ-LTAMDADEGANALVTYALISGADDS----FRIDPESGDLIATKRLDREHRSKYSLLVRADDGLQ---SSDMRINITISDVNDHTPRFSRPVYSFDIPEDTTPGSLVAAILATDDDSGVNGEISYVVEED--DGDGVFFLNLVTGVFNLTRALDYETQQYYILTVRAEDGGG------QSTTIRAYFNILDVNDNPPVFSMSSYSTSLMENLPLGSTVLVFNVTDADDGVNSQL-SYSIASGD---------SLGQFAVDKHGVLKTL 2003          

HSP 7 Score: 140.969 bits (354), Expect = 3.436e-32
Identity = 152/608 (25.00%), Postives = 272/608 (44.74%), Query Frame = 2
Query:  440 ILIKVLDENDNSPKF---LPFLNPYQTLPENSQINTVILLPSAIDLDS-----------EAFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDK-TFYTANIVEHSKL-VNVISFYVTDLDEGQNKQVSITI-ETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITAINEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIFSLIN 2212
            ++I V D ND+ P F   +  +N  + +P  S ++ V    SA D DS              G+ ++ IS+        H  L+   A+G         LDRE+ S+   +L    R+   H  +S  ++ + V D+ND  PVF +   Y  ++VE++     ++    TD D G N  V  ++ E END      +R F++D     ++G +     +D E   + Y  +++ATD G P  SSTA+VN+ L++ ND +PV   ++    +       ENEP  + V ++  +D D           +  + + I+A +      H K  +I+T   LDRE+ K  Y ++ +  +D   L      + + + + D  DNPPVF+++ Y   + EN+            T+D     NA ++Y I +         F ++  +G++++   ID E+   +   I+A       ++   ++ + V D NDNAP F +   S    EN      I Q +  D D     +++    ++  N   +  +++ +G +  +G +D     S  + I A +    Q    + S  ++ + + DVNDNPP+F  I+
Sbjct:  461 LVIFVNDINDHPPVFEQQVYRVNLSEEVPPGSYVSGV----SATDGDSGLNANLRYSIVSGNGLGWFHISE--------HSGLVTTSAAGG--------LDRELASQ--IVLNISARDQGVHPKVSYAQLVVTVLDVNDEKPVFSQPEGYEVSVVENAPTGTELLVLGATDRDLGDNGTVRFSLQEAEND------QRLFRLD----PVSGRLSTASSLDREEQAF-YCLSILATDLGSPPQSSTAQVNVSLLDINDNSPVFYPVQYFAHIQ------ENEPGGSYVTTVSATDPDMG--------PNGTVKYSISAGDRSRFQIHAKSGVISTKMALDREE-KTAY-QLQVVATDGGNLQSPNQAI-VTVTVLDTQDNPPVFSQAAYSFVVFENVALGYHVGSVSATTMDL----NANISYLITTGDQRG---MFAMNPVTGQLTTASVIDREEQSFYQLKIVA---SGGAVTGDTVVNITVKDLNDNAPHFLQAVESINAVENWQAGHSIFQAKAVDPDEGVNGRVLYSLKQNPKN---LFTINEQNGNISLLGALDVH-AGSYQVEIVASDMGVPQ----LSSSILLTVYVHDVNDNPPVFDQIS 1000          

HSP 8 Score: 138.658 bits (348), Expect = 1.725e-31
Identity = 156/574 (27.18%), Postives = 264/574 (45.99%), Query Frame = 2
Query:  512 LPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVE-VEIKVGDINDNPPVFDKTFYTANIVEHSKLVNVISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDI-ECSLDDYHLNFEITAINEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLF--------SFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIFS 2203
             PEN  + T++   +   L  E   + YY  S     GN      +D +     Q+ +  PLD E I +Y   ++A D         S  E ++I V DINDN P F++  + + I+E+     +++   TD D G N Q+   I   N           +  F+ +  TG IR I  +D E   + Y   + ++D G P  S++ KV I ++++ND AP     R  +I S  ++  EN P    V  +  SD D  +  I   S+ D  L F I          +  + +I+  +PL+RED     +++    S  D    ++T++TI +   DINDN P F+R  Y  +  E +P+   ++ + +   D D G N  V Y I S       EYF I+A +G+I ++Q + Y+    F        SF + A D+   +L S   + ++ +D+NDN P F +  Y   V +NV V T++ ++   D      N  V+YF  S  N+     +D ++G +     +  +  ++  I +TA+++ +      + S+ +V IT+ + N + P FS
Sbjct: 2578 FPENQPVGTLVTTITGSSLRGET--LSYYIAS-----GNLGDTFQIDPLTG---QVSISQPLDFEKIQKYVVWIEARD---GGFPPFSSYEKLDITVLDINDNAPTFEEDPFVSEILENLSPRKILTVSATDKDSGPNGQLDYEIVNGNQ----------ESSFTINHATGEIRSIRPLDREKISH-YELTVKSSDKGSPSQSTSVKVIISILDENDNAP-----RFSQIFSAYVS--ENSPLGYTVTRVTTSDEDIGINAISRYSIVDTSLPFTINP--------NTGDIVIS--RPLNREDTDRYRIRV----SAHDSGWTVSTDVTIFVT--DINDNTPRFSRPSYYLDCPE-LPELGSRVTQ-VSATDPDEGSNGQVFYFIKSQS-----EYFRINATTGEIFNKQVLKYQNVSGFSNVNINRHSFIVTASDRGNPSLLSETTVTINTVDSNDNPPQFLQNKYFTPVTKNVKVGTKLIKVTAVDDKDFGLNSEVEYF-VSDGNHLGKFKLDNDTGWISIASSLVSDLNQNFLIRVTAKDKGNPP----LSSQAVVHITVTEENYHTPEFS 3092          

HSP 9 Score: 134.42 bits (337), Expect = 3.391e-30
Identity = 165/614 (26.87%), Postives = 260/614 (42.35%), Query Frame = 2
Query:  428 SSFYILIKVLDENDNSPKFLPFLNPYQ-TLPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKLVNVIS-FYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYET-----NPYKYSFNLIATDNGLPR-LSSTAKVNIILINKNDQAP-VIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITAINEIHPLGHYKEFIINT-------LKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKI-VKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEA------SYQNKNLMDSECMVIITIEDVNDNPPIF 2200
            SS  + + V D NDN P F      Y+ TL E+  +N+      A D DS A G   Y I+      N   F +         QL + S LDRE+   Y  ++ A DR  +     + V V + + D+NDN P+F+ T YT    E  +  + +      D D G N +V    E              Q +F    +TG I    + D E+         +SF + A D GLP+ L   A V++ + + ND AP  +K   +  +         +E A  +   L+VS  D  V +    L    +++ I   NE       ++F I++       +  LD E      L I    S      PL +  T+ I++ D NDN P F +S    +++EN+     +++  +   D D G NA + Y I  S N      F+I  ++G I   + +D+E   L+  NI A D+ +   SST  +++ V D NDN P FP      ++ EN+P+ T +  +   D D     ++      +    N+    +D+  G + T   IDRE      + + A ++A       Y  KN       V I + D+NDN P+F
Sbjct:  978 SSILLTVYVHDVNDNPPVFDQI--SYEVTLSESEPVNSRFFKVQASDKDSGANGEIAYTITDG---NNGDAFGIFPD-----GQLYIKSELDRELQDRYVLLVVASDRAVEPLS--ATVNVTVLLEDVNDNRPLFNSTNYTFYFEEEQRAGSFVGKVSAVDKDFGPNGEVRYAFEVT------------QPNFELHAVTGEITSTHKFDRESLMRRRGTAVFSFTVTAMDRGLPQPLKDQATVHVYMKDINDNAPKFLKDFYQATV---------SETATNLTQVLRVSASD--VDEGSNGL----IHYSILKGNE------ERQFAIDSFSGQVTLVGKLDYEATSAYSLLIQAVDSGA---IPLNSTCTLSIDILDENDNTPSFPKSTLFVDVLENMRIG--ELVSSVTATDSDSGVNADLHYTITGSNNHGT---FSISPNTGSIFLAKKLDFETQSLYKLNITAKDQGRPPRSSTMSVVIQVRDFNDNPPSFPPGDIFKSIVENIPLGTSVISVTAHDPDADINGQLSYAIIQQMPRGNH--FSIDEVKGTIYTSAEIDREFANLFELTVKANDQAVPIETRRYALKN-------VTILVTDLNDNVPMF 1529          

HSP 10 Score: 130.183 bits (326), Expect = 6.431e-29
Identity = 155/604 (25.66%), Postives = 256/604 (42.38%), Query Frame = 2
Query:  410 DSGI--KISSFYILIKVLDENDNSPKFLPFLNPYQTLPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKLVN-VISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITAINEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIFSLIN 2212
            D G+  K+S   +++ VLD ND  P F        ++ EN+   T +L+  A D D    G   + + +     ND     LD + SGR  L   S LDRE  + Y   + A D  +      S  +V + + DINDN PVF    Y A+I E+    + V +   TD D G N  V  +I   +       +  FQI     +++  + L  E         Y   ++ATD G  +  + A V + +++  D  PV          + S  +FEN     +     V    +   D+  ++       +   +  ++P+       + T   +DRE+     LKI            +T +  ++I + D+NDN P F ++      +EN  QA   + +    +D D G N  V Y +  +  +     FTI+  +G IS   ++D      +   I+A D     LSS+ L+ V+V D NDN P+F +  Y  T+ E+ PVN+   +++ +D D+    +I          +   I  D   G+L     +DRE      +L+ A + A       + +   V + +EDVNDN P+F+  N
Sbjct:  556 DQGVHPKVSYAQLVVTVLDVNDEKPVFSQPEGYEVSVVENAPTGTELLVLGATDRDLGDNGTVRFSLQE---AENDQRLFRLDPV-SGR--LSTASSLDREEQAFYCLSILATDLGSPPQS--STAQVNVSLLDINDNSPVFYPVQYFAHIQENEPGGSYVTTVSATDPDMGPNGTVKYSISAGD-------RSRFQIHAKSGVISTKMALDRE-----EKTAYQLQVVATDGGNLQSPNQAIVTVTVLDTQDNPPVFSQ------AAYSFVVFEN-----VALGYHVGSVSATTMDLNANISYLITTGDQRGMFAMNPVTGQ----LTTASVIDREEQSFYQLKIVASGG------AVTGDTVVNITVKDLNDNAPHFLQAVESINAVENW-QAGHSIFQ-AKAVDPDEGVNGRVLYSLKQNPKN----LFTINEQNGNISLLGALDVHAGS-YQVEIVASDMGVPQLSSSILLTVYVHDVNDNPPVFDQISYEVTLSESEPVNSRFFKVQASDKDSGANGEIAYTITDGNNGDAFGIFPD---GQLYIKSELDRELQDRYVLLVVASDRA----VEPLSATVNVTVLLEDVNDNRPLFNSTN 1104          

HSP 11 Score: 130.183 bits (326), Expect = 7.001e-29
Identity = 150/577 (26.00%), Postives = 256/577 (44.37%), Query Frame = 2
Query:  428 SSFYILIKVLDENDNSPKFLPFLNPYQTLPENSQINTVILLPSAIDLDSEAFGIKYYKI---SKPFLIGNDSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKLVN-VISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYE-------TNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITA-INEIHPLGHYK----EFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARN 2110
            +S  ++I +LDENDN+P+F    + Y  + ENS +   +   +  D D     I  Y I   S PF I  ++              +++  PL+RE    YR  + A    +D    +S  +V I V DINDN P F +  Y  +  E  +L + V     TD DEG N QV   I+++++Y        F+I+ +    TG I     + Y+        N  ++SF + A+D G P L S   V I  ++ ND  P                  +N+    +  +++V  +   VT ++    D+ LN E+   +++ + LG +K       I+    L    D NQ   I +   D+    PL++   +HI + + N + P F+++     + E+   +   ++  +   D+D   N  ++Y I S     +   F I++ +G ++  +++DYE +      I A D      +    + V VID NDN+P+F    +  TV EN P  T +  +  TD D+   N ++ Y  +S  ++  VI  D N G + T G +D E  +S  + + A N
Sbjct: 2757 TSVKVIISILDENDNAPRFSQIFSAY--VSENSPLGYTVTRVTTSDEDIGINAISRYSIVDTSLPFTINPNTG------------DIVISRPLNREDTDRYRIRVSA----HDSGWTVS-TDVTIFVTDINDNTPRFSRPSYYLDCPELPELGSRVTQVSATDPDEGSNGQVFYFIKSQSEY--------FRINAT----TGEIFNKQVLKYQNVSGFSNVNINRHSFIVTASDRGNPSLLSETTVTINTVDSNDNPP---------------QFLQNKYFTPVTKNVKVGTKLIKVTAVDDK--DFGLNSEVEYFVSDGNHLGKFKLDNDTGWISIASSL--VSDLNQNFLIRVTAKDKGN-PPLSSQAVVHITVTEENYHTPEFSQNHISATIPES--HSIGSVVRTVSARDRDTAMNGLISYNIISGN---EEGIFAINSSTGVVTLAKALDYEMSSKHEMTISATDGGWVARTGYCSLTVSVIDVNDNSPVFVPDEFFPTVMENAPSGTTVIHLNATDADSG-ANAVIAYTVQSSDSDLFVI--DPNMGVITTQGFLDFETKQSYHLTVKAFN 3274          

HSP 12 Score: 124.79 bits (312), Expect = 3.172e-27
Identity = 162/613 (26.43%), Postives = 269/613 (43.88%), Query Frame = 2
Query:  410 DSGIKISSFYILIKVLDENDNSPKFLPFLNPYQT-LPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGN---DSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDR-ENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKLVNVI-SFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITAINEIHPLGHYKEFIINTL-------KPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENI---PQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIF 2200
            D G + ++      +LD NDN P F   ++ Y T L EN  + + +L+ +  D D        Y I+    +G    D H  L             +  LDRE  S Y  +++  D  +    R  S  +V I + D+NDNPP+F     T  I E++ +  V+     TD D G N  +  T+   +  K           FS   + G + L  E+D E     YS  ++ATD G P LSS+ +V +++++ ND  PV       + + R + + EN    T +  +  +D D           +  + + I   N       ++EF I+++       K LDRE      L +    +D+   +P T + T+ I L D+ND  PVF  S Y   + EN+   P+A ++    ++  D D G N+ ++Y +       +   F + A SG++   QS+D E    F   + A D     L+ T  I + V D NDN P F    Y  ++ E+    T++  +  +D D    N ++ Y   S         ++ ++G++ T   +DRE   + T+++ A +  S ++ +   S  +   TI DVNDNPP F
Sbjct: 1920 DGGGQSTTIRAYFNILDVNDNPPVF--SMSSYSTSLMENLPLGSTVLVFNVTDADDGVNSQLSYSIASGDSLGQFAVDKHGVLK-----------TLKALDRESQSFYNLVIQVHDLPQPPTSRFTSTAQVSIILLDVNDNPPMFLSPKLTY-IPENTPIDTVVFKAQATDPDSGPNSYIEYTLLNPSGNK-----------FSIGTIDGEVHLTGELDRE-EVSNYSLTVVATDKGQPPLSSSTEVVVMVLDINDNNPVFA-----QAMYR-VQIKENILTGTDIIQVSAADNDEGT--------NGQVRYGIVGGNT------HQEFRIDSVTGAITVAKSLDRETTPAYTLTVQ--ATDRGS-SPRTDSCTVAITLLDMNDFVPVFELSPYSVNVPENLGTLPRAILQ----VVARDDDQGPNSQLSYVL---LGGNEDNAFVLTA-SGELRVTQSLDREARDHFVLVVTAADAGSPALTGTGTINIIVDDINDNVPTFANNMYLTSIAEDARTGTDVLLVNASDADAA-ANAVISY---SIIGGNSQFTINPSTGQIITSALLDRETKDNYTLVVVASDAGSPESLSSSTSVLV---TITDVNDNPPRF 2468          

HSP 13 Score: 122.479 bits (306), Expect = 1.627e-26
Identity = 156/570 (27.37%), Postives = 246/570 (43.16%), Query Frame = 2
Query:  428 SSFYILIKVLDENDNSPKFLPFLNPYQT-LPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEH-SKLVNVISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITAINEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTP-LTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVI-DANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTN-NYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASY 2122
            S+  + I +LD NDN P FL   +P  T +PEN+ I+TV+    A D DS       Y +  P   GN      +D       ++ L   LDRE +S Y   + A D+        S  EV + V DINDN PVF +  Y   I E+     ++I     D DEG N QV   I   N +++      F+ID     +TG+I +   +D ET P  Y+  + ATD G    + +  V I L++ ND  PV       E+   S+ + EN       A LQV  RD      +    +  L++ +   NE +         +   + LDRE   +  L +    +  D  +P LT   TI+I + DINDN P F  + Y   + E+    T  ++  +   D D   NA ++Y I    +      FTI+  +G+I +   +D E    ++  ++A D       S++  ++  I D NDN P F    Y   +    P  + +  +  TD D    +++    H S +  N +  H+D   G +   GP+       +T  +  ++  S+
Sbjct: 2033 STAQVSIILLDVNDNPPMFL---SPKLTYIPENTPIDTVVFKAQATDPDSGPNSYIEYTLLNPS--GNKFSIGTIDG------EVHLTGELDREEVSNYSLTVVATDKGQPPLS--SSTEVVVMVLDINDNNPVFAQAMYRVQIKENILTGTDIIQVSAADNDEGTNGQVRYGIVGGNTHQE------FRIDS----VTGAITVAKSLDRETTP-AYTLTVQATDRGSSPRTDSCTVAITLLDMNDFVPVF------ELSPYSVNVPENL-GTLPRAILQVVARD------DDQGPNSQLSYVLLGGNEDNAFVLTASGELRVTQSLDREARDHFVLVV----TAADAGSPALTGTGTINIIVDDINDNVPTFANNMYLTSIAEDARTGTDVLL--VNASDADAAANAVISYSIIGGNSQ-----FTINPSTGQIITSALLDRETKDNYTLVVVASDAGSPESLSSSTSVLVTITDVNDNPPRFQHHPYVTHIPSPTPPGSFVFAVTVTDADIGSNSEL----HYSLSGRNSEKFHIDPLRGAIMAAGPL--SGASEVTFSVHVKDGGSF 2548          

HSP 14 Score: 120.939 bits (302), Expect = 3.762e-26
Identity = 161/620 (25.97%), Postives = 262/620 (42.26%), Query Frame = 2
Query:  383 CCTVFSFQVDSGIKISSFYILIKVLDENDNSPKFLP---FLNPYQTLPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKL---VNVISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAP-VIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTD-IECSLDDYHLNFEITAINEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKV---RSITIL---ITARNEASYQNKNLMDSECMVIITIEDVNDNPPIF 2200
            C ++ +  + S  + S+  + + +LD NDNSP F P   F +  +  P  S + TV    SA D D    G   Y IS     G+ S F +  K      ++     LDRE  + Y+  + A D  N   +  +   V + V D  DNPPVF +  Y+  + E+  L   V  +S    DL    N  +S  I T      DQ   F     +  L T S+     ID E   + Y   ++A+      ++    VNI + + ND AP  ++ +        SI   EN  A   +   +  D D  V   +  SL     N  +  INE       +   I+ L  LD      Q   + I  SD   +  L++++ + + + D+NDNPPVF +  Y+  L E+ P  +      +   DKD G N  + Y I    N   +  F      G++  +  +D E    +   ++A D+    LS+T  + V + D NDN P+F   +Y+F   E     + +G++   D D  P N  V+Y  +    N+++  V   +G++ +    DRE +   R   +    +TA +    Q    +  +  V + ++D+NDN P F
Sbjct:  656 CLSILATDLGSPPQSSTAQVNVSLLDINDNSPVFYPVQYFAHIQENEPGGSYVTTV----SATDPDMGPNGTVKYSISA----GDRSRFQIHAKSGVISTKMA----LDREEKTAYQLQVVATDGGN--LQSPNQAIVTVTVLDTQDNPPVFSQAAYSFVVFENVALGYHVGSVSATTMDL----NANISYLITT-----GDQRGMFAMNPVTGQLTTASV-----IDREEQSF-YQLKIVASGGA---VTGDTVVNITVKDLNDNAPHFLQAV-------ESINAVENWQAGHSIFQAKAVDPDEGVNGRVLYSLKQNPKN--LFTINE-------QNGNISLLGALDVHAGSYQ---VEIVASDM-GVPQLSSSILLTVYVHDVNDNPPVFDQISYEVTLSESEPVNS--RFFKVQASDKDSGANGEIAYTITDGNNGDAFGIFP----DGQLYIKSELDRELQDRYVLLVVASDRAVEPLSATVNVTVLLEDVNDNRPLFNSTNYTFYFEEEQRAGSFVGKVSAVDKDFGP-NGEVRYAFEVTQPNFELHAV---TGEITSTHKFDRESLMRRRGTAVFSFTVTAMDRGLPQP---LKDQATVHVYMKDINDNAPKF 1210          

HSP 15 Score: 116.701 bits (291), Expect = 7.596e-25
Identity = 161/615 (26.18%), Postives = 264/615 (42.93%), Query Frame = 2
Query:  428 SSFYILIKVLDENDNSPKFLPFLNPYQTLPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHS-KLVNVISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLP--RLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPAR---TIVASLQVSDRDSLVTDIECSLDDYHLNFEITAINEIHPL----GHYKEFIINTLKP-------LDREDDKNQYLKI------NIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKN-AYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKS---YTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNP 2191
            S   + I V +EN ++P+F    +   T+PE+  I +V+   SA D D+   G+  Y I    + GN+     +  I S    + L   LD E+ S++   + A D           + V +   D+NDN PVF    +   ++E++     VI    TD D G N  ++ T+++ +          F ID  P++  G I     +D+ET   K S++L      +P     S A V+I L   N+  P          VS+ +  FE   A    T V  +  SDRD                  + A  E+H L       K F IN +         LDRE ++   LK+      NI  +D D++T       ++I + D ND PPVF+ S Y+ ++ E +P  T   +  +   D D   + +  +Y I S   +     F+I+  +G+I+    +D E   +++  ++A+D    + + +A ++V + D NDN P+         V EN    T +  +++TD D  P      Y+  S    TN + +      +G L T   IDRE++    + +  R+  + Q    M S   V IT+ D NDNP
Sbjct: 3073 SQAVVHITVTEENYHTPEFSQN-HISATIPESHSIGSVVRTVSARDRDTAMNGLISYNI----ISGNEEG---IFAINSSTGVVTLAKALDYEMSSKHEMTISATDGGWVARTGYCSLTVSVI--DVNDNSPVFVPDEFFPTVMENAPSGTTVIHLNATDADSGANAVIAYTVQSSD-------SDLFVID--PNM--GVITTQGFLDFET---KQSYHLTVKAFNVPDEEKCSFATVDIQLKGTNEYVP--------RFVSK-LYYFEVSEAASRGTAVGEVFASDRD------------------MGADGEVHYLIFGNSRKKGFQINKMTGQIYVSGLLDREKEERVSLKVLAKNFGNIRGADIDEVT-------VNITVLDAND-PPVFSLSTYRVQISEGVPIGT--HVTFVSAFDSDSIPSWSRFSYFIGSGNENG---AFSINPQTGQITVTSGLDRESLPVYNLTVLAVDSGTPSATGSASLVVTLEDINDNGPVLTVSEGE--VLENKRPGTLVMTLQSTDPDLPPNQGPFNYYLLSTGPATNYFSL----STAGVLSTTREIDREQIADFYLSVVTRDSGAPQ----MSSTGTVHITVLDQNDNP 3613          

HSP 16 Score: 111.694 bits (278), Expect = 2.938e-23
Identity = 173/619 (27.95%), Postives = 264/619 (42.65%), Query Frame = 2
Query:  407 VDSG-IKISSFYIL-IKVLDENDNSPKFLPFLNPYQTLPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKL-VNVISFYVTDLDEGQNKQVSITIETE----NDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLP---RLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLV-TDIECSLDDYHLNFEITAINEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTP----LTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQAT-VKMIEPILTLDKDHGKNAYVTYKIDSSK--NSTDWEYFTIDADSGKISSRQSIDYEKNK-LFSFNIIAIDKDQS-NLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIFS 2203
            VDSG I ++S   L I +LDENDN+P F P    +  + EN +I  ++   +A D DS      +Y I+     G+++H T    I+     + L   LD E  S Y+  + A D+        S + V I+V D NDNPP F       +IVE+  L  +VIS    D D   N Q+S  I  +    N +  D++K             G+I    EID E     +   + A D  +P   R  +   V I++ + ND  P+   I +  + +    M       +++ ++  +D D     ++E  +    LN +          G  +  + + L P          L  N+  S  D L P     TT LT+ +   D     PVFT++KY   L E  P  T V  IE         G  A V Y I S +    T    FTI   +G I +   +D E+   L+  ++ AI+K  +   +  A + + + D NDN P+FP      TV EN+   ++I Q+   D D    N +V Y   S  ++     +D  SG L     +DRE     ++L+ A       +  L  S+  + ITI DVND+ P FS
Sbjct: 1288 VDSGAIPLNSTCTLSIDILDENDNTPSF-PKSTLFVDVLENMRIGELVSSVTATDSDSGVNADLHYTIT-----GSNNHGTF--SISPNTGSIFLAKKLDFETQSLYKLNITAKDQGRPPRS--STMSVVIQVRDFNDNPPSFPPGDIFKSIVENIPLGTSVISVTAHDPDADINGQLSYAIIQQMPRGNHFSIDEVK-------------GTIYTSAEIDREFANL-FELTVKANDQAVPIETRRYALKNVTILVTDLNDNVPMF--ISQNALAADPSAMI-----GSVLTTIMAADPDEGANGEVEYEI----LNGDTDTFTVDRYSGDLR--VASALVP--------SQLIYNLIVSATD-LGPERRKSTTELTVILQGLD----GPVFTQTKYITILKEGEPIGTNVISIEAA----SPRGSEAPVEYYIVSVRCEEKTVGRLFTIGRQTGVIQTAAILDREQGACLYLVDVYAIEKSSAFPRTQRAEVEITLQDINDNPPVFPTDTLDLTVEENIGDGSKIMQLTAMDAD-EGANALVTYALISGADDS--FRIDPESGDLIATKRLDREHRSKYSLLVRA-------DDGLQSSDMRINITISDVNDHTPRFS 1842          

HSP 17 Score: 108.227 bits (269), Expect = 3.384e-22
Identity = 151/614 (24.59%), Postives = 267/614 (43.49%), Query Frame = 2
Query:  425 ISSFYILIKVLDENDNSPKFLPFLNPYQT-LPENSQINTVILLPSAID-----LDSEAFGIKYY-----KISKPFLIGNDSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKLVNVI-SFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITAINEIHP-LGHYKEFIINTLKPLDREDDKNQYLKINIY-CSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTAL----IIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREK--VRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIFSL 2206
            +S   + I  +D NDN P+FL   N Y T + +N ++ T ++  +A+D     L+SE   ++Y+      + K F + ND+ +     IAS      L+S L++       F+++   ++  +    S   V I V + N + P F +   +A I E   + +V+ +    D D   N  +S  I + N+      +  F I+ S    TG + L   +DYE +  K+   + ATD G    +    + + +I+ ND +PV       E      T+ EN P+ T V  L  +D DS    +      Y +    + +  I P +G     +I T   LD E  ++ +L +  +   D++K +      T+ I L   N+  P F    Y  E+ E   + T   +  +   D+D G +  V Y I  +      + F I+  +G+I     +D EK +  S  ++A  K+  N+    +    + + V+DAND  P+F    Y   + E VP+ T +  +   D D+ P      YF  S   N     ++  +G++     +DRE   V ++T+L       S            +++T+ED+NDN P+ ++
Sbjct: 2966 LSETTVTINTVDSNDNPPQFL--QNKYFTPVTKNVKVGTKLIKVTAVDDKDFGLNSE---VEYFVSDGNHLGK-FKLDNDTGWI---SIASS-----LVSDLNQN------FLIRVTAKDKGNPPLSSQAVVHITVTEENYHTPEFSQNHISATIPESHSIGSVVRTVSARDRDTAMNGLISYNIISGNE------EGIFAINSS----TGVVTLAKALDYEMS-SKHEMTISATDGGWVARTGYCSLTVSVIDVNDNSPVFV---PDEFFP---TVMENAPSGTTVIHLNATDADSGANAVIA----YTVQSSDSDLFVIDPNMG-----VITTQGFLDFETKQSYHLTVKAFNVPDEEKCS----FATVDIQLKGTNEYVPRFVSKLYYFEVSEAASRGTA--VGEVFASDRDMGADGEVHYLIFGNSRK---KGFQINKMTGQIYVSGLLDREKEERVSLKVLA--KNFGNIRGADIDEVTVNITVLDAND-PPVFSLSTYRVQISEGVPIGTHVTFVSAFDSDSIPSWSRFSYFIGSGNEN-GAFSINPQTGQITVTSGLDRESLPVYNLTVLAVDSGTPS------ATGSASLVVTLEDINDNGPVLTV 3514          

HSP 18 Score: 105.531 bits (262), Expect = 1.981e-21
Identity = 162/602 (26.91%), Postives = 266/602 (44.19%), Query Frame = 2
Query:  446 IKVLDENDNSPKFL--PFLNPYQTLPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGN-DSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKLVNVISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQID----FSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITAINEIHPLGHYKEFIINTLKPLDREDDKNQ----YLKINI-----YCSDQDKLTP-LTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIF 2200
            I VLD NDN+P F   PF++    + EN      IL  SA D DS   G   Y+I      GN +S FT+    A+G  ++  I PLDRE IS Y   +K+ D+ +      + V+V I + D NDN P F + F +A + E+S L   ++  VT  DE              D   + I R+  +D    F+ +  TG I +   ++ E +  +Y   + A D+G    + +  V I + + ND  P           SR  + + + P        ++ +  S VT +  +  D   N ++     I     Y      T +  +++  K Q    +  +NI       +  D+  P L +  T+ IN  D NDNPP F ++KY   + +N+   T K+I+     DKD G N+ V Y +    +      F +D D+G IS   S+  + N+ F   + A DK    LSS A++ + V + N + P F + H S T+ E+  + + +  +   D DT   N ++ Y   S  N   +  ++ ++G +     +D E      + I+A +             C + +++ DVNDN P+F
Sbjct: 2659 ITVLDINDNAPTFEEDPFVS---EILENLSPRK-ILTVSATDKDSGPNGQLDYEIVN----GNQESSFTI--NHATG--EIRSIRPLDREKISHYELTVKSSDKGSPSQS--TSVKVIISILDENDNAPRFSQIF-SAYVSENSPLGYTVT-RVTTSDE--------------DIGINAISRYSIVDTSLPFTINPNTGDIVISRPLNRE-DTDRYRIRVSAHDSG---WTVSTDVTIFVTDINDNTPRF---------SRP-SYYLDCP--------ELPELGSRVTQVSATDPDEGSNGQVFYF--IKSQSEYFRINATTGEIFNKQVLKYQNVSGFSNVNINRHSFIVTASDRGNPSLLSETTVTINTVDSNDNPPQFLQNKYFTPVTKNVKVGT-KLIKVTAVDDKDFGLNSEVEYFV---SDGNHLGKFKLDNDTGWISIASSLVSDLNQNFLIRVTAKDKGNPPLSSQAVVHITVTEENYHTPEFSQNHISATIPESHSIGSVVRTVSARDRDTA-MNGLISYNIIS-GNEEGIFAINSSTGVVTLAKALDYEMSSKHEMTISATDGGWVARTGY----CSLTVSVIDVNDNSPVF 3196          

HSP 19 Score: 99.3673 bits (246), Expect = 1.450e-19
Identity = 111/442 (25.11%), Postives = 194/442 (43.89%), Query Frame = 2
Query:  959 YKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSST----AKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITAINE---------IHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTN-LTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPI-----FPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENK--IVKYFHKSYTNNYQVIHVD-QNSGKLKTIGPIDREKVRSITILIT------ARNEASYQNKNLMDSECMVIITIEDVNDNPPIF 2200
            Y+  +    F I+ S    TG++     ID E+ P     NL+        LSS+     +V +++ + ND APV        IV   +T  E+  +   V     +D     +DI  +  D+H ++ I + NE         ++P G      + +   LDRE      L + +    +DK  P     L +++ + DINDNPPVF  S YQ  + E+        +  +   D D G NA + Y++           F +D ++G I+ R+ +D+E  + +S  + A D+   +L+  A   + ++D NDN P+     FP      +V EN  V T +  +  TD D+   N    V+    +   +++V      N   +K    +DRE++ S  + ++      A   A  Q ++ + S   ++I + D+ND+PP+F
Sbjct:   72 YRLSESHALFAINSS----TGALYTTATIDRESLPSDV-VNLVV-------LSSSPTYPTEVRVLVRDLNDNAPVFP---DPSIV---VTFKEDSGSGRQVILDTATD-----SDIGSNGVDHH-SYRIVSGNEAGRFRLDITLNPSGEGAFLHLVSKGGLDREVTPQYQLLVEV----EDKGEPKRRGYLQVNVTVQDINDNPPVFGSSHYQAGVPED--AVVGSSVLQVAAADADEGTNADIRYRLQDEGTP-----FQMDPETGLITVREPLDFEARRQYSLTVQATDRGVPSLTGRAEAFIQLLDVNDNDPVVKFRYFPATSRYASVDENAQVGTVVALLTVTDADSPAANGNISVQILGGNEQRHFEVQRSKVPNLSLIKVASALDRERIPSYNLTVSVSDNSGAPPTAEVQARSSVAS---LVIFVNDINDHPPVF 475          

HSP 20 Score: 91.6633 bits (226), Expect = 3.455e-17
Identity = 148/609 (24.30%), Postives = 251/609 (41.22%), Query Frame = 2
Query:  782 EVEIKVGDINDNPPVFDKTFYTANIVEHSKLV-NVISFYVTDLDEGQNKQVSITIETENDYKKDQIKRF-FQIDFSPSLMTGSIRLIDE--IDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVAS--LQVSDRDS---LVTDIECSLDDYHLNFEITAINEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPV-----FTRSKYQGELIENIPQATVKMIEPILTL-DKDH-GKNAYVTYKIDSSKNSTDWEYFTIDADS----GKISSRQSIDYEKNKLFSFNIIAIDKDQSNL---------SSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKT--IGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIFSLINPAKSSLIFTINKGFRHENCQMIPYAVSDADHDEPNSDSCCILQLDNDQNGMLYLLSNTPNFLCLQNTMNTP--GIYRVSLTATDNKNNPNKSLKAKVSFNI 2509
            EV + V D+NDN PVF          E S     VI    TD D G N    +   +      ++  RF   I  +PS     + L+ +  +D E  P +Y   +   D G P+     +VN+ + + ND  PV            S       P   +V S  LQV+  D+      DI   L D    F++            +  +I   +PLD E  + QY  + +  +D+  +  LT      I L D+NDN PV     F  +     + EN   A V  +  +LT+ D D    N  ++ +I       +  +F +          I    ++D E  ++ S+N+     D S           SS A +++ V D ND+ P+F +  Y   + E VP  + +  +  TD D+   N  ++Y   S  N     H+ ++SG + T   G +DRE    I + I+AR++  +       S   +++T+ DVND  P+FS     + S++     G      +++    +D D  +  +    + + +NDQ   L+ L      L   ++++      Y +S+ ATD   +P +S  A+V+ ++
Sbjct:  120 EVRVLVRDLNDNAPVFPDPSIVVTFKEDSGSGRQVILDTATDSDIGSN---GVDHHSYRIVSGNEAGRFRLDITLNPSGEGAFLHLVSKGGLDREVTP-QYQLLVEVEDKGEPKRRGYLQVNVTVQDINDNPPVFG----------SSHYQAGVPEDAVVGSSVLQVAAADADEGTNADIRYRLQDEGTPFQMDP----------ETGLITVREPLDFE-ARRQY-SLTVQATDR-GVPSLTGRAEAFIQLLDVNDNDPVVKFRYFPATSRYASVDEN---AQVGTVVALLTVTDADSPAANGNISVQI---LGGNEQRHFEVQRSKVPNLSLIKVASALDRE--RIPSYNLTVSVSDNSGAPPTAEVQARSSVASLVIFVNDINDHPPVFEQQVYRVNLSEEVPPGSYVSGVSATDGDSG-LNANLRYSIVS-GNGLGWFHISEHSGLVTTSAAGGLDRELASQIVLNISARDQGVHPKV----SYAQLVVTVLDVNDEKPVFSQPEGYEVSVVENAPTG-----TELLVLGATDRDLGDNGTVRFSLQEAENDQR--LFRLDPVSGRLSTASSLDREEQAFYCLSILATD-LGSPPQSSTAQVNVSL 679          

HSP 21 Score: 86.2705 bits (212), Expect = 1.651e-15
Identity = 178/717 (24.83%), Postives = 300/717 (41.84%), Query Frame = 2
Query:  173 IIPYDKHQRYKIYAVTEKASPFSLIDNRLSVVSNIDRESICPIKNSLNDYDQSAETYNSQQSSHSCKYDECCTVFSFQVDSGIKISSFYILIKVLDENDNSPKFLPFLNPYQT-LPEN-SQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGN-DSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVE-VEIKVGDINDNPPVFDKTFYTANIVEHSKL-VNVISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINK-NDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRD-SLVTDIECSL-----DDYHLNFEITAINEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELI-ENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNS--------GKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIFSLINPA----KSSLIFTINK 2248
            I+  + HQ ++I +VT            ++V  ++DRE+      ++   D+ +          S + D C                  + I +LD ND  P F   L+PY   +PEN   +   IL   A D D         ++S   L GN D+ F L    ASG  +L +   LDRE    +  ++ A D  +     ++G   + I V DINDN P F    Y  +I E ++   +V+    +D D   N  +S +I   N           Q   +PS  TG I     +D ET    Y+  ++A+D G P   S++   ++ I   ND  P  +       V+    +    P  + V ++ V+D D    +++  SL     + +H++    AI    PL    E                  +  +++  D     P T + T+ +   +  D P V  R+K Q  +  EN P  T+     + T+     +   ++Y I +S N  D   F ID  +G++S  Q +D+EK + +   I A D      SS   + + V+D NDNAP F +  +   + EN+    +I  +  TD D+ P  ++          +Y++++ +Q S        G++++I P+DREK+    + + + ++ S        +   VII+I D NDN P FS I  A     S L +T+ +
Sbjct: 2193 IVGGNTHQEFRIDSVT----------GAITVAKSLDRETTPAYTLTVQATDRGS----------SPRTDSCT-----------------VAITLLDMNDFVPVFE--LSPYSVNVPENLGTLPRAILQVVARDDDQG----PNSQLSYVLLGGNEDNAFVL---TASG--ELRVTQSLDREARDHFVLVVTAADAGSPA---LTGTGTINIIVDDINDNVPTFANNMYLTSIAEDARTGTDVLLVNASDADAAANAVISYSIIGGNS----------QFTINPS--TGQIITSALLDRETKD-NYTLVVVASDAGSPESLSSSTSVLVTITDVNDNPPRFQ---HHPYVTH---IPSPTPPGSFVFAVTVTDADIGSNSELHYSLSGRNSEKFHIDPLRGAIMAAGPLSGASE------------------VTFSVHVKDGGSF-PKTDSTTVTVRFANKADFPKV--RAKEQTFMFPENQPVGTL-----VTTITGSSLRGETLSYYI-ASGNLGDT--FQIDPLTGQVSISQPLDFEKIQKYVVWIEARDGGFPPFSSYEKLDITVLDINDNAPTFEEDPFVSEILENLSPR-KILTVSATDKDSGPNGQL----------DYEIVNGNQESSFTINHATGEIRSIRPLDREKISHYELTVKSSDKGSPSQS----TSVKVIISILDENDNAPRFSQIFSAYVSENSPLGYTVTR 2795          
BLAST of Protocadherin Fat 1 vs. UniProt/SwissProt
Match: sp|Q91ZI0|CELR3_MOUSE (Cadherin EGF LAG seven-pass G-type receptor 3 OS=Mus musculus OX=10090 GN=Celsr3 PE=2 SV=2)

HSP 1 Score: 191.045 bits (484), Expect = 1.122e-47
Identity = 184/711 (25.88%), Postives = 322/711 (45.29%), Query Frame = 2
Query:  104 SVKENIYYSQPLLDLEKVLKNRTIIPYDKHQRYKIY---AVTEKASPFSLIDNRLSVVSN---IDRESICPIKNSLNDYDQSAETYNSQQSSHSCKYDECCTVFSFQVDSGIKISSFYILIKVLDENDNSPKFLPFLNPYQTLPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKL-VNVISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPAR--TIVASLQVSDRDSLVTDIECSLDDYHLNFEITAINEIHPLGHYKEF---IINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIF 2200
            +++EN+    P+L L     +    P + + RY+     AV   A+    ID R  ++S    +DRE        +  Y+   E  +  Q                  + G + ++  + I VLDENDN+P+F       Q + E+ + +TV+L  +A D D +A G+ +Y I    + GN      +D +     ++ +++PLD E   EY   ++A D       + +G+   I+V DIND+ P+F  T +  +++E++ L  +VI     D D G+N ++  ++                  F  +  TG + +   +D E+  + Y F + A D+G P LS++A V + +++ ND  P        E   +   +  NE A   T V S+   DRD+          +  ++++IT  N  +      +    ++    PLD + ++  Y K+ +  SD+     L  +  +HIN+ D N + PVF  + Y   + E+ P  +  ++  I   D D G+NA +TY ++      +   F IDADSG I+ +  +DYE    ++  I A D      + T  + V V D NDNAP F   HY+  V E+ P  T + QI  TD D     + V+Y  ++  +      ++  SG ++T+  +DRE V    +   A +         + +   + +T++DVNDN P+F
Sbjct:  432 TLRENVEEGYPILQLRATDGD---APPNANLRYRFVGSPAVRTAAAAAFEIDPRSGLISTSGRVDREH-------MESYELVVEASDQGQ------------------EPGPRSATVRVHITVLDENDNAPQFSEKRYVAQ-VREDVRPHTVVLRVTATDKDKDANGLVHYNI----ISGNSRGHFAIDSLTG---EIQVMAPLDFEAEREYALRIRAQDAGRPPLSNNTGL-ASIQVVDINDHAPIFVSTPFQVSVLENAPLGHSVIHIQAVDADHGENSRLEYSLTGVAS----------DTPFVINSATGWVSVSGPLDRESVEH-YFFGVEARDHGSPPLSASASVTVTVLDVNDNRP--------EFTMKEYHLRLNEDAAVGTSVVSVTAVDRDA----------NSAISYQITGGNTRNRFAISTQGGVGLVTLALPLDYKQER--YFKLVLTASDR----ALHDHCYVHINITDANTHRPVFQSAHYSVSMNEDRPVGSTVVV--ISASDDDVGENARITYLLED-----NLPQFRIDADSGAITLQAPLDYEDQVTYTLAITARDNGIPQKADTTYVEVMVNDVNDNAPQFVASHYTGLVSEDAPPFTSVLQISATDRDAHANGR-VQYTFQNGEDGDGDFTIEPTSGIVRTVRRLDREAVPVYELTAYAVDRGVPP----LRTPVSIQVTVQDVNDNAPVF 1058          

HSP 2 Score: 143.665 bits (361), Expect = 4.752e-33
Identity = 154/590 (26.10%), Postives = 252/590 (42.71%), Query Frame = 2
Query:  446 IKVLDENDNSPKFLPFLNPYQ-TLPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKL-VNVISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRD-SLVTDIECSLDDYHLNFEITAINEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLT-IHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIFS 2203
            I+V+D ND++P F+    P+Q ++ EN+ +   ++   A+D D        Y ++    + +D+ F     I S    + +  PLDRE +  Y F ++A  R++      +   V + V D+NDN P F    Y   + E + +  +V+S  VT +D   N  +S  I   N   +  I        S     G + L   +DY+   Y +   L A+D  L        V+I + + N   PV +          S++M E+ P  + V  +  SD D      I   L+D    F I A              I    PLD ED     L I    + +D   P   + T + + + D+NDN P F  S Y G + E+ P  T   +  I   D+D   N  V Y   + ++  D + FTI+  SG + + + +D E   ++     A+D+    L +   I V V D NDNAP+FP   +   V+EN  V + + QI   D D  P   I+  +     N  ++  +D  SG+L  +  +D E  +   I++ A +         + S   V + + D NDN P+ +
Sbjct:  630 IQVVDINDHAPIFVS--TPFQVSVLENAPLGHSVIHIQAVDADHGENSRLEYSLTG---VASDTPFV----INSATGWVSVSGPLDRESVEHYFFGVEA--RDHGSPPLSASASVTVTVLDVNDNRPEFTMKEYHLRLNEDAAVGTSVVS--VTAVDRDANSAISYQITGGNTRNRFAI--------STQGGVGLVTLALPLDYKQERY-FKLVLTASDRAL---HDHCYVHINITDANTHRPVFQS------AHYSVSMNEDRPVGSTVVVISASDDDVGENARITYLLEDNLPQFRIDA----------DSGAITLQAPLDYEDQVTYTLAI----TARDNGIPQKADTTYVEVMVNDVNDNAPQFVASHYTGLVSEDAPPFT--SVLQISATDRDAHANGRVQYTFQNGEDG-DGD-FTIEPTSGIVRTVRRLDREAVPVYELTAYAVDRGVPPLRTPVSIQVTVQDVNDNAPVFPAEEFEVRVKENSIVGSVVAQITAVDPDDGPNAHIM--YQIVEGNIPELFQMDIFSGELTALIDLDYEARQEYVIVVQATSAP-------LVSRATVHVRLVDQNDNSPVLN 1161          

HSP 3 Score: 141.739 bits (356), Expect = 1.510e-32
Identity = 184/717 (25.66%), Postives = 297/717 (41.42%), Query Frame = 2
Query:  476 PKFLPFLNPYQTL-PENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLI---SPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEH-SKLVNVISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGL---PRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITAINEIHPLGHYK----EFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLT--IHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKY-FHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIFSLINPAKSSLIFTINKGFRHENCQMIPYAVSDADHDEPNSDSCCILQLDNDQNG----MLYLLS-NTPNF--------LCLQNTMNTPG--IYRVSLTATDNKNNPNKSLKAKVSFNIDVRHEVSDN 2536
            P+F P  N YQTL PEN    T +L   A D D    G   Y ++    + N     L     S  PQ  LI   + LDRE  S  R  L+   +++   R  +   V + V D ND+ PVF++  Y   + E+  +   ++    TD D   N  +       +   +      F+ID    L++ S R +D    E+    Y   + A+D G    PR S+T +V+I ++++ND AP     R    V       E+    T+V  +  +D+D     +        +++ I + N     GH+        I  + PLD E ++   L+I      QD   P  +N T    I + DIND+ P+F  + +Q  ++EN P      +  I  +D DHG+N+ + Y +    + T    F I++ +G +S    +D E  + + F + A D     LS++A + V V+D NDN P F    Y   + E+  V T +  +   D D    N  + Y      T N   I      G +    P+D ++ R   +++TA + A       +   C V I I D N + P+F                       Q   Y+VS  + D P   +  ++   +D  G    + YLL  N P F        + LQ  ++      Y +++TA DN   P K+    V   ++   +V+DN
Sbjct:  314 PQF-PQYN-YQTLVPENEAAGTSVLRVVAQDPDPGEAGRLIYSLAA---LMNSRSLELF----SIDPQSGLIRTAAALDRE--SMERHYLRVTAQDHGSPRLSATTMVAVTVADRNDHAPVFEQAQYRETLRENVEEGYPILQLRATDGDAPPNANLRYRF-VGSPAVRTAAAAAFEIDPRSGLISTSGR-VDREHMES----YELVVEASDQGQEPGPR-SATVRVHITVLDENDNAPQFSEKRYVAQVR------EDVRPHTVVLRVTATDKDKDANGL--------VHYNIISGNS---RGHFAIDSLTGEIQVMAPLDFEAEREYALRIRA----QDAGRPPLSNNTGLASIQVVDINDHAPIFVSTPFQVSVLENAPLG--HSVIHIQAVDADHGENSRLEYSLTGVASDTP---FVINSATGWVSVSGPLDRESVEHYFFGVEARDHGSPPLSASASVTVTVLDVNDNRPEFTMKEYHLRLNEDAAVGTSVVSVTAVDRDA---NSAISYQITGGNTRNRFAISTQGGVGLVTLALPLDYKQERYFKLVLTASDRA-------LHDHCYVHINITDANTHRPVF-----------------------QSAHYSVS-MNEDRPVGSTVVVISASDDDVGENARITYLLEDNLPQFRIDADSGAITLQAPLDYEDQVTYTLAITARDN-GIPQKADTTYVEVMVN---DVNDN 948          
BLAST of Protocadherin Fat 1 vs. UniProt/SwissProt
Match: sp|O88278|CELR3_RAT (Cadherin EGF LAG seven-pass G-type receptor 3 OS=Rattus norvegicus OX=10116 GN=Celsr3 PE=1 SV=1)

HSP 1 Score: 190.274 bits (482), Expect = 1.685e-47
Identity = 163/603 (27.03%), Postives = 285/603 (47.26%), Query Frame = 2
Query:  410 DSGIKISSFYILIKVLDENDNSPKFLPFLNPYQTLPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKL-VNVISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPAR--TIVASLQVSDRDSLVTDIECSLDDYHLNFEITAINEIHPLGHYKEF---IINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIF 2200
            + G + ++  + I VLDENDN+P+F       Q + E+ + +TV+L  +A D D +A G+ +Y I    + GN      +D +     ++ +++PLD E   EY   ++A D       + +G+   I+V DIND+ P+F  T +  +++E++ L  +VI     D D G+N ++  ++                  F  +  TG + +   +D E+  + Y F + A D+G P LS++A V + +++ ND  P        E   +   +  NE A   T V S+   DRD+          +  ++++IT  N  +      +    ++    PLD + ++  Y K+ +  SD+     L  +  +HIN+ D N + PVF  + Y   + E+ P  +  ++  I   D D G+NA +TY ++      +   F IDADSG I+ +  +DYE    ++  I A D      + T  + V V D NDNAP F   HY+  V E+ P  T + QI  TD D     + V+Y  ++  +      ++  SG ++T+  +DRE V    +   A +         + +   + +T++DVNDN P+F
Sbjct:  512 EPGPRSATVRVHITVLDENDNAPQFSEKRYVAQ-VREDVRPHTVVLRVTATDKDKDANGLVHYNI----ISGNSRGHFAIDSLTG---EIQVMAPLDFEAEREYALRIRAQDAGRPPLSNNTGL-ASIQVVDINDHSPIFVSTPFQVSVLENAPLGHSVIHIQAVDADHGENSRLEYSLTGVAS----------DTPFVINSATGWVSVSGPLDRESVEH-YFFGVEARDHGSPPLSASASVTVTVLDVNDNRP--------EFTMKEYHLRLNEDAAVGTSVVSVTAVDRDA----------NSAISYQITGGNTRNRFAISTQGGMGLVTLALPLDYKQER--YFKLVLTASDR----ALHDHCYVHINITDANTHRPVFQSAHYSVSMNEDRPVGSTVVV--ISASDDDVGENARITYLLED-----NLPQFRIDADSGAITLQAPLDYEDQVTYTLAITARDNGIPQKADTTYVEVMVNDVNDNAPQFVASHYTGLVSEDAPPFTSVLQISATDRDAHANGR-VQYTFQNGEDGDGDFTIEPTSGIVRTVRRLDREAVPVYELTAYAVDRGVPP----LRTPVSIQVTVQDVNDNAPVF 1058          

HSP 2 Score: 144.821 bits (364), Expect = 1.964e-33
Identity = 155/590 (26.27%), Postives = 253/590 (42.88%), Query Frame = 2
Query:  446 IKVLDENDNSPKFLPFLNPYQ-TLPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKL-VNVISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRD-SLVTDIECSLDDYHLNFEITAINEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLT-IHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIFS 2203
            I+V+D ND+SP F+    P+Q ++ EN+ +   ++   A+D D        Y ++    + +D+ F     I S    + +  PLDRE +  Y F ++A  R++      +   V + V D+NDN P F    Y   + E + +  +V+S  VT +D   N  +S  I   N   +      F I     +  G + L   +DY+   Y +   L A+D  L        V+I + + N   PV +          S++M E+ P  + V  +  SD D      I   L+D    F I A              I    PLD ED     L I    + +D   P   + T + + + D+NDN P F  S Y G + E+ P  T   +  I   D+D   N  V Y   + ++  D + FTI+  SG + + + +D E   ++     A+D+    L +   I V V D NDNAP+FP   +   V+EN  V + + QI   D D  P   I+  +     N  ++  +D  SG+L  +  +D E  +   I++ A +         + S   V + + D NDN P+ +
Sbjct:  630 IQVVDINDHSPIFVS--TPFQVSVLENAPLGHSVIHIQAVDADHGENSRLEYSLTG---VASDTPFV----INSATGWVSVSGPLDRESVEHYFFGVEA--RDHGSPPLSASASVTVTVLDVNDNRPEFTMKEYHLRLNEDAAVGTSVVS--VTAVDRDANSAISYQITGGNTRNR------FAISTQGGM--GLVTLALPLDYKQERY-FKLVLTASDRAL---HDHCYVHINITDANTHRPVFQS------AHYSVSMNEDRPVGSTVVVISASDDDVGENARITYLLEDNLPQFRIDA----------DSGAITLQAPLDYEDQVTYTLAI----TARDNGIPQKADTTYVEVMVNDVNDNAPQFVASHYTGLVSEDAPPFT--SVLQISATDRDAHANGRVQYTFQNGEDG-DGD-FTIEPTSGIVRTVRRLDREAVPVYELTAYAVDRGVPPLRTPVSIQVTVQDVNDNAPVFPAEEFEVRVKENSIVGSVVAQITAVDPDDGPNAHIM--YQIVEGNIPELFQMDIFSGELTALIDLDYEARQEYVIVVQATSAP-------LVSRATVHVRLVDQNDNSPVLN 1161          

HSP 3 Score: 142.124 bits (357), Expect = 1.377e-32
Identity = 184/717 (25.66%), Postives = 297/717 (41.42%), Query Frame = 2
Query:  476 PKFLPFLNPYQTL-PENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLI---SPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEH-SKLVNVISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGL---PRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITAINEIHPLGHYK----EFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLT--IHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKY-FHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIFSLINPAKSSLIFTINKGFRHENCQMIPYAVSDADHDEPNSDSCCILQLDNDQNG----MLYLLS-NTPNF--------LCLQNTMNTPG--IYRVSLTATDNKNNPNKSLKAKVSFNIDVRHEVSDN 2536
            P+F P  N YQTL PEN    T +L   A D D    G   Y ++    + N     L     S  PQ  LI   + LDRE  S  R  L+   +++   R  +   V + V D ND+ PVF++  Y   + E+  +   ++    TD D   N  +       +   +      F+ID    L++ S R +D    E+    Y   + A+D G    PR S+T +V+I ++++ND AP     R    V       E+    T+V  +  +D+D     +        +++ I + N     GH+        I  + PLD E ++   L+I      QD   P  +N T    I + DIND+ P+F  + +Q  ++EN P      +  I  +D DHG+N+ + Y +    + T    F I++ +G +S    +D E  + + F + A D     LS++A + V V+D NDN P F    Y   + E+  V T +  +   D D    N  + Y      T N   I      G +    P+D ++ R   +++TA + A       +   C V I I D N + P+F                       Q   Y+VS  + D P   +  ++   +D  G    + YLL  N P F        + LQ  ++      Y +++TA DN   P K+    V   ++   +V+DN
Sbjct:  314 PQF-PQYN-YQTLVPENEAAGTAVLRVVAQDPDPGEAGRLVYSLAA---LMNSRSLELF----SIDPQSGLIRTAAALDRE--SMERHYLRVTAQDHGSPRLSATTMVAVTVADRNDHAPVFEQAQYRETLRENVEEGYPILQLRATDGDAPPNANLRYRF-VGSPAARTAAAAAFEIDPRSGLISTSGR-VDREHMES----YELVVEASDQGQEPGPR-SATVRVHITVLDENDNAPQFSEKRYVAQVR------EDVRPHTVVLRVTATDKDKDANGL--------VHYNIISGNS---RGHFAIDSLTGEIQVMAPLDFEAEREYALRIRA----QDAGRPPLSNNTGLASIQVVDINDHSPIFVSTPFQVSVLENAPLG--HSVIHIQAVDADHGENSRLEYSLTGVASDTP---FVINSATGWVSVSGPLDRESVEHYFFGVEARDHGSPPLSASASVTVTVLDVNDNRPEFTMKEYHLRLNEDAAVGTSVVSVTAVDRDA---NSAISYQITGGNTRNRFAISTQGGMGLVTLALPLDYKQERYFKLVLTASDRA-------LHDHCYVHINITDANTHRPVF-----------------------QSAHYSVS-MNEDRPVGSTVVVISASDDDVGENARITYLLEDNLPQFRIDADSGAITLQAPLDYEDQVTYTLAITARDN-GIPQKADTTYVEVMVN---DVNDN 948          
BLAST of Protocadherin Fat 1 vs. UniProt/SwissProt
Match: sp|Q9NYQ7|CELR3_HUMAN (Cadherin EGF LAG seven-pass G-type receptor 3 OS=Homo sapiens OX=9606 GN=CELSR3 PE=1 SV=2)

HSP 1 Score: 188.734 bits (478), Expect = 5.888e-47
Identity = 164/603 (27.20%), Postives = 284/603 (47.10%), Query Frame = 2
Query:  410 DSGIKISSFYILIKVLDENDNSPKFLPFLNPYQTLPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKL-VNVISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPAR--TIVASLQVSDRDSLVTDIECSLDDYHLNFEITAINEIHPLGHYKEF---IINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIF 2200
            + G + ++  + I VLDENDN+P+F       Q + E+ + +TV+L  +A D D +A G+ +Y I    + GN      +D +     ++ +++PLD E   EY   ++A D       + +G+   I+V DIND+ P+F  T +  +++E++ L  +VI     D D G+N ++  ++                  F  +  TG + +   +D E+  + Y F + A D+G P LS++A V + +++ ND  P        E   +   +  NE A   T V S+   DRD+          +  ++++IT  N  +      +    ++    PLD + ++  Y K+ +  SD+     L  +  +HIN+ D N + PVF  + Y   + E+ P  +  ++  I   D D G+NA +TY ++      +   F IDADSG I+ +  +DYE    ++  I A D      + T  + V V D NDNAP F   HY+  V E+ P  T + QI  TD D     + V+Y  ++  +      ++  SG ++T+  +DRE V    +   A +      +  +  + MV    +DVNDN P+F
Sbjct:  521 EPGPRSATVRVHITVLDENDNAPQFSEKRYVAQ-VREDVRPHTVVLRVTATDRDKDANGLVHYNI----ISGNSRGHFAIDSLTG---EIQVVAPLDFEAEREYALRIRAQDAGRPPLSNNTGL-ASIQVVDINDHIPIFVSTPFQVSVLENAPLGHSVIHIQAVDADHGENARLEYSLTGVAP----------DTPFVINSATGWVSVSGPLDRESVEH-YFFGVEARDHGSPPLSASASVTVTVLDVNDNRP--------EFTMKEYHLRLNEDAAVGTSVVSVTAVDRDA----------NSAISYQITGGNTRNRFAISTQGGVGLVTLALPLDYKQER--YFKLVLTASDR----ALHDHCYVHINITDANTHRPVFQSAHYSVSVNEDRPMGSTIVV--ISASDDDVGENARITYLLED-----NLPQFRIDADSGAITLQAPLDYEDQVTYTLAITARDNGIPQKADTTYVEVMVNDVNDNAPQFVASHYTGLVSEDAPPFTSVLQISATDRDAHANGR-VQYTFQNGEDGDGDFTIEPTSGIVRTVRRLDREAVSVYELTAYAVDRGVPPLRTPVSIQVMV----QDVNDNAPVF 1067          

HSP 2 Score: 159.458 bits (402), Expect = 5.336e-38
Identity = 158/605 (26.12%), Postives = 268/605 (44.30%), Query Frame = 2
Query:  440 ILIKVLDENDNSPKFLPFLNPYQTLPENSQINTVILLPSAIDLDSEA-FGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLISP---LDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVE----HSKLVNVISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLS-STAKVNIILINKNDQAPVIKVIRKGEIVSR--SITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITAINEIHPLGHYKEFIINTLK-------PLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIF 2200
            + + V D ND+SP F       +TL EN +    IL   A D D+     ++Y  +  P      +    +D      P+  LIS    +DRE +  Y  +++A D+  +     + V V I V D NDN P F +  Y A + E    H+ ++ V +   TD D+  N  V   I + N       +  F ID     +TG I+++  +D+E    +Y+  + A D G P LS +T   +I +++ ND  P+         VS    +++ EN P    V  +Q  D D          ++  L + +T +    P      F+IN+         PLDRE  ++ +  +    +      PL+ + ++ + + D+NDN P FT  +Y   L E+    T   +  +  +D+D   N+ ++Y+I +  N+ +    +     G ++    +DY++ + F   + A D+    L     + +++ DAN + P+F   HYS +V E+ P+ + I  I  +D D   EN  + Y      +N     +D +SG +    P+D E   + T+ ITAR+    Q  +    E MV     DVNDN P F
Sbjct:  419 VAVTVADRNDHSPVFEQ-AQYRETLRENVEEGYPILQLRATDGDAPPNANLRYRFVGPPAARAAAAAAFEID------PRSGLISTSGRVDREHMESYELVVEASDQGQEPGPRSATVRVHITVLDENDNAPQFSEKRYVAQVREDVRPHTVVLRVTA---TDRDKDANGLVHYNIISGNS------RGHFAIDS----LTGEIQVVAPLDFEAE-REYALRIRAQDAGRPPLSNNTGLASIQVVDINDHIPI--------FVSTPFQVSVLENAPLGHSVIHIQAVDAD--------HGENARLEYSLTGVAPDTP------FVINSATGWVSVSGPLDRESVEHYFFGVE---ARDHGSPPLSASASVTVTVLDVNDNRPEFTMKEYHLRLNEDAAVGT--SVVSVTAVDRD--ANSAISYQI-TGGNTRNRFAISTQGGVGLVTLALPLDYKQERYFKLVLTASDR---ALHDHCYVHINITDANTHRPVFQSAHYSVSVNEDRPMGSTIVVISASD-DDVGENARITYL---LEDNLPQFRIDADSGAITLQAPLDYEDQVTYTLAITARDNGIPQKADTTYVEVMV----NDVNDNAPQF 961          

HSP 3 Score: 142.124 bits (357), Expect = 1.152e-32
Identity = 186/717 (25.94%), Postives = 296/717 (41.28%), Query Frame = 2
Query:  476 PKFLPFLNPYQTL-PENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLI---SPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEH-SKLVNVISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGL---PRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITAINEIHPLGHYK----EFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLT--IHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKY-FHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIFSLINPAKSSLIFTINKGFRHENCQMIPYAVSDADHDEPNSDSCCILQLDNDQNG----MLYLLS-NTPNF--------LCLQNTMNTPG--IYRVSLTATDNKNNPNKSLKAKVSFNIDVRHEVSDN 2536
            P+F P  N YQTL PEN    T +L   A D D+   G   Y ++    + N     L     S  PQ  LI   + LDRE  S  R  L+   +++   R  +   V + V D ND+ PVF++  Y   + E+  +   ++    TD D   N  +           +      F+ID    L++ S R +D    E+    Y   + A+D G    PR S+T +V+I ++++ND AP     R    V       E+    T+V  +  +DRD     +        +++ I + N     GH+        I  + PLD E ++   L+I      QD   P  +N T    I + DIND+ P+F  + +Q  ++EN P      +  I  +D DHG+NA + Y +      T    F I++ +G +S    +D E  + + F + A D     LS++A + V V+D NDN P F    Y   + E+  V T +  +   D D    N  + Y      T N   I      G +    P+D ++ R   +++TA + A       +   C V I I D N + P+F                       Q   Y+VS  + D P   +  ++   +D  G    + YLL  N P F        + LQ  ++      Y +++TA DN   P K+    V   ++   +V+DN
Sbjct:  323 PQF-PQYN-YQTLVPENEAAGTAVLRVVAQDPDAGEAGRLVYSLAA---LMNSRSLELF----SIDPQSGLIRTAAALDRE--SMERHYLRVTAQDHGSPRLSATTMVAVTVADRNDHSPVFEQAQYRETLRENVEEGYPILQLRATDGDAPPNANLRYRF-VGPPAARAAAAAAFEIDPRSGLISTSGR-VDREHMES----YELVVEASDQGQEPGPR-SATVRVHITVLDENDNAPQFSEKRYVAQVR------EDVRPHTVVLRVTATDRDKDANGL--------VHYNIISGNS---RGHFAIDSLTGEIQVVAPLDFEAEREYALRIRA----QDAGRPPLSNNTGLASIQVVDINDHIPIFVSTPFQVSVLENAPLG--HSVIHIQAVDADHGENARLEYSLTGVAPDTP---FVINSATGWVSVSGPLDRESVEHYFFGVEARDHGSPPLSASASVTVTVLDVNDNRPEFTMKEYHLRLNEDAAVGTSVVSVTAVDRDA---NSAISYQITGGNTRNRFAISTQGGVGLVTLALPLDYKQERYFKLVLTASDRA-------LHDHCYVHINITDANTHRPVF-----------------------QSAHYSVS-VNEDRPMGSTIVVISASDDDVGENARITYLLEDNLPQFRIDADSGAITLQAPLDYEDQVTYTLAITARDN-GIPQKADTTYVEVMVN---DVNDN 957          

HSP 4 Score: 139.043 bits (349), Expect = 1.298e-31
Identity = 152/590 (25.76%), Postives = 250/590 (42.37%), Query Frame = 2
Query:  446 IKVLDENDNSPKFLPFLNPYQ-TLPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKL-VNVISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRD-SLVTDIECSLDDYHLNFEITAINEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLT-IHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIFS 2203
            I+V+D ND+ P F+    P+Q ++ EN+ +   ++   A+D D        Y ++    +  D+ F     I S    + +  PLDRE +  Y F ++A  R++      +   V + V D+NDN P F    Y   + E + +  +V+S  VT +D   N  +S  I   N   +  I        S     G + L   +DY+   Y +   L A+D  L        V+I + + N   PV +          S+++ E+ P  + +  +  SD D      I   L+D    F I A              I    PLD ED     L I    + +D   P   + T + + + D+NDN P F  S Y G + E+ P  T   +  I   D+D   N  V Y   + ++  D + FTI+  SG + + + +D E   ++     A+D+    L +   I V V D NDNAP+FP   +   V+EN  V + + QI   D D  P   I+  +     N  ++  +D  SG+L  +  +D E  +   I++ A +         + S   V + + D NDN P+ +
Sbjct:  639 IQVVDINDHIPIFVS--TPFQVSVLENAPLGHSVIHIQAVDADHGENARLEYSLTG---VAPDTPFV----INSATGWVSVSGPLDRESVEHYFFGVEA--RDHGSPPLSASASVTVTVLDVNDNRPEFTMKEYHLRLNEDAAVGTSVVS--VTAVDRDANSAISYQITGGNTRNRFAI--------STQGGVGLVTLALPLDYKQERY-FKLVLTASDRAL---HDHCYVHINITDANTHRPVFQS------AHYSVSVNEDRPMGSTIVVISASDDDVGENARITYLLEDNLPQFRIDA----------DSGAITLQAPLDYEDQVTYTLAI----TARDNGIPQKADTTYVEVMVNDVNDNAPQFVASHYTGLVSEDAPPFT--SVLQISATDRDAHANGRVQYTFQNGEDG-DGD-FTIEPTSGIVRTVRRLDREAVSVYELTAYAVDRGVPPLRTPVSIQVMVQDVNDNAPVFPAEEFEVRVKENSIVGSVVAQITAVDPDEGPNAHIM--YQIVEGNIPELFQMDIFSGELTALIDLDYEARQEYVIVVQATSAP-------LVSRATVHVRLVDQNDNSPVLN 1170          
BLAST of Protocadherin Fat 1 vs. UniProt/SwissProt
Match: sp|Q6V0I7|FAT4_HUMAN (Protocadherin Fat 4 OS=Homo sapiens OX=9606 GN=FAT4 PE=1 SV=2)

HSP 1 Score: 187.963 bits (476), Expect = 9.839e-47
Identity = 179/612 (29.25%), Postives = 287/612 (46.90%), Query Frame = 2
Query:  440 ILIKVLDENDNSPKFLPFLNPYQTLPENSQINTVILLPSAIDLDSEAFGIKY--YKISKPFLIGNDSHFTLLDKI--ASGRPQLL-LIS--PLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKL-VNVISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIECSL------DDYHLNFEITAINEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLT--------TNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQS--IDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPH-YSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIF 2200
            + + V D NDN+P F P  +   T  E+S     ++L +A D D  + G+ +  Y+I +    GN++    LD     SG    L L+S   LDREV  +Y+ +++  D+     R    ++V + V DINDNPPVF  + Y A + E + +  +V+     D DEG N  +   ++ E           FQ+D      TG I + + +D+E    +YS  + A D G+P L+  A+  I L++ ND  PV+K  R     SR  ++ EN    T+VA L V+D DS   +   S+      +  H   + + +  +         +I     LDRE   +  L +++  SD     P           +L I +N  DIND+PPVF++  Y+  L E  P  +   +  I   D D G NA + Y I  S N   W  F I   SG +++  S  +D E       NI A D+      S A ++V ++D ND  P+F +P  Y  +V EN P  TE+  +  TD D   +N  V++  +    + +   +D  SG+L TI  +DRE+    ++L+ A +  S    ++      + +++ D+NDN P+F
Sbjct:  121 VRVLVRDLNDNAPVF-PDPSIVVTFKEDSSSGRQVILDTATDSDIGSNGVDHRSYRIIR----GNEAGRFRLDITLNPSGEGAFLHLVSKGGLDREVTPQYQLLVEVEDKGEPKRRGY--LQVNVTVQDINDNPPVFGSSHYQAGVPEDAVVGSSVLQVAAADADEGTNADIRYRLQDEGTP--------FQMDPE----TGLITVREPLDFEAR-RQYSLTVQAMDRGVPSLTGRAEALIQLLDVNDNDPVVK-FRYFPATSRYASVDENAQVGTVVALLTVTDADSPAANGNISVQILGGNEQRHFEVQSSKVPNLS--------LIKVASALDRERIPSYNLTVSV--SDNYGAPPGAAVQARSSVASLVIFVN--DINDHPPVFSQQVYRVNLSEEAPPGS--YVSGISATDGDSGLNANLRYSI-VSGNGLGW--FHISEHSGLVTTGSSGGLDRELASQIVLNISARDQGVHPKVSYAQLVVTLLDVNDEKPVFSQPEGYDVSVVENAPTGTELLMLRATDGDLG-DNGTVRFSLQEAETDRRSFRLDPVSGRLSTISSLDREEQAFYSLLVLATDLGSPPQSSM----ARINVSLLDINDNSPVF 689          

HSP 2 Score: 177.948 bits (450), Expect = 1.247e-43
Identity = 169/608 (27.80%), Postives = 280/608 (46.05%), Query Frame = 2
Query:  443 LIKVLDENDNSP----KFLPFLNPYQTLPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDS-HFTLLDKIASGRPQLLLI---SPLDREVISEYRFILKAVDRENDDHRDISGVEVEIK---------VGDINDNPPVFDKTFYTANIVEHSKLVNVIS-FYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQI-DFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTD---IECSLDDYHLNFEITAINEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIF 2200
            LI++LD NDN P    ++ P  + Y ++ EN+Q+ TV+ L +  D DS A       IS   L GN+  HF +    +S  P L LI   S LDRE I  Y   +      +D++    G  V+ +         V DIND+PPVF +  Y  N+ E +   + +S    TD D G N  +  +I + N         +F I + S  + TGS   +D         +   N+ A D G+    S A++ + L++ ND+ PV       +     +++ EN P  T +  L+ +D D  + D   +  SL +   +     ++ +          ++T+  LDRE+    +  + +  +D     P ++   I+++L DINDN PVF   +Y   + EN P  +   I  +   D D G N  V Y I +     D   F ++A SG IS+R ++D E+   +   I+A D       + A++ + V+D  DN P+F +  YSF V ENV +   +G +  + +D    N  + Y   +  +   +  ++Q +G+L T   IDRE+     + + A       +   +  + MV IT++D+NDN P F
Sbjct:  340 LIQLLDVNDNDPVVKFRYFPATSRYASVDENAQVGTVVALLTVTDADSPA---ANGNISVQILGGNEQRHFEVQ---SSKVPNLSLIKVASALDRERIPSYNLTVSV----SDNYGAPPGAAVQARSSVASLVIFVNDINDHPPVFSQQVYRVNLSEEAPPGSYVSGISATDGDSGLNANLRYSIVSGNGLG------WFHISEHSGLVTTGSSGGLDR----ELASQIVLNISARDQGVHPKVSYAQLVVTLLDVNDEKPVFS-----QPEGYDVSVVENAPTGTELLMLRATDGD--LGDNGTVRFSLQEAETDRRSFRLDPVSGR-------LSTISSLDREE--QAFYSLLVLATDLGS-PPQSSMARINVSLLDINDNSPVFYPVQYFAHIKENEPGGS--YITTVSATDPDLGTNGTVKYSISAG----DRSRFQVNAQSGVISTRMALDREEKTAYQLQIVATDGGNLQSPNQAIVTITVLDTQDNPPVFSQVAYSFVVFENVALGYHVGSVSASTMDL---NSNISYLITT-GDQKGMFAINQVTGQLTTANVIDREEQSFYQLKVVA-------SGGTVTGDTMVNITVKDLNDNSPHF 893          

HSP 3 Score: 159.073 bits (401), Expect = 8.096e-38
Identity = 161/588 (27.38%), Postives = 262/588 (44.56%), Query Frame = 2
Query:  446 IKVLDENDNSPKFLPFLNPYQTLPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKLVNVIS-FYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITAINEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIFSL 2206
            I + D NDN P F P      T+ EN    + I+  +A+D D  A  +  Y I    + G D  F    +I      L+    LDRE  S+Y  +++A     DD    S + + I V D+ND+ P F +  Y+ +I E +   ++++    TD D G N +++  +   N+  +D I  FF    +P  +TG   L   +DYE   Y Y   + A D G     +T +V   +++ ND  P+        + S S ++ EN P  + V    V+D D  +        +  L + I + + +      K  ++  LK LDRE      L + ++   Q   +  T+   + I L D+NDNPP F   K    + EN P  TV  +      D D G N+Y+ Y + +   +     F+I    G++     +D E+   ++  ++A DK Q +LSS+  ++V V+D NDN PIF +  Y   + EN    T+I Q+   D D     ++        TN  Q   +D  +G +    P+DREK  +  + + A +  S    +       V I + D+ND  P+F L
Sbjct: 1728 ITLQDINDNPPVF-PTDMLDLTVEENIGDGSKIMQLTAMDADEGANALVTYTI----ISGADDSF----RIDPESGDLIATRRLDRERRSKYSLLVRA-----DDGLQSSDMRINITVSDVNDHTPKFSRPVYSFDIPEDTIPGSLVAAILATDDDSGVNGEITYIV---NEDDEDGI--FF---LNP--ITGVFNLTRLLDYEVQQY-YILTVRAEDGG--GQFTTIRVYFNILDVNDNPPIFS------LNSYSTSLMENLPVGSTVLVFNVTDADDGI--------NSQLTYSIASGDSLGQFTVDKNGVLKVLKALDRESQSFYNLVVQVHDLPQIPASRFTSTAQVSIILLDVNDNPPTFLSPKLT-YIPENTPIDTV--VFKAQATDPDSGPNSYIEYTLLNPLGNK----FSIGTIDGEVRLTGELDREEVSNYTLTVVATDKGQPSLSSSTEVVVMVLDINDNNPIFAQALYKVEINENTLTGTDIIQVFAADGDEGTNGQVRYGIVNGNTN--QEFRIDSVTGAITVAKPLDREKTPTYHLTVQATDRGSTPRTD----TSTVSIVLLDINDFVPVFEL 2261          

HSP 4 Score: 155.221 bits (391), Expect = 1.196e-36
Identity = 164/594 (27.61%), Postives = 257/594 (43.27%), Query Frame = 2
Query:  446 IKVLDENDNSPKFLPFLNPYQTLPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKLVNVISFYV--TDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMF--ENEPARTIVASLQVSDRD-SLVTDIECSLDDYHLNFEITAINEIHPLGHYKEFIINTLKPLDRED----DKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIF 2200
            I V D NDNSP FL  +     + EN Q    I    A+D D    G+  Y + +       + F + +K  +    + L+ PLD    S Y+  + A D         S V + + V D+NDN PVFD+  Y   + E S+ VN   F V  +D D G N +++ TI   N    D    F           G + +  E+D E    +Y   ++A+D  +  LS+T  V +IL + ND  P+          S + T +  E + A + V  +   D+D     ++  S +    +FE+ AI+           I NT +  DRE              +  +DQ    PL    T+H+ + DINDN P F +  YQ  + E+   A +  +  +   D D G N  + Y I       +   F ID+ SG+++    +DYE    +S  I A+D     L+ST  + + ++D NDN P FPK      V EN+ +   +  +  TD D+     +  Y+  + TNN+    +  N+G +     +D E      + ITA++    Q +    S   V+I + D NDNPP F
Sbjct:  881 ITVKDLNDNSPHFLQAIESVNVV-ENWQAGHSIFQAKAVDPDEGVNGMVLYSLKQ----NPKNLFAINEKNGT----ISLLGPLDVHAGS-YQIEILASDMGVPQLS--SSVILTVYVHDVNDNSPVFDQLSYEVTLSE-SEPVNSRFFKVQASDKDSGANGEIAYTIAEGN--TGDAFGIF---------PDGQLYIKSELDRELQD-RYVLMVVASDRAVEPLSATVNVTVILEDVNDNRPLFN--------STNYTFYFEEEQRAGSFVGKVSAVDKDFGPNGEVRYSFEMVQPDFELHAISG---------EITNTHQ-FDRESLMRRRGTAVFSFTVIATDQGIPQPLKDQATVHVYMKDINDNAPKFLKDFYQATISES--AANLTQVLRVSASDVDEGNNGLIHYSI---IKGNEERQFAIDSTSGQVTLIGKLDYEATPAYSLVIQAVDSGTIPLNSTCTLNIDILDENDNTPSFPKSTLFVDVLENMRIGELVSSVTATDSDSGDNADL--YYSITGTNNHGTFSISPNTGSIFLAKKLDFETQSLYKLNITAKD----QGRPPRSSTMSVVIHVRDFNDNPPSF 1420          

HSP 5 Score: 154.066 bits (388), Expect = 2.852e-36
Identity = 170/623 (27.29%), Postives = 284/623 (45.59%), Query Frame = 2
Query:  446 IKVLDENDNSPKFLPFLNPYQT-LPENSQINTVILLPSAIDLDSEAFGIKYYKI---SKPFLIGNDSHFTLLDKIASGRPQLLLIS---PLDREVISEYRFILKAVDRENDDHRDISG-VEVEIKVGDINDNPPV-----FDKTFYTANIVEHSKLVNVISFY-VTDLDE-GQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDN-GLP------RLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITAINEI---HPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSK-YQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIFSLINPAKSSLIF 2236
            + V D NDN P F    + YQ  +PE++ + + +L  +A D D        Y++     PF +                P+  LI+   PLD E   +Y   ++A+DR       ++G  E  I++ D+NDN PV     F  T   A++ E++++  V++   VTD D    N  +S+ I   N+      +R F++  S       I++   +D E  P  Y+  +  +DN G P        SS A + I + + ND  PV       + V R + + E  P  + V+ +  +D DS +        + +L + I + N +   H   H       +   LDRE      + +NI   DQ  + P  +   + + L D+ND  PVF++ + Y   ++EN P  T  ++  +   D D G N  V + +  ++  TD   F +D  SG++S+  S+D E+   +S  ++A D      SS A I V ++D NDN+P+F    Y   ++EN P  + I  +  TD D    N  VKY   +   +     V+  SG + T   +DRE+  +  + I A +  + Q+ N    + +V IT+ D  DNPP+FS +  A S ++F
Sbjct:  238 VTVQDINDNPPVFGS--SHYQAGVPEDAVVGSSVLQVAAADADEGTNADIRYRLQDEGTPFQM---------------DPETGLITVREPLDFEARRQYSLTVQAMDR---GVPSLTGRAEALIQLLDVNDNDPVVKFRYFPATSRYASVDENAQVGTVVALLTVTDADSPAANGNISVQILGGNE------QRHFEVQSSKVPNLSLIKVASALDRERIP-SYNLTVSVSDNYGAPPGAAVQARSSVASLVIFVNDINDHPPVFS-----QQVYR-VNLSEEAPPGSYVSGISATDGDSGL--------NANLRYSIVSGNGLGWFHISEHSGLVTTGSSGGLDRE--LASQIVLNISARDQ-GVHPKVSYAQLVVTLLDVNDEKPVFSQPEGYDVSVVENAPTGTELLM--LRATDGDLGDNGTVRFSLQEAE--TDRRSFRLDPVSGRLSTISSLDREEQAFYSLLVLATDLGSPPQSSMARINVSLLDINDNSPVFYPVQYFAHIKENEPGGSYITTVSATDPDLG-TNGTVKYSISA--GDRSRFQVNAQSGVISTRMALDREEKTAYQLQIVATDGGNLQSPN----QAIVTITVLDTQDNPPVFSQV--AYSFVVF 803          

HSP 6 Score: 152.525 bits (384), Expect = 8.927e-36
Identity = 169/618 (27.35%), Postives = 286/618 (46.28%), Query Frame = 2
Query:  404 QVDSGIKISSFYILIKVLDENDNSPKFLPFLNPYQTLPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKLVN-VISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLP-----RLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMF-ENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITAINEIHPLGHYKEFIINTL-------KPLDREDDKNQYLKINIYCSDQDKLTP-LTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVP-VNTEIGQIETTDLDTRPENKIVKY--FHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIFS 2203
            + D G++ S   I I V D ND++PKF   +  +  +PE++   +++    A D DS   G   Y +++     ++     L+ I        L   LD EV   Y   ++A     D     + + V   + D+NDNPP+F    Y+ +++E+  + + V+ F VTD D+G N Q++ +I + +   +      F +D       G ++++  +D E+  +   +NL+   + LP     R +STA+V+IIL++ ND  P          +S  +T   EN P  T+V   Q +D DS         + Y    E T +N   PLG+  +F I T+         LDRE+  N  L +       DK  P L+++  + + + DINDN P+F ++ Y+ E+ EN    T  +I+ +   D D G N  V Y I    N    + F ID+ +G I+  + +D EK   +   + A D+  +  + T+ + + ++D ND  P+F    YS  V EN+  +   I Q+   D D R  N  + Y  F  +  N + +      SG+L     +DRE      ++ITA +  S      +     + + ++DVNDN P F+
Sbjct: 1815 RADDGLQSSDMRINITVSDVNDHTPKFSRPVYSFD-IPEDTIPGSLVAAILATDDDSGVNGEITYIVNE----DDEDGIFFLNPITG---VFNLTRLLDYEVQQYYILTVRA----EDGGGQFTTIRVYFNILDVNDNPPIFSLNSYSTSLMENLPVGSTVLVFNVTDADDGINSQLTYSIASGDSLGQ------FTVD-----KNGVLKVLKALDRESQSF---YNLVVQVHDLPQIPASRFTSTAQVSIILLDVNDNPPTF--------LSPKLTYIPENTPIDTVVFKAQATDPDS-------GPNSY---IEYTLLN---PLGN--KFSIGTIDGEVRLTGELDREEVSNYTLTV----VATDKGQPSLSSSTEVVVMVLDINDNNPIFAQALYKVEINENTLTGT-DIIQ-VFAADGDEGTNGQVRYGI---VNGNTNQEFRIDSVTGAITVAKPLDREKTPTYHLTVQATDRGSTPRTDTSTVSIVLLDINDFVPVFELSPYSVNVPENLGTLPRTILQVVARD-DDRGSNSKLSYVLFGGNEDNAFTL----SASGELGVTQSLDRETKERFVLMITATDSGS----PALTGTGTINVIVDDVNDNVPTFA 2365          

HSP 7 Score: 146.747 bits (369), Expect = 4.908e-34
Identity = 182/711 (25.60%), Postives = 313/711 (44.02%), Query Frame = 2
Query:  440 ILIKVLDENDNSPKFLPFLNPYQTLPENSQINTVI--LLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKLVN-VISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITAINEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYE------KNKLFSFNIIAIDKD-QSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIFSLINPAKSSLIFTINKGFRHENCQMIPYAVSDADHDEPNSDSCCILQLDNDQNGMLYLLSNTPN-FLCLQNTMNTPGIYRVSLTATDNKNNPNKSLKAKVSFNIDVRHEVSDNP 2539
            + I VLD  DN P F      +    EN  +   +  +  S +DL+S         IS     G+      ++++     QL   + +DRE  S Y+  LK V        D     V I V D+NDN P F +   + N+VE+ +  + +      D DEG N  V  ++       K   K  F I+       G+I L+  +D     Y+    ++A+D G+P+LSS+  + + + + ND +PV       + +S  +T+ E+EP  +    +Q SD+DS          +  + + I   N     G + +  +     LDRE  +++Y+ + +  SD+  + PL+  + + + L D+NDN P+F  + Y     E   Q     +  +  +DKD G N  V Y  +  +       F + A SG+I++    D E         +FSF +IA D+     L   A + V++ D NDNAP F K  Y  T+ E+    T++ ++  +D+D    N  + ++     N  +   +D  SG++  IG +D E   + +++I A +  +      ++S C + I I D NDN P F      KS+L   + +  R      +  +V+  D D  ++          + +G   +  NT + FL  +    T  +Y++++TA D    P  S  + V   I VR + +DNP
Sbjct:  779 VTITVLDTQDNPPVFSQVAYSFVVF-ENVALGYHVGSVSASTMDLNS--------NISYLITTGDQKGMFAINQVTG---QLTTANVIDREEQSFYQ--LKVVASGGTVTGD---TMVNITVKDLNDNSPHFLQAIESVNVVENWQAGHSIFQAKAVDPDEGVNGMVLYSL-------KQNPKNLFAINEK----NGTISLLGPLDVHAGSYQ--IEILASDMGVPQLSSSVILTVYVHDVNDNSPVF------DQLSYEVTLSESEPVNSRFFKVQASDKDSGA--------NGEIAYTIAEGNTGDAFGIFPDGQLYIKSELDRE-LQDRYV-LMVVASDR-AVEPLSATVNVTVILEDVNDNRPLFNSTNYTFYFEEE--QRAGSFVGKVSAVDKDFGPNGEVRYSFEMVQPD-----FELHAISGEITNTHQFDRESLMRRRGTAVFSFTVIATDQGIPQPLKDQATVHVYMKDINDNAPKFLKDFYQATISESAANLTQVLRVSASDVDE--GNNGLIHYSIIKGNEERQFAIDSTSGQVTLIGKLDYEATPAYSLVIQAVDSGTIP----LNSTCTLNIDILDENDNTPSF-----PKSTLFVDVLENMR---IGELVSSVTATDSDSGDNADLYYSITGTNNHGTFSISPNTGSIFLAKKLDFETQSLYKLNITAKDQGRPPRSSTMSVV---IHVR-DFNDNP 1417          

HSP 8 Score: 146.747 bits (369), Expect = 5.165e-34
Identity = 182/668 (27.25%), Postives = 299/668 (44.76%), Query Frame = 2
Query:  422 KISSFYILIKVLDENDNSPKFLPFLNPYQTLPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDREND-DHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKLVNVI--SFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLI--ATDNGLPRLSSTAKVNIILINKND----QAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITAINEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIFSLINPAKSSLIFTINKGFRHENCQMIPYAVSDADHDEPNSD-------SCCILQLDNDQNGMLYLL 2377
            + S+  ++I V D NDN P F P  + ++++ EN  I T ++  +A D D++  G   Y I +    GN  HFT+ D++   +  +   + +DRE  + +   +KA D+    + R  +   V I V D+NDN P+F      A   + S ++  +  +    D DEG N ++   I    D     + R+          +G +R+   +     P +  +NLI  ATD G  R  ST ++ IIL   +     Q   I ++++GE +  ++   E    R   A ++       +  + C         E   +  +  +G +   II T   LDRE     YL +++Y  ++    P T    + I L DINDNPPVF        + ENI   + K+++ +  +D D G NA VTY I S  + +    F ID +SG + + + +D E+   +S  + A D  Q   SS   I + V D ND+ P F +P YSF + E+    + +  I  TD D+    +I    ++   +   +  ++  +G       +D E V+   IL     +   Q   +      V   I DVNDNPPIFSL N   +SL+  +  G       ++ + V+DAD D  NS           + Q   D+NG+L +L
Sbjct: 1400 RSSTMSVVIHVRDFNDNPPSFPPG-DIFKSIVENIPIGTSVISVTAHDPDADINGQLSYTIIQQMPRGN--HFTI-DEV---KGTIYTNAEIDREFANLFELTVKANDQAVPIETRRYALKNVTILVTDLNDNVPMFISQ--NALAADPSAVIGSVLTTIMAADPDEGANGEIEYEI-INGDTDTFIVDRY----------SGDLRVASAL----VPSQLIYNLIVSATDLGPERRKSTTELTIILQGLDGPVFTQPKYITILKEGEPIGTNVISIEAASPRGSEAPVEY-----YIVSVRC---------EEKTVGRLFTIGRHTG-IIQTAAILDREQGACLYL-VDVYAIEKSTAFPRTQRAEVEITLQDINDNPPVFPTDMLDLTVEENIGDGS-KIMQ-LTAMDADEGANALVTYTIISGADDS----FRIDPESGDLIATRRLDRERRSKYSLLVRADDGLQ---SSDMRINITVSDVNDHTPKFSRPVYSFDIPEDTIPGSLVAAILATDDDSGVNGEITYIVNEDDEDG--IFFLNPITGVFNLTRLLDYE-VQQYYILTVRAEDGGGQFTTI-----RVYFNILDVNDNPPIFSL-NSYSTSLMENLPVG-----STVLVFNVTDAD-DGINSQLTYSIASGDSLGQFTVDKNGVLKVL 2003          

HSP 9 Score: 145.206 bits (365), Expect = 1.533e-33
Identity = 173/619 (27.95%), Postives = 271/619 (43.78%), Query Frame = 2
Query:  428 SSFYILIKVLDENDNSPKFLPFLNPYQTLPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGN--DSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKLVNVIS-FYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYET-----NPYKYSFNLIATDNGLPR-LSSTAKVNIILINKNDQAP-VIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITAINEIHPLGHYKEFIINT-------LKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQV-----IHVDQNSGKLKTIGPIDREKVRSITILITARNEA------SYQNKNLMDSECMVIITIEDVNDNPPIF 2200
            SS  + + V D NDNSP F   L+   TL E+  +N+      A D DS A G   Y I++    GN  D+     D       QL + S LDRE+   Y  ++ A DR  +     + V V + + D+NDN P+F+ T YT    E  +  + +      D D G N +V  + E              Q DF    ++G I    + D E+         +SF +IATD G+P+ L   A V++ + + ND AP  +K   +  I         +E A  +   L+VS  D  V +    L    +++ I   NE       ++F I++       +  LD E      L I    S      PL +  T++I++ D NDN P F +S    +++EN+     +++  +   D D G NA + Y I  + N      F+I  ++G I   + +D+E   L+  NI A D+ +   SST  +++HV D NDN P FP      ++ EN+P+ T +  +   D D     ++      SYT   Q+       +D+  G + T   IDRE      + + A ++A       Y  KN       V I + D+NDN P+F
Sbjct:  978 SSVILTVYVHDVNDNSPVF-DQLSYEVTLSESEPVNSRFFKVQASDKDSGANGEIAYTIAE----GNTGDAFGIFPDG------QLYIKSELDRELQDRYVLMVVASDRAVEPLS--ATVNVTVILEDVNDNRPLFNSTNYTFYFEEEQRAGSFVGKVSAVDKDFGPNGEVRYSFE------------MVQPDFELHAISGEITNTHQFDRESLMRRRGTAVFSFTVIATDQGIPQPLKDQATVHVYMKDINDNAPKFLKDFYQATI---------SESAANLTQVLRVSASD--VDEGNNGL----IHYSIIKGNE------ERQFAIDSTSGQVTLIGKLDYEATPAYSLVIQAVDSGT---IPLNSTCTLNIDILDENDNTPSFPKSTLFVDVLENMRIG--ELVSSVTATDSDSGDNADLYYSITGTNNHGT---FSISPNTGSIFLAKKLDFETQSLYKLNITAKDQGRPPRSSTMSVVIHVRDFNDNPPSFPPGDIFKSIVENIPIGTSVISVTAHDPDADINGQL------SYTIIQQMPRGNHFTIDEVKGTIYTNAEIDREFANLFELTVKANDQAVPIETRRYALKN-------VTILVTDLNDNVPMF 1529          

HSP 10 Score: 142.51 bits (358), Expect = 1.188e-32
Identity = 156/578 (26.99%), Postives = 263/578 (45.50%), Query Frame = 2
Query:  428 SSFYILIKVLDENDNSPKFLPFLNPYQTLPENSQINTVILLPSAIDLDSEAFGIKYYKI---SKPFLIGNDSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKLVN-VISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYE-------TNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITAI--NEIHPLGHYK----EFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARN 2110
            +S  ++I +LDENDN+P+F    + +  +PENS +   +   +  D D     I  Y I   S PF I   +              +++  PL+RE    YR  + A    +D    +S  +V I V DINDN P F +T Y  +  E +++ + V   + TD DEG N QV   I+++++Y        F+I+ +    TG I     + Y+        N  ++SF + ++D G P L S   V I +++ ND AP                  +++    +  +++V  +   VT I+    D+ LN E+     N+ H LG +K       I+    L    D NQ   I +   D+    PL++  T+HI + + N + P F++S     + E+   +   ++  +   D+D   N  + Y I S     +   F I++ +G ++  +++DYE  +     I AID      +    + V+VID NDN+P+F    Y  TV EN P  T +  +  TD D+   N ++ Y  +S  ++  VI  D N+G + T G +D E  +S  + + A N
Sbjct: 2755 TSVKVMINILDENDNAPRFSQIFSAH--VPENSPLGYTVTRVTTSDEDIGINAISRYSIMDASLPFTINPSTG------------DIVISRPLNREDTDRYRIRVSA----HDSGWTVS-TDVTIFVTDINDNAPRFSRTSYYLDCPELTEIGSKVTQVFATDPDEGSNGQVFYFIKSQSEY--------FRINAT----TGEIFNKQILKYQNVTGFSNVNINRHSFIVTSSDRGKPSLISETTVTINIVDSNDNAP---------------QFLKSKYFTPVTKNVKVGTKLIRVTAIDDK--DFGLNSEVEYFISNDNH-LGKFKLDNDTGWISVASSL--ISDLNQNFFITVTAKDKGN-PPLSSQATVHITVTEENYHTPEFSQSHMSATIPES--HSIGSIVRTVSARDRDAAMNGLIKYSISSGN---EEGIFAINSSTGILTLAKALDYELCQKHEMTISAIDGGWVARTGYCSVTVNVIDVNDNSPVFLSDDYFPTVLENAPSGTTVIHLNATDADSG-TNAVIAYTVQSSDSDLFVI--DPNTGVITTQGFLDFETKQSYHLTVKAFN 3272          

HSP 11 Score: 142.124 bits (357), Expect = 1.316e-32
Identity = 164/611 (26.84%), Postives = 262/611 (42.88%), Query Frame = 2
Query:  428 SSFYILIKVLDENDNSPKFLPFLNPYQTLPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKLV--NVISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRS--ITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITAINEIHPLGHYKEFIIN-------TLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATV--KMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSST--ALIIVHVIDANDNAPIFPK---PHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEA--SYQNKNLMDSECMVIITIEDVNDNPPIF 2200
            SS  +++ VLD NDN+P F   L   + + EN+   T I+   A D D    G   Y I      GN +    +D +      + +  PLDRE    Y   ++A DR +    D S   V I + DIND  PVF+ + Y+ N+ E+   +   ++     D D G N ++S  +   N+         F +  S     G + +   +D ET   ++   + ATD+G P L+ T  +N+I+ + ND  P           S++   T+ E+ P  T V  +  SD D+    +                  I  +G   +F IN       T   LDRE   N  L +   CSD     PL+++ ++ + + D+NDNPP F    Y    + +IP  T+    +  +   D D G N+ + Y + S +NS   E F ID   G I +   ++      FS ++    KD  +   T    + V  ++  D    FPK      +F   EN PV++ +  I  + L   P    + Y+  S  N      +DQ +G++    P+D EK++   + I AR+     + +   +D      IT+ DVNDN PIF
Sbjct: 2136 SSTEVVVMVLDINDNNPIFAQALYKVE-INENTLTGTDIIQVFAADGDEGTNGQVRYGIVN----GNTNQEFRIDSVTGA---ITVAKPLDREKTPTYHLTVQATDRGSTPRTDTS--TVSIVLLDINDFVPVFELSPYSVNVPENLGTLPRTILQVVARDDDRGSNSKLSYVLFGGNE------DNAFTLSAS-----GELGVTQSLDRETKE-RFVLMITATDSGSPALTGTGTINVIVDDVNDNVPTF--------ASKAYFTTIPEDAPTGTDVLLVNASDADASKNAV------------------IRIIGGNSQFTINPSTGQIITSALLDRETKDNYTLVV--VCSDAGSPEPLSSSTSVLVTVTDVNDNPPRFQHHPY----VTHIPSPTLPGSFVFAVTVTDADIGPNSELHYSL-SGRNS---EKFHIDPLRGAIMAAGPLNGASEVTFSVHV----KDGGSFPKTDSTTVTVRFVNKAD----FPKVRAKEQTFMFPENQPVSSLVTTITGSSLRGEP----MSYYIAS-GNLGNTFQIDQLTGQVSISQPLDFEKIQKYVVWIEARDGGFPPFSSYEKLD------ITVLDVNDNAPIF 2669          

HSP 12 Score: 137.117 bits (344), Expect = 4.205e-31
Identity = 154/574 (26.83%), Postives = 266/574 (46.34%), Query Frame = 2
Query:  512 LPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVE-VEIKVGDINDNPPVFDKTFYTANIVEHSKLVNVISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDI-ECSLDDYHLNFEITAINEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLF--------SFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIFS 2203
             PEN  +++++   +   L  E   + YY  S     GN  +   +D++     Q+ +  PLD E I +Y   ++A D         S  E ++I V D+NDN P+F +  + + I+E+     +++    D D G N Q+   I   N           +  FS +  TG IR +  +D E   + Y   + ++D G P  S++ KV I ++++ND AP     R  +I S  +   EN P    V  +  SD D  +  I   S+ D  L F I             + +I+  +PL+RED     +++    S  D    ++T++TI +   DINDN P F+R+ Y  +  E + +   K+ + +   D D G N  V Y I S       EYF I+A +G+I ++Q + Y+    F        SF + + D+ + +L S   + ++++D+NDNAP F K  Y   V +NV V T++ ++   D      N  V+YF  S  N+     +D ++G +     +  +  ++  I +TA+++ +      + S+  V IT+ + N + P FS
Sbjct: 2576 FPENQPVSSLVTTITGSSLRGEP--MSYYIAS-----GNLGNTFQIDQLTG---QVSISQPLDFEKIQKYVVWIEARD---GGFPPFSSYEKLDITVLDVNDNAPIFKEDPFISEILENLSPRKILTVSAMDKDSGPNGQLDYEIVNGN----------MENSFSINHATGEIRSVRPLDREKVSH-YVLTIKSSDKGSPSQSTSVKVMINILDENDNAP-----RFSQIFSAHVP--ENSPLGYTVTRVTTSDEDIGINAISRYSIMDASLPFTINP--------STGDIVIS--RPLNREDTDRYRIRV----SAHDSGWTVSTDVTIFVT--DINDNAPRFSRTSYYLDCPE-LTEIGSKVTQ-VFATDPDEGSNGQVFYFIKSQS-----EYFRINATTGEIFNKQILKYQNVTGFSNVNINRHSFIVTSSDRGKPSLISETTVTINIVDSNDNAPQFLKSKYFTPVTKNVKVGTKLIRVTAIDDKDFGLNSEVEYF-ISNDNHLGKFKLDNDTGWISVASSLISDLNQNFFITVTAKDKGNPP----LSSQATVHITVTEENYHTPEFS 3090          

HSP 13 Score: 130.568 bits (327), Expect = 4.318e-29
Identity = 161/606 (26.57%), Postives = 269/606 (44.39%), Query Frame = 2
Query:  410 DSGI--KISSFYILIKVLDENDNSPKFLPFLNPYQTLPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKLVNVI-SFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIE--CSLDDYHLNFEITAINEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIFSLIN 2212
            D G+  K+S   +++ +LD ND  P F        ++ EN+   T +L+  A D D    G   + + +      D     LD + SGR  L  IS LDRE  + Y  ++ A D  +     ++ + V +   DINDN PVF    Y A+I E+    + I +   TD D G N  V  +I   +       +  FQ++    ++  S R+  + + +T    Y   ++ATD G  +  + A V I +++  D  PV         V+ S  +FEN      V S+  S  D L ++I    +  D    F   AIN++   G      + T   +DRE+     LK+            +T +  ++I + D+NDN P F ++     ++EN  QA   + +    +D D G N  V Y +  +  +     F I+  +G IS    +D      +   I+A D     LSS+ ++ V+V D NDN+P+F +  Y  T+ E+ PVN+   +++ +D D+    +I     +  T +   I  D   G+L     +DRE      +++ A + A       + +   V + +EDVNDN P+F+  N
Sbjct:  556 DQGVHPKVSYAQLVVTLLDVNDEKPVFSQPEGYDVSVVENAPTGTELLMLRATDGDLGDNGTVRFSLQE---AETDRRSFRLDPV-SGR--LSTISSLDREEQAFYSLLVLATDLGSPPQSSMARINVSLL--DINDNSPVFYPVQYFAHIKENEPGGSYITTVSATDPDLGTNGTVKYSISAGD-------RSRFQVNAQSGVI--STRMALDREEKT---AYQLQIVATDGGNLQSPNQAIVTITVLDTQDNPPVFSQ------VAYSFVVFENVALGYHVGSVSASTMD-LNSNISYLITTGDQKGMF---AINQV--TGQ-----LTTANVIDREEQSFYQLKVVASGGT------VTGDTMVNITVKDLNDNSPHFLQAIESVNVVENW-QAGHSIFQ-AKAVDPDEGVNGMVLYSLKQNPKN----LFAINEKNGTISLLGPLDVHAGS-YQIEILASDMGVPQLSSSVILTVYVHDVNDNSPVFDQLSYEVTLSESEPVNSRFFKVQASDKDSGANGEIAYTIAEGNTGDAFGIFPD---GQLYIKSELDRELQDRYVLMVVASDRA----VEPLSATVNVTVILEDVNDNRPLFNSTN 1104          

HSP 14 Score: 118.627 bits (296), Expect = 2.028e-25
Identity = 155/596 (26.01%), Postives = 260/596 (43.62%), Query Frame = 2
Query:  440 ILIKVLDENDNSPKFLPFLNPYQTLPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHS-KLVNVISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLP--RLSSTAKVNIILINKNDQAPVIKVIRKGEIVSR--SITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITAINEIHPLGHYKEFIINTLKPLDREDDKNQYLKI------NIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKN-AYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNP 2191
            + I V +EN ++P+F    +   T+PE+  I +++   SA D D+   G+  Y IS     GN+     +  I S    L L   LD E+  ++   + A+D           V V +   D+NDN PVF    Y   ++E++     VI    TD D G N  ++ T+++ +          F ID +    TG I     +D+ET   K S++L      +P     S A VNI L   N+  P          VS+     + E  P  TIV  +  SDRD L TD E     ++L F  +            +  ++ +  LDRE ++   LK+      +I  +D D++T       +++ + D ND PP+FT + Y  ++ E +P  T   +  +   D D   + +  +Y I S   +     F+I+  +G+I+    +D E   +++ +++A+D    + + +A ++V + D NDN P+         V EN    T +  +++TD D  P      Y+  S         +   +G L T   IDRE++    + +  ++    Q    M S   V IT+ D NDNP
Sbjct: 3075 VHITVTEENYHTPEFSQS-HMSATIPESHSIGSIVRTVSARDRDAAMNGLIKYSISS----GNEEG---IFAINSSTGILTLAKALDYELCQKHEMTISAIDGGWVARTGYCSVTVNVI--DVNDNSPVFLSDDYFPTVLENAPSGTTVIHLNATDADSGTNAVIAYTVQSSD-------SDLFVIDPN----TGVITTQGFLDFET---KQSYHLTVKAFNVPDEERCSFATVNIQLKGTNEYVP--------RFVSKLYYFEISEAAPKGTIVGEVFASDRD-LGTDGEV----HYLIFGNSRKKGFQINKKTGQIYVSGI--LDREKEERVSLKVLAKNFGSIRGADIDEVT-------VNVTVLDAND-PPIFTLNIYSVQISEGVPIGT--HVTFVSAFDSDSIPSWSRFSYFIGSGNENG---AFSINPQTGQITVTAELDRETLPIYNLSVLAVDSGTPSATGSASLLVTLEDINDNGPMLTVSEGE--VMENKRPGTLVMTLQSTDPDLPPNQGPFTYYLLSTGPATSYFSL-STAGVLSTTREIDREQIADFYLSVVTKDSGVPQ----MSSTGTVHITVIDQNDNP 3611          

HSP 15 Score: 117.857 bits (294), Expect = 3.859e-25
Identity = 180/666 (27.03%), Postives = 284/666 (42.64%), Query Frame = 2
Query:  245 IDNRLSVVSNIDRESICPIKNSLNDYDQSAETYNSQQSSHSCKYDECCTVFSFQVDSGIKISSFYILIKVLDENDNSPKFLP---FLNPYQTLPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLIS---PLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKL---VNVISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAP-VIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIEC-SLDDYHLNFEITAINEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKV--RSITILITARNEASYQN-KNLMDSECMVIITIEDVNDNPPIF 2200
            +  RLS +S++DRE                     +Q+ +S        V +  + S  + S   I + +LD NDNSP F P   F +  +  P  S I TV    SA D D    G   Y IS     G+ S F +         Q  +IS    LDRE  + Y+  + A D  N   +  +   V I V D  DNPPVF +  Y+  + E+  L   V  +S    DL    N  +S  I T      DQ K  F I+     +TG +   + ID E   + Y   ++A+      ++    VNI + + ND +P  ++ I        S+ + EN  A   +   +  D D  V  +   SL     N  + AINE       K   I+ L PLD      Q   I I  SD   +  L++++ + + + D+NDN PVF +  Y+  L E+ P  +      +   DKD G N  + Y I +  N+ D   F I  D G++  +  +D E    +   ++A D+    LS+T  + V + D NDN P+F   +Y+F   E     + +G++   D D  P N  V+Y  +    ++++  +   SG++      DRE +  R  T + +    A+ Q     +  +  V + ++D+NDN P F
Sbjct:  637 VSGRLSTISSLDRE---------------------EQAFYSL------LVLATDLGSPPQSSMARINVSLLDINDNSPVFYPVQYFAHIKENEPGGSYITTV----SATDPDLGTNGTVKYSISA----GDRSRFQV-------NAQSGVISTRMALDREEKTAYQLQIVATDGGN--LQSPNQAIVTITVLDTQDNPPVFSQVAYSFVVFENVALGYHVGSVSASTMDL----NSNISYLITT-----GDQ-KGMFAIN----QVTGQLTTANVIDREEQSF-YQLKVVASGG---TVTGDTMVNITVKDLNDNSPHFLQAI-------ESVNVVENWQAGHSIFQAKAVDPDEGVNGMVLYSLKQNPKN--LFAINE-------KNGTISLLGPLDVHAGSYQ---IEILASDM-GVPQLSSSVILTVYVHDVNDNSPVFDQLSYEVTLSESEPVNS--RFFKVQASDKDSGANGEIAYTI-AEGNTGD--AFGIFPD-GQLYIKSELDRELQDRYVLMVVASDRAVEPLSATVNVTVILEDVNDNRPLFNSTNYTFYFEEEQRAGSFVGKVSAVDKDFGP-NGEVRYSFEMVQPDFELHAI---SGEITNTHQFDRESLMRRRGTAVFSFTVIATDQGIPQPLKDQATVHVYMKDINDNAPKF 1210          

HSP 16 Score: 112.079 bits (279), Expect = 2.025e-23
Identity = 145/604 (24.01%), Postives = 261/604 (43.21%), Query Frame = 2
Query:  425 ISSFYILIKVLDENDNSPKFLP--FLNPYQTLPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKLVNVI-SFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSI--TMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITAINEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIY-CSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTAL----IIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIFSL 2206
            IS   + I ++D NDN+P+FL   +  P   + +N ++ T ++  +AID   + FG+        + I ND+H     K+ +    + + S L  ++   +   + A D+ N      S   V I V + N + P F ++  +A I E   + +++ +    D D   N  +  +I + N+      +  F I+ S    TG + L   +DYE    K+   + A D G    +    V + +I+ ND +PV         +S     T+ EN P+ T V  L  +D DS    +      Y +    + +  I P       +I T   LD E  ++ +L +  +   D+++ +  T N    I L   N+  P F    Y  E+ E  P+ T+  +  +   D+D G +  V Y I  +      + F I+  +G+I     +D EK +  S  ++A  K+  ++    +    + V V+DAND  PIF    YS  + E VP+ T +  +   D D+ P      YF  S   N     ++  +G++     +DRE +    + + A +  +            +++T+ED+NDN P+ ++
Sbjct: 2964 ISETTVTINIVDSNDNAPQFLKSKYFTP---VTKNVKVGTKLIRVTAID--DKDFGLNS---EVEYFISNDNHLGKF-KLDNDTGWISVASSLISDLNQNFFITVTAKDKGNPPLS--SQATVHITVTEENYHTPEFSQSHMSATIPESHSIGSIVRTVSARDRDAAMNGLIKYSISSGNE------EGIFAINSS----TGILTLAKALDYELC-QKHEMTISAIDGGWVARTGYCSVTVNVIDVNDNSPVF--------LSDDYFPTVLENAPSGTTVIHLNATDADSGTNAVIA----YTVQSSDSDLFVIDP----NTGVITTQGFLDFETKQSYHLTVKAFNVPDEERCSFATVN----IQLKGTNEYVPRFVSKLYYFEISEAAPKGTI--VGEVFASDRDLGTDGEVHYLIFGNSRK---KGFQINKKTGQIYVSGILDREKEERVSLKVLA--KNFGSIRGADIDEVTVNVTVLDAND-PPIFTLNIYSVQISEGVPIGTHVTFVSAFDSDSIPSWSRFSYFIGSGNEN-GAFSINPQTGQITVTAELDRETLPIYNLSVLAVDSGTPS----ATGSASLLVTLEDINDNGPMLTV 3512          

HSP 17 Score: 110.538 bits (275), Expect = 6.673e-23
Identity = 160/605 (26.45%), Postives = 266/605 (43.97%), Query Frame = 2
Query:  446 IKVLDENDNSPKFL--PFLNPYQTLPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGN-DSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKLVNVISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQID----FSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAP-------VIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITAINEIHPLGHYKEFIINTLKPLDREDDKNQYLKINI-----YCSDQDKLTP-LTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIF 2200
            I VLD NDN+P F   PF++    + EN     ++ + SA+D DS   G   Y+I      GN ++ F++    A+G  ++  + PLDRE +S Y   +K+ D+ +      + V+V I + D NDN P F + F +A++ E+S L   ++  VT  DE              D   + I R+  +D    F+ +  TG I +   ++ E +  +Y   + A D+G    + +  V I + + ND AP        +      EI S+   +F  +P           D  S          +  + + I + +E   +      I N  K + +  +   +  +NI       +  D+  P L +  T+ IN+ D NDN P F +SKY   + +N+   T K+I      DKD G N+ V Y I    N      F +D D+G IS   S+  + N+ F   + A DK    LSS A + + V + N + P F + H S T+ E+  + + +  +   D D    N ++KY   S  N   +  ++ ++G L     +D E  +   + I+A +             C V + + DVNDN P+F
Sbjct: 2657 ITVLDVNDNAPIFKEDPFIS---EILENLSPRKILTV-SAMDKDSGPNGQLDYEIVN----GNMENSFSI--NHATG--EIRSVRPLDREKVSHYVLTIKSSDKGSPSQS--TSVKVMINILDENDNAPRFSQIF-SAHVPENSPLGYTVT-RVTTSDE--------------DIGINAISRYSIMDASLPFTINPSTGDIVISRPLNRE-DTDRYRIRVSAHDSGW---TVSTDVTIFVTDINDNAPRFSRTSYYLDCPELTEIGSKVTQVFATDP-----------DEGS----------NGQVFYFIKSQSEYFRINATTGEIFN--KQILKYQNVTGFSNVNINRHSFIVTSSDRGKPSLISETTVTINIVDSNDNAPQFLKSKYFTPVTKNVKVGT-KLIRVTAIDDKDFGLNSEVEYFI---SNDNHLGKFKLDNDTGWISVASSLISDLNQNFFITVTAKDKGNPPLSSQATVHITVTEENYHTPEFSQSHMSATIPESHSIGSIVRTVSARDRDAA-MNGLIKY-SISSGNEEGIFAINSSTGILTLAKALDYELCQKHEMTISAIDGGWVARTGY----CSVTVNVIDVNDNSPVF 3194          

HSP 18 Score: 100.908 bits (250), Expect = 5.872e-20
Identity = 78/300 (26.00%), Postives = 141/300 (47.00%), Query Frame = 2
Query: 1349 IHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTN-LTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPI-----FPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENK--IVKYFHKSYTNNYQVIHVD-QNSGKLKTIGPIDREKVRSITILIT------ARNEASYQNKNLMDSECMVIITIEDVNDNPPIFS 2203
            ++P G      + +   LDRE      L + +    +DK  P     L +++ + DINDNPPVF  S YQ  + E+        +  +   D D G NA + Y++           F +D ++G I+ R+ +D+E  + +S  + A+D+   +L+  A  ++ ++D NDN P+     FP      +V EN  V T +  +  TD D+   N    V+    +   +++V      N   +K    +DRE++ S  + ++      A   A+ Q ++ + S   ++I + D+ND+PP+FS
Sbjct:  191 LNPSGEGAFLHLVSKGGLDREVTPQYQLLVEV----EDKGEPKRRGYLQVNVTVQDINDNPPVFGSSHYQAGVPED--AVVGSSVLQVAAADADEGTNADIRYRLQDEGTP-----FQMDPETGLITVREPLDFEARRQYSLTVQAMDRGVPSLTGRAEALIQLLDVNDNDPVVKFRYFPATSRYASVDENAQVGTVVALLTVTDADSPAANGNISVQILGGNEQRHFEVQSSKVPNLSLIKVASALDRERIPSYNLTVSVSDNYGAPPGAAVQARSSVAS---LVIFVNDINDHPPVFS 476          

HSP 19 Score: 94.3597 bits (233), Expect = 4.996e-18
Identity = 160/621 (25.76%), Postives = 265/621 (42.67%), Query Frame = 2
Query:  440 ILIKVLDENDNSPKFLPFLNPYQT-LPEN-SQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGN-DSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKL-VNVISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPR-LSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDR---DSLVTDIECSLDDYHLNFEITAIN----EIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELI-ENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKI-VKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPP----IFSLINPAKSSLIFTINK 2248
            + I +LD ND  P F   L+PY   +PEN   +   IL   A D D  +      K+S     GN D+ FTL    ASG  +L +   LDRE  ++ RF+L     ++          + + V D+NDN P F    Y   I E +    +V+    +D D  +N  + I            I    Q   +PS  TG I     +D ET    Y+  ++ +D G P  LSS+  V + + + ND  P                 F++ P  T + S  +         VTD +   +   L++ ++  N     I PL       I    PL+   +    +  +++  D     P T + T+ +   +  D P V  R+K Q  +  EN P +++     + T+     +   ++Y I S         F ID  +G++S  Q +D+EK + +   I A D      SS   + + V+D NDNAPIF +  +   + EN+    +I  +   D D+ P  ++  +  + +  N++ + H    +G+++++ P+DREKV    + I + ++ S        +   V+I I D NDN P    IFS   P  S L +T+ +
Sbjct: 2245 VSIVLLDINDFVPVFE--LSPYSVNVPENLGTLPRTILQVVARDDDRGS----NSKLSYVLFGGNEDNAFTLS---ASG--ELGVTQSLDRE--TKERFVLMITATDSGSPALTGTGTINVIVDDVNDNVPTFASKAYFTTIPEDAPTGTDVLLVNASDADASKNAVIRI------------IGGNSQFTINPS--TGQIITSALLDRETKD-NYTLVVVCSDAGSPEPLSSSTSVLVTVTDVNDNPP----------------RFQHHPYVTHIPSPTLPGSFVFAVTVTDADIGPNS-ELHYSLSGRNSEKFHIDPL----RGAIMAAGPLNGASE----VTFSVHVKDGGSF-PKTDSTTVTVRFVNKADFPKV--RAKEQTFMFPENQPVSSL-----VTTITGSSLRGEPMSYYIASGNLGNT---FQIDQLTGQVSISQPLDFEKIQKYVVWIEARDGGFPPFSSYEKLDITVLDVNDNAPIFKEDPFISEILENLSPR-KILTVSAMDKDSGPNGQLDYEIVNGNMENSFSINHA---TGEIRSVRPLDREKVSHYVLTIKSSDKGSPSQS----TSVKVMINILDENDNAPRFSQIFSAHVPENSPLGYTVTR 2793          

HSP 20 Score: 86.2705 bits (212), Expect = 1.543e-15
Identity = 128/506 (25.30%), Postives = 205/506 (40.51%), Query Frame = 2
Query:  782 EVEIKVGDINDNPPVF-DKTFYTANIVEHSKLVNVISFYVTDLDEGQNKQVSITIETENDYKKDQIKRF-FQIDFSPSLMTGSIRLIDE--IDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVAS--LQVSDRDS---LVTDIECSLDDYHLNFEITAINEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTP-LTTNLTIHINLFDINDNPPV-----FTRSKYQGELIENIPQATVKMIEPILTL-DKDH-GKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSID----YEKNKLFSFNIIAIDKDQSNL---------SSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKT--IGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIFS 2203
            EV + V D+NDN PVF D +       + S    VI    TD D G N    +   +    + ++  RF   I  +PS     + L+ +  +D E  P +Y   +   D G P+     +VN+ + + ND  PV            S       P   +V S  LQV+  D+      DI   L D    F++            +  +I   +PLD E  +   L +       D+  P LT      I L D+NDN PV     F  +     + EN   A V  +  +LT+ D D    N  ++ +I        +E       S K+ +   I      ++ ++ S+N+     D             SS A +++ V D ND+ P+F +  Y   + E  P  + +  I  TD D+   N  ++Y   S  N     H+ ++SG + T   G +DRE    I + I+AR++  +       S   +++T+ DVND  P+FS
Sbjct:  120 EVRVLVRDLNDNAPVFPDPSIVVTFKEDSSSGRQVILDTATDSDIGSN---GVDHRSYRIIRGNEAGRFRLDITLNPSGEGAFLHLVSKGGLDREVTP-QYQLLVEVEDKGEPKRRGYLQVNVTVQDINDNPPVFG----------SSHYQAGVPEDAVVGSSVLQVAAADADEGTNADIRYRLQDEGTPFQMDP----------ETGLITVREPLDFEARRQYSLTVQA----MDRGVPSLTGRAEALIQLLDVNDNDPVVKFRYFPATSRYASVDEN---AQVGTVVALLTVTDADSPAANGNISVQILGGNEQRHFE-----VQSSKVPNLSLIKVASALDRERIPSYNLTVSVSDNYGAPPGAAVQARSSVASLVIFVNDINDHPPVFSQQVYRVNLSEEAPPGSYVSGISATDGDSG-LNANLRYSIVS-GNGLGWFHISEHSGLVTTGSSGGLDRELASQIVLNISARDQGVHPKV----SYAQLVVTLLDVNDEKPVFS 583          
BLAST of Protocadherin Fat 1 vs. TrEMBL
Match: A0A087VWC5 (Uncharacterized protein OS=Echinococcus multilocularis OX=6211 GN=EmuJ_000007700 PE=4 SV=2)

HSP 1 Score: 389.808 bits (1000), Expect = 2.415e-114
Identity = 291/940 (30.96%), Postives = 459/940 (48.83%), Query Frame = 2
Query:   83 SNFLEMISVKENIYYSQPLLDL-EKVLKNRTIIPYDKHQRYKIYAVTEKA-SPFSLIDNRLSVVSNIDRESICPIKNSLNDYDQSAETYNSQQSSHSCKYDECCTVFSFQV--DSGIKISSFYILIKVLDENDNSPKFLPFLNPYQTLPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHF---TLLDK-------------IASGRPQLLLISPLDREVISEYRFILKAVDR-ENDDHRDISG-VEVEIKVGDINDNPPVFDKTFYTANIVEHSKLVNVISFYVTDLDEGQNKQVSITI-----ETENDYK---------KDQIKRFFQIDFSP-SLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRS-------ITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITAINEIHPLGH--------------------------------YKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTL---DKDHGKNAYVTYKID--------------SSKNSTDWEYFTIDADSGKISSRQSIDYEKNK----LFSFNIIAIDKD-QSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDS---------ECMVIITIEDVNDNPPIFSLINPAKSSLIFT--------INKGFRHEN--CQMIPYAVSDADHDEPNSDSCCILQLDNDQNGMLYLLSNTPNFLCLQNTMNTPGIYRVSLTATDNKNNPNKSLKAKVSFNIDVRHEVSDNPFSEK 2551
            S  +E +SV EN      + DL E++L+   I+   +     +YA  +    PF+L D R+ V   +DRE+IC  + +   +D S +  +   S   C    CC +    V          F+I + V D NDN P F    +P+ T+PE+  +   I LP AID+DS  FG+  Y+I + ++ GN SHF   T+ D+             + +G P L ++ PLDRE    Y F+L+A+D  + D     +G V + I+V D+NDN P FD+  Y+A + E++    V+ F V+D+D G+N +V ++I     +  N ++          + + R+ Q   +P S  T S+ L++ +D E  P +  F++ ATDNG P LSS A+VN+ +IN NDQAP I  +R+G+ ++ S       IT+ E     +IV  + V+D DS +  + CS+      F +    E+HP  +                                Y++F + T   LDRE  K  Y+ + + C+D D   PL  N ++H+++ DIND  P F  + YQG + EN   A V  + P  TL   D D G+NA +T+ +               S+++++D  YF ID  SG++ +  ++D E++      + F ++A D       SS+AL+ V V D NDN P F    Y+F V EN PV T +GQ+   D D    N+ V++  +    +  ++ +D+ +G+L    P+D EK  SI++ + A NEA      ++DS         E  VII++ ++NDN P F LI P +  +IF         +N+  R +   C+ IPY V D D D  +   CC L+LDN  +GM  L    PN LC       P  Y++ L A D     N SL ++   ++ V+ E     F +K
Sbjct:   23 SQLMESVSVLENSELGTVVYDLRERLLR---ILDPGQLANVTVYAGQQDLFWPFALKDLRIIVARPLDREAICEKQRA---FDLS-QYLSGALSGGDCPIYHCCQLLHINVVVSPTSPTQVFFIRVAVQDLNDNPPTFPHLESPFATIPEDLPVGERIPLPEAIDIDSRPFGVMDYRIVR-WIQGNASHFQLNTMTDQEDEEVSRGPAFAYMKTGHPYLSVVHPLDRETEEVYEFVLEAIDGGQGDGESPFTGSVGILIRVRDVNDNAPEFDEKAYSAVVQENTLPRRVLQFKVSDMDTGENGRVFLSIFDPTHKANNLFRVSLQNTLPPPEVLNRYPQSRRTPGSFYTASVHLLEYLDAEQLPPRLKFHITATDNGQPPLSSRAEVNVDIINVNDQAPNIVFLREGKRLTSSRLALPEVITVPE-----SIVVEVHVADSDSNLGQLSCSVTSEMDAFRLI---EVHPFSNGGDSAATVLSNFRHSIPSSSTFSSSSSFLFPSYRQFTLRTKVNLDRET-KAAYM-VTLMCTDNDSAKPLARNASLHVSISDINDETPRFEHTAYQGHVRENQASAPVTHLSPSPTLRVTDADIGRNALITFSLKEAPEKAGKGHLLNTSTRDTSDVGYFRIDPRSGRLWTVTALDAEEDAPGEHKYIFYVVATDDGVPERRSSSALVTVLVDDVNDNPPAFEHYTYNFEVEENAPVGTVVGQVSVRDADLTEANRRVRFLLRGRPEDLFLVDIDRATGQLSMRRPVDFEKQSSISLTVIAENEAPLATSPVVDSPMSSTAYHTEANVIISVLNLNDNRPEFVLITPHRKHIIFAWEQLPPAGVNQTLRDQRRFCEPIPYRVIDRDCDPTSRVLCCTLELDNTFDGMFGLFGEIPNVLCALKRPPQPQSYKLLLKARDGTG--NDSLSSQTQLSVIVKSEPDYTKFIQK 942          
BLAST of Protocadherin Fat 1 vs. TrEMBL
Match: A0A068WEQ7 (Protocadherin 2 gamma c6 sCP1 OS=Echinococcus granulosus OX=6210 GN=EgrG_000854900 PE=4 SV=1)

HSP 1 Score: 393.275 bits (1009), Expect = 9.278e-114
Identity = 290/932 (31.12%), Postives = 457/932 (49.03%), Query Frame = 2
Query:   83 SNFLEMISVKENIYYSQPLLDLEKVLKNRTIIPYDKHQRYKIYAVTEKA-SPFSLIDNRLSVVSNIDRESICPIKNSLNDYDQSAETYNSQQSSHSCKYDECCTVFSFQV--DSGIKISSFYILIKVLDENDNSPKFLPFLNPYQTLPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHF---TLLDK------IASGRPQLLLISPLDREVISEYRFILKAVDR-ENDDHRDISG-VEVEIKVGDINDNPPVFDKTFYTANIVEHSKLVNVISFYVTDLDEGQNKQVSITI-----ETENDYK---------KDQIKRFFQIDFSP-SLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRS-------ITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITAINEIHPLGH--------------------------------YKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTL---DKDHGKNAYVTYKID--------------SSKNSTDWEYFTIDADSGKISSRQSIDYEKNK----LFSFNIIAIDKD-QSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDS---------ECMVIITIEDVNDNPPIFSLINPAKSSLIFT--------INKGFRHEN--CQMIPYAVSDADHDEPNSDSCCILQLDNDQNGMLYLLSNTPNFLCLQNTMNTPGIYRVSLTATDNKNNPNKSLKAKVSFNIDVRHEVSDNPFSEK 2551
            S  +E +SV EN      + DL + L    I+   +     +YA  +    PF+L D R+ V   +DRE+IC  + +   +D S +  +   +   C    CC +    V          F+I + V D NDN P F    +P+ T+PE+  +   I LP AID+DS  FG+  Y+I++ ++ GN SHF   T+ D+      + +G P L ++ PLDRE    Y F+L+A+D  + D     +G V + I+V D+NDN P FD+  Y+A + E++    V+ F V D+D G+N +V ++I     +  N ++          + + R+ Q   +P S  T S+ L++  D E  P +  F++ ATDNG P LSS A+VN+ +IN NDQAP I  +R+G+ ++ S       IT+ E     +IV  + V+D DS +  + CS+      F +    E+HP  +                                Y++F + T   LDRE  K  Y+ + + C+D D   PLT N ++H+++ DIND  P F  + YQG + EN   A V  + P  TL   D D G+NA +T+ +               S+++++D  YF ID  SG++ +  ++D E++      + F ++A D       SS+AL+ V V D NDN P F    Y+F V EN PV T +GQ+   D D    N+ V++  +    +  ++ +D+ +G+L    P+D EK  SI++ + A NEA      ++DS         E  VII++ ++NDN P F LI P +  +IF         +N+  R +   C+ IPY V D D D  +   CC L+LDN  +GM  L    PN LC       P  Y++ L A D     N SL +++  ++ V+ E     F +K
Sbjct:   23 SQLMESVSVLENSELGTVVYDLREGLLR--ILDPGQLANVTVYAGQQDLFWPFALKDLRIIVARPLDREAICEKQRA---FDLS-QYLSGALNGGDCPIYHCCQLLHINVVVSPTSPTQVFFIRVAVQDLNDNPPTFPHLESPFATIPEDLPVGERIPLPEAIDIDSRPFGVMDYRIAR-WIQGNASHFQLNTMTDQEDEEVNMKTGHPYLSVVHPLDRETEEVYEFVLEAIDGGQGDGESPFTGSVGILIRVRDVNDNAPEFDEKAYSAVVQENTLPRRVLQFKVADMDAGENGRVFLSIFDPTHKANNLFRVSLQNTLPPPEALNRYSQSRRTPGSFYTASVHLLEYPDAEQLPPRLKFHITATDNGQPPLSSRAEVNVDIINVNDQAPNIVFLREGKRLTSSRLALPEVITVPE-----SIVVEVHVTDSDSNLGQLSCSVTSEMDAFRLI---EVHPFSNGGDSAATVLSNFRHSIPSSSTFSSSSSFLFPSYRQFTLRTKVNLDRET-KAAYM-VTLMCTDNDSAKPLTRNASLHVSISDINDETPRFEHTAYQGHVRENQANAPVTHLSPSPTLCVTDADIGRNALITFSLKEAPEKAGKGHPLNASTRDTSDVGYFRIDPRSGRLWTVTALDAEEDAPGEHKYVFYVVATDDGVPERRSSSALVTVLVDDVNDNPPTFEHYTYNFEVEENAPVGTVVGQVSVRDADLTETNRRVRFLLRGRPEDLFLVDIDRATGQLSMRRPVDFEKQSSISLTVIAENEAPLATSPVVDSPMSSAAYHTEANVIISVLNLNDNRPEFVLITPHRKHIIFAWEQLPPAGVNQTLRDQRRFCEPIPYRVIDRDCDPTSRVLCCTLELDNTFDGMFGLFGEIPNVLCALKRPPQPQSYKLLLKARDGTG--NDSLSSQIQLSVIVKSEPDYTKFIQK 935          
BLAST of Protocadherin Fat 1 vs. TrEMBL
Match: A0A074ZYB3 (Uncharacterized protein OS=Opisthorchis viverrini OX=6198 GN=T265_02662 PE=4 SV=1)

HSP 1 Score: 375.17 bits (962), Expect = 1.017e-106
Identity = 285/974 (29.26%), Postives = 448/974 (46.00%), Query Frame = 2
Query:   83 SNFLEMISVKENIYYSQPLLDLEKVL--KNRTIIPYDKHQRYKIYAVTEKA-SPFSLIDNRLSVVSNIDRESICPIK----NSLNDYDQSAETYNSQQSSHSCKYDECCTVFSFQV---DSGIKISSFYILIKVLDENDNSPKFLPFLNPYQTLPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTL---------------------------LDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISG--------VEVEIKVGDINDNPPVFDKTFYTANIVEHSKLVNVISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMT------------------GSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFE--NEPARTIVASLQVSDRDSLVTDIEC---------SLDD--------YHLN--FEITAINEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTD----------W----EYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQ-SNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQ-------NKNLMDSECMV--------IITIEDVNDNPPIFSLINPAKSSLIF----------------------------------TINKGFRHE----------NCQMIPYAVSDADHDEPNSDSCCILQLDNDQNGMLYLLSNTPNFLCLQNTMNTPGIYRVSLTATDNKNNPNKSLKAKVSFNIDVRHEVS 2530
            +   E I++ EN   +  +LD+   L       +P    +    YA  +K   PF+L +  L ++  +DRE++C +     + L+         ++  ++  C    CC +    +    + +   +F+I + V D NDN+P+F    +PY  + E+S +   I LP AID DS  + +  Y+ ++ ++ GN SHF +                           +   ASGRP L+  +PLDRE+   Y F L AVD  + +  D++         V V IKV D+NDN P FD+  Y A IVE+    N+ +F V D D G+N +VSI+I+  +   +   +   Q   +P+  T                  G ++LI  ID E  P    F+L+A D G P LSS+A V I +IN ND AP I    +G+ ++    +      P R++V  + V+D DS ++   C         SLD+        YH +  FE +A+     +  Y+++ I T K LDRE     Y  + + C+D + +  L  N ++HI + D ND+ PVF +  Y G + EN P A V+ + PI   D D G N+ +T+ I    N+T+          W    +YF ID  SG+I +  ++D E    +   ++  D     + SSTA +IV V D NDN P F   HY+F V EN P  TEIG++E TD D    N+ ++Y  +   ++  +I +++N+G L+T  PIDRE   SIT+  TA NE   +       N+ L  SE  V        ++ + +VNDN P F+LI P +S + F                                     KG   +           C+ +P+ V+D D ++  +  CC+LQL  D +G+  L+   P  LC+      P  Y++ L A D     N SL A+V F + +R + S
Sbjct:   28 AQLFERITIVENSPLNTDILDIRAALVRHGEGQLP----ENATAYASQQKLFWPFALDNFVLRLIRPLDREAVCQLHQQKFHRLDKPPGQNPPLSASFANDGCLAGACCQLLHVNILPLPTALP-KAFFIQVVVQDVNDNAPRFPVIHSPYTVVHEDSGLEERIWLPQAIDPDSSQYSVTEYR-TENWVHGNQSHFQIGVDEERTTSVTPRDQYSQIYGVPVVQRIATTASGRPYLIPTAPLDRELCDLYAFTLIAVDGGDRNAIDVTASNRALTGSVYVVIKVADVNDNRPTFDRPHYEAKIVENFMPANIFTFEVVDKDIGENGRVSISIQDTSRTAEQTFRVSLQAVHNPTYQTSGSHTKPHQTLPSGSHYRGYVQLISRIDAERFPPFLQFSLVANDFGKPSLSSSADVQIQIININDNAPNIAFFSRGKRLTDGRILLPEVTTPPRSLVVLVHVTDEDSPISQFRCQIISETEMFSLDEASSHGFPSYHSDVIFE-SALESRGIVASYRQYAIRTKKELDRE--TRSYYVVTVECTDAEGVNSLARNASLHITVTDENDHNPVFDKLTYHGRVQENSPAAEVQFVSPIKVTDADIGPNSLLTFLISDLDNTTEQAADVSKQAVWRNGSQYFRIDPRSGRIWTTVALDCEVKSQYDLLVVVHDSGSPESRSSTANLIVSVEDVNDNIPEFSSAHYTFEVAENAPPGTEIGRVEATDKDATEPNRKLRYGLRGRADDLHLISINRNTGVLRTRRPIDRESRSSITLTATAENELPVRASLSLSPNRPLAPSELAVETIAKTSIVLNVLNVNDNRPEFTLIEPHRSHVTFIWEQLSSLPNTSNVDVKSLKNGRQTSLGAKKNGMGTQKGAEDKLFVNALNVSPVCERLPHRVTDKDVEQDENSECCLLQLQEDFDGLFALMPEAPTVLCMTRRPPMPTSYKLVLIAKD--GTANDSLSAQVQFTVVIRSDPS 990          
BLAST of Protocadherin Fat 1 vs. TrEMBL
Match: A0A3R7D3G0 (Protocadherin Fat 1 OS=Clonorchis sinensis OX=79923 GN=FAT1 PE=4 SV=1)

HSP 1 Score: 372.474 bits (955), Expect = 7.528e-106
Identity = 285/974 (29.26%), Postives = 446/974 (45.79%), Query Frame = 2
Query:   83 SNFLEMISVKENIYYSQPLLDLEKVL--KNRTIIPYDKHQRYKIYAVTEKA-SPFSLIDNRLSVVSNIDRESICPIK----NSLNDYDQSAETYNSQQSSHSCKYDECCTVFSFQV--DSGIKISSFYILIKVLDENDNSPKFLPFLNPYQTLPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTL---------------------------LDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISG--------VEVEIKVGDINDNPPVFDKTFYTANIVEHSKLVNVISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMT-------------------GSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFE--NEPARTIVASLQVSDRDSLVTDIEC---------SLDD--------YH--LNFEITAINEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDW--------------EYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKD-QSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQ-------NKNLMDSECM--------VIITIEDVNDNPPIFSLINPAKSSLIF----------TIN------KGFRHEN----------------------------CQMIPYAVSDADHDEPNSDSCCILQLDNDQNGMLYLLSNTPNFLCLQNTMNTPGIYRVSLTATDNKNNPNKSLKAKVSFNIDVRHEVS 2530
            +   E I++ EN   +  +LD+   L       +P    +    YA  ++   PF+L +  L +V  +DRE +C +     + L+         ++  ++  C    CC +    +         +F+I + V D NDN+P+F    +PY  + E+S +   I LP AID DS  + +  Y+ ++ ++ GN SHF +                           +   ASGRP L+  +PLDRE+   Y F L AVD  + +  D++         V V IKV D+NDN P FD++ Y A IVE+    NV +F V D D G+N +VSI+I+  +   +   +   Q   SP+  +                   G ++LI  ID E  P    F+L+A+D G P LSS+A V I +IN ND AP I    +G+ ++    +      P R++V  + V+D DS ++   C         SLD+        YH  + FE + +     +  Y+++ I T K LDRE     Y  + + C+D + +  L  N ++HI + D ND+ PVF +  Y G + EN P A V+   PI   D D G NA +T+ I    N+T+               +YF ID  SG+I +  ++D E    +   ++  D     + SSTA +IV V D NDN P F   HY+F V EN P  TEIG++E TD D    N+ ++Y      ++  ++ +++N+G L+T  PIDRE   SIT+  TA NE   +       N+ L  +E          +++ + +VNDN P F+LI P +S + F          T N      K  R E+                            C+ +P+ V+D D ++  +  CC+LQL  D +G+  L+   P  LC+      P  Y++ L A D     N SL A+V F + +R + S
Sbjct:   28 AQLFERITIVENSPLNTDILDIRAALVRHGEGQLP----ENATAYASQQELFWPFALDNFVLRLVRPLDREVVCQLHQQKFHRLDKPPGQNPPLSASLANDGCLAGACCQLLHVNILPTPTALPKAFFIQVVVQDVNDNAPRFPVIHSPYTVVHEDSGLEERIWLPQAIDPDSPQYSVTEYR-TENWVHGNQSHFQIGVDEERATSVTPKDQYSQLYGVPVVQRMATTASGRPYLIPTAPLDRELCDLYAFTLIAVDGGDRNAIDVTAPNRALTGSVYVVIKVADVNDNRPTFDRSHYEAKIVENFMPANVFTFDVVDKDIGENGRVSISIQDTSRTAEQTFRVSLQAVHSPTYQSSGSHHTKQHQTLTGGSHYRGYVQLISRIDAERFPPFLQFSLVASDFGKPSLSSSADVQIQIININDNAPNIAFFSRGKRLTDGRILLPEVTTPPRSLVVLVHVTDEDSPISQFRCQIVSETEMFSLDEASSHGFPSYHSDVTFE-SPLESRGIVASYRQYAIRTKKELDRE--TKSYYVVTVECTDAEGVNSLARNASLHITVTDENDHNPVFDKLNYHGRVQENSPAAEVQFSSPIKVTDADIGPNALLTFLISDLDNTTEQAADFSKLAISRNGSQYFRIDPRSGRIWTTVALDCEVKNQYDLLVVVHDSGLPESRSSTANLIVSVEDVNDNVPEFSSAHYTFEVAENAPPGTEIGRVEATDKDATEPNRKLRYGLTGRADDLHLVSINRNTGVLRTRRPIDRESRSSITLTATAENELPVRASLSLSPNRPLGPTELAAETIARTNIVLNVLNVNDNRPEFTLIEPHRSHVTFIWEQLSSLPNTTNVDSKSLKNGRQESLSVKKNGMGTQTEAKDMLSVNAINVSPVCERLPHRVTDKDVEQDGNSECCVLQLQEDFDGLFALMPEAPTVLCMTRRPPVPTSYKLVLIAKD--GTANDSLSAQVQFTVVIRSDPS 991          
BLAST of Protocadherin Fat 1 vs. TrEMBL
Match: A0A5K3F6N9 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 370.933 bits (951), Expect = 8.075e-106
Identity = 276/909 (30.36%), Postives = 446/909 (49.06%), Query Frame = 2
Query:   83 SNFLEMISVKENIYYSQPLLDLEKVLKNRTIIPYDKHQRYKIYAVTEKA-SPFSLIDNRLSVVSNIDRESICPIKNSLNDYDQSAETYNSQQSSHSCKYDECCTVFSFQV-DSGIKISS-FYILIKVLDENDNSPKFLPFLNPYQTLPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTL-------------LDKIA----SGRPQLLLISPLDREVISEYRFILKAVDR-ENDDHRDISG-VEVEIKVGDINDNPPVFDKTFYTANIVEHSKLVNVISFYVTDLDEGQNKQVSITI-------------ETENDYKKDQIKRFFQIDFSP--SLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFEN--EPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITAINEIHP--------------------LGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTL---DKDHGKNAYVTYKID------------SSKNSTDWEYFTIDADSGKISSRQSIDYE---KNKLFSFNIIAIDKD-QSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASY--------QNKNLMDSECMVIITIEDVNDNPPIFSLINPAKSSLIFT--------INKGF-RHENCQMIPYAVSDADHDEPNSDSCCILQLDNDQNGMLYLLSNTPNFLCLQNTMNTPGIYRVSLTATDNKNNPNKSLKAKVSFNIDVRHE 2524
            S  +E +SV EN      + DL + L    I+  D+      YA  +    PF+L D R+ V   +DRE+IC  + +L         Y        C    CC +    V  S   ++  F+I + V D NDN+P F    +P+ T+ E+  +   ILLP A+D+DS+ FG+  Y+I++ ++ GN SHF L             L+ ++    + RP L ++  LDRE    Y F+L+A+D  + D     +G V + I+V D+NDN P FDK  Y A + E++    VI F ++D D G+N ++ I I               +N     +I   +    SP  S   GS+ L++ +D E  P +  F+LIA+DNG P L+S A+VNI +IN NDQAP I  +R+G+ ++ S  +         +IVA + V+D DS +  + C +      F +T +N                           Y++F + T   LDRE  K  Y+ + I C+D + + P + N ++HI++ DIND  P F  S Y G + EN   A V  + P  T+   D D G+NA +T+ +             SS   +D   F ID  SG++ +  ++D +   ++  + F ++A D       SS+AL+ + V D NDN P F   HY+F V+EN P  T IG++  +D D    N+ V++  +    +  ++ +++ SG+L T  PID EK  SI++ + A NE              ++  +E  V+I++ +VNDN P F  ++P +  ++F         +N+   R + C+ IPY V D D D  + + CC L+L++  +GM  LL   PN +C+      P  Y+V L A D K   + SL +++  ++ +++E
Sbjct:   25 SLLIETVSVLENSELGTVVYDLRESLLR--ILDSDQLANVTAYAGQQDLFWPFALKDLRIVVARPLDREAICEKQKTLG--------YRLSGPFGGCLVFHCCQLLHVNVVMSPTSLTQVFFIRVAVQDVNDNAPTFPHVESPFITISEDMPVGEKILLPKAVDIDSQPFGVADYRIAR-WVQGNASHFQLNMLTDKEDDEDGNLNPVSEYAQTRRPYLDIVHSLDRETDEVYEFVLEAIDGGQGDGGAPFTGTVNILIRVRDVNDNAPEFDKLVYDAVVQENTLPQKVIRFKISDFDAGENGRIFINIVDPTHKANNLFRVSLQNTIPPPEIMNKYASSRSPPGSHYIGSLHLLEYLDAEQLPPRLRFHLIASDNGQPALTSRAEVNIDIINVNDQAPNIVFLREGKRLTTSRLVLPEVITAPESIVAEVHVTDSDSNLGHLTCRITSGGDAFRLTEVNPFAGSNSGTVTALLNFDQSTSPFVFSSYRQFTLRTKVNLDRES-KAVYV-VTIMCTDNESVNPFSRNSSLHISISDINDQTPKFEYSVYTGHVKENEANAPVTHLSPSPTIHVTDNDVGRNALITFSLKEAPVEGKNDPNKSSIGVSDASRFRIDPRSGRLWTVPALDADDISESHKYVFYVVATDDGVPERRSSSALVHIIVDDCNDNPPAFEHYHYNFEVKENAPAGTSIGRVSVSDADKTEANRKVRFSLRGRLEDLFLVDINRASGELTTRRPIDYEKQSSISLTVVAENEVPLVADAVGRPSRADISQAEASVVISVINVNDNRPEFVPVSPHRKHIVFVWEQLPVVGVNQTLDRRKFCESIPYKVIDKDCDPASQELCCTLELEDTFDGMFGLLEEIPNVVCVLKRPTHPQSYKVMLKARDGKG--DDSLSSQMQLSVIIKNE 918          
BLAST of Protocadherin Fat 1 vs. Ensembl Cavefish
Match: dchs1b (dachsous cadherin-related 1b [Source:ZFIN;Acc:ZDB-GENE-050208-41])

HSP 1 Score: 199.904 bits (507), Expect = 2.067e-51
Identity = 173/593 (29.17%), Postives = 279/593 (47.05%), Query Frame = 2
Query:  446 IKVLDENDNSPKFLPFLNPYQTLPENSQINTVILLPSAIDLDSEAFGIKY-YKISKPFLIGNDSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDREND-DHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKLVNVISFYVT--DLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRD----SLVTDIECSLDDYHLNFEITAINEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIF 2200
            I V D ND++P+F P       +PEN Q  + I    A D D      +  Y I   +   + S    LD I+     L L   LD E  S    +++  D   D + R    V   I V D NDN P+F     TA  V   + V  +  YV   D D+G+N +VS  I+T N   +          FS +  TGS+ ++  +D E     Y+  +IA D+G P+ S+T  +++ +I+ ND+AP  +   K E     + + EN+PA T V ++  +DRD      VT  + ++D + +  E                +I+  K LDRE  +  +  + +Y  D   + P     T+HI + D NDN PVF R +Y  EL EN+    + +I+     D+D G + ++ Y+I       D   F +D+ SG +S+ + +D E+   +S  ++A D+   +LSSTA + + V+D NDN+P F    Y+  V E+  V + +  +   D D     +I+ +       ++    VD ++G++ T  P+DREK  S +  + A + +    +N   +   V +TI DVNDN P F
Sbjct: 1419 ITVQDSNDHAPEF-PEDPVTIVVPENMQPGSSIYTFQAADKDGSGPNSEVRYSIQHRYP--DRSDLLTLDPISG---VLTLGQALDHEETSSLFLVVRGTDSAVDPNQRRWGSVTARIFVTDENDNAPIFSSP--TAVSVMEDQPVGFVLLYVMARDADQGENGRVSYRIQTGNAGGR----------FSLNPNTGSLSILKAMDREEQD-SYNLTIIAEDHGTPQHSTTQVLSVQVIDVNDEAPWFE---KSEY---EVQVRENQPAGTTVLTVSATDRDQGTNGRVTYGDVTVDGFIIAPETG--------------VISLTKVLDRE--QQDHYTVTVYAKD-GGMPPNFAKATVHITVLDENDNAPVFGRLQYSLELPENLEPVELFIIK---ATDQDSGDSGHLEYRITVGDPDGD---FQLDSSSGALSTSRPLDRERRDSYSLEVVAQDRGTPSLSSTATVEITVLDVNDNSPTFTSSSYTVDVSEDAAVGSSLLDVTAKDADEGQNGQILYFLSSEARGDFT---VDPDTGRIVTAAPLDREKRASYSFQVCAVDLSPATPRN---TTAQVTVTILDVNDNAPFF 1957          

HSP 2 Score: 163.696 bits (413), Expect = 3.601e-40
Identity = 165/606 (27.23%), Postives = 276/606 (45.54%), Query Frame = 2
Query:  440 ILIKVLDENDNSPKFLPFLNPYQTLPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSH-FTLLDKIASGRP---QLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEH-SKLVNVISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRD-SLVTDIECSLDDYHLNFEITAINEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATV--KMIEPILTLDKDHGKNAYVTYKIDSSKNS-TDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQV-IHVDQNSGKLKTIGPIDR-EKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIFSLINPAKS 2224
            + I V D ND++P F P       +PE + + T   L  A D D +    + Y I +    GN    F L  K A+ +     L++   LDRE  + Y  +L+A D      +    + +++ V DIND+ P+F+++ Y A I E   +  N++  + +D DEG N  V   I    + ++    R+F ID      +G I L   +DYE     +   + A DN      + A V I + + ND  P + +I   E  S  I+  E       VA + VSD D    +++  SL+     F +T  + I        ++I   + LDRE+  +  L++    +      PL    +  I + D+NDNPP+F +  Y+    + IP+       +  +   DKDHG N  V Y I   + + +DW  FTID  +G I++   +DYE     S  ++A D  +  LSSTAL+ + + D NDN P+F    Y+ +++EN    T   ++  +D D      +         ++      +++ +G++ T   +DR E   S    +TA +         + S  +V ++++D+NDN P F  +N A S
Sbjct:  130 VSITVNDINDHAPVF-PKKKASLKIPEQTAVGTKFSLEPATDADKDQLTTQGYLIKE----GNVGQVFRLETKRATNKVLYLDLVVNGVLDREKRASYSLLLEAFD--GGSPKKTGQMTLDVTVQDINDHAPIFNQSRYRAIISESLPQGSNILQVFASDADEGDNGLVLYEI----NRRQSDPDRYFVID----PRSGIITLNKPLDYEVRKV-HELVVQARDNASHPEITNAFVTIHVRDFNDNQPTMTIIFLSEDGSPRIS--EGAQPGQYVARISVSDPDYGEYSNVNVSLEGGDGKFALTTKDSII-------YLIYVDQVLDREERDSYELRV---MATDSGTPPLRAESSFTIQVTDVNDNPPLFDQQAYK----QTIPEVVYPGSFVLQVTARDKDHGPNGDVLYSILPDRGTHSDW--FTIDPVTGIITTATQLDYETYPNPSVKVVATDGGKPPLSSTALVEISLQDINDNEPVFGSSVYNVSIKENTAAGTCFLEVTASDADGGSFGAVAYSLGSGAGSSPPTRFSINKETGQICTSAALDRDEGADSFEFTVTAADGGG------LSSSAVVKVSLQDINDNRPTFYPVNYAVS 695          

HSP 3 Score: 129.798 bits (325), Expect = 9.632e-30
Identity = 126/523 (24.09%), Postives = 238/523 (45.51%), Query Frame = 2
Query:  629 DSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIV-EHSKLVNVI-SFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIE-CSLDDYHLNFEITAIN-EIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKI-DSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIF----PKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITI 2170
            D +FT+  +  + R  L    PLD E        ++A    +          V I +GD+NDN P F  ++  + ++ E +K+ +V+      D D GQN ++S  +      +   ++R           +G IRLI  + Y++ P +Y   ++A D G+P+ S+T  + + +  ++DQ P        + ++  + + EN P  T    ++   RD L       +L  Y L  +  A    I P   +  F+ + L   DRE  K+ YL   +  S   ++   T + T+ +++ D NDN P  ++ +    + EN+P  T      +   D+D G N+ +TY++  + +N      F I++ +G++S+R ++D E    +   ++  D      S+T    + V+D NDNAPIF    P       V+E +P  + +G ++  D D   EN  +  F+    +  +   ++ N+G+L++  P+ R +    +I ++A +  +        S C++ I I
Sbjct:  836 DGYFTVDSETGALRTSL----PLDHEARPSLELEVQA---SSGSPPAFGQTRVTITIGDVNDNTPAFLPSYSESLLLPEVTKIGSVVYRVQAEDRDSGQNGRISFHLLASGGQRAFSVER----------GSGEIRLISSLSYDSVP-RYDLQVLARDGGVPQRSATFTLVVHVQAEDDQGPAF------DTLTYRVELKENTPLNTRFLQVRALSRDQLKNGSSPAALLSYRLRPDGDAAGFGIVPDSGWL-FVKSAL---DREA-KDIYLLTVLATSGSGRMKK-TGSATVRVSVTDENDNSPRLSQERVFLAVRENLPTGT--GFGRVSATDRDAGLNSRLTYRLLHTDRN------FQINSQTGEVSTRAALDREHQSSYQLVVVVQDGGTPPRSATGTAHITVLDENDNAPIFSHMMPGKELLIQVQEGLPAGSLLGTLQAKDPD-EGENSTI--FYSLSGSRAERFSLNPNTGELRSSSPLRRAEKSEYSITVSASDRGAPPQS----SSCVLRIQI 1313          

HSP 4 Score: 127.487 bits (319), Expect = 4.952e-29
Identity = 132/531 (24.86%), Postives = 237/531 (44.63%), Query Frame = 2
Query:  440 ILIKVLDENDNSPKFLPFLNPYQ-TLPENSQINTVILLPSAIDLDSEAFGIKYYKI----SKPFLIGNDSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHS-KLVNVISFYVTDLDEGQ-NKQVSITIETENDYKKDQIKRFFQIDFSPSLM-------TGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITAINEIHPLGHYKEFI--INTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYF 1984
            + + V D NDN P F   L  YQ TLPE+S   + ++  +A D DS   G   Y++     + F I  ++    + +     P+   +S            +++A DR       I+ V++++   D+NDN P+F ++ Y A + E       +++    D+D  Q N      I + N      +   FQI+ S   +        G++ L +++D+E    +Y+  ++ +D G+P+ SS+    I +I+ ND  PV       E V   + + E   A T +  L  +D+DS             + + I++ +E+  L    ++   +   +PLDRE   +  + I    SD      L     I++ + DINDN P F        + EN P  +   +  +  +D+D G    + Y +   ++S   E+F +D ++G++ SRQ+ D+EK   F F  +A+D    N S+T  + V++   ++  P F    +SF V E       IGQ++  D D   +  ++  F
Sbjct: 2355 VTVLVGDMNDNVPTFTQDL--YQVTLPEHSPPGSAVVTVTATDRDSGENGRVTYRVLSSSREGFYIDPNNGTLFIGQKVEFDPERPSVS-----------VVIEASDRGKPPLSSIATVQIQLT--DVNDNAPMFHQSEYRATVSEDQLPGATILTLEAVDVDLSQENSGFDFAIASGN------VGNAFQIESSVRFIEGHGFQTVGTLILAEQLDFELM-SRYNLTIVVSDRGVPQRSSSVPAVITVIDVNDNPPVFS---HAEYV---VALSEGAAAGTEILRLSATDQDSA--------PHAEIQYSISSGDEME-LFSVDQWTGALRLQRPLDRETQPSHVVIIQ--ASDGHGHFALAP---INVEVKDINDNRPYFPIQTMTASIRENQPANSAVTV--LHAIDQDTGMYGILKYFM-VDRSSQGKEFFAVDQNTGEVRSRQAFDFEKVNSFHFMALAVDA--GNNSATVTVQVYITGEDEYDPAFTSSAFSFEVPEGAKKGQSIGQVQAVDEDGGVDGIVLYSF 2838          

HSP 5 Score: 125.176 bits (313), Expect = 2.545e-28
Identity = 159/597 (26.63%), Postives = 254/597 (42.55%), Query Frame = 2
Query:  428 SSFYILIKVLDENDNSPKFLPFLNPYQT-LPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKLVN--VISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIECSL--DDYHLNFEITAINEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIFS 2203
            S+  + I VLD NDNSP F    + Y   + E++ + + +L  +A D D    G   Y +S          FT+     +GR  ++  +PLDRE  + Y F + AVD      R+ +  +V + + D+NDN P F +     N+   S   N  V +    D D G N  V         Y+     R F I+     +TG I+  + +   T   + +  + A D G P  SS   V I +  ++ Q   I+  R     +R +++ EN    T VA  Q    D     I  S+   +   +F I++           E  +++   LD ED     L +    +           + +++ L D+NDN P F    Y   + E   +     I  ++  D D G N  VTY I SS  S     F ID  SG I++   +D E        I A D+    L+ +A + V ++D NDN+P  P P     V EN  + TEI  +   D+D+ P   ++ Y  +  T +     + + SG++    P+D E+ RS   L    +++ +Q      SE  V + + D+NDN P F+
Sbjct: 1834 STATVEITVLDVNDNSPTFTS--SSYTVDVSEDAAVGSSLLDVTAKDADEGQNGQILYFLSSE----ARGDFTV--DPDTGR--IVTAAPLDREKRASYSFQVCAVDLSPATPRNTT-AQVTVTILDVNDNAPFFIQDPLIINVSSRSVATNHVVATMKAEDKDFGANGSVF--------YRFAMPVRGFSINS----LTGEIQTTELLSSLTQSQR-TLIVEAMDQGSPAQSSLGVVIIYVKEQDYQG--IRFSR----TTRDVSIQENAAKGTAVAQAQAQYPDGTRGGIAYSIFSGNRQQSFRISS--------STGEIWVHSSTGLDFEDTPRLRLVVKAETASSSSF------MAVNLILQDVNDNLPRFQLQNYVAYMRE--ARGYDSPIIQVVAEDVDQGPNGQVTYSIQSSGRSG---LFKIDPLSGSITTAAIMDREIWMQTKLVITATDRGSPKLAGSATLTVIIVDLNDNSPTIPLPR-EVRVPENSLIGTEITMVTGNDVDSGP---VLSYSLRLDTPSQGKFGIHRYSGRVFLTAPLDFEE-RSWYTLTVQASDSKHQ------SEANVTVLVGDMNDNVPTFT 2370          

HSP 6 Score: 120.939 bits (302), Expect = 4.069e-27
Identity = 148/617 (23.99%), Postives = 260/617 (42.14%), Query Frame = 2
Query:  428 SSFYILIKVL-DENDNSPKFLPFLNPYQTLPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLISPL----------DREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKLVNVISFYVT-DLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIEC--SLDDYHLNFEITAINEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIEN-IPQATVKMIEPI-LTLDKDHGK--------NAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIFSL 2206
            SSF  +  +L D NDN P+F    N    + E    ++ I+   A D+D    G   Y I                  +SGR  L  I PL          DRE+  + + ++ A DR +   +      + + + D+NDN P          + E+S +   I+     D+D G     S+ ++T +  K           F     +G + L   +D+E   + Y+  + A+D+   +  S A V +++ + ND  P              +T+ E+ P  + V ++  +DRDS          L      F I   N    +G   EF           D +   + + I  SD+ K  PL++  T+ I L D+NDN P+F +S+Y+  + E+ +P AT+  +E + + L +++          N    ++I+SS    +   F      G +   + +D+E    ++  I+  D+     SS+   ++ VID NDN P+F    Y   + E     TEI ++  TD D+ P  +I   +  S  +  ++  VDQ +G L+   P+DRE   S  ++I A +   +       +   + + ++D+NDN P F +
Sbjct: 2145 SSFMAVNLILQDVNDNLPRFQ-LQNYVAYMREARGYDSPIIQVVAEDVDQGPNGQVTYSIQ-----------------SSGRSGLFKIDPLSGSITTAAIMDREIWMQTKLVITATDRGSP--KLAGSATLTVIIVDLNDNSPTIPLP-REVRVPENSLIGTEITMVTGNDVDSGPVLSYSLRLDTPSQGK-----------FGIHRYSGRVFLTAPLDFEERSW-YTLTVQASDS---KHQSEANVTVLVGDMNDNVPTFTQDLY------QVTLPEHSPPGSAVVTVTATDRDSGENGRVTYRVLSSSREGFYIDPNNGTLFIGQKVEF-----------DPERPSVSVVIEASDRGK-PPLSSIATVQIQLTDVNDNAPMFHQSEYRATVSEDQLPGATILTLEAVDVDLSQENSGFDFAIASGNVGNAFQIESSVRFIEGHGFQT---VGTLILAEQLDFELMSRYNLTIVVSDRGVPQRSSSVPAVITVIDVNDNPPVFSHAEYVVALSEGAAAGTEILRLSATDQDSAPHAEI--QYSISSGDEMELFSVDQWTGALRLQRPLDRETQPSHVVIIQASDGHGHF------ALAPINVEVKDINDNRPYFPI 2696          

HSP 7 Score: 112.464 bits (280), Expect = 1.973e-24
Identity = 154/650 (23.69%), Postives = 260/650 (40.00%), Query Frame = 2
Query:  356 SSHSCKYDECCTVFSFQV---DSGIKISSFYILIKVLDENDNSPKFLPFLNPYQTLPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDN--PPVFDKTFYTANIVEHSKLVNVISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNL-IATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITAINEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIY---CSDQDKLTP---LTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKN-----AYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAI-DKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQN------SGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIFSLINPAKSSLI 2233
            +S +   DE    F F V   D G   SS  + + + D NDN P F P +N   +L   S   T ++  +A D D    G   Y+     + G  S+F  L+K         +IS L R +  +   ++  V    D     + V   + +  +  +  PPVF++  Y   + E       +     +      K +S TI + +         +F +D      TG++R    +D+E  P   S  L +   +G P      +V I + + ND  P           S S+ + E     ++V  +Q  DRD        S  +  ++F + A       G  + F +       R      Y  +  Y      +D   P    T  L +H+   D  D  P F    Y+ EL EN P  T + ++ +  L +D  KN     A ++Y++   +   D   F I  DSG +  + ++D E   ++   ++A     +   + +A + V V D NDN+P   +      VREN+P  T  G++  TD D    +++           Y+++H D+N      +G++ T   +DRE   S  +++  ++  +        +     IT+ D NDN PIFS + P K  LI
Sbjct:  642 TSAALDRDEGADSFEFTVTAADGGGLSSSAVVKVSLQDINDNRPTFYP-VNYAVSLSSQSAPGTSVIRVTAHDPDGGENGKVTYRT----VPGGGSNFFTLNKDTG------VIS-LSRSLHGKANSVIAMVITAQDGGGLTAPVNARVNISVVAGSVAPPVFEQAQYFFTVSEDVLRGTEVGVVRANSRSLATKDISYTISSGDP------DGYFTVDSE----TGALRTSLPLDHEARP---SLELEVQASSGSPPAFGQTRVTITIGDVNDNTPAFL-----PSYSESLLLPEVTKIGSVVYRVQAEDRD--------SGQNGRISFHLLA------SGGQRAFSVERGSGEIRLISSLSYDSVPRYDLQVLARDGGVPQRSATFTLVVHVQAED--DQGPAFDTLTYRVELKENTPLNT-RFLQ-VRALSRDQLKNGSSPAALLSYRL---RPDGDAAGFGIVPDSGWLFVKSALDREAKDIYLLTVLATSGSGRMKKTGSATVRVSVTDENDNSPRLSQERVFLAVRENLPTGTGFGRVSATDRDAGLNSRL----------TYRLLHTDRNFQINSQTGEVSTRAALDREHQSSYQLVVVVQDGGTPPRS----ATGTAHITVLDENDNAPIFSHMMPGKELLI 1226          

HSP 8 Score: 108.997 bits (271), Expect = 1.973e-23
Identity = 192/764 (25.13%), Postives = 325/764 (42.54%), Query Frame = 2
Query:  365 SCKYDECCTVFSFQV---DSGI--KISSFYILIKVLDENDNSPKFLPFLNPYQTLPENSQINTVILLPSAIDLD-----SEAFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVF--DKTFYTA--NIVEHSKLVNVISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKG-EIVSRSITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITAINEIHP-LGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLD-KDHGKNAYVTYKI--DSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALII-VHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKY-FHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIFSLINPAKSSLIFTINKGFRHENCQMIPYAVS-DADHDEPNSDSCCILQLDNDQNGMLYLLSNTPNFLCLQNT-MNTPGIYRVSLTATDNKNNPNKSLKAKVSFN-IDVRHEVSDNPFSEKSDNKVHTTKNQ 2584
            S  YD     +  QV   D G+  + ++F +++ V  E+D  P F   L     L EN+ +NT  L   A+  D     S    +  Y++ +P   G+ + F ++    SG   L + S LDRE    Y   + A        +      V + V D NDN P    ++ F     N+   +    V +   TD D G N +++        Y+     R FQI+      TG +     +D E +   Y   ++  D G P  S+T   +I ++++ND AP+   +  G E++   I + E  PA +++ +LQ  D D    + E S   Y L+        ++P  G  +     +  PL R  +K++Y  I +  SD+    P +++  + I +   +   P           +E     +V  I  + + D +D   +  VTY +   + K+ T    F +D  +G +   + +DYEK  L++ NI   D  ++  S+  + + + V D+ND+AP FP+   +  V EN+   + I   +  D D    N  V+Y     Y +   ++ +D  SG L     +D E+  S+ +++   + A   N+    S    I  + D NDN PIFS  +P   S++     GF      ++ Y ++ DAD  E N      +Q  N   G   L  NT +   L+         Y +++ A D+   P  S    +S   IDV  E    P+ EKS+ +V   +NQ
Sbjct:  958 SLSYDSVPR-YDLQVLARDGGVPQRSATFTLVVHVQAEDDQGPAF-DTLTYRVELKENTPLNTRFLQVRALSRDQLKNGSSPAALLSYRL-RP--DGDAAGFGIVPD--SG--WLFVKSALDREAKDIYLLTVLATSGSGR-MKKTGSATVRVSVTDENDNSPRLSQERVFLAVRENLPTGTGFGRVSA---TDRDAGLNSRLT--------YRLLHTDRNFQINS----QTGEVSTRAALDRE-HQSSYQLVVVVQDGGTPPRSATGTAHITVLDENDNAPIFSHMMPGKELL---IQVQEGLPAGSLLGTLQAKDPD----EGENSTIFYSLSGSRAERFSLNPNTGELR-----SSSPL-RRAEKSEY-SITVSASDRGA-PPQSSSCVLRIQILGSSRAAPKPNTLSMTLNSVEGAKPGSV--IGSVRSHDHRDVVLDGQVTYLVVGGTDKDGT----FMVDRLTGDVYLARELDYEKGALYTLNIEVEDFSKAYPSTYMIQLDITVQDSNDHAPEFPEDPVTIVVPENMQPGSSIYTFQAADKDGSGPNSEVRYSIQHRYPDRSDLLTLDPISGVLTLGQALDHEETSSLFLVVRGTDSAVDPNQRRWGSVTARIF-VTDENDNAPIFS--SPTAVSVMEDQPVGF------VLLYVMARDADQGE-NGRVSYRIQTGN-AGGRFSLNPNTGSLSILKAMDREEQDSYNLTIIAEDH-GTPQHSTTQVLSVQVIDVNDEA---PWFEKSEYEVQVRENQ 1659          

HSP 9 Score: 108.612 bits (270), Expect = 2.521e-23
Identity = 118/486 (24.28%), Postives = 221/486 (45.47%), Query Frame = 2
Query:  779 VEVEIKVGDINDNPPVFDKTFYTANIVEHSKLVNVI-SFYVTDLD-EGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGL---PRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITAINEIHPLGHYK----EFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPL-TTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENV-PVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIFS 2203
            ++++I V D ND+ P F +   T  + E+ +  + I +F   D D  G N +V  +I+     + D +         P  ++G + L   +D+E     +   +  TD+ +    R   +    I + ++ND AP+            ++++ E++P   ++  +   D D          ++  +++ I   N     G +        ++ LK +DRE+ ++ Y   N+    +D  TP  +T   + + + D+ND  P F +S+Y+ ++ EN P  T  +   +   D+D G N  VTY           + F I  ++G IS  + +D E+   ++  + A D       + A + + V+D NDNAP+F +  YS  + EN+ PV  E+  I+ TD D+     +   +  +  +      +D +SG L T  P+DRE+  S ++ + A++  +      + S   V IT+ DVNDN P F+
Sbjct: 1415 IQLDITVQDSNDHAPEFPEDPVTIVVPENMQPGSSIYTFQAADKDGSGPNSEVRYSIQHRYPDRSDLLT------LDP--ISGVLTLGQALDHEETSSLF-LVVRGTDSAVDPNQRRWGSVTARIFVTDENDNAPIFSS-------PTAVSVMEDQPVGFVLLYVMARDADQG--------ENGRVSYRIQTGNA---GGRFSLNPNTGSLSILKAMDREE-QDSY---NLTIIAEDHGTPQHSTTQVLSVQVIDVNDEAPWFEKSEYEVQVRENQPAGTTVLT--VSATDRDQGTNGRVTY------GDVTVDGFIIAPETGVISLTKVLDREQQDHYTVTVYAKDGGMPPNFAKATVHITVLDENDNAPVFGRLQYSLELPENLEPV--ELFIIKATDQDSGDSGHL--EYRITVGDPDGDFQLDSSSGALSTSRPLDRERRDSYSLEVVAQDRGTPS----LSSTATVEITVLDVNDNSPTFT 1853          

HSP 10 Score: 105.916 bits (263), Expect = 1.636e-22
Identity = 163/639 (25.51%), Postives = 266/639 (41.63%), Query Frame = 2
Query:  389 TVFSFQVDSGI--KISSFYILIKVLDENDNSPKFLPFLNPYQTLPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGN-DSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKL-VNVISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATD--NGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIV---SRSITMFENEPARTIVASLQVSDRD-----SLVTDIECSLDDYHLNFEITAINEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPV-FTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKI--SSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVI--DANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIFSL---INPAKSSLIFT 2239
            TV  +  D G+    +   + I VLDENDN+P F   L     LPEN +   + ++  A D DS   G   Y+I+    +G+ D  F    ++ S    L    PLDRE    Y   + A DR        S   VEI V D+NDN P F  + YT ++ E + +  +++     D DEGQN Q+   + +E            + DF+    TG I     +D E     YSF + A D     PR ++TA+V + +++ ND AP    I+   I+   SRS+          +VA+++  D+D     S+       +  + +N     I            ++++L    R           +     D+ +P  ++L + I      D   + F+R+     + EN  + T          D   G  AY  +  +  ++      F I + +G+I   S   +D+E        + A        SS++ + V++I  D NDN P F   +Y   +RE    ++ I Q+   D+D  P  ++      S  +   +  +D  SG + T   +DRE      ++ITA +  S     L  S  + +I I D+NDN P   L   +   ++SLI T
Sbjct: 1715 TVTVYAKDGGMPPNFAKATVHITVLDENDNAPVF-GRLQYSLELPENLEPVELFII-KATDQDSGDSGHLEYRIT----VGDPDGDF----QLDSSSGALSTSRPLDRERRDSYSLEVVAQDRGTPSLS--STATVEITVLDVNDNSPTFTSSSYTVDVSEDAAVGSSLLDVTAKDADEGQNGQILYFLSSEA-----------RGDFTVDPDTGRIVTAAPLDREKR-ASYSFQVCAVDLSPATPR-NTTAQVTVTILDVNDNAPFF--IQDPLIINVSSRSVAT------NHVVATMKAEDKDFGANGSVFYRFAMPVRGFSINSLTGEIQTTE--------LLSSLTQSQR----------TLIVEAMDQGSPAQSSLGVVIIYVKEQDYQGIRFSRTTRDVSIQENAAKGTAVAQAQAQYPDGTRGGIAYSIFSGNRQQS------FRISSSTGEIWVHSSTGLDFEDTPRLRLVVKA-----ETASSSSFMAVNLILQDVNDNLPRFQLQNYVAYMREARGYDSPIIQVVAEDVDQGPNGQVTYSIQSSGRSG--LFKIDPLSGSITTAAIMDREIWMQTKLVITATDRGS---PKLAGSATLTVI-IVDLNDNSPTIPLPREVRVPENSLIGT 2285          

HSP 11 Score: 97.0561 bits (240), Expect = 8.625e-20
Identity = 141/599 (23.54%), Postives = 235/599 (39.23%), Query Frame = 2
Query:  428 SSFYILIKVLDENDNSPKFLPFLNPYQ-TLPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLISPLDR-EVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSK-LVNVISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITAINEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYT----NNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIFS 2203
            S+  + I + D NDN P F   +  Y  ++ EN+   T  L  +A D D  +FG   Y +         + F++  +      Q+   + LDR E    + F + A D         S   V++ + DINDN P F    Y  ++   S    +VI     D D G+N +V+                FF ++      TG I L   +  + N    +  + A D G       A+VNI ++  +   PV       E      T+ E+    T V  ++ + R     DI  ++     +   T  +E   L         T  PLD E      L++ +  S         T +TI I   D+NDN P F  S  +  L+  + +    ++  +   D+D G+N  +++ + +S        F+++  SG+I    S+ Y+    +   ++A D      S+T  ++VHV   +D  P F    Y   ++EN P+NT   Q+     D + +N        SY      +     +  +SG L     +DRE  + I +L       S + K        V +++ D NDN P  S
Sbjct:  562 STALVEISLQDINDNEPVFGSSV--YNVSIKENTAAGTCFLEVTASDADGGSFGAVAYSLGSGAGSSPPTRFSINKETG----QICTSAALDRDEGADSFEFTVTAADGGGLS----SSAVVKVSLQDINDNRPTFYPVNYAVSLSSQSAPGTSVIRVTAHDPDGGENGKVTYRTVPGGG------SNFFTLNKD----TGVISLSRSLHGKANSV-IAMVITAQDGGGLTAPVNARVNISVVAGSVAPPVF------EQAQYFFTVSEDVLRGTEVGVVRANSRSLATKDISYTISSGDPDGYFTVDSETGAL--------RTSLPLDHE--ARPSLELEVQASSGSPPAFGQTRVTITIG--DVNDNTPAFLPSYSESLLLPEVTKIG-SVVYRVQAEDRDSGQNGRISFHLLASGGQ---RAFSVERGSGEIRLISSLSYDSVPRYDLQVLARDGGVPQRSATFTLVVHVQAEDDQGPAFDTLTYRVELKENTPLNTRFLQVRALSRD-QLKNGSSPAALLSYRLRPDGDAAGFGIVPDSGWLFVKSALDRE-AKDIYLLTVLATSGSGRMKKT--GSATVRVSVTDENDNSPRLS 1113          

HSP 12 Score: 87.4261 bits (215), Expect = 8.036e-17
Identity = 126/509 (24.75%), Postives = 209/509 (41.06%), Query Frame = 2
Query:  734 KAVDRENDDHRD-----ISG--VEVEIKVGDINDNPPVFDKTFYTANIVEHSKLVNVISFY-VTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEI-----DYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITAINE---IHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFT---RSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIFS 2203
            + +DRE  DH       ++G  VEV I V DIND+ PVF K   +  I E + +    S    TD D+ Q       I      K+  + + F+++   +  T  +  +D +     D E     YS  L A D G P+ +    +++ + + ND AP+    R   I+S S+    N         LQV   D+   D    L  Y +N   +  +    I P    +  II   KPLD E  K   L +    +  +   P  TN  + I++ D NDN P  T    S+     I    Q   + +  I   D D+G+ + V   ++       +   T D+    I   Q +D E+   +   ++A D     L + +   + V D NDN P+F +  Y  T+ E V   + + Q+   D D  P   ++         +     +D  +G + T   +D E   + ++ + A +      K  + S  +V I+++D+NDN P+F 
Sbjct:  106 RRLDREERDHYSFIAVTMTGLTVEVSITVNDINDHAPVFPKKKASLKIPEQTAVGTKFSLEPATDADKDQLTTQGYLI------KEGNVGQVFRLETKRA--TNKVLYLDLVVNGVLDREKR-ASYSLLLEAFDGGSPKKTGQMTLDVTVQDINDHAPIFNQSRYRAIISESLPQGSN--------ILQVFASDADEGDNGLVL--YEINRRQSDPDRYFVIDP----RSGIITLNKPLDYEVRKVHELVVQ---ARDNASHPEITNAFVTIHVRDFNDNQPTMTIIFLSEDGSPRISEGAQPG-QYVARISVSDPDYGEYSNVNVSLEGGDGK--FALTTKDSIIYLIYVDQVLDREERDSYELRVMATDSGTPPLRAESSFTIQVTDVNDNPPLFDQQAYKQTIPEVVYPGSFVLQVTARDKDHGPNGDVLYSILPDRGTHSDWFTIDPVTGIITTATQLDYETYPNPSVKVVATD----GGKPPLSSTALVEISLQDINDNEPVFG 581          

HSP 13 Score: 55.8398 bits (133), Expect = 3.304e-7
Identity = 50/174 (28.74%), Postives = 81/174 (46.55%), Query Frame = 2
Query: 1700 IDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTI-------GPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIF 2200
            ID  +G I + + +D E+   +SF  IA+    +    T  + + V D ND+AP+FPK   S  + E   V T+      TD D + +     Y  K   N  QV  ++      K +       G +DREK  S ++L+ A +  S +    M     + +T++D+ND+ PIF
Sbjct:   95 IDETTGIIETARRLDREERDHYSF--IAV----TMTGLTVEVSITVNDINDHAPVFPKKKASLKIPEQTAVGTKFSLEPATDAD-KDQLTTQGYLIKE-GNVGQVFRLETKRATNKVLYLDLVVNGVLDREKRASYSLLLEAFDGGSPKKTGQM----TLDVTVQDINDHAPIF 256          
BLAST of Protocadherin Fat 1 vs. Ensembl Cavefish
Match: ENSAMXT00000036438.1 (pep primary_assembly:Astyanax_mexicanus-2.0:20:10706414:10716598:1 gene:ENSAMXG00000034381.1 transcript:ENSAMXT00000036438.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 189.119 bits (479), Expect = 1.243e-49
Identity = 206/717 (28.73%), Postives = 326/717 (45.47%), Query Frame = 2
Query:  446 IKVLDENDNSPKFLPFLNPYQTLPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKLVNVISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTD-IECSLD-DYHLNFEITAINEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDK-DHGKNAYVTYKIDSSKNSTDWEYFTIDADSG---KISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIFSLINPAKSSLIFTINKGFRHENCQMIPYAVSDADHDEPNSDSCCILQLDNDQNGMLYLLSNTPNF--LCLQNTMNTPG--IYRVSLTATDNKNNPNKSLKAKVSFNIDVRHEVSDNP--FSEKSDN 2560
            IK+LD ND+SP F P  +    + E++ + +   L  A D D     I  YK+S+      + H T  D+  S   +L+L+  LDRE  +  R +L AVD         +  E+ + V D NDN P F K+ Y  ++ E++ +   + +      +GQ K +S T               F IDF+    TG I LI E+DYE+    Y   + A D G   L+S  KV + +++ ND AP IK      + S   ++ E+    T++A + V D+D      + C +  +     E T        G Y   +++    LDRE+   Q   ++I   D+    PL++   + + + D+NDNPP F  +     + EN P  + K   P+L  D  D G N+  +YK+ S     + E  T DAD G   ++   +S+D E+   F   + A+D  +   S T  I V V+DANDNAP+F K  Y   V E+V + T + ++  TDLD    ++++  F +          +D  +G++  IG +D E   +  I + AR+  S      + S C V++ + DVNDN P   L     SSL+ ++ +  R +    +   V D D  +     C +      +N    L S    +  L L  T++     +Y VS+TATD    P   L       + V  +V+DNP  F E S N
Sbjct:   35 IKILDTNDHSPVF-PGKSQTIRVAESALVGSKFPLLGADDPDIGINSISSYKLSQNAFFNLEVH-TDADQGPSA--ELVLLKSLDRERQATLRLVLTAVDGGRPPRSGTT--EIHVVVLDANDNAPAFSKSVYKVSVPENTAIGTSVKY---SFKQGQ-KGISDT---------------FSIDFN----TGEISLIGELDYEST-GAYEIRVEARDGGSTPLASHCKVLVEVVDVNDNAPEIK------LSSLLDSVPEDSRKGTVIALITVQDKDGGKNGKVHCFMSKNSPFVLESTQ-------GKYYSLVLS--GALDREE--KQIYNVSITAIDEGT-PPLSSTTVVTVRVSDVNDNPPRFPEASVNVYVKENSPAGS-KF--PLLGADDPDIGINSISSYKL-SQNTFFNLEVHT-DADQGPSAELVLLKSLDRERQATFRLVLTAVDGGRPPRSGTTEIHVVVLDANDNAPVFSKSLYKVLVSEDVALGTSVLKLNATDLDEGINSELLYSFKQGQKGISDKFTIDPGTGEISVIGELDYESTSAYEIRVEARDGGSTP----LASHCKVLVEVVDVNDNAPEIKL-----SSLLDSVREDARKDTAIAL-ITVQDKDGGKNGKVHCSM-----SKNSPFVLESTQEKYYSLVLSGTLDREKNELYNVSITATDEGTPP---LSGTTVLTVRV-SDVNDNPPLFPEASVN 679          

HSP 2 Score: 134.035 bits (336), Expect = 1.131e-31
Identity = 158/595 (26.55%), Postives = 259/595 (43.53%), Query Frame = 2
Query:  440 ILIKVLDENDNSPKFLPFLNPYQ-TLPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKLVNVISFY-VTDLDEGQNKQVSITIETENDYKKDQIK-RFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITAINEIHP---LGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNN--YQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIF 2200
            I + VLD NDN+P F   +  Y+ ++PEN+ I T +           +F      IS  F I  ++             ++ LI  LD E    Y   ++A  R+       S  +V ++V D+NDN P    +    ++ E S+   VI+   V D D G+N +V   +   + +  +  + +++ +  S +L           D E     Y+ ++ A D G P LSST  V + + + ND  P     R  E  S ++ + EN PA +    L   D D  +     S+  Y L+       E+H     G   E ++  LK LDRE  +    ++ +   D  +  P +    IH+ + D NDN PVF++S Y+  + E++   T   +  +   D D G N+ + Y     +     + FTID  +G+IS    +DYE    +   + A D   + L+S   ++V V+D NDNAP         +VRE+   +T I  I   D D     K+    H S + N  + +    +    L   G +DREK     + ITA +E +      +    ++ + + DVNDNPP+F
Sbjct:  142 IHVVVLDANDNAPAFSKSV--YKVSVPENTAIGTSV---------KYSFKQGQKGISDTFSIDFNTG------------EISLIGELDYESTGAYEIRVEA--RDGGSTPLASHCKVLVEVVDVNDNAPEIKLSSLLDSVPEDSRKGTVIALITVQDKDGGKNGKVHCFMSKNSPFVLESTQGKYYSLVLSGAL-----------DREEKQI-YNVSITAIDEGTPPLSSTTVVTVRVSDVNDNPP-----RFPE-ASVNVYVKENSPAGSKFPLLGADDPDIGIN----SISSYKLSQNTFFNLEVHTDADQGPSAELVL--LKSLDRE--RQATFRLVLTAVDGGR-PPRSGTTEIHVVVLDANDNAPVFSKSLYKVLVSEDVALGT--SVLKLNATDLDEGINSELLYSFKQGQKGIS-DKFTIDPGTGEISVIGELDYESTSAYEIRVEARDGGSTPLASHCKVLVEVVDVNDNAPEIKLSSLLDSVREDARKDTAIALITVQDKDGGKNGKV----HCSMSKNSPFVLESTQEKYYSLVLSGTLDREKNELYNVSITATDEGTPP----LSGTTVLTVRVSDVNDNPPLF 673          

HSP 3 Score: 110.923 bits (276), Expect = 1.742e-24
Identity = 110/372 (29.57%), Postives = 175/372 (47.04%), Query Frame = 2
Query:  428 SSFYILIKVLDENDNSPKFLPFLNPYQTLPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKL-VNVISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTD-IECSLDDYHLNFEITAINEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVF 1537
            S+  + ++V D NDN P+F P  +    + ENS   +   L  A D D     I  YK+S+      + H T  D+  S   +L+L+  LDRE  + +R +L AVD         +  E+ + V D NDN PVF K+ Y   + E   L  +V+    TDLDEG N ++         Y   Q ++     F+    TG I +I E+DYE+    Y   + A D G   L+S  KV + +++ ND AP IK      + S   ++ E+    T +A + V D+D      + CS+   +  F + +  E      Y   +++    LDRE  KN+   ++I  +D+    PL+    + + + D+NDNPP+F
Sbjct:  334 STTVVTVRVSDVNDNPPRF-PEASVNVYVKENSPAGSKFPLLGADDPDIGINSISSYKLSQNTFFNLEVH-TDADQGPSA--ELVLLKSLDRERQATFRLVLTAVDGGRPPRSGTT--EIHVVVLDANDNAPVFSKSLYKVLVSEDVALGTSVLKLNATDLDEGINSELL--------YSFKQGQKGISDKFTIDPGTGEISVIGELDYEST-SAYEIRVEARDGGSTPLASHCKVLVEVVDVNDNAPEIK------LSSLLDSVREDARKDTAIALITVQDKDGGKNGKVHCSMSK-NSPFVLESTQE-----KYYSLVLS--GTLDRE--KNELYNVSITATDEGT-PPLSGTTVLTVRVSDVNDNPPLF 673          

HSP 4 Score: 90.1225 bits (222), Expect = 5.498e-18
Identity = 108/370 (29.19%), Postives = 160/370 (43.24%), Query Frame = 2
Query: 1490 TIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDK-DHGKNAYVTYKIDSSKNS-TDWEYFTIDADSG---KISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKY-FHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIFSLINPAKSSLIFTINKGFRHENCQMIPYAVSDADHDEPNSDSCCILQLDNDQNGMLYLLSNTPNF--LCLQNTMN--TPGIYRVSLTATDNKNNPNKSLKAKVSFNIDVR-HEVSDNP--FSEKSDN 2560
            ++ I + D ND+ PVF     + + I     A V    P+L  D  D G N+  +YK+  S+N+  + E  T DAD G   ++   +S+D E+       + A+D  +   S T  I V V+DANDNAP F K  Y  +V EN  + T                  VKY F +          +D N+G++  IG +D E   +  I + AR+  S      + S C V++ + DVNDN P   L     SSL+ ++ +  R      +   V D D  + N    C +     +N    L S    +  L L   ++     IY VS+TA D    P  S        + VR  +V+DNP  F E S N
Sbjct:   32 SVEIKILDTNDHSPVFPG---KSQTIRVAESALVGSKFPLLGADDPDIGINSISSYKL--SQNAFFNLEVHT-DADQGPSAELVLLKSLDRERQATLRLVLTAVDGGRPPRSGTTEIHVVVLDANDNAPAFSKSVYKVSVPENTAIGTS-----------------VKYSFKQGQKGISDTFSIDFNTGEISLIGELDYESTGAYEIRVEARDGGSTP----LASHCKVLVEVVDVNDNAPEIKL-----SSLLDSVPEDSRKGTVIAL-ITVQDKDGGK-NGKVHCFMS----KNSPFVLESTQGKYYSLVLSGALDREEKQIYNVSITAIDEGTPPLSSTTV-----VTVRVSDVNDNPPRFPEASVN 358          
BLAST of Protocadherin Fat 1 vs. Ensembl Cavefish
Match: pcdh1a (protocadherin 1a [Source:ZFIN;Acc:ZDB-GENE-091116-32])

HSP 1 Score: 192.2 bits (487), Expect = 2.099e-49
Identity = 175/605 (28.93%), Postives = 295/605 (48.76%), Query Frame = 2
Query:  446 IKVLDENDNSPKFLPFLNPYQTLP--ENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIASGR----PQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKL-VNVISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRS---ITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITAINEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIFSLINPAKSSL 2230
            I+V D NDN+P+F    +P  TL   EN+ +     +P A D D+E  G+  Y +S     G ++      ++A+ R    PQL+++  LDRE+   Y   + AVD         S   + + + D NDN P F+K+ Y A + E+S +  +V+     D D G N ++  TI   +D     + +  QI+ S    TG I +   +D E     + F++IA D G    SST  V+I + ++ND AP ++ IR   + + S     + E+ P  T VA +QVSD+D     +   +    + F++    +   + + K++ + T  PLD E  ++  ++I    S    L+  +TN ++ + + D NDN P+F+   ++ E  E   Q   K+++ ++ LD D G NA + Y I +  +S+    F ID  SG++ +R  +D E  + + F + A DK   +   TA +++ V+D NDN P F    YSF+V EN+P  + +G +   D+D + EN  V+   +    N+    V   +G + +    DREK  S T  + A +       + +     V I + D NDN P+  +  P+ SS 
Sbjct:  155 IEVQDINDNTPQFP---SPVLTLSVQENAHMGATFAIPQATDRDTERNGVLKYDLSA----GPEASALFSLQMANDRGEKLPQLIVLGNLDRELKDSYDLTINAVDGGTPSR--YSSALLRVVITDANDNAPQFEKSSYEAEVSENSPVGYSVLQVKANDSDLGPNGEIEYTIHQASD----PVPKMLQIERS----TGIISVKGPLDREEI-SSFKFHVIARDKGPSPKSSTTYVSIEVTDQNDNAPAVE-IRGIGLRTHSDGVANISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDVPFQLRPAGDSS-VDNKKKYFLQTTTPLDYERIRDYRVEIVAVDSGNPALS--STN-SLRVQVTDTNDNSPIFSPPLFEVEFAEEN-QPGEKVLD-VIALDADSGTNAELVYSIIA--DSSTRGLFEIDPSSGEVRARSPLDREHKERYEFRVTAADKGVPSHRGTATVVIKVLDRNDNDPKFMLSSYSFSVLENMPPLSPVGMVTVLDMD-KGENAQVQLSVEPDVGNFV---VQNGTGTILSSISFDREKESSYTFRLKAVDGGEPPRSSYVG----VTINVLDENDNAPV--VTKPSNSSF 722          

HSP 2 Score: 119.398 bits (298), Expect = 9.630e-27
Identity = 156/604 (25.83%), Postives = 260/604 (43.05%), Query Frame = 2
Query:  407 VDSGI--KISSFYILIKVLDENDNSPKFLPFLNPYQT-LPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFD--------KTFYTANIVEHSKLVNVISFY-VTDLDEGQNKQVSITIETE--------NDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITA------INEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPL-TTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQ-ATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPV---NTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDRE--KVRSITILITARNEAS 2119
            VD G   + SS  + + + D NDN+P+F    + Y+  + ENS +   +L   A D D    G   Y I +     +D    +L +I      + +  PLDRE IS ++F    + R+       S   V I+V D NDN P  +         +   ANI E   +   ++   V+D DEG+N  V+  +  +         D   D  K++F    +P            +DYE     Y   ++A D+G P LSST  + + + + ND +P+            S  +FE E A       +V D  +L  D   S  +  L + I A      + EI P        +    PLDRE  +    ++       DK  P      T+ I + D NDN P F  S Y   ++EN+P  + V M   +  LD D G+NA V   ++      D   F +   +G I S  S D EK   ++F + A+D  +   SS   + ++V+D NDNAP+  KP  S + R   P+   ++ +  +E  D+D     ++V  +  +  N +++ ++  + G++K    + R+   +  + + ++ R + S
Sbjct:  252 VDGGTPSRYSSALLRVVITDANDNAPQF--EKSSYEAEVSENSPVGYSVLQVKANDSDLGPNGEIEYTIHQ----ASDPVPKML-QIERSTGIISVKGPLDREEISSFKF--HVIARDKGPSPKSSTTYVSIEVTDQNDNAPAVEIRGIGLRTHSDGVANISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDVPFQLRPAGDSSVDNKKKYFLQTTTP------------LDYERI-RDYRVEIVAVDSGNPALSSTNSLRVQVTDTNDNSPIF-----------SPPLFEVEFAEENQPGEKVLDVIALDAD---SGTNAELVYSIIADSSTRGLFEIDP----SSGEVRARSPLDREHKERYEFRVTA----ADKGVPSHRGTATVVIKVLDRNDNDPKFMLSSYSFSVLENMPPLSPVGM---VTVLDMDKGENAQVQLSVE-----PDVGNFVVQNGTGTILSSISFDREKESSYTFRLKAVDGGEPPRSSYVGVTINVLDENDNAPVVTKPSNS-SFRRLSPLAAPDSVVEVVEAEDIDYGSNAELV--YSIAGGNPHELFYISPSDGEIKLTKELTRKHGGLHRLVVKVSDRGKPS 800          

HSP 3 Score: 103.99 bits (258), Expect = 4.504e-22
Identity = 134/578 (23.18%), Postives = 237/578 (41.00%), Query Frame = 2
Query:  692 PLDREVISEYR---------FILKAVDR-ENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKLVNVISF-YVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFS-------PSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITAINEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVF--------TRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVT--------YKIDSSKNST---DWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIFSL-------------INPAKSSLIFTINKGFRHENCQM 2275
            P+DRE + + R         F +   D  +N   R I G    I+V DINDN P F     T ++ E++ +    +    TD D  +N  +   +         +    F +  +       P L+     ++  +D E     Y   + A D G P   S+A + +++ + ND AP        E  S    + EN P    V  ++ +D D L  + E     +  +  +  + +I         II+   PLDRE+  +   K ++   D+   +P ++   + I + D NDN P          T S     + E++P  T   +  +   DKD G+NA VT        +++  + +S+     +YF        + +   +DYE+ + +   I+A+D     LSST  + V V D NDN+PIF  P +     E      ++  +   D D+    ++V Y   + ++   +  +D +SG+++   P+DRE        +TA ++    ++        V+I + D NDN P F L             ++P     +  ++KG   EN Q+
Sbjct:  115 PIDRETLKDCRIKGKPCFLEFEVSVTDLIQNQSPRLIEG---RIEVQDINDNTPQFPSPVLTLSVQENAHMGATFAIPQATDRDTERNGVLKYDLSA-----GPEASALFSLQMANDRGEKLPQLI-----VLGNLDRELK-DSYDLTINAVDGGTPSRYSSALLRVVITDANDNAPQF------EKSSYEAEVSENSPVGYSVLQVKANDSD-LGPNGEIEYTIHQASDPVPKMLQI----ERSTGIISVKGPLDREEISS--FKFHVIARDKGP-SPKSSTTYVSIEVTDQNDNAPAVEIRGIGLRTHSDGVANISEDMPVGTAVAL--VQVSDKDEGENAVVTCVVAGDVPFQLRPAGDSSVDNKKKYF--------LQTTTPLDYERIRDYRVEIVAVDSGNPALSSTNSLRVQVTDTNDNSPIFSPPLFEVEFAEENQPGEKVLDVIALDADSGTNAELV-YSIIADSSTRGLFEIDPSSGEVRARSPLDREHKERYEFRVTAADKGVPSHRGT----ATVVIKVLDRNDNDPKFMLSSYSFSVLENMPPLSPVGMVTVLDMDKG---ENAQV 646          

HSP 4 Score: 94.7449 bits (234), Expect = 3.671e-19
Identity = 122/511 (23.87%), Postives = 216/511 (42.27%), Query Frame = 2
Query:  380 ECCTVFSFQV---DSGI--KISSFYILIKVLDENDNSPK-------FLPFLNPYQTLPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLL---DKIASGRPQLLL--ISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHS----KLVNVISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLV-TDIECSLDDYHLNFEITAINEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTR---SKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHV 1837
            E  + F F V   D G   K S+ Y+ I+V D+NDN+P             +    + E+  + T + L    D D     +         ++  D  F L    D     + +  L   +PLD E I +YR  + AVD  N      + + V++   D NDN P+F    +     E +    K+++VI+    D D G N ++  +I  ++       +  F+ID S    +G +R    +D E +  +Y F + A D G+P    TA V I ++++ND  P      K  + S S ++ EN P  + V  + V D D      ++ S++    NF +          +    I++++   DRE + +   ++      +    P ++ + + IN+ D NDN PV T+   S ++       P + V+++E     D D+G NA + Y I         E F I    G+I   + +  +   L    +   D+ + +  + AL+ ++V
Sbjct:  347 EEISSFKFHVIARDKGPSPKSSTTYVSIEVTDQNDNAPAVEIRGIGLRTHSDGVANISEDMPVGTAVALVQVSDKDEGENAVVT------CVVAGDVPFQLRPAGDSSVDNKKKYFLQTTTPLDYERIRDYRVEIVAVDSGNPALSSTNSLRVQVT--DTNDNSPIFSPPLFEVEFAEENQPGEKVLDVIAL---DADSGTNAELVYSIIADS-----STRGLFEIDPS----SGEVRARSPLDRE-HKERYEFRVTAADKGVPSHRGTATVVIKVLDRNDNDP------KFMLSSYSFSVLENMPPLSPVGMVTVLDMDKGENAQVQLSVEPDVGNFVVQ---------NGTGTILSSIS-FDREKESSYTFRLKAVDGGE---PPRSSYVGVTINVLDENDNAPVVTKPSNSSFRRLSPLAAPDSVVEVVE---AEDIDYGSNAELVYSI---AGGNPHELFYISPSDGEIKLTKELTRKHGGLHRLVVKVSDRGKPSRHAIALVHIYV 811          

HSP 5 Score: 89.3521 bits (220), Expect = 1.506e-17
Identity = 79/294 (26.87%), Postives = 130/294 (44.22%), Query Frame = 2
Query: 1379 IINTLKPLDREDDKNQYLKIN-IYCSDQDKLTPLTTN-----LTIHINLFDINDNPPVFTRSKYQGELIEN--------IPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSG----KISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIFSL 2206
            I  T  P+DRE  K+  +K    +   +  +T L  N     +   I + DINDN P F        + EN        IPQAT          D+D  +N  + Y + +   ++      +  D G    ++    ++D E    +   I A+D    +  S+AL+ V + DANDNAP F K  Y   V EN PV   + Q++  D D  P  +I    H++     +++ +++++G +   GP+DRE++ S    + AR+    +  +   S   V I + D NDN P   +
Sbjct:  109 IFTTEIPIDRETLKDCRIKGKPCFLEFEVSVTDLIQNQSPRLIEGRIEVQDINDNTPQFPSPVLTLSVQENAHMGATFAIPQAT----------DRDTERNGVLKYDLSAGPEASALFSLQMANDRGEKLPQLIVLGNLDRELKDSYDLTINAVDGGTPSRYSSALLRVVITDANDNAPQFEKSSYEAEVSENSPVGYSVLQVKANDSDLGPNGEIEYTIHQASDPVPKMLQIERSTGIISVKGPLDREEISSFKFHVIARD----KGPSPKSSTTYVSIEVTDQNDNAPAVEI 388          
BLAST of Protocadherin Fat 1 vs. Ensembl Cavefish
Match: pcdh1a (protocadherin 1a [Source:ZFIN;Acc:ZDB-GENE-091116-32])

HSP 1 Score: 191.045 bits (484), Expect = 2.698e-49
Identity = 175/605 (28.93%), Postives = 292/605 (48.26%), Query Frame = 2
Query:  446 IKVLDENDNSPKFLPFLNPYQTLP--ENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIASGR----PQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKL-VNVISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRS---ITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITAINEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIFSLINPAKSSL 2230
            I+V D NDN+P+F    +P  TL   EN+ +     +P A D D+E  G+  Y +S     G ++      ++A+ R    PQL+++  LDRE+   Y   + AVD         S   + + + D NDN P F+K+ Y A + E+S +  +V+     D D G N ++  TI   +D     + +  QI+ S    TG I +   +D E     + F++IA D G    SST  V+I + ++ND AP ++ IR   + + S     + E+ P  T VA +QVSD+D     +   +    + F++    +   + + K++ + T  PLD E  ++   ++ I   D       +TN ++ + + D NDN P+F+   ++ E  E   Q   K+++ ++ LD D G NA + Y I +  +S+    F ID  SG++ +R  +D E  + + F + A DK   +   TA +++ V+D NDN P F    YSF+V EN+P  + +G +   D+D + EN  V+   +    N+    V   +G + +    DREK  S T  + A +           S   V I + D NDN P+ +   P+ SS 
Sbjct:  119 IEVQDINDNTPQFP---SPVLTLSVQENAHMGATFAIPQATDRDTERNGVLKYDLSA----GPEASALFSLQMANDRGEKLPQLIVLGNLDRELKDSYDLTINAVDGGTPSR--YSSALLRVVITDANDNAPQFEKSSYEAEVSENSPVGYSVLQVKANDSDLGPNGEIEYTIHQASD----PVPKMLQIERS----TGIISVKGPLDRE-EISSFKFHVIARDKGPSPKSSTTYVSIEVTDQNDNAPAVE-IRGIGLRTHSDGVANISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDVPFQLRPAGD-SSVDNKKKYFLQTTTPLDYERIRD--YRVEIVAVDSGNPALSSTN-SLRVQVTDTNDNSPIFSPPLFEVEFAEE-NQPGEKVLD-VIALDADSGTNAELVYSIIA--DSSTRGLFEIDPSSGEVRARSPLDREHKERYEFRVTAADKGVPSHRGTATVVIKVLDRNDNDPKFMLSSYSFSVLENMPPLSPVGMVTVLDMD-KGENAQVQLSVEPDVGNFV---VQNGTGTILSSISFDREKESSYTFRLKAVDGGEPPRS----SYVGVTINVLDENDNAPVVT--KPSNSSF 686          

HSP 2 Score: 118.627 bits (296), Expect = 1.220e-26
Identity = 156/604 (25.83%), Postives = 261/604 (43.21%), Query Frame = 2
Query:  407 VDSGI--KISSFYILIKVLDENDNSPKFLPFLNPYQT-LPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFD--------KTFYTANIVEHSKLVNVISFY-VTDLDEGQNKQVSITIETE--------NDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITA------INEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPL-TTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQ-ATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPV---NTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDRE--KVRSITILITARNEAS 2119
            VD G   + SS  + + + D NDN+P+F    + Y+  + ENS +   +L   A D D    G   Y I +     +D    +L +I      + +  PLDRE IS ++F    + R+       S   V I+V D NDN P  +         +   ANI E   +   ++   V+D DEG+N  V+  +  +         D   D  K++F    +P            +DYE     Y   ++A D+G P LSST  + + + + ND +P+            S  +FE E A       +V D  +L  D   S  +  L + I A      + EI P        +    PLDRE  +    ++    +  DK  P      T+ I + D NDN P F  S Y   ++EN+P  + V M   +  LD D G+NA V   ++      D   F +   +G I S  S D EK   ++F + A+D  +   SS   + ++V+D NDNAP+  KP  S + R   P+   ++ +  +E  D+D     ++V  +  +  N +++ ++  + G++K    + R+   +  + + ++ R + S
Sbjct:  216 VDGGTPSRYSSALLRVVITDANDNAPQFEK--SSYEAEVSENSPVGYSVLQVKANDSDLGPNGEIEYTIHQ----ASDPVPKML-QIERSTGIISVKGPLDREEISSFKF--HVIARDKGPSPKSSTTYVSIEVTDQNDNAPAVEIRGIGLRTHSDGVANISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDVPFQLRPAGDSSVDNKKKYFLQTTTP------------LDYE-RIRDYRVEIVAVDSGNPALSSTNSLRVQVTDTNDNSPIF-----------SPPLFEVEFAEENQPGEKVLDVIALDAD---SGTNAELVYSIIADSSTRGLFEIDP----SSGEVRARSPLDREHKERYEFRV----TAADKGVPSHRGTATVVIKVLDRNDNDPKFMLSSYSFSVLENMPPLSPVGM---VTVLDMDKGENAQVQLSVE-----PDVGNFVVQNGTGTILSSISFDREKESSYTFRLKAVDGGEPPRSSYVGVTINVLDENDNAPVVTKPSNS-SFRRLSPLAAPDSVVEVVEAEDIDYGSNAELV--YSIAGGNPHELFYISPSDGEIKLTKELTRKHGGLHRLVVKVSDRGKPS 764          

HSP 3 Score: 103.219 bits (256), Expect = 8.134e-22
Identity = 134/578 (23.18%), Postives = 237/578 (41.00%), Query Frame = 2
Query:  692 PLDREVISEYR---------FILKAVDR-ENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKLVNVISF-YVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFS-------PSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITAINEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVF--------TRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVT--------YKIDSSKNST---DWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIFSL-------------INPAKSSLIFTINKGFRHENCQM 2275
            P+DRE + + R         F +   D  +N   R I G    I+V DINDN P F     T ++ E++ +    +    TD D  +N  +   +         +    F +  +       P L+     ++  +D E     Y   + A D G P   S+A + +++ + ND AP        E  S    + EN P    V  ++ +D D L  + E     +  +  +  + +I         II+   PLDRE+  +   K ++   D+   +P ++   + I + D NDN P          T S     + E++P  T   +  +   DKD G+NA VT        +++  + +S+     +YF        + +   +DYE+ + +   I+A+D     LSST  + V V D NDN+PIF  P +     E      ++  +   D D+    ++V Y   + ++   +  +D +SG+++   P+DRE        +TA ++    ++        V+I + D NDN P F L             ++P     +  ++KG   EN Q+
Sbjct:   79 PIDRETLKDCRIKGKPCFLEFEVSVTDLIQNQSPRLIEG---RIEVQDINDNTPQFPSPVLTLSVQENAHMGATFAIPQATDRDTERNGVLKYDLSA-----GPEASALFSLQMANDRGEKLPQLI-----VLGNLDRELKD-SYDLTINAVDGGTPSRYSSALLRVVITDANDNAPQF------EKSSYEAEVSENSPVGYSVLQVKANDSD-LGPNGEIEYTIHQASDPVPKMLQI----ERSTGIISVKGPLDREEISS--FKFHVIARDKGP-SPKSSTTYVSIEVTDQNDNAPAVEIRGIGLRTHSDGVANISEDMPVGTAVAL--VQVSDKDEGENAVVTCVVAGDVPFQLRPAGDSSVDNKKKYF--------LQTTTPLDYERIRDYRVEIVAVDSGNPALSSTNSLRVQVTDTNDNSPIFSPPLFEVEFAEENQPGEKVLDVIALDADSGTNAELV-YSIIADSSTRGLFEIDPSSGEVRARSPLDREHKERYEFRVTAADKGVPSHRGT----ATVVIKVLDRNDNDPKFMLSSYSFSVLENMPPLSPVGMVTVLDMDKG---ENAQV 610          

HSP 4 Score: 93.5893 bits (231), Expect = 6.535e-19
Identity = 122/511 (23.87%), Postives = 216/511 (42.27%), Query Frame = 2
Query:  380 ECCTVFSFQV---DSGI--KISSFYILIKVLDENDNSPK-------FLPFLNPYQTLPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLL---DKIASGRPQLLL--ISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHS----KLVNVISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLV-TDIECSLDDYHLNFEITAINEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTR---SKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHV 1837
            E  + F F V   D G   K S+ Y+ I+V D+NDN+P             +    + E+  + T + L    D D     +         ++  D  F L    D     + +  L   +PLD E I +YR  + AVD  N      + + V++   D NDN P+F    +     E +    K+++VI+    D D G N ++  +I  ++       +  F+ID S    +G +R    +D E +  +Y F + A D G+P    TA V I ++++ND  P      K  + S S ++ EN P  + V  + V D D      ++ S++    NF +          +    I++++   DRE + +   ++      +    P ++ + + IN+ D NDN PV T+   S ++       P + V+++E     D D+G NA + Y I         E F I    G+I   + +  +   L    +   D+ + +  + AL+ ++V
Sbjct:  311 EEISSFKFHVIARDKGPSPKSSTTYVSIEVTDQNDNAPAVEIRGIGLRTHSDGVANISEDMPVGTAVALVQVSDKDEGENAVVT------CVVAGDVPFQLRPAGDSSVDNKKKYFLQTTTPLDYERIRDYRVEIVAVDSGNPALSSTNSLRVQVT--DTNDNSPIFSPPLFEVEFAEENQPGEKVLDVIAL---DADSGTNAELVYSIIADS-----STRGLFEIDPS----SGEVRARSPLDRE-HKERYEFRVTAADKGVPSHRGTATVVIKVLDRNDNDP------KFMLSSYSFSVLENMPPLSPVGMVTVLDMDKGENAQVQLSVEPDVGNFVVQ---------NGTGTILSSIS-FDREKESSYTFRLKAVDGGE---PPRSSYVGVTINVLDENDNAPVVTKPSNSSFRRLSPLAAPDSVVEVVE---AEDIDYGSNAELVYSI---AGGNPHELFYISPSDGEIKLTKELTRKHGGLHRLVVKVSDRGKPSRHAIALVHIYV 775          

HSP 5 Score: 89.3521 bits (220), Expect = 1.301e-17
Identity = 79/294 (26.87%), Postives = 130/294 (44.22%), Query Frame = 2
Query: 1379 IINTLKPLDREDDKNQYLKIN-IYCSDQDKLTPLTTN-----LTIHINLFDINDNPPVFTRSKYQGELIEN--------IPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSG----KISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIFSL 2206
            I  T  P+DRE  K+  +K    +   +  +T L  N     +   I + DINDN P F        + EN        IPQAT          D+D  +N  + Y + +   ++      +  D G    ++    ++D E    +   I A+D    +  S+AL+ V + DANDNAP F K  Y   V EN PV   + Q++  D D  P  +I    H++     +++ +++++G +   GP+DRE++ S    + AR+    +  +   S   V I + D NDN P   +
Sbjct:   73 IFTTEIPIDRETLKDCRIKGKPCFLEFEVSVTDLIQNQSPRLIEGRIEVQDINDNTPQFPSPVLTLSVQENAHMGATFAIPQAT----------DRDTERNGVLKYDLSAGPEASALFSLQMANDRGEKLPQLIVLGNLDRELKDSYDLTINAVDGGTPSRYSSALLRVVITDANDNAPQFEKSSYEAEVSENSPVGYSVLQVKANDSDLGPNGEIEYTIHQASDPVPKMLQIERSTGIISVKGPLDREEISSFKFHVIARD----KGPSPKSSTTYVSIEVTDQNDNAPAVEI 352          
BLAST of Protocadherin Fat 1 vs. Ensembl Cavefish
Match: pcdh11 (protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-21])

HSP 1 Score: 190.66 bits (483), Expect = 4.773e-49
Identity = 185/620 (29.84%), Postives = 293/620 (47.26%), Query Frame = 2
Query:  383 CCTVFS-----FQVDSGIKISSFYILIKVL----DENDNSPKFLPFLNPYQTLPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIASGR----PQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKL-VNVISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITAINEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIF 2200
            C  VF+     ++++  +     + L+K+     D NDN+P F   +    ++PEN+ IN    +PSA D D    GI++Y+     L+ + S F L D I +      PQL++   LDRE  ++  F++K    +  +    S   +++ V D+NDN PVF  +    N+ E++ +  +V   + TD D G N Q+  +   +        KR F ID S    TG I +   +D E+NP  +   ++A+D       +T  VN+  +N  D  P I        V+ ++ + EN P  T +A + V+DRD+ +        D+ + F +  +          +F++ T  PLD E  +   +KI    SD  K  PL T+  + I + D NDN PVF + + Q  + EN    T ++I+ I   D D G NA + Y +    ++ D   F ID  SG +S  + +D EK + +SF +IA D   + L S   + + V D NDN+P F    Y+F V EN+P+   +G I  TD D   +N IV     S  N      +D  +G +K     DRE+  S T ++ A +    Q      S   V I + DVNDN P+F
Sbjct:  137 CSGVFNEKRCFYEIEVAVLPDEIFRLVKIRFLIEDINDNAPLFQSTVINI-SIPENTAINNRYPVPSAFDPDVGINGIQHYE-----LVKSVSEFGL-DIIETPEGDKWPQLIVQQNLDRE--TKDTFVMKIKVEDGGNPPKSSTAILQVTVSDVNDNRPVFKDSEVEVNVPENAPMGTSVTQLHATDADLGSNAQIHFSFSNQ---ISPATKRHFAIDSS----TGLITVKQPLDRESNPV-HKLIVLASDGSATPSRATVIVNVTDVN--DNVPSIDTRYIMNPVNGTVLLSENAPLNTKIALITVTDRDADLNGKVTCYTDHDVPFRLKPV-------FNDQFLLETAAPLDYETTREYAIKI--VASDSGK-PPLNTSAMVLIKIKDENDNAPVFPQPEIQLSIPENNDPGT-QLIK-ITATDADSGSNALIIYSL--GPDAPDG--FNIDPRSGILSVSKRLDREKQEKYSFTVIARDNGSNPLQSNVTVKLIVQDQNDNSPAFTHAEYNFYVPENLPLYGTVGLITVTDADAG-DNAIVTL---SIINGKDNFIIDPKTGVIKPNITFDREQQSSYTFVVKAVDSGLIQTT----SYAKVTINVVDVNDNRPVF 713          
BLAST of Protocadherin Fat 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010725.1 (pep scaffold:Pmarinus_7.0:GL479425:26296:30457:-1 gene:ENSPMAG00000009713.1 transcript:ENSPMAT00000010725.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 188.734 bits (478), Expect = 2.245e-49
Identity = 202/797 (25.35%), Postives = 354/797 (44.42%), Query Frame = 2
Query:  245 IDNRLSVVSNIDRESICPIKNSLNDYDQSAETYNSQQSSHSCKYDECCTVFSFQVDSGIKISSFYILIKVLDENDNSPKF-LPFLNPYQTLPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIG-NDSHFTLLDKIA---------------SGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISG-VEVEIKVGDINDNPPVF-DKTFYTANIVEHSKL-VNVISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIR-KGE-IVSRSITMFENEPARTIVASLQVSDRD---SLVTDIECSLDDYHLNFEITAINEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTP-LTTNLTIHINLFDINDNPPVFTR--------SKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKI-DSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPH------YSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIFSLINPAKSSLIFTINKGFRH-----ENCQMIPYAVSDADHDEPNSDSCCILQLDNDQNGMLYLLSNTPNFLCLQNTMNT--PGIYRVSLTATDNKNNPNKSLKA 2491
            +   LSV   +DRE++C             E  ++ +S+      +   +   Q  S +++    +L++  D ND++P F  P LN   ++ E+  +   + LP AID D+    I++Y+IS     G     F+L++                    R  L L   LDRE +  Y  +L   D  N     +SG V + I V D NDN PVF D       I EHSK+  +V+     D D G N  ++ +  T+      Q      +D +  L+T  +R  +++D ET P  +   ++A D G    S++  V + L + ND APV +VI  +GE +    + + EN P+ T V  + VSD D   S   D+     ++    E+ + N++       +F++ T + LD E+ + QY   N+     D+ TP L+  L + I++ DINDN PVF          + Y+  L EN P  TV +   +L  D D G N  +T+ + + +   +  E F+++  +G+++    +D EK   +  ++ A D       + A++ V V+D NDNAP F          Y F V E   V T +G + T+DLD     ++     +    ++     D   G ++T+  +DRE      + + A +      +  + + C V IT+ D NDN P+ +  N          N  ++H         ++  +V+  D D  ++       +  +  G ++LL+     L L  T+++   G++R+ +   D   + ++ ++A
Sbjct:   79 LSGELSVALRLDREALC------------MEEPDACRSTGFMHTVQVAAMAKGQGSSNLRLLDVQLLVR--DINDHAPAFRAPHLN--VSISESEAVGRRVPLPRAIDPDAGTNSIQHYRISAASGDGLQLGPFSLVESDDDDDGGGVGVDGDGGMGHRALLELREQLDREAVPSYELLLWGEDGGNPK---LSGSVLLTIVVVDANDNAPVFVDPPTRPVRITEHSKVGTSVVQLRAADPDAGPNGAIAYSFHTKLTSLATQAA--LHVDGTTGLVT--VRNAEKLDRETMPV-HRLVVVARDGGQLSRSASVTVTVELNDDNDNAPVFEVIALQGEYLPDGGVKIVENLPSGTPVVLISVSDPDLGSSGTVDVRL---EFPTGAELASPNKV-------QFLLKTTRLLDYEEAQ-QY---NVSVLAADRGTPKLSKLLNLIISVVDINDNTPVFMNPASIEGDVAVYEVSLRENGPAGTVVL--NLLATDADSGPNGAITFTLSELAGGESVAELFSLNMRTGQLTLATPLDREKRMRYELSVEACDGGSPQRKARAIVRVTVLDENDNAPTFVGVSNSTNCMYQFFVEEETSVGTYVGTVSTSDLDEGDNARVALNLVREAGPDWIGGAGDTPGGVVRTLVVLDREDRVQYELSVRAVD----SGRPALSASCRVSITVSDTNDNAPVITSPN---------TNDTWKHVRTFSPAGMLVGVSVTANDIDAGDNGRPLYEIIGGNPKG-IFLLNADSGALSLARTVSSLDEGLHRLVVRVRDRGGSGSRRVRA 821          
BLAST of Protocadherin Fat 1 vs. Ensembl Sea Lamprey
Match: pcdh11 (protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-21])

HSP 1 Score: 182.185 bits (461), Expect = 3.339e-47
Identity = 204/731 (27.91%), Postives = 334/731 (45.69%), Query Frame = 2
Query:  107 VKENIYYSQPLLDLEKVLKNRTIIPYDKHQRYKIY--AVTEKASPFSLIDNR----LSVVSNIDRESICPIKNSLNDYDQSAETYNSQQSSHSCKYDECCTVFSFQVDSGIKISSFYILIKVLDENDNSPKFL-PFLNPYQTLPENSQINTVILLPSAIDLDSEAFGIKYYKI--SKPFLIGNDSHFTL-LDKIASGR--PQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEV-EIKVGDINDNPPVFDKTFYTANIVEHSKL-VNVISFYVTDLDEGQNKQV--SITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRD-SLVTDIECSLDDYHLNFEITAINEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIFSLINPAKSSLIFTINK 2248
            ++E  +   P +DL        +  Y+    YK+      + A P   ++ R     +    +DRE++C                  Q     C  D    V   Q     K+    + I V D NDN+P F  P L    ++PEN+       +  A D DSEA G++ Y++  S P  +   S F L + + A+G   P L++   LDRE    Y   L+AVD  +  H   SG  V  I V D NDN PVFD+      I E+S +  +V+  + +D D G N +V   +   T         KR F++D +  L+T    +   ++ E +P  Y   ++ATD G   + +TA V + + + ND +P I++      V+  I + E       VA + VSD D      + C + +  + F++        L +  ++++ T + LD E  KN+Y+ + I  +D    T L+  +++ I L D NDN PVFT   Y+  + EN      K +  +   D+D  KNA + Y +     +     F +D ++G IS  + +D EK   +SF I+A D+    L   A +IV+V+D NDN P F    + F V ENVP ++ +G +   D D   EN  V+      T+N Q+  +D  SG +++    DRE+     + +    +A+   + +  S   V+I + D+NDN PI  L+ P+ ++  F + +
Sbjct:   47 LREGAFIGNPSVDLR-------LADYNLELTYKVMLSKAEDAAPPLVRVNPRTGELFAAGRKMDREALC----------------GGQDPGDECHVDVQVGVLPVQPGPFFKL--IEVRINVEDINDNAPAFAAPVLT--VSVPENAPAGKRFPIQPANDPDSEANGVRRYELLPSDPATV---SAFELSVTETANGEKVPYLVVRKSLDREERQLYEMNLRAVDGGSPPH---SGSAVLRINVTDTNDNSPVFDQAEVNVEIPENSPVGTHVVQLHASDRDAGSNAEVVYRLGTSTGGAGSGQGGKRLFRLDQNSGLVT----VNGLLNREESPV-YRIIILATDKGPEPVPATATVTVTVTDVNDNSPTIEIRDIVAPVNGVIYISEASHVNLPVALITVSDPDIGANGAVTCYIYNPEVPFQLKK------LTYPNQYLLETRETLDYET-KNEYV-VQIKAADAGA-TSLSRTMSVTIKLLDSNDNAPVFTEPTYKVSVPEN--NVIGKHLITVSATDRDMDKNAEMVYFLGPDAPT----MFHMDPETGIISLTEQLDREKKANYSFTILAKDQGIPVLEGNATVIVNVLDVNDNRPRFSLAEFDFYVNENVPKHSTVGMVTVADSD-EGENGRVR-LSILGTDNRQLFSIDPESGMIRSNVGFDREQRHYYVLEV----QATDGGEPVRSSTVKVVIHVMDINDNSPIV-LMPPSNTTYKFVVPR 717          

HSP 2 Score: 104.76 bits (260), Expect = 4.943e-23
Identity = 97/347 (27.95%), Postives = 159/347 (45.82%), Query Frame = 2
Query: 1037 DEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITAINEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQ-ATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKP----HYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPI 2062
            + +DYET   +Y   + A D G   LS T  V I L++ ND APV          +  +++ EN      + ++  +DRD    D    +  Y L  +   +  + P    +  II+  + LDRE   N      I   DQ  +  L  N T+ +N+ D+NDN P F+ +++   + EN+P+ +TV M+      D D G+N  V   I  + N    + F+ID +SG I S    D E+   +   + A D  +   SST  +++HV+D NDN+PI   P     Y F V   +P  T + ++   D D     ++   +H    N + + H+D   G +  + P+
Sbjct:  449 ETLDYETK-NEYVVQIKAADAGATSLSRTMSVTIKLLDSNDNAPVFTE------PTYKVSVPENNVIGKHLITVSATDRD---MDKNAEMV-YFLGPDAPTMFHMDP----ETGIISLTEQLDREKKAN--YSFTILAKDQ-GIPVLEGNATVIVNVLDVNDNRPRFSLAEFDFYVNENVPKHSTVGMV---TVADSDEGENGRVRLSILGTDNR---QLFSIDPESGMIRSNVGFDREQRHYYVLEVQATDGGEPVRSSTVKVVIHVMDINDNSPIVLMPPSNTTYKFVVPRTLP-GTIVTEVSAVDNDAEINAEL--RYHIVGGNPHNLFHIDPVIGNITLMEPL 768          
BLAST of Protocadherin Fat 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008517.1 (pep scaffold:Pmarinus_7.0:GL476786:43429:129410:1 gene:ENSPMAG00000007697.1 transcript:ENSPMAT00000008517.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 158.688 bits (400), Expect = 2.300e-39
Identity = 157/603 (26.04%), Postives = 260/603 (43.12%), Query Frame = 2
Query:  440 ILIKVLDENDNSPKFLPFLNPYQTLPENSQINTVILLPSAIDLDSEAFGIKY--YKISKPFLIGNDSHFTLLDKIASGRP--QLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKLVNVISFYVTDLDEGQNKQVSITIETENDYKKDQIKRF---FQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITAINE-----IHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDK--LTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKY-FHKSYTNNY-QVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIF 2200
            + + V D NDN+P F           E++ +   +LL +A+D D    G+ +  YKI    + GN+    +  +  + R    L    PLDRE    Y   ++A D      R    ++V + V D NDNPP F+K  Y A++ E S +   +                          +D + R      + F P   TG +     +D+E    +Y+ +L A D G P LS  A   I L++ ND  P I+ +      +RS ++ E+    T+ A + V+D DS   + E S+        I   NE     +H  G     ++     LDRE  +     + I  SD  K      T +L +++N  D+ND+ P F  S Y   L E  P  +   ++ +  +D D G NA + Y I S     D  +F++D  +G +++   +D E       NI A D+     ++   + V ++D ND  P+F +  Y  T  EN      +  +   D D   EN  V+Y F       Y ++  +D  +GK+ T+  +DRE++    +++ A++  S      + S   V + + D+NDN P+F
Sbjct:    9 VRVVVGDVNDNAPSFPEPGVMEVAFKEDAAVGRQVLLDTAVDRDVGPNGVNHHAYKI----VSGNEEGRLVPPRPVTKRAFLHLATTGPLDREANPSYALAVQAED--GGSPRRYGRLQVNVTVQDANDNPPAFEKPAYRASVAEDSPVGAAL--------------------------RDLLHRGRGPLAVPFDPK--TGMVSTRQPLDFEAR-RQYTLSLRAADGGNPPLSGRATAVIQLLDVNDNDPAIRFVYL-PPAARSASVDESAAPGTVAALVTVTDADSPTANGELSV-------SIVGGNERGHFVLHAPGVPGLRVLKVASQLDRE--RIPMYNLTILASDNGKPVARSATASLVVYVN--DVNDHAPRFALSAYAAALSEGAPAGS--YVKDVTAMDADSGLNAKLRYSIVSGN---DLGWFSVDESTGLVTTDGKVDREVASSVVLNISAQDQGAQPKTAYTSLTVTLLDVNDEPPLFTQTKYVATAVENSLPGLFVVSVSAADSDLG-ENGTVRYNFDPDMPAQYREMFRLDSLTGKVTTLKSLDREELEEYPLVVQAQDRGSPP----LGSTAKVTVVVGDLNDNHPVF 554          

HSP 2 Score: 152.91 bits (385), Expect = 1.200e-37
Identity = 181/716 (25.28%), Postives = 314/716 (43.85%), Query Frame = 2
Query:  428 SSFYILIKVLDENDNSPKFLPFLNPYQTLPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTL--LDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEH---SKLVNVISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITAINEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEK------NKLFSFNIIAIDKDQSN-LSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIFSLINPAKSSLIFTINKGFRHENCQMIPYAVSDADHDEPNSDSCCILQLDNDQNGMLYLLSNTPNFLCLQNTMNTPGIYRVSLTATDNKNNPNKSLKAKVSFNIDVRHEVSDNP 2539
            S+  + + V D NDN P F P +  + ++ EN    T +   +A D D  A G   Y+++     G+ + F +  +    S R  L      DRE  + Y+  + A+D      R  S   V I V D  D PP F +  Y+  + E+     LV  +S    DL    N  V+  I        DQ +  F I++S     G I   + ID E   + Y   ++A   G+   +  A V++++ + N+ APV       +  S  +++ E+EP  +   S++ +D+DS          +  + +EI   N     G + +  +     LDRE  +   L ++   +    + PL++++T+++ + D+NDN P+F  S Y     E   Q    ++  +   D D G N  VTY  +  + +     F +D+++G+I+S +  D E          FSF+++A D  +   L   A + V V D NDN P F K  Y  +V E+    T++ ++  +D+D    N  ++Y   +  N      VD ++G++  +G +DRE+  S T++++A +  +    + + + C V + + D NDNPP F+       SL+             +I    SD D   P+ D    +   N         S    FL  +    T  +YR++++A D    P  S    V   + VR + +DNP
Sbjct:  536 STAKVTVVVGDLNDNHPVFYP-VQYFASILENEPGGTAVTTVTATDPDRGANGTVRYQLTA----GDAARFQVNAVTGAVSTRVSL------DREERAVYQLQVTALD--GGHLRARSPAIVTITVADAQDTPPTFARDDYSFVVFENVAPGTLVGSVSASTLDL----NANVTYLI-----VSGDQ-RGSFSIEWS----GGRIFTANAIDREEQAF-YQLRVVANSGGV---AGEASVSVLVHDVNNHAPVF------DRASYEVSIAEDEPVNSRFFSVRATDKDSG--------KNGEVKYEIGEGNGGEKFGIFPDGQLYVRYELDRETREEYSLTVSAMDT---GVEPLSSSVTVNVTVLDVNDNKPLFNSSSYVFHFCEE--QEVGSLVGAVQATDADAGSNGGVTYSFEKPQVN-----FELDSETGRIASLRVFDREALIRQGGAASFSFSVVATDGGRPKPLQDRATVQVFVQDVNDNPPQFAKSVYQASVSESASNLTQLLRVTASDVD-EGVNGALRY-AINEGNEGGKFTVDASTGQITLLGSLDREETASYTLVVSATDSGT----SPLAASCTVAVQVLDENDNPPRFT------ESLLSVDALESTRVGELLITLTASDEDTG-PSGDVRYAIVAGNTHATFAIDRSTGSVFLARRLDFETQRLYRLNVSAEDGGRPPRSSATILV---VHVR-DFNDNP 1179          

HSP 3 Score: 149.828 bits (377), Expect = 1.004e-36
Identity = 159/616 (25.81%), Postives = 275/616 (44.64%), Query Frame = 2
Query:  425 ISSF-YILIKVLDENDNSPKF-LPFLNPYQTLPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHS----KLVNVI--SFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEIT-AINEIHPLGHYK---EFIINTLKPLDREDDKNQYLKINIYCSDQDKLTP--LTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDS------SKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSY--TNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIFSL 2206
            +SSF  + I V D NDN P F +P +     + EN+    VI   SA D D     +  Y +    L G++  F +    ASG   L     LDRE  + Y   ++A D  +      +   + + V D NDN P F +  Y+ ++ E +    K    +  +    D D G   +V+  +    D   D     F +      +TG++ +   +D E+    Y     ATD G   L++TA++ + +++ ND AP ++        S +  + E+ P  T +  +  +D            DD  +N E+  +I+   P G +    +  ++  + LDRE  +  +  + +  SD+ +  P  L++ + + + L D+NDN P FT S       E+ P   V  +  +  +D D G+N+YV Y + +               F ++  +G++   + +D E  + ++  ++A+DK +  L+STA + V V DANDNAP FP+  Y   + E+ P  TE+ ++   D D    N  ++Y   S   T +++   +D   G L    P+DRE+  S  + + AR+       +       V +T+ DVND  P F L
Sbjct: 1496 MSSFNQVEISVEDVNDNPPVFAVPEME--LEVEENTGEGEVIFTLSATDADQGQNALVTYSV----LSGSEGAFVV--DAASG--VLRASRRLDREERASYLLTVRASDGTH-----ATDARLSVAVRDANDNSPRFSRHAYSFDVAEDAAPDGKTTRAVIGTVLAGDADSGPFGEVTYALAPSED--SDWADGAFGL----HPVTGALNVTRPLDRESRAC-YVLRARATDGG--GLAATARLYVNVLDANDNAPSVQND------SLAAEVPEDAPPGTSLLRISATD------------DDEGVNAELEFSISSGDPEGRFAVGNDGQLSVARALDRE--RQSFYNLVVRVSDRARHPPARLSSAVRVSLILTDVNDNAPAFT-SPRSALAPEDSPVGAV--VATVQAVDPDSGRNSYVEYALATDGEEGGGGAGAGPGPFALNTVTGEVRLVRELDREARQSYALTVLAVDKGRPPLTSTATLAVTVGDANDNAPRFPRREYEAAIAEDEPPGTEVLRLSAWDPD-EGANGELRYDIASGDPTGDFR---LDPVLGTLAVARPLDRERTASYELAVRARDGGGPARSDT----ASVRVTLSDVNDCSPAFQL 2056          

HSP 4 Score: 149.058 bits (375), Expect = 1.748e-36
Identity = 156/601 (25.96%), Postives = 257/601 (42.76%), Query Frame = 2
Query:  443 LIKVLDENDNSPK----FLPFLNPYQTLPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGND-SHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKLVNVIS-FYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITAINEIHPLGHYKEFI--------INTLKPLDREDDKNQYLKINIYCSDQDKLTP-LTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIF 2200
            +I++LD NDN P     +LP      ++ E++   TV  L +  D DS        ++S   + GN+  HF L      G   L + S LDRE I  Y   + A D      R  +   V + V D+ND+ P F  + Y A + E +   + +      D D G N ++  +I + ND        +F +D S  L+T   ++  E+           N+ A D G    ++   + + L++ ND+ P+    +         T  EN      V S+  +D D      E     Y+ + ++ A         Y+E          + TLK LDRE+ +   L +      QD+ +P L +   + + + D+NDN PVF   +Y   ++EN P  T          D D G N  V Y++     + D   F ++A +G +S+R S+D E+  ++   + A+D       S A++ + V DA D  P F +  YSF V ENV   T +G +  + LD    N  V Y   S  +      ++ + G++ T   IDRE+     + + A       N   +  E  V + + DVN++ P+F
Sbjct:  212 VIQLLDVNDNDPAIRFVYLPPAARSASVDESAAPGTVAALVTVTDADSP---TANGELSVSIVGGNERGHFVLHAPGVPGLRVLKVASQLDRERIPMYNLTILASDNGKPVARSATASLV-VYVNDVNDHAPRFALSAYAAALSEGAPAGSYVKDVTAMDADSGLNAKLRYSIVSGNDLG------WFSVDESTGLVTTDGKVDREV-----ASSVVLNISAQDQGAQPKTAYTSLTVTLLDVNDEPPLFTQTKY------VATAVENSLPGLFVVSVSAADSDLG----ENGTVRYNFDPDMPA--------QYREMFRLDSLTGKVTTLKSLDREELEEYPLVVQA----QDRGSPPLGSTAKVTVVVGDLNDNHPVFYPVQYFASILENEPGGTAVTTV--TATDPDRGANGTVRYQL----TAGDAARFQVNAVTGAVSTRVSLDREERAVYQLQVTALDGGHLRARSPAIVTITVADAQDTPPTFARDDYSFVVFENVAPGTLVGSVSASTLDL---NANVTYLIVS-GDQRGSFSIEWSGGRIFTANAIDREEQAFYQLRVVA-------NSGGVAGEASVSVLVHDVNNHAPVF 758          

HSP 5 Score: 142.895 bits (359), Expect = 1.521e-34
Identity = 189/735 (25.71%), Postives = 307/735 (41.77%), Query Frame = 2
Query:  410 DSGIKISSFY--ILIKVLDENDNSPKFLPFLNPYQTLPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHS-KLVNVISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSR---SITMFENEPARTIVASLQVS--DRDSLVTDIECSLDDYHLNFEITAINEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASY----------QNKNLMDSECMVIITIEDVNDNPPIFSLINPAKSSLIFTINKGFRHENCQMIPYAVSDADHDEPNSDSCCILQLDNDQNGMLYLLSNTPNFLCLQNTMNT--PGIYRVSLTATDNKNNPNKSLKAKVSFNIDVRHEVSDNP--FSE 2548
            D G +  + Y  + + +LD ND  P F        T  ENS     ++  SA D D    G   Y    P +         LD +     ++  +  LDRE + EY  +++A DR +      S  +V + VGD+NDN PVF    Y A+I+E+      V +   TD D G N  V   + T  D  +      FQ++     +TG++     +D E     Y   + A D G  R  S A V I + +  D  P           +R   S  +FEN    T+V S+  S  D ++ VT +  S  D   +F I           +    I T   +DRE+    + ++ +  +        + ++ +H    D+N++ PVF R+ Y+  + E+ P  +      +   DKD GKN  V Y+I         E F I  D G++  R  +D E  + +S  + A+D     LSS+  + V V+D NDN P+F    Y F   E   V + +G ++ TD D      +   F K   N      +D  +G++ ++   DRE       LI     AS+          + K L D    V + ++DVNDNPP F     AKS    ++++   +   Q++    SD D      +      ++    G  + +  +   + L  +++      Y + ++ATD+  +P   L A  +  + V  E +DNP  F+E
Sbjct:  420 DQGAQPKTAYTSLTVTLLDVNDEPPLFTQ-TKYVATAVENSLPGLFVVSVSAADSDLGENGTVRYNF-DPDMPAQYREMFRLDSLTG---KVTTLKSLDREELEEYPLVVQAQDRGSPPLG--STAKVTVVVGDLNDNHPVFYPVQYFASILENEPGGTAVTTVTATDPDRGANGTVRYQL-TAGDAAR------FQVN----AVTGAVSTRVSLDREERAV-YQLQVTALDGGHLRARSPAIVTITVADAQDTPPTF---------ARDDYSFVVFENVAPGTLVGSVSASTLDLNANVTYLIVS-GDQRGSFSI----------EWSGGRIFTANAIDREE--QAFYQLRVVANSGGVAGEASVSVLVH----DVNNHAPVFDRASYEVSIAEDEPVNS--RFFSVRATDKDSGKNGEVKYEIGEGNGG---EKFGIFPD-GQLYVRYELDRETREEYSLTVSAMDTGVEPLSSSVTVNVTVLDVNDNKPLFNSSSYVFHFCEEQEVGSLVGAVQATDADAGSNGGVTYSFEKPQVN----FELDSETGRIASLRVFDREA------LIRQGGAASFSFSVVATDGGRPKPLQD-RATVQVFVQDVNDNPPQF-----AKSVYQASVSESASNL-TQLLRVTASDVDE---GVNGALRYAINEGNEGGKFTVDASTGQITLLGSLDREETASYTLVVSATDSGTSP---LAASCTVAVQVLDE-NDNPPRFTE 1079          

HSP 6 Score: 141.739 bits (356), Expect = 3.565e-34
Identity = 158/619 (25.53%), Postives = 271/619 (43.78%), Query Frame = 2
Query:  407 VDSGIKISSFYILIKVLDENDNSPKFLPFLNPYQ-TLPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSH-FTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKLVNVI-SFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDE--IDYETNPYKYSFNLIATDNGLPR-LSSTAKVNIILINKNDQAP-VIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEIT-AINEIHPLGHY----KEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTL---DKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNY---QVIHVDQNSGKLKTIGPIDREKVRS---ITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIF 2200
             +SG       + + V D N+++P F      Y+ ++ E+  +N+      A D DS   G   Y+I +    GN    F +         QL +   LDRE   EY   + A+D   +     S V V + V D+NDN P+F+ + Y  +  E  ++ +++ +   TD D G N  V+ + E      K Q+   F++D S +    S+R+ D   +  +     +SF+++ATD G P+ L   A V + + + ND  P   K + +  +         +E A  +   L+V+  D           D  +N  +  AINE +  G +        I  L  LDRE+  +  L   +  +     +PL  + T+ + + D NDNPP FT S    + +E     + ++ E ++TL   D+D G +  V Y I +         F ID  +G +   + +D+E  +L+  N+ A D  +   SS  +++VHV D NDN P F       ++ EN+P+ T +  +   D    P+  +    H S    +       +D  SG++ T   IDRE       +T+  T +    +  ++ + +   V + + D NDN P F
Sbjct:  733 ANSGGVAGEASVSVLVHDVNNHAPVF--DRASYEVSIAEDEPVNSRFFSVRATDKDSGKNGEVKYEIGE----GNGGEKFGIFPD-----GQLYVRYELDRETREEYSLTVSAMDTGVEPLS--SSVTVNVTVLDVNDNKPLFNSSSYVFHFCEEQEVGSLVGAVQATDADAGSNGGVTYSFE------KPQVN--FELD-SETGRIASLRVFDREALIRQGGAASFSFSVVATDGGRPKPLQDRATVQVFVQDVNDNPPQFAKSVYQASV---------SESASNLTQLLRVTASDV----------DEGVNGALRYAINEGNEGGKFTVDASTGQITLLGSLDREETASYTL---VVSATDSGTSPLAASCTVAVQVLDENDNPPRFTESLLSVDALE-----STRVGELLITLTASDEDTGPSGDVRYAIVAGNTHA---TFAIDRSTGSVFLARRLDFETQRLYRLNVSAEDGGRPPRSSATILVVHVRDFNDNPPAFLPGDVFASIMENIPIGTRVITVTARD----PDADVNGELHYSIARQFPPGAHFTIDPESGEICTAAEIDREVTGGLFEVTVRATDKAIPVHTRRSALKN---VTVLVTDENDNAPRF 1292          

HSP 7 Score: 133.265 bits (334), Expect = 1.265e-31
Identity = 143/528 (27.08%), Postives = 242/528 (45.83%), Query Frame = 2
Query:  671 PQLLLIS---PLDREVISEYRFILKAVDRENDDHRDISG-VEVEIKVGDINDNPPVFDKTFY-----TANIVEHSKLVNVISFY-VTDLDE-GQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLP-RLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITAINEIHPLGHYK----EFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIEN-IPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIFS 2203
            P+  ++S   PLD E   +Y   L+A D  N     +SG     I++ D+NDN P     +      +A++ E +    V +   VTD D    N ++S++I   N+    +          P L    +++  ++D E  P  Y+  ++A+DNG P   S+TA + + + + ND AP      +  + + +  + E  PA + V  +   D DS +        +  L + I + N+   LG +       ++ T   +DRE   +  L  NI   DQ    P T   ++ + L D+ND PP+FT++KY    +EN +P   V  +      D D G+N  V Y  D    +   E F +D+ +GK+++ +S+D E+ + +   + A D+    L STA + V V D NDN P+F    Y  ++ EN P  T +  +  TD D R  N  V+Y  +    +     V+  +G + T   +DRE+     + +TA +    + +    S  +V IT+ D  D PP F+
Sbjct:  172 PKTGMVSTRQPLDFEARRQYTLSLRAADGGNPP---LSGRATAVIQLLDVNDNDPAIRFVYLPPAARSASVDESAAPGTVAALVTVTDADSPTANGELSVSIVGGNE----RGHFVLHAPGVPGLRV--LKVASQLDRERIPM-YNLTILASDNGKPVARSATASLVVYVNDVNDHAP------RFALSAYAAALSEGAPAGSYVKDVTAMDADSGL--------NAKLRYSIVSGND---LGWFSVDESTGLVTTDGKVDREVASSVVL--NISAQDQGA-QPKTAYTSLTVTLLDVNDEPPLFTQTKYVATAVENSLPGLFVVSVS---AADSDLGENGTVRYNFDPDMPAQYREMFRLDSLTGKVTTLKSLDREELEEYPLVVQAQDRGSPPLGSTAKVTVVVGDLNDNHPVFYPVQYFASILENEPGGTAVTTVTATDPD-RGANGTVRY--QLTAGDAARFQVNAVTGAVSTRVSLDREERAVYQLQVTALDGGHLRAR----SPAIVTITVADAQDTPPTFA 659          

HSP 8 Score: 130.568 bits (327), Expect = 8.791e-31
Identity = 151/591 (25.55%), Postives = 258/591 (43.65%), Query Frame = 2
Query:  440 ILIKVLDENDNSPKFLPFLNPY---QTLPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHS-KLVNVISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITAINEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIF 2200
            +++ V D ND++P+F          +  P  S +  V    +A+D DS       Y I    + GND  +  +D+       +     +DREV S     + A D+        + + V +   D+ND PP+F +T Y A  VE+S   + V+S    D D G+N  V    + +      Q +  F++D     +TG +  +  +D E    +Y   + A D G P L STAKV +++ + ND  PV   ++         ++ ENEP  T V ++  +D D              + +++TA +      +     ++T   LDRE+      ++ +   D   L   +  + + I + D  D PP F R  Y   + EN+   T+       TLD     NA VTY I S         F+I+   G+I +  +ID E+   +   ++A   +   ++  A + V V D N++AP+F +  Y  ++ E+ PVN+    +  TD D+  +N  VKY      N  +   +  + G+L     +DRE     ++ ++A +         + S   V +T+ DVNDN P+F
Sbjct:  327 LVVYVNDVNDHAPRFALSAYAAALSEGAPAGSYVKDV----TAMDADSGLNAKLRYSI----VSGNDLGWFSVDESTG---LVTTDGKVDREVASSVVLNISAQDQGAQPKTAYTSLTVTLL--DVNDEPPLFTQTKYVATAVENSLPGLFVVSVSAADSDLGENGTVRYNFDPD---MPAQYREMFRLDS----LTGKVTTLKSLDRE-ELEEYPLVVQAQDRGSPPLGSTAKVTVVVGDLNDNHPVFYPVQY------FASILENEPGGTAVTTVTATDPDRGANGT--------VRYQLTAGDAARFQVNAVTGAVSTRVSLDREE--RAVYQLQVTALDGGHLRARSPAI-VTITVADAQDTPPTFARDDYSFVVFENVAPGTLVGSVSASTLDL----NANVTYLIVSGDQRGS---FSIEWSGGRIFTANAIDREEQAFYQLRVVA---NSGGVAGEASVSVLVHDVNNHAPVFDRASYEVSIAEDEPVNSRFFSVRATDKDSG-KNGEVKY-EIGEGNGGEKFGIFPD-GQLYVRYELDRETREEYSLTVSAMD----TGVEPLSSSVTVNVTVLDVNDNKPLF 862          

HSP 9 Score: 118.242 bits (295), Expect = 5.825e-27
Identity = 135/531 (25.42%), Postives = 213/531 (40.11%), Query Frame = 2
Query:  371 KYDECCTVFSFQVDSGIKISSFYILIKVLDENDNSPKF----LPFLNPYQTLPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIASGRP---QLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSK-LVNVISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGL---PRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDS---------LVTDIECSLDDYHLNFEITAINEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVREN 1903
            + +    + + +   G   +   + + V D NDNSP+F      F       P+      VI    A D DS  FG   Y ++       DS +   D      P    L +  PLDRE  S   ++L+A  R  D     +   + + V D NDN P        A + E +    +++    TD DEG N ++  +I +      D   RF   +       G + +   +D E   + Y+  +  +D       RLSS  +V++IL + ND AP            RS    E+ P   +VA++Q  D DS         L TD E             A+N +   G      +  ++ LDRE    Q   + +   D+ +  PLT+  T+ + + D NDN P F R +Y+  + E+ P  T   +  +   D D G N  + Y I S   + D   F +D   G ++  + +D E+   +   + A D      S TA + V + D ND +P F    Y+   REN
Sbjct: 1580 REERASYLLTVRASDGTHATDARLSVAVRDANDNSPRFSRHAYSFDVAEDAAPDGKTTRAVIGTVLAGDADSGPFGEVTYALAP----SEDSDWA--DGAFGLHPVTGALNVTRPLDRE--SRACYVLRA--RATDGGGLAATARLYVNVLDANDNAPSVQNDSLAAEVPEDAPPGTSLLRISATDDDEGVNAELEFSISS-----GDPEGRFAVGN------DGQLSVARALDRERQSF-YNLVVRVSDRARHPPARLSSAVRVSLILTDVNDNAPAFTS-------PRSALAPEDSPVGAVVATVQAVDPDSGRNSYVEYALATDGEEGGGGAGAGPGPFALNTV--TGE-----VRLVRELDRE--ARQSYALTVLAVDKGR-PPLTSTATLAVTVGDANDNAPRFPRREYEAAIAEDEPPGT--EVLRLSAWDPDEGANGELRYDIASGDPTGD---FRLDPVLGTLAVARPLDRERTASYELAVRARDGGGPARSDTASVRVTLSDVNDCSPAFQLSPYTVHAREN 2066          

HSP 10 Score: 108.997 bits (271), Expect = 3.863e-24
Identity = 125/481 (25.99%), Postives = 204/481 (42.41%), Query Frame = 2
Query:  383 CCTVFSFQVDSGIKISSFYILIKVLDENDNSPKFLPFLNPYQTLPENSQINTVILLPSAIDLDSEA-----FGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDR-ENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKLVNVIS-FYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITAINEIHPLGHYK-EFIINTL---KPLDREDDKNQYLKINIYCSDQDKLTPLTTN-LTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAID 1789
            C  + +   D G   ++  + + VLD NDN+P  +   +    +PE++   T +L  SA D D        F I        F +GND              QL +   LDRE  S Y  +++  DR  +   R  S V V + + D+NDN P F  +  +A   E S +  V++     D D G+N  V   + T+ +             F+ + +TG +RL+ E+D E     Y+  ++A D G P L+STA + + + + ND AP  +  R+         + E+EP  T V  L   D D           +  L ++I + +   P G ++ + ++ TL   +PLDRE   +  L +      +D   P  ++  ++ + L D+ND  P F  S Y     EN  Q    +I  ++  D D G +  VTY      +      F++  D G +   +S+D E        I A D
Sbjct: 1696 CYVLRARATDGGGLAATARLYVNVLDANDNAPS-VQNDSLAAEVPEDAPPGTSLLRISATDDDEGVNAELEFSISSGDPEGRFAVGNDG-------------QLSVARALDRERQSFYNLVVRVSDRARHPPARLSSAVRVSLILTDVNDNAPAF-TSPRSALAPEDSPVGAVVATVQAVDPDSGRNSYVEYALATDGEEGGGGAGAGPGP-FALNTVTGEVRLVRELDREAR-QSYALTVLAVDKGRPPLTSTATLAVTVGDANDNAP--RFPRR----EYEAAIAEDEPPGTEVLRLSAWDPDEGA--------NGELRYDIASGD---PTGDFRLDPVLGTLAVARPLDRERTASYELAVRA----RDGGGPARSDTASVRVTLSDVNDCSPAFQLSPYTVHARENT-QGPPVLILQVVARDDDLGSSGQVTYAAAGGNDGG---AFSVSPD-GHVHLLRSLDREAQPQHVLIITATD 2133          

HSP 11 Score: 90.8929 bits (224), Expect = 1.339e-18
Identity = 70/251 (27.89%), Postives = 117/251 (46.61%), Query Frame = 2
Query: 1472 PLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTL---DKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTE-----IGQIETTDLDTRPENKIVKYFHKSYTNNYQ--VIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPP 2194
            P+++   + I++ D+NDNPPVF   + + E+ EN  +  V     I TL   D D G+NA VTY + S         F +DA SG + + + +D E+   +   + A D      ++ A + V V DANDN+P F +  YSF V E+   + +     IG +   D D+ P  ++      S  +++      +   +G L    P+DRE  R+  +L      A   +   + +   + + + D NDN P
Sbjct: 1495 PMSSFNQVEISVEDVNDNPPVFAVPEMELEVEENTGEGEV-----IFTLSATDADQGQNALVTYSVLSGSEGA----FVVDAASGVLRASRRLDREERASYLLTVRASDGTH---ATDARLSVAVRDANDNSPRFSRHAYSFDVAEDAAPDGKTTRAVIGTVLAGDADSGPFGEVTYALAPSEDSDWADGAFGLHPVTGALNVTRPLDRES-RACYVL-----RARATDGGGLAATARLYVNVLDANDNAP 1727          

HSP 12 Score: 87.0409 bits (214), Expect = 1.695e-17
Identity = 157/631 (24.88%), Postives = 252/631 (39.94%), Query Frame = 2
Query:  410 DSGIK--ISSFYILIKVLDENDNSPKFLPFLNPYQTLPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKL-VNVISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLP---RLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITAINEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNL--TIHINLFDINDNPPVFTRSKYQGELIENIPQA-TVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWE------YFT----IDADSGKISS-----RQSIDYEKNKLFSF--NIIAIDKDQSN-------LSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIFS 2203
            DSG     +S  + ++VLDENDN P+F   L     L E++++  +++  +A D D+   G   Y I     +  ++H T     ++G   + L   LD E    YR  + A D         + + V ++  D NDNPP F      A+I+E+  +   VI+    D D   N ++  +I      ++      F ID      +G I    EID E     +   + ATD  +P   R S+   V +++ ++ND AP  + +    I+   +       A ++V +LQ SD D    + E +   Y +     AI  +  L   +  II T   LDRE     +  + +   +     P T     TI  N    N   P F +  Y+  +  N+ Q  T+ M    L L                 ++  DWE      +FT    +    G I+      R S D     +F    ++++  +D          +SS   + + V D NDN P+F  P     V EN      I  +  TD D + +N +V Y   S +    V  VD  SG L+    +DRE+  S  + + A +     +  L        + + D NDN P FS
Sbjct: 1051 DSGTSPLAASCTVAVQVLDENDNPPRFTESLLSVDAL-ESTRVGELLITLTASDEDTGPSGDVRYAI-----VAGNTHATFAIDRSTG--SVFLARRLDFETQRLYRLNVSAEDGGRPPRSSATILVVHVR--DFNDNPPAFLPGDVFASIMENIPIGTRVITVTARDPDADVNGELHYSIA-----RQFPPGAHFTIDPE----SGEICTAAEIDREVTGGLFEVTVRATDKAIPVHTRRSALKNVTVLVTDENDNAP--RFVTPTAILVDGL----RAAAGSVVGTLQASDPD----EAENAAVRYAVTGGDAAI--LFRL-DRRTGIIETSTELDRESGHGAF-TLEVVAVEAKAAAPRTQRAENTIIANSMTFNHPLPRFPQ-DYESPI--NLLQGQTIPMPSSYLFL-----------------RHHLDWEPEGQLVFFTLLLGVTRGHGVINPLDAPWRVSFDLTARCMFIVFSSLLSSLRDNGAGSFIRPPMSSFNQVEISVEDVNDNPPVFAVPEMELEVEENTGEGEVIFTLSATDAD-QGQNALVTYSVLSGSEGAFV--VDAASGVLRASRRLDREERASYLLTVRASDGTHATDARLS-------VAVRDANDNSPRFS 1618          

HSP 13 Score: 55.8398 bits (133), Expect = 6.607e-8
Identity = 77/353 (21.81%), Postives = 132/353 (37.39%), Query Frame = 2
Query: 1493 IHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNA--YVTYKIDSS---------KNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPI--FSLINPAKSSLIFTINKGFRHENCQMIPYAVSDADHDEPNSDSCCILQLDNDQNGMLYLLSNTPNFLCLQ-----NTMNTPGIYRVSLTATDNKNNPNKSLKAKV 2497
            + + + D+NDN P F       E+      A  + +     +D+D G N   +  YKI S          +  T   +         +++   +D E N  ++  + A D           + V V DANDN P F KP Y  +V E+ PV   +      DL  R    +   F             D  +G + T  P+D E  R  T+ + A +  +      +      +I + DVNDN P   F  + PA  S   ++++         +   V+DAD    N +    +   N++   +      P    L+     +    P +Y +++ A+DN     +S  A +
Sbjct:    9 VRVVVGDVNDNAPSFPEPGVM-EVAFKEDAAVGRQVLLDTAVDRDVGPNGVNHHAYKIVSGNEEGRLVPPRPVTKRAFL-------HLATTGPLDREANPSYALAVQAEDGGSPRRYGRLQVNVTVQDANDNPPAFEKPAYRASVAEDSPVGAAL-----RDLLHRGRGPLAVPF-------------DPKTGMVSTRQPLDFEARRQYTLSLRAADGGNPP----LSGRATAVIQLLDVNDNDPAIRFVYLPPAARSA--SVDESAAPGTVAAL-VTVTDADSPTANGELSVSIVGGNERGHFVLHAPGVPGLRVLKVASQLDRERIP-MYNLTILASDNGKPVARSATASL 327          
BLAST of Protocadherin Fat 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009557.1 (pep scaffold:Pmarinus_7.0:GL476748:59426:101420:1 gene:ENSPMAG00000008644.1 transcript:ENSPMAT00000009557.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 150.214 bits (378), Expect = 8.630e-37
Identity = 144/568 (25.35%), Postives = 241/568 (42.43%), Query Frame = 2
Query:  629 DSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEH-SKLVNVISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLP-RLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITAINEIHPLGHYKEF------------IINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSR-----------------------------QSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKP-HYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIF 2200
            D  F +L +  +GR  L +   LD E +  YRF +KA  R  D+   ++ V V + VGD+NDN PVF+ + Y   ++E+    V V+    TD D G N Q++ ++  E   +    +  F +D      +G +R +  +D E     +   ++ATD G P RLS+TA V + + + ND  P  + +R     S +  + E+     +VA +   D D+   + + +   Y+L        E    GH +              ++  L P  RE +      I +   D  +  PL T   + + + D NDN P F   + Q + +        + +  +   D DHG NA ++Y ID    +     F ID   G IS+R                             Q +D E+   +   + A D       S A++ V V+DANDN+P+  K   Y+  V E+V     +  +   D D      I    H     +++   +D  +G+L T+ P+DRE V +  + + A +            +  +++++EDVNDN P F
Sbjct: 1211 DDTFVVLSQ--TGR--LKVAKALDHETVRSYRFGVKATFRR-DEVDVVAQVLVTVHVGDVNDNRPVFESSVYEGVVMENLPAGVPVVQVRATDRDGGANGQLAYSLAEEAGGEGGAARDLFSVDAE----SGWVRTLRPLDREARA-GHELAVVATDLGDPARLSATASVRVAVADANDCPP--RFLRG----SYAGDVPEDSAPGQVVAVVGADDADATPDNGQLT---YYLTGAPRVAAEDALPGHGEHVLRESRTVAISVELLTILPPTVRETESACQFNIGVSIVDGGE-PPLQTTARVVVRVSDENDNAPQFVEKRVQVKALARERSVAREAVCRVYARDADHGANAELSYSIDGGNEAGK---FFIDPKDGVISTRNPCPVGTNDFLTVPCDIYVVVGEWKLHLKQPVDREERDRYQIEVTATD---GAFVSKAVVDVAVLDANDNSPVCDKGLLYAVAVAEDVAPGIFLLLVSARDADIGANAAIQYTLHGPGAEHFR---MDSATGELFTLAPLDREAVPAYALSVRATDGGGRS------CQAEILVSLEDVNDNAPQF 1743          

HSP 2 Score: 120.553 bits (301), Expect = 1.023e-27
Identity = 153/611 (25.04%), Postives = 253/611 (41.41%), Query Frame = 2
Query:  446 IKVLDENDNSPKFLPFLNPYQT-LPENSQINTVILLPSAIDLDSEAFGIKYYKI-------SKPFLIGNDSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKLVNVIS-FYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITAINEIHPLGHYKEFIIN----------------TLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNL-MDSECMVIITIEDVNDNPPIF 2200
            I V D NDN P F    + Y T L E + I   +L  SA D D  +    YY+I       S+ F I + S   L  +             LD E    + F+++A D  +      S V V I V DINDNPPVF++  Y A + E +   + ++    +D D     ++  +I + ND+        F +D    +++     I  +  +T   +Y  N+  +D      +STA+V++ + + N  +P+     + E V     + EN    T++  +Q +D+D                          PLGH    I+N                T +PLDRED   +   INI   D       TT   + +   D NDN P F  ++Y G ++    + T   I  +L  D D G NA + Y +   ++    +   +   +G + +++S+   +    SF + A DK      S   + V V+ A+   P F +  Y+ TV E+  V +EIG       D+      V     +  N      V   +G+LK    +D E VRS    +    +A+++   + + ++ +V + + DVNDN P+F
Sbjct:  732 ILVQDVNDNPPLFSQ--SAYATTLSEAALIGISVLQVSATDADIGSNKALYYQIINNGKNSSECFYIDSSSGLILTSRF------------LDYEQNQVHNFLVRASD--SGMPFLTSDVPVTITVTDINDNPPVFNQLLYEAFVSELAPRGHFVTRVQASDADASDTDKLEYSILSGNDHMN------FVVDGKSGIIS-----ISNLRKQTLAPQYRLNISVSDG---VFTSTAQVHVNIQSANLHSPIFG---QNEYVKE---IPENSEVGTLLTLVQATDKD------------------------WGPLGHVSYSIVNQFAGDRFTIDENGQIFTSEPLDREDPLERVFDINIMAKDGGGRVGFTT---VKVIATDENDNKPTFVTNEYFGNVLARAEKGTA--ILQVLATDPDEGSNADLVYTLYKGESDAVEDVLEVQPLTGHVVTKESLVGLEGSRMSFFVKAEDKGPERKHSVVPVSVSVLPADAELPAFTEAAYALTVAEDAEVGSEIGVARLAGNDS-ATYAAVPGGGGAENNADDTFVVLSQTGRLKVAKALDHETVRSYRFGV----KATFRRDEVDVVAQVLVTVHVGDVNDNRPVF 1272          

HSP 3 Score: 119.783 bits (299), Expect = 1.604e-27
Identity = 149/648 (22.99%), Postives = 267/648 (41.20%), Query Frame = 2
Query:  398 SFQVDSGIKISSFYILIKVLDENDNSPKFLPFLNPYQ-TLPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIA-SGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKLVNVISFYVTDLDEGQNKQVSIT--------IETEN---DYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVI---KVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITAINEIH-----------------PLGH-------------YKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSK-YQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIF 2200
            +F+ D    ++   + + V D NDN P F   +  Y+  + EN      ++   A D D  A G   Y +++       +   L    A SG  + L   PLDRE  + +   + A D   D  R  +   V + V D ND PP F +  Y  ++ E S    V++    D  +       +T        +  E+    + +  ++    +  S  L+T     + E +   +  +++  +   D G P L +TA+V + + ++ND AP     +V  K     RS+       AR  V  +   D D           +  L++ I   NE                   P+G                E+ ++  +P+DRE+ +++Y +I +  +D        +   + + + D NDN PV  +   Y   + E++      ++  +   D D G NA + Y +    +    E+F +D+ +G++ +   +D E    ++ ++ A D      S  A I+V + D NDNAP FP  HY+ +V E+  V T + +++ TD D     K+   F  S   ++    +D+ SG +    P+DRE      + + A +   ++    + S   V + + DVNDNPP F
Sbjct: 1244 TFRRDEVDVVAQVLVTVHVGDVNDNRPVFESSV--YEGVVMENLPAGVPVVQVRATDRDGGANGQLAYSLAEEAGGEGGAARDLFSVDAESGWVRTL--RPLDREARAGHELAVVATDL-GDPARLSATASVRVAVADANDCPPRFLRGSYAGDVPEDSAPGQVVAVVGADDADATPDNGQLTYYLTGAPRVAAEDALPGHGEHVLRESRTVAISVELLTILPPTVRETE---SACQFNIGVSIVDGGEPPLQTTARVVVRVSDENDNAPQFVEKRVQVKALARERSV-------AREAVCRVYARDADHGA--------NAELSYSIDGGNEAGKFFIDPKDGVISTRNPCPVGTNDFLTVPCDIYVVVGEWKLHLKQPVDREE-RDRY-QIEVTATDG----AFVSKAVVDVAVLDANDNSPVCDKGLLYAVAVAEDVAPGIFLLL--VSARDADIGANAAIQYTL----HGPGAEHFRMDSATGELFTLAPLDREAVPAYALSVRATDG--GGRSCQAEILVSLEDVNDNAPQFPASHYAVSVYESTAVETLLTRVQATDSDLGLNRKVTYSFLDSAGGHFA---IDERSGIISLKRPLDREHQAVYELTVRAEDGDVFRP---LTSTVGVSVAVLDVNDNPPAF 1848          

HSP 4 Score: 117.472 bits (293), Expect = 9.225e-27
Identity = 180/702 (25.64%), Postives = 303/702 (43.16%), Query Frame = 2
Query:  182 YDKHQRYKIYAVTEKASPFSLIDNRLSVV---SNIDRESICPIKNSLNDY---DQSAETYNSQQSSHSC-------KYDECCTVFSFQV---DSGI-KISS---FYILIKVLDENDNSPKFLPFLNPYQTLPENSQINTVILLP-SAIDLDSEA---FGIKYYKISKPFLIGNDSHFTLLDKIASGRPQL-LLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVF-DKTFYTANIVEHSKLVNVISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITAINEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKM-IEPILTLDKDHGKNAYVTYKI-DSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIFS 2203
            +D+ Q   + +   +A    L D  + +V   +++D E     +NSL  Y   +  A+TY S  SS           Y++    F FQV   DSG  K+S+     + I VLD ND+ P F   +  Y+T+      + V LL  SA D D++A   F I    +   F I   +    +      R +  L +   D + +S  + +                  V ++V D+NDN PVF +  +Y    V+ +    V +    D D G+N +VS +++ E++Y            F     +G + L      + +   ++ N++ATD+G+P LSS   + I +INK    P+ +        S+S+   EN    T + +LQ    + L      +  D    F I           +   ++N +  LD E       K+ +  +D    +    NL I +   D+NDNPP+F++S Y   L E    A + + +  +   D D G N  + Y+I ++ KNS+  E F ID+ SG I + + +DYE+N++ +F + A D     L+S   + + V D NDN P+F +  Y   V E  P    + +++ +D D    +K+ +Y   S  N++    VD  SG +          +R  T+    R   S  +  +  S   V + I+  N + PIF 
Sbjct:  327 FDRSQYRGVVSEEAQAQTVVLNDKNVPLVIRATDLDSE-----QNSLLVYQIVEHEAQTYFSIDSSTGAIKMIKVLDYEKTPE-FHFQVRVSDSGSPKLSAETPANVTITVLDANDSPPIFSRAV--YETVLLTPTYSGVRLLSMSATDPDTDASLTFSISTGNVGDKFAINARTGDISVQNATHLRSRYELAVKVFDGKFVSTAQAV------------------VAVRVEDVNDNAPVFVNLPYYAVVEVDAAPGSVVYTIAAFDRDVGRNGEVSYSLKEEHEY------------FDVEARSGDVSLRRSFTADMSSKDFTVNVVATDSGVPPLSSEVSLPITVINK--AMPIFER----PFYSKSVP--ENIKPHTPILNLQAKSPEGLPLIFSITDGDPFNQFSI----------DFNTGVVNVIGSLDHE--TQTTFKLTVRATDSVTGSHAEVNLDILVQ--DVNDNPPLFSQSAYATTLSE---AALIGISVLQVSATDADIGSNKALYYQIINNGKNSS--ECFYIDSSSGLILTSRFLDYEQNQVHNFLVRASDSGMPFLTSDVPVTITVTDINDNPPVFNQLLYEAFVSELAPRGHFVTRVQASDADASDTDKL-EYSILS-GNDHMNFVVDGKSGIISI------SNLRKQTLAPQYRLNISVSD-GVFTSTAQVHVNIQSANLHSPIFG 954          

HSP 5 Score: 114.39 bits (285), Expect = 8.976e-26
Identity = 131/504 (25.99%), Postives = 216/504 (42.86%), Query Frame = 2
Query:  785 VEIKVGDINDNPPVFDKTFYTANIVEHSKLVN-VISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPAR--TIVASLQVSDRDSLVTDIECSLDDYHLNFEITAINEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEP-----ILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSST--ALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIF--------SLINPAKSSLIFTI 2242
            V + V D ND+ P+F    Y   +VE + L + V+     D D G N +V+ +IE  N      +   F I   P++  G + +  E+D       Y   + A D G P  S+T  V + L+   D AP        +  S+  +   +E AR  + V  +  S R ++  +I         NFE T    ++P       +I T + LD E   +  LKI         +  L+TN ++ I+L D NDN PVF RS+Y+G + E     TV + +      I   D D  +N+ + Y+I   +  T   YF+ID+ +G I   + +DYEK   F F +   D     LS+   A + + V+DAND+ PIF +  Y   +         +  +  TD    P+      F  S  N      ++  +G +             + + +       +  K +  ++ +V + +EDVNDN P+F          ++ A  S+++TI
Sbjct:  108 VVVNVRDSNDHAPLFTSRHYEGRVVESAALGSAVLEVVALDRDRGPNAEVAYSIEAGNR----NVGNSFTI--HPTM--GILSVAKELDRAVVE-AYELVVRAVDRGEPPRSATTAVRV-LVTVADNAPP-------KFTSKDYSAEVSEGARPGSFVLMVTASSRSTVNYEIRDG------NFEDTFY--VNPTSG----VITTKELLDYERKPSYQLKIQ-----ATNMVGLSTNASVSIHLSDENDNAPVFDRSQYRGVVSEEAQAQTVVLNDKNVPLVIRATDLDSEQNSLLVYQIVEHEAQT---YFSIDSSTGAIKMIKVLDYEKTPEFHFQVRVSDSGSPKLSAETPANVTITVLDANDSPPIFSRAVYETVLLTPTYSGVRLLSMSATD----PDTDASLTFSISTGNVGDKFAINARTGDISVQNATHLRSRYELAVKV-------FDGKFVSTAQAVVAVRVEDVNDNAPVFVNLPYYAVVEVDAAPGSVVYTI 563          

HSP 6 Score: 105.916 bits (263), Expect = 3.407e-23
Identity = 148/599 (24.71%), Postives = 261/599 (43.57%), Query Frame = 2
Query:  440 ILIKVLDENDNSPKFLPFLNPYQ-TLPENSQINTVIL----LP---SAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFY-TANIVEHSKLVNVISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAK--VNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRD-SLVTDIECSLDDYHLNFEITAINEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIF 2200
            + I + DENDN+P F    + Y+  + E +Q  TV+L    +P    A DLDSE   +  Y+I +       ++F+    I S    + +I  LD E   E+ F ++  D  +      +   V I V D ND+PP+F +  Y T  +      V ++S   TD D   +  ++ +I T N   K          F+ +  TG I + +     +   +Y   +   D    +  STA+  V + + + ND APV        +   ++   +  P  ++V ++   DRD     ++  SL + H  F++ A +    L   + F           D  ++   +N+  +D   + PL++ +++ I +  IN   P+F R  Y   + ENI   T     PIL L     +   + + I    +   +  F+ID ++G ++   S+D+E    F   + A D    + +   L I+ V D NDN P+F +  Y+ T+ E   +   + Q+  TD D      +      +  N+ +  ++D +SG + T   +D E+ +    L+     AS      + S+  V IT+ D+NDNPP+F
Sbjct:  313 VSIHLSDENDNAPVF--DRSQYRGVVSEEAQAQTVVLNDKNVPLVIRATDLDSEQNSLLVYQIVEHEA---QTYFS----IDSSTGAIKMIKVLDYEKTPEFHFQVRVSDSGSPKLSAETPANVTITVLDANDSPPIFSRAVYETVLLTPTYSGVRLLSMSATDPD--TDASLTFSISTGNVGDK----------FAINARTGDISVQNATHLRS---RYELAVKVFDG---KFVSTAQAVVAVRVEDVNDNAPVFV-----NLPYYAVVEVDAAPG-SVVYTIAAFDRDVGRNGEVSYSLKEEHEYFDVEARSGDVSL--RRSFT---------ADMSSKDFTVNVVATDS-GVPPLSSEVSLPITV--INKAMPIFERPFYSKSVPENIKPHT-----PILNLQAKSPEGLPLIFSI---TDGDPFNQFSIDFNTGVVNVIGSLDHETQTTFKLTVRATDSVTGSHAEVNLDIL-VQDVNDNPPLFSQSAYATTLSEAALIGISVLQVSATDADIGSNKALYYQIINNGKNSSECFYIDSSSGLILTSRFLDYEQNQVHNFLV----RASDSGMPFLTSDVPVTITVTDINDNPPVF 851          

HSP 7 Score: 105.531 bits (262), Expect = 3.804e-23
Identity = 118/467 (25.27%), Postives = 196/467 (41.97%), Query Frame = 2
Query:  350 QQSSHSCKYDECCTVFSFQVDSGIK--ISSFYILIKVLDENDNSPKFLPFLNPYQTLP-ENSQINTVILLPSAIDLDSEAFGIKYYKI------SKPFLIGNDSHFTLLDKIASGRPQLLLISPLD-REVISEYRFILKA-VDRENDDHRDI----------SGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKLVNVISFYVT--DLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITAINEIHPLGHY----KEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSS 1669
            +++  +C+++   ++    VD G     ++  ++++V DENDN+P+F+      + L  E S     +    A D D  A     Y I       K F+   D   +  +    G    L + P D   V+ E++  LK  VDRE  D   I          S   V++ V D NDN PV DK    A  V       +    V+  D D G N  +  T+              F++D +    TG +  +  +D E  P  Y+ ++ ATD G    S  A++ + L + ND AP             +++++E+    T++  +Q +D             D  LN ++T        GH+    +  II+  +PLDRE       ++ +   D D   PLT+ + + + + D+NDNPP F + +Y     E+   A    +  +L + KD G NA VTY + S 
Sbjct: 1465 RETESACQFNIGVSI----VDGGEPPLQTTARVVVRVSDENDNAPQFVEKRVQVKALARERSVAREAVCRVYARDADHGANAELSYSIDGGNEAGKFFIDPKDGVISTRNPCPVGTNDFLTV-PCDIYVVVGEWKLHLKQPVDREERDRYQIEVTATDGAFVSKAVVDVAVLDANDNSPVCDKGLLYAVAVAEDVAPGIFLLLVSARDADIGANAAIQYTLHGPG-------AEHFRMDSA----TGELFTLAPLDREAVP-AYALSVRATDGG--GRSCQAEILVSLEDVNDNAPQFPASHY------AVSVYESTAVETLLTRVQATD------------SDLGLNRKVTYSFLDSAGGHFAIDERSGIISLKRPLDRE--HQAVYELTVRAEDGDVFRPLTSTVGVSVAVLDVNDNPPAFEQREYHAAAPED--AAPGSAVLSVLAISKDAGANAEVTYSVVSG 1890          

HSP 8 Score: 91.2781 bits (225), Expect = 8.234e-19
Identity = 129/529 (24.39%), Postives = 214/529 (40.45%), Query Frame = 2
Query:  440 ILIKVLDENDNSPKFLPFLNPYQT-LPENSQINTVILLPSAIDLDS--EAFGIKYYKISKP------FLIGNDSHFTLLDKIASGRPQLL-LISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKLVN---VISFYVTDLDEGQNKQVSITIETENDYKK------DQI-----------KRFFQIDFSPSLMTGS--IRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITAINEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYK-IDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSN-LSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEI 1924
            + + V D ND  P+FL     Y   +PE+S    V+ +  A D D+  +   + YY    P       L G+  H     +  +   +LL ++ P  RE  S  +F +     +  +    +   V ++V D NDN P F +       +   + V    V   Y  D D G N ++S +I+  N+  K      D +             F  +     ++ G   + L   +D E    +Y   + ATD       S A V++ +++ ND +PV     KG + + ++     E     +  L VS RD+   DI     +  + + +      H         + TL PLDRE        +++  +D    +       I ++L D+NDN P F  S Y   + E+   A   ++  +   D D G N  VTY  +DS+       +F ID  SG IS ++ +D E   ++   + A D D    L+ST  + V V+D NDN P F +  Y     E+    + +
Sbjct: 1370 VRVAVADANDCPPRFL--RGSYAGDVPEDSAPGQVVAVVGADDADATPDNGQLTYYLTGAPRVAAEDALPGHGEHVLRESRTVAISVELLTILPPTVRETESACQFNIGVSIVDGGEPPLQTTARVVVRVSDENDNAPQFVEKRVQVKALARERSVAREAVCRVYARDADHGANAELSYSIDGGNEAGKFFIDPKDGVISTRNPCPVGTNDFLTVPCDIYVVVGEWKLHLKQPVDREERD-RYQIEVTATDGAF---VSKAVVDVAVLDANDNSPVCD---KGLLYAVAVA----EDVAPGIFLLLVSARDA---DIGA---NAAIQYTLHGPGAEHFRMDSATGELFTLAPLDRE--AVPAYALSVRATDGGGRS---CQAEILVSLEDVNDNAPQFPASHYAVSVYEST--AVETLLTRVQATDSDLGLNRKVTYSFLDSAGG-----HFAIDERSGIISLKRPLDREHQAVYELTVRAEDGDVFRPLTSTVGVSVAVLDVNDNPPAFEQREYHAAAPEDAAPGSAV 1867          

HSP 9 Score: 85.8853 bits (211), Expect = 4.222e-17
Identity = 141/617 (22.85%), Postives = 251/617 (40.68%), Query Frame = 2
Query:  410 DSGIKI--SSFYILIKVLDENDNSPKFLPFLNPYQT-LPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLISPLDREVIS-EYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKLVNVISFY-VTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSF--NLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRK-GEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITAINEIHPL-GHY--KEFIIN----TLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIA-IDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQ----VIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIF 2200
            DSG+    S   + I V D NDN P F   L  Y+  + E +     +    A D D+        K+    L GND     ++ +  G+  ++ IS L ++ ++ +YR  +        D    S  +V + +   N + P+F +  Y   I E+S++  +++    TD D G    VS +I   N +  D+    F ID       G I   + +D E +P +  F  N++A D G  R+  T  V +I  ++ND  P        G +++R+      E    I+  L     +    D+  +L     +  +  + E+ PL GH   KE ++      +    + +DK    K ++       L P    L             P FT + Y   + E+    +   +  +     D    A V     +  N+ D   F + + +G++   +++D+E  + + F + A   +D+ ++ +  L+ VHV D NDN P+F    Y   V EN+P    + Q+  TD D     ++     +           +  VD  SG ++T+ P+DRE      + + A +     +   + +   V + + D ND PP F
Sbjct:  825 DSGMPFLTSDVPVTITVTDINDNPPVFNQLL--YEAFVSELAPRGHFVTRVQASDADAS----DTDKLEYSILSGNDH----MNFVVDGKSGIISISNLRKQTLAPQYRLNISV-----SDGVFTSTAQVHVNIQSANLHSPIFGQNEYVKEIPENSEVGTLLTLVQATDKDWGPLGHVSYSIV--NQFAGDR----FTID-----ENGQIFTSEPLDRE-DPLERVFDINIMAKDGG-GRVGFT-TVKVIATDENDNKPTFVTNEYFGNVLARA------EKGTAILQVLATDPDEGSNADLVYTLYKGESD-AVEDVLEVQPLTGHVVTKESLVGLEGSRMSFFVKAEDKGPERKHSVVPVSVSVL-PADAEL-------------PAFTEAAYALTVAEDAEVGSEIGVARLA--GNDSATYAAVPGGGGAENNADDT--FVVLSQTGRLKVAKALDHETVRSYRFGVKATFRRDEVDVVAQVLVTVHVGDVNDNRPVFESSVYEGVVMENLPAGVPVVQVRATDRDGGANGQLAYSLAEEAGGEGGAARDLFSVDAESGWVRTLRPLDREARAGHELAVVATD---LGDPARLSATASVRVAVADANDCPPRF 1384          

HSP 10 Score: 72.7886 bits (177), Expect = 4.130e-13
Identity = 53/238 (22.27%), Postives = 110/238 (46.22%), Query Frame = 2
Query: 1493 IHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDK-DHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIFS 2203
            + +++ + N++ P F+R +Y+  + E  P  T      IL L+  D    + +T+ I SS +      F +D ++G +S+ +S+D+E  +     ++  D +     + A ++V+V D+ND+AP+F   HY   V E+  + + + ++   D D  P  ++         N      +    G L     +DR  V +  +++ A +    +      +   V++T+ D  + PP F+
Sbjct:    2 VEVSVINTNEHRPQFSRPRYEVSVAEETPPNT-----EILRLNATDRDDTSSLTFSIVSSTDVASLRKFKLDYNTGALSTVESLDHETKQSHILTVMVRDSEIPVQKAYATVVVNVRDSNDHAPLFTSRHYEGRVVESAALGSAVLEVVALDRDRGPNAEVAYSIEAGNRNVGNSFTIHPTMGILSVAKELDRAVVEAYELVVRAVDRG--EPPRSATTAVRVLVTVAD--NAPPKFT 230          

HSP 11 Score: 61.6178 bits (148), Expect = 9.937e-10
Identity = 58/197 (29.44%), Postives = 96/197 (48.73%), Query Frame = 2
Query:  380 ECCTVFSFQV---DSGIKISSFYILIKVLDENDNSPKFLPFLNPYQTLPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDI-SGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKLVN-VISFYVTDLDEGQNKQVSITIETEN 955
            E    ++  V   D G +     IL+ + D NDN+P+F P  +   ++ E++ + T++    A D D    G+   K++  FL     HF + ++  SG   + L  PLDRE  + Y   ++A D   D  R + S V V + V D+NDNPP F++  Y A   E +   + V+S      D G N +V+ ++ + N
Sbjct: 1706 EAVPAYALSVRATDGGGRSCQAEILVSLEDVNDNAPQF-PASHYAVSVYESTAVETLLTRVQATDSD---LGLN-RKVTYSFLDSAGGHFAIDER--SG--IISLKRPLDREHQAVYELTVRAED--GDVFRPLTSTVGVSVAVLDVNDNPPAFEQREYHAAAPEDAAPGSAVLSVLAISKDAGANAEVTYSVVSGN 1891          

HSP 12 Score: 59.6918 bits (143), Expect = 4.075e-9
Identity = 141/664 (21.23%), Postives = 237/664 (35.69%), Query Frame = 2
Query:  410 DSGIKISSFYILIKVLDENDNSPKFLPFLNPY-QTLPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLISPLDREVI----------SEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKLVNVISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPR----LSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRD---------SLVTDIECSLDDYHLNFEITAINEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHG-KNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSI--------------DYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIF--PKPHYSFTVRENVPVNTEIGQIETTDLDTRP----------ENKIVKYF-------------HKSYTNNYQV----IHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPI 2197
            D G ++    + +   DENDN P F+   N Y   +   ++  T IL   A D D  +                D  +TL    +     +L + PL   V+          S   F +KA D+  +    +  V V +   D     P F +  Y   + E +++ + I   V  L  G +      +      + +    F  +       TG +++   +D+ET    Y F + AT     R    + +   V + + + ND  PV +       V   + M EN PA   V  ++ +DRD         SL  +           F + A          +   + TL+PLDRE      L   +  +D      L+   ++ + + D ND PP F R  Y G++ E+   A  +++  +   D D    N  +TY +  +      +      +     SR                 + E    F+  +  +D  +  L +TA ++V V D NDNAP F   +       RE       + ++   D D              N+  K+F                 TN++      I+V     KL    P+DRE+     I +TA + A         S+ +V + + D NDN P+
Sbjct: 1033 DGGGRVGFTTVKVIATDENDNKPTFV--TNEYFGNVLARAEKGTAILQVLATDPDEGS--------------NADLVYTLYKGESDAVEDVLEVQPLTGHVVTKESLVGLEGSRMSFFVKAEDKGPERKHSVVPVSVSVLPADA--ELPAFTEAAYALTVAEDAEVGSEIG--VARL-AGNDSATYAAVPGGGGAENNADDTFVVLS-----QTGRLKVAKALDHET-VRSYRFGVKAT---FRRDEVDVVAQVLVTVHVGDVNDNRPVFE-----SSVYEGVVM-ENLPAGVPVVQVRATDRDGGANGQLAYSLAEEAGGEGGAARDLFSVDA----------ESGWVRTLRPLDREARAGHELA--VVATDLGDPARLSATASVRVAVADANDCPPRFLRGSYAGDVPED--SAPGQVVAVVGADDADATPDNGQLTYYLTGAPRVAAEDALPGHGEHVLRESRTVAISVELLTILPPTVRETESACQFNIGVSIVDGGEPPLQTTARVVVRVSDENDNAPQFVEKRVQVKALARERSVAREAVCRVYARDADHGANAELSYSIDGGNEAGKFFIDPKDGVISTRNPCPVGTNDFLTVPCDIYVVVGEWKLHLKQPVDREERDRYQIEVTATDGA-------FVSKAVVDVAVLDANDNSPV 1639          
BLAST of Protocadherin Fat 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006996.1 (pep scaffold:Pmarinus_7.0:GL476780:2096:143714:1 gene:ENSPMAG00000006222.1 transcript:ENSPMAT00000006996.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 145.591 bits (366), Expect = 2.500e-35
Identity = 173/627 (27.59%), Postives = 274/627 (43.70%), Query Frame = 2
Query:  413 SGIKISSFYILIKVLDENDNSPKF-LPFLNPYQTLPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEH-SKLVNVISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYK-YSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRD--------SLVTDIECSLDDYHLNFEITAINEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKI-SSRQSIDYEKNKLFSF----NIIAIDKDQSN----LSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTN-NYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIFSLINPAKSSL 2230
            SG    S  + I +++ENDN P F LP  N   ++ EN+ + T ++   A DLD+  FG   Y  S      +DS    LD  ASG   + + + LD E     RF +  + R+       +   V I + D+NDN PVF +  Y     E+ + L  V+    TD D   N Q++ +I   + Y       +F I  S     G + L   +DYE  P    S  ++A D G P L+ST    + + ++ND +P+    R     S SI + EN  A   V  +  +D D        SL+  +E S       F I A          +   I +   LDRE   +QY+ I       D     T   T++I L D+NDN P +    Y   ++EN P  T   I  +   D D  +N  + Y ID         ++ I+A SGKI ++   +D E     SF    +I+    D+ +     +++A + V + D NDN P F    Y+  V E +P N+ + Q+  TD D      +      +    ++Q   +D  +G + T+  +DRE V +  + + A +  +      + S   + + + DVNDN P F   +PA+S++
Sbjct:    7 SGEHWGSARVHITLINENDNRPIFSLPLYN--VSVWENATLGTSVVQVLATDLDAGVFGQVSYHFS------DDSDKFSLDP-ASG--LISVAAALDFEATP--RFTVTVMARDGGGQE--TAGRVRINLLDVNDNTPVFQRDSYVGTARENDNSLTPVVRVRATDEDSPPNNQITYSILPTSAYSS-----YFSITVSGGY--GVVTLARALDYEKIPGGTISLTIMALDGGSPPLNSTVTAIVEVFDENDNSPIFD--RN----SYSIAIPENILAGATVLYVNATDGDQSPEYGQLSLIYSLEGS-----TQFRINA----------RSGDITSTTLLDRE-AVSQYILIVRAVDGGDGNDQKTGIATVNITLLDVNDNDPAWRDLPYAVTIVENTPGGT--DIFTVSAADPDLNENGTLVYAIDPPN-----PFYRINAASGKIRTTGLQLDREDLNPISFASMRSIVVSGADRGSPPRRATASATVTVLLQDVNDNEPSFVGLPYALQVLEGLPANSTLFQVTATDPDEGANGNVTYSMTAALPRPDFQ---LDAATGLITTLVQLDREAVAAYQLRLVATDRGTPA----LSSTTTLSLVVLDVNDNAPTF---HPARSAV 572          

HSP 2 Score: 127.487 bits (319), Expect = 8.815e-30
Identity = 149/627 (23.76%), Postives = 266/627 (42.42%), Query Frame = 2
Query:  437 YILIKVLDENDNSPKFLPFLNPYQTLPENSQINTVILLPSAIDLDSEAFGIKYYKISKP----------FLIGNDSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVF-DKTFYTANIVE-HSKLVNVISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLI--DEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITAINEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQD-KLTPLTTNLTIHINLFDINDNPPVFTRSKYQGEL--IENIPQATVKMIEPILTLDKDHGKNAYVTYKI--DSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQS-NLSSTALIIVHVIDANDNAPIF------PKPHYSFTVRENVPVNTEIGQIE-TTDLDTRPENKIVKYFHKSY--TNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSEC---------MVIITIEDVNDNPPIFS 2203
            Y+ + V DENDNSP+F         + E++   T++ +  A D D+ + G    +               +I N+S  T++D           ++  D    +    + + V  +       +   + + V D+NDN P+F     Y  ++VE  +    V S + TD D G N QV+  IE+    K         +   PS   G IR+     ID ET    Y+  ++A D G P LS +A V +++ + ND+ P      +      ++++ E+    + VA+++ ++             +    ++I  I +     H    ++ + + L        Y + N+     D    PL     +++ + D+ND+ PVF      G +  I  +    ++++E +L +D D G+N  V Y         S DWE F I+A SG IS+ +++D E   ++S  ++A D+ Q  +  ST  + V + D +DN P+F        P+ SF++ E+ P  T +G +    D D    N IV YF  +    N + +       G L  +  +DRE      I++ A +  ++        E           V + +ED+ND  P+F+
Sbjct: 1824 YVYVNVTDENDNSPEFEAGSATLVEVRESAAPGTLLTVLHATDRDAGSNGTVSARAHTHTGTRIPPQYILIIQNESGVTIVD-----------VAKADFVEKTSQFILFRIVALDGGSPPRSTTFNLSVIVLDVNDNVPIFLSPGGYAVSVVELGAPGTLVASVWATDADAGPNGQVTFRIESGGGDK---------LSIGPS--DGIIRVAPGANIDRETRA-AYTLMVVAVDRGNPPLSGSAIVRVLVDDVNDERPAFLAPVQ------TVSVLESLSVGSFVATVKATE--------NYKGHNTKYTYKIAGIGKNAFTVHATSGLVTSTRLL------KSYERFNLTAVATDHGRPPLWGQAGLYVEVLDVNDHRPVFVLPP-NGTVVNITEVMPVVIRIVE-VLAVDGDEGQNGAVRYSFLHAGGVGSRDWESFRINATSGIISTARALDRESQAVYSLILLASDQGQPVSYESTQPLQVVLDDIDDNEPVFIVLPDGGAPYQSFSIPEHSPPGTAVGNVSGAVDADVG-ANAIVYYFIAAGNEGNKFNL----SRWGLLVVLSDLDREVSPYYAIIVKASSNPNWTPAVTTGPEFDPSKDRTLREVRVYLEDINDQWPVFT 2400          

HSP 3 Score: 123.25 bits (308), Expect = 1.591e-28
Identity = 147/571 (25.74%), Postives = 257/571 (45.01%), Query Frame = 2
Query:  428 SSFYILIKVLDENDNSPKFLPFLNPYQ-TLPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKLVNVISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLID-EIDYE-TNPYKY----SFNLIATDNGLP--RLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRD-----SLVTDIECSLDDYHLNFEITAINEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTP-LTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTL---DKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKD--QSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKL-KTIGPIDREKV 2077
            S+   +++V DENDNSP F    N Y   +PEN      +L  +A D D      +Y ++S  + +   + F    +I +    +   + LDRE +S+Y  I++AVD  + + +      V I + D+NDN P +    Y   IVE++     I F V+  D   N+  ++       Y  D    F++I+ +    +G IR    ++D E  NP  +    S  +   D G P  R +++A V ++L + ND  P    +        ++ + E  PA + +  +  +D D     ++   +  +L     +F++ A   +          I TL  LDRE      L++       D+ TP L++  T+ + + D+NDN P F  ++    L+E++ + +V     +++L   D D G NA +++ I           F++    G + +  S+D E    +S  I AID     S  + T  + V V+D NDN P+F +  Y  +V ENV     I Q++ TD+D     ++  ++     N      V+ +SG + +   P+DRE V
Sbjct:  223 STVTAIVEVFDENDNSPIF--DRNSYSIAIPENILAGATVLYVNATDGDQSP---EYGQLSLIYSLEGSTQF----RINARSGDITSTTLLDREAVSQYILIVRAVDGGDGNDQKTGIATVNITLLDVNDNDPAWRDLPYAVTIVENTPGGTDI-FTVSAADPDLNENGTLV------YAIDPPNPFYRINAA----SGKIRTTGLQLDREDLNPISFASMRSIVVSGADRGSPPRRATASATVTVLLQDVNDNEPSFVGL------PYALQVLEGLPANSTLFQVTATDPDEGANGNVTYSMTAALP--RPDFQLDAATGL----------ITTLVQLDREAVAAYQLRL----VATDRGTPALSSTTTLSLVVLDVNDNAPTFHPARSAVSLMESVARDSV-----VISLNCTDADSGLNAELSFFITGGNQDGQ---FSVGFRDGLVRTVVSLDRETKASYSLVIEAIDNGPAGSRRTGTTTLDVLVLDVNDNRPLFLEGSYEVSVPENVTRGAIILQVQATDIDEGINGRV--WYRIISGNQDGNFLVNVSSGLISRGATPLDRETV 741          

HSP 4 Score: 123.25 bits (308), Expect = 1.674e-28
Identity = 146/608 (24.01%), Postives = 261/608 (42.93%), Query Frame = 2
Query:  440 ILIKVLDENDNSPKFLPFLNPYQTL----PENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLISPLDREVISE-YRFILKAVDRENDDHRDI-SGVEVEIKVGDINDNPPVFDKTFYTA-NIVEHSKLVNVISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRD------SLVTDIECSLDDYHLNFEITAINEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMI--EPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSR--QSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVP-VNTEIGQIETTDLDTRP-ENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIFSL 2206
            +LI++ DENDN+P F      Y+ L    P  + +    +  S  D    A      ++    + GN +    +D    G   L  +  LD EV +  Y  ++ A D+  D  R + S   V + V D+ND  P F +++    ++ E      + +F  +D D G N ++  +I  + D + + +        SP+     +R   E+D ET  + Y+  ++A D G P L+ST  V + +++ +D  PV   +     +S +  +        IV+ ++ SD +      +L+     S  +    F              +  ++   +PLDRE      L + +  +  +       +  + + + D NDN PVF++  Y+ E+ EN P  TV  +   PI   D D G NA + Y +    ++    YF ID D G +S    Q +D E        +  + +D    ++T  + V V+D NDN P F     +  V EN P V T +  ++  D D    +   V+Y   S  N+     +D+++G + T+ PID E      +++ A ++A         + C + +++++  D    FSL
Sbjct: 1158 VLIRITDENDNAPAF--GAATYEVLLTEGPSTAGVAVANVTASDPDEGDNA------RVVYAIVSGNTAATFGIDN---GTGVLTAVKALDFEVSAGLYLLVVTATDQPRDPARRLTSTATVSVHVADVNDVTPWFLRSYEGPIDVSEGQPGPRIATFMASDQDSGLNGELEYSI-IDGDPRNEFV-------ISPADGDLRVRRYVELDRETQAF-YNLTIMAKDMGTPPLNSTLTVGVRVLDVHDNDPVFLNLPANASLSEAAAVL------AIVSRVRASDANEGRNCAALLQHSPTSFCNGERAF----------YADSQTGLVYVNRPLDRERVAEYRLTLTVRDNPDNPSYARKDSDIMIVTILDENDNSPVFSQVTYEAEIPENSPNGTVLTVLNGPIYASDADFGVNATLAYSLLGGSSA----YFLIDRDRGNVSMALGQGLDREGIPGGRLELTILVQDGGRRNATVRLGVTVLDVNDNTPTFNVTSQTAHVLENSPAVGTSVIVVKAMDRDLGVCDAGTVRYSIASGGND--TFGIDESTGLIVTVAPIDYETRPEYLLMVVATDQA----PPFHTASCELRVSLQNELDEKLSFSL 1719          

HSP 5 Score: 121.324 bits (303), Expect = 6.901e-28
Identity = 157/614 (25.57%), Postives = 267/614 (43.49%), Query Frame = 2
Query:  389 TVFSFQVDSGIKISSFYILIKVLDENDNSPKFLPFLNPY-QTLPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKLVNVISFYVTDLDEGQN---KQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYET-NPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITAINEIHPLGHYKEFIINTLKPLDRED-DKNQYLKI-NIYCSDQDKLTP---LTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIF 2200
            TV     D G + ++  + I +LD NDN+P F    + Y  T  EN    T ++   A D DS       Y I         S+F++   ++ G   + L   LD E I      L  +  +       S V   ++V D NDN P+FD+  Y+  I E+  L      YV   D  Q+    Q+S+    E   +       F+I+      +G I     +D E  + Y      +   +G  + +  A VNI L++ ND  P  + +        ++T+ EN P  T + ++  +D D          ++  L + I   N  + +      I  T   LDRED +   +  + +I  S  D+ +P    T + T+ + L D+NDN P F    Y  +++E +P A   + + +   D D G N  VTY + ++    D   F +DA +G I++   +D E    +   ++A D+    LSST  + + V+D NDNAP F     + ++ E+V  ++ +  +  TD D+   N  + +F      + Q   V    G ++T+  +DRE   S +++I A +     ++    +   V++   DVNDN P+F
Sbjct:  100 TVTVMARDGGGQETAGRVRINLLDVNDNTPVFQ--RDSYVGTARENDNSLTPVVRVRATDEDSPPNNQITYSILPTS--AYSSYFSI--TVSGGYGVVTLARALDYEKIPGGTISLTIMALDGGSPPLNSTVTAIVEVFDENDNSPIFDRNSYSIAIPEN-ILAGATVLYVNATDGDQSPEYGQLSLIYSLEGSTQ-------FRIN----ARSGDITSTTLLDREAVSQYILIVRAVDGGDGNDQKTGIATVNITLLDVNDNDPAWRDL------PYAVTIVENTPGGTDIFTVSAADPDLN--------ENGTLVYAIDPPNPFYRINAASGKIRTTGLQLDREDLNPISFASMRSIVVSGADRGSPPRRATASATVTVLLQDVNDNEPSFVGLPYALQVLEGLP-ANSTLFQ-VTATDPDEGANGNVTYSMTAALPRPD---FQLDAATGLITTLVQLDREAVAAYQLRLVATDRGTPALSSTTTLSLVVLDVNDNAPTFHPARSAVSLMESVARDSVVISLNCTDADSG-LNAELSFFITGGNQDGQ-FSVGFRDGLVRTVVSLDRETKASYSLVIEAIDNGPAGSRRTGTTTLDVLVL--DVNDNRPLF 672          

HSP 6 Score: 105.145 bits (261), Expect = 5.779e-23
Identity = 107/430 (24.88%), Postives = 179/430 (41.63%), Query Frame = 2
Query: 1118 STAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLV-TDIECSLDDYHLNFEITAINEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEK--NKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIFSLINPAKSSLIFTINKGFRHENCQMIPYAVSDADHDEPNSDSCCILQLDND--QNGMLYLLSNTPN 2392
             +A+V+I LIN+ND  P+        +   +++++EN    T V  +  +D D+ V   +     D    F +   + +          I+    LD E        + +   D        T   + INL D+NDN PVF R  Y G   EN    ++  +  +   D+D   N  +TY I  +   + +   T+    G ++  +++DYEK      S  I+A+D     L+ST   IV V D NDN+PIF +  YS  + EN+     +  +  TD D  PE   +   + S   + Q   ++  SG + +   +DRE V    +++ A +     ++        V IT+ DVNDN P +                       + +PYAV+  ++    +D   +   D D  +NG L    + PN
Sbjct:   12 GSARVHITLINENDNRPIFS------LPLYNVSVWENATLGTSVVQVLATDLDAGVFGQVSYHFSDDSDKFSLDPASGL----------ISVAAALDFE--ATPRFTVTVMARDGGGQE---TAGRVRINLLDVNDNTPVFQRDSYVGTAREN--DNSLTPVVRVRATDEDSPPNNQITYSILPTSAYSSYFSITVSGGYGVVTLARALDYEKIPGGTISLTIMALDGGSPPLNSTVTAIVEVFDENDNSPIFDRNSYSIAIPENILAGATVLYVNATDGDQSPEYGQLSLIY-SLEGSTQ-FRINARSGDITSTTLLDREAVSQYILIVRAVDGGDGNDQK--TGIATVNITLLDVNDNDPAW-----------------------RDLPYAVTIVENTPGGTDIFTVSAADPDLNENGTLVYAIDPPN 391          

HSP 7 Score: 94.3597 bits (233), Expect = 1.024e-19
Identity = 128/543 (23.57%), Postives = 231/543 (42.54%), Query Frame = 2
Query:  656 IASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDIS------GVEVEIKVGDINDNPPVFDKTFYTANIVEHSKLVNVI--SFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKY-SFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITAIN----EIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQ----ATVKMIEPILTLDKDHGKNAYVTYKIDS-SKNSTDWEYFTIDADSGKISSRQSI-DYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTV--RENVPVNTEIGQIETTDLDTRPENKIVKY--FHKSYTN--NYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEA---SYQNKNLMDSECMVIITIEDVNDNPPIF 2200
            IA+ + ++   + LDRE    Y  +L  + R+      I+      G  V + V D NDN P F+    T   V  S     +    + TD D G N  VS    T    +     ++  I  + S +T  I  + + D+     ++  F ++A D G P  S+T  +++I+++ ND  P+   +  G     ++++ E     T+VAS+  +D D+          +  + F I +       I P     + II      + + +      + +   D+    PL+ +  + + + D+ND  P F        ++E++      ATVK  E         G N   TYKI    KN+     FT+ A SG ++S + +  YE+   F+   +A D  +  L   A + V V+D ND+ P+F  P     V   E +PV   I ++   D D   +N  V+Y   H       +++   ++  SG + T   +DRE     ++++ A ++    SY++   +       + ++D++DN P+F
Sbjct: 1778 IAALQGEITTQAALDREATDSY--MLTVLSRDGGPREAIAVLTNKPGAYVYVNVTDENDNSPEFEAGSATLVEVRESAAPGTLLTVLHATDRDAGSNGTVSARAHTHTGTRIP--PQYILIIQNESGVT--IVDVAKADFVEKTSQFILFRIVALDGGSPPRSTTFNLSVIVLDVNDNVPIF--LSPG---GYAVSVVELGAPGTLVASVWATDADAG--------PNGQVTFRIESGGGDKLSIGP----SDGIIRVAPGANIDRETRAAYTLMVVAVDRGN-PPLSGSAIVRVLVDDVNDERPAFLAPVQTVSVLESLSVGSFVATVKATE------NYKGHNTKYTYKIAGIGKNA-----FTVHATSGLVTSTRLLKSYER---FNLTAVATDHGRPPLWGQAGLYVEVLDVNDHRPVFVLPPNGTVVNITEVMPVVIRIVEVLAVDGD-EGQNGAVRYSFLHAGGVGSRDWESFRINATSGIISTARALDRESQAVYSLILLASDQGQPVSYESTQPLQ------VVLDDIDDNEPVF 2275          

HSP 8 Score: 93.2041 bits (230), Expect = 2.800e-19
Identity = 95/373 (25.47%), Postives = 165/373 (44.24%), Query Frame = 2
Query: 1118 STAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFEN-EPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITAINEIHPLG-HYKEFIINTLKPLDREDDKNQYLKINIYCSDQ--DKLTPLTTNLTIHINLFDINDNPPVFTRSKYQG--ELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQ--SIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDL-DTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIFSLI 2209
            +T  V I + ++ND AP           +  + + E    A   VA++  SD D          D+  + + I + N     G      ++  +K LD E     YL + +  +DQ  D    LT+  T+ +++ D+ND  P F RS Y+G  ++ E  P      I   +  D+D G N  + Y I       +   F I    G +  R+   +D E    ++  I+A D     L+ST  + V V+D +DN P+F     + ++ E   V   + ++  +D  + R    ++++   S+ N  +  + D  +G +    P+DRE+V    + +T R+     +    DS+ M I+TI D NDN P+FS +
Sbjct: 1154 ATTSVLIRITDENDNAPAFGA------ATYEVLLTEGPSTAGVAVANVTASDPDEG--------DNARVVYAIVSGNTAATFGIDNGTGVLTAVKALDFEVSAGLYLLV-VTATDQPRDPARRLTSTATVSVHVADVNDVTPWFLRS-YEGPIDVSEGQPG---PRIATFMASDQDSGLNGELEYSIIDGDPRNE---FVISPADGDLRVRRYVELDRETQAFYNLTIMAKDMGTPPLNSTLTVGVRVLDVHDNDPVFLNLPANASLSEAAAVLAIVSRVRASDANEGRNCAALLQHSPTSFCNGERAFYADSQTGLVYVNRPLDRERVAEYRLTLTVRDNPDNPSYARKDSDIM-IVTILDENDNSPVFSQV 1503          

HSP 9 Score: 91.2781 bits (225), Expect = 9.541e-19
Identity = 135/630 (21.43%), Postives = 260/630 (41.27%), Query Frame = 2
Query:  410 DSGIKISSFYILIKVLDENDNSPKFLPFLNPYQTLPENSQINTVILLPSAIDLD---SEAFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKLVNVISFYVTDLDEGQNK---QVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLS-------STAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFE---NEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITAINEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVF-TRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSG--KISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITA-RNEASYQNKNL-----------MDSECMVIITIEDVNDNPPIFSL 2206
            D G + ++  + + VLD NDN+P F         L  +  + T +++  A+D D    +A  ++Y   S     GND+       I      ++ ++P+D E   EY  ++ A D+    H   +  E+ + + +  D    F    Y A + E +    V+        +   K    ++I ++  ++ K+ + +     +   +L  G I     +D E     Y   +++ D G PR +         A V + + ++ND +P        E  + S T+ E   +    T++  L  +DRD+       +    H    I     I  + +     I  +   D  +  +Q++   I   D     P +T   + + + D+NDN P+F +   Y   ++E     T  ++  +   D D G N  VT++I+S       +  +I    G  +++   +ID E    ++  ++A+D+    LS +A++ V V D ND  P F  P  + +V E++ V + +  ++ T      EN   K  +  YT  Y++  + +N+             V + + L+T+ R   SY+  NL           +  +  + + + DVND+ P+F L
Sbjct: 1586 DGGRRNATVRLGVTVLDVNDNTPTFNVTSQTAHVLENSPAVGTSVIVVKAMDRDLGVCDAGTVRYSIASG----GNDTF-----GIDESTGLIVTVAPIDYETRPEYLLMVVATDQAPPFH--TASCELRVSLQNELDEKLSFSLAAYQAALSEAAVPGTVVVRVAAPQMKAPPKLPLPLAILVQKWHEDKRHKQQESDNAELIAALQ-GEITTQAALDREATD-SYMLTVLSRDGG-PREAIAVLTNKPGAYVYVNVTDENDNSP--------EFEAGSATLVEVRESAAPGTLLTVLHATDRDAGSNGTVSARAHTHTGTRIPP-QYILIIQNESGVTIVDVAKADFVEKTSQFILFRIVALDGGS-PPRSTTFNLSVIVLDVNDNVPIFLSPGGYAVSVVELGAPGT--LVASVWATDADAGPNGQVTFRIESGGG----DKLSIGPSDGIIRVAPGANIDRETRAAYTLMVVAVDRGNPPLSGSAIVRVLVDDVNDERPAFLAPVQTVSVLESLSVGSFVATVKAT------ENY--KGHNTKYT--YKIAGIGKNA-----------FTVHATSGLVTSTRLLKSYERFNLTAVATDHGRPPLWGQAGLYVEVLDVNDHRPVFVL 2164          

HSP 10 Score: 82.8037 bits (203), Expect = 3.788e-16
Identity = 141/565 (24.96%), Postives = 231/565 (40.88%), Query Frame = 2
Query:  422 KISSFYILIKVLDENDNSPKFLPFLNPYQTLPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIASG-RPQLLLISP---LDREVISEYRFILKAVDRENDDHRDISGVE-VEIKVGDINDNPPVFDKTFYTANIVEHSKLVN-VISFYVTDLDEGQNKQVSITIETENDYKKDQI-KRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRD---------SLVTDIECSLDDYHLNFEITAINEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVF-----TRSKYQG-ELIENIPQAT-VKMIEPILTLDKDHGKNAYVTYKIDSSK-----NSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALII-----------------VHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKY 1981
            + ++F + + VLD NDN P FL       ++ E     T++    A D D+   G   ++I      G        DK++ G    ++ ++P   +DRE  + Y  ++ AVDR N     +SG   V + V D+ND  P F     T +++E   + + V +   T+  +G N        T+  YK   I K  F +  +  L+T S RL+    YE    +++   +ATD+G P L   A + + +++ ND  PV  +   G +V+    + E  P    +  +   D D         S +        D+  +F I A +           II+T + LDRE        + +  SDQ +     +   + + L DI+DN PVF       + YQ   + E+ P  T V  +     +D D G NA V Y I +       N + W    + +D         +D E +  ++     I K  SN + T  +                  V++ D ND  P+F    Y+  V  +  V +E+ Q+E  D D    N IV Y
Sbjct: 1933 RSTTFNLSVIVLDVNDNVPIFLSPGGYAVSVVELGAPGTLVASVWATDADAGPNGQVTFRIES----GGG------DKLSIGPSDGIIRVAPGANIDRETRAAYTLMVVAVDRGNPP---LSGSAIVRVLVDDVNDERPAFLAPVQTVSVLESLSVGSFVATVKATENYKGHN--------TKYTYKIAGIGKNAFTVHATSGLVT-STRLLKS--YE----RFNLTAVATDHGRPPLWGQAGLYVEVLDVNDHRPVFVLPPNGTVVN----ITEVMPVVIRIVEVLAVDGDEGQNGAVRYSFLHAGGVGSRDWE-SFRINATSG----------IISTARALDRE--SQAVYSLILLASDQGQPVSYESTQPLQVVLDDIDDNEPVFIVLPDGGAPYQSFSIPEHSPPGTAVGNVSG--AVDADVGANAIVYYFIAAGNEGNKFNLSRWGLLVVLSD---------LDREVSPYYAI----IVKASSNPNWTPAVTTGPEFDPSKDRTLREVRVYLEDINDQWPVFTNHEYTAGVAVDAKVGSELLQLEAVDRDVG-NNSIVLY 2436          

HSP 11 Score: 80.8777 bits (198), Expect = 1.476e-15
Identity = 147/632 (23.26%), Postives = 253/632 (40.03%), Query Frame = 2
Query:  428 SSFYILIKVLDENDNSPKFLPFLNPYQTLPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLIS-PLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDI---NDNPPVFDKTFYTANIVEHSKLVNVIS-----FYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNP-YKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPA-RTIVASLQVSDRDSLVTDIECSLDDYHLNFEI-TAINEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPL-TTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATV-------------KMIEPILTL------DKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSST------ALIIVHVIDANDNAPIFPKPHYSFT-VRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNY--QVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIF 2200
            S+  + ++VLD +DN P FL  L    +L E + +  ++    A D +         + S       +  F      A  +  L+ ++ PLDRE ++EYR  L    R+N D+   +  + +I +  I   NDN PVF +  Y A I E+S    V++      Y +D D G N  ++ ++   +         +F ID     +  S+ L   +D E  P  +    ++  D G  R ++T ++ + +++ ND  P   V       S++  + EN PA  T V  ++  DRD  V D         + + I +  N+   +      I+ T+ P+D E  + +YL + +     D+  P  T +  + ++L +  D    F+ + YQ  L E     TV             K+  P+  L      DK H        K   S N+       I A  G+I+++ ++D E    +   +++ D       +       A + V+V D NDN+P F     +   VRE+    T +  +  TD D      +    H         Q I + QN   +  +     + V   +  I  R  A         +   + + + DVNDN PIF
Sbjct: 1371 STLTVGVRVLDVHDNDPVFL-NLPANASLSEAAAVLAIVSRVRASDANEGRNCAALLQHSPTSFCNGERAF-----YADSQTGLVYVNRPLDRERVAEYRLTLTV--RDNPDNPSYARKDSDIMIVTILDENDNSPVFSQVTYEAEIPENSPNGTVLTVLNGPIYASDADFGVNATLAYSLLGGS-------SAYFLIDRDRGNV--SMALGQGLDREGIPGGRLELTILVQDGG--RRNATVRLGVTVLDVNDNTPTFNV------TSQTAHVLENSPAVGTSVIVVKAMDRDLGVCDAGT------VRYSIASGGNDTFGIDESTGLIV-TVAPIDYE-TRPEYLLMVVAT---DQAPPFHTASCELRVSLQNELDEKLSFSLAAYQAALSEAAVPGTVVVRVAAPQMKAPPKLPLPLAILVQKWHEDKRH--------KQQESDNAE-----LIAALQGEITTQAALDREATDSYMLTVLSRDGGPREAIAVLTNKPGAYVYVNVTDENDNSPEFEAGSATLVEVRESAAPGTLLTVLHATDRDAGSNGTVSARAHTHTGTRIPPQYILIIQNESGVTIVDVAKADFVEKTSQFILFRIVALDGGSPPRSTTFNLSVIVLDVNDNVPIF 1953          

HSP 12 Score: 73.1738 bits (178), Expect = 3.125e-13
Identity = 90/355 (25.35%), Postives = 145/355 (40.85%), Query Frame = 2
Query: 1469 TPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYE-KNKLFSFNIIAIDKDQ---SNLSSTALIIVHVIDANDNAPIFPKPHYS-FTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIFSLINPAKSSLIFTINKGFRHENCQMIPYAVSDADHDEPNSDSCCILQLDNDQ----NGMLYLLSNTPNFLCLQNTMNTP------GIYRVSLTATDNKNNPNKSLK 2488
            TP     ++ I + D NDN P F  + Y+  L E    A V +   +   D D G NA V Y I S   +     F ID  +G +++ +++D+E    L+   + A D+ +     L+STA + VHV D ND  P F + +     V E  P    I     +D D+    ++          N  VI       +++    +DRE      + I A++  +      ++S   V + + DV+DN P+F L  PA +SL               +   VS     + N    C   L +      NG     +++   L     +N P        YR++LT  DN +NP+ + K
Sbjct: 1150 TPAQATTSVLIRITDENDNAPAFGAATYEVLLTEGPSTAGVAVAN-VTASDPDEGDNARVVYAIVSGNTAAT---FGIDNGTGVLTAVKALDFEVSAGLYLLVVTATDQPRDPARRLTSTATVSVHVADVNDVTPWFLRSYEGPIDVSEGQP-GPRIATFMASDQDSGLNGELEYSIIDGDPRNEFVISPADGDLRVRRYVELDRETQAFYNLTIMAKDMGTPP----LNSTLTVGVRVLDVHDNDPVF-LNLPANASL----------SEAAAVLAIVSRVRASDANEGRNCAALLQHSPTSFCNGERAFYADSQTGLVY---VNRPLDRERVAEYRLTLTVRDNPDNPSYARK 1481          
BLAST of Protocadherin Fat 1 vs. Ensembl Nematostella
Match: EDO35412 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLK9])

HSP 1 Score: 182.57 bits (462), Expect = 1.260e-46
Identity = 200/693 (28.86%), Postives = 318/693 (45.89%), Query Frame = 2
Query:  440 ILIKVLDENDNSPKF-LPFLNPYQT----LPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKLVN-VISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAP-VIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITA----INEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIFSLINPAKSSLIFTINKGFRHENCQMIPYAVSDADHDEPNSDSCCILQLDNDQNGMLYLLSNTPNF-LCLQNTMNTPGIYRVSLTATDNKNNPNKS 2482
            + I VLD NDNSP+  + +L P+        ENS INT I      D DS        KI+     G+D     ++ +  G   + L  PLDRE++  Y   L   D+       +  V +++   D+NDN P F    YTANI E ++  + V+    TD DEG N  VS +I   ND        +FQ+DF   L+T +  L  E          +  + A D+G    + +  V + +I+ ND  P  +K   KG I         +E A      LQVS      TD++ S D+  + +EI++    +N +  L + +  ++ T   LDRE  K+ Y    +   D      L +++ + + + DINDN PVF   +Y   ++EN P    K+++ +   D D G NA ++Y I    N+ +   F+ID+ +G IS+  S+D+E  + FS  I A D      + TA++ V V++  DN P+F    Y+FTV ENVP  T +G++  T   T+ +N  + Y   S  +   +  VD   G +K  G +DRE+     + + AR          + ++  V I + D NDN P FS      SS+I  I+  +       + Y  +  D D    +     QL ++  G+L++ S +    L  + T      Y V + A+D+ + P  S
Sbjct:  299 VTINVLDTNDNSPQLKITYLPPHNGDKAIRSENSLINTNIAYILVTDKDSNTNSQTELKITN----GDDEGCFKVEFL--GFYFIQLQKPLDRELVPFYNLTLNVTDKGVPSRSTLGFVLIDVT--DVNDNSPAFTSNAYTANISELAQNGSYVLQLNATDPDEGDNGTVSYSITGGNDLG------WFQVDFQSGLVTTAKPLDRE-----QVSSVTITITAQDHGSAPKTGSTTVTVTIIDGNDNKPRFMKSSYKGTI---------SEGASIGATVLQVS-----ATDVD-SGDNGRITYEISSSDAQVNGLFEL-NTQTGVLWTKSQLDRET-KSLY-SFTVLAKDHGD-PQLMSSVKVELTISDINDNAPVFYPVEYFASIMENEPPG--KLLQ-VTATDADEGTNAVISYDIIGGNNNGN---FSIDSSTGVISTLASLDHEVEEFFSLIISAKDGGNKYAAKTAVVNVTVLNKADNLPVFLYEMYNFTVYENVPKGTLVGRVYAT---TKDKNGSISYAIVS-GDPTNLFLVDSTGGIIKINGDMDREEKAQYLLAVIAR----VGTVKPLSAQATVNIEVLDRNDNAPQFS-----TSSVIVDIDGTWL---VGQVVYNAAAVDLDA-GKNGLVRYQLTSNAEGLLWINSTSGVIKLARKLTDGDETQYTVQVLASDSGSPPQHS 930          

HSP 2 Score: 179.489 bits (454), Expect = 1.060e-45
Identity = 171/598 (28.60%), Postives = 274/598 (45.82%), Query Frame = 2
Query:  440 ILIKVLDENDNSPKFLPFLNPYQTLPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLIS--PLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSK-LVNVISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVI----RKGEIVSRSITMFENEPARTIVASLQVSDRDSLV---TDIECSLDDYHLNFEITAINEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLT-IHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIF 2200
            + ++V D NDN P+F P L     + E+  +NT   + +A D D+   G   Y I+      N + F+L          L +I+  PLDRE    Y+  + A DR       +    + I + D ND+ PVF +  Y  +I E++K  V+++     D D G N  +   I    D+   Q    F +D S    TG IR    +D+E     Y+FN+IA+D G+P  +  A V I +++ ND +P +K+       G+   RS    EN    T +A + V+D+DS     T+++ +  D    F      ++  LG Y    I   KPLDRE      L +N+     DK  P  + L  + I++ D+NDN P FT + Y   + E + Q    +++ +   D D G N  V+Y I       D  +F +D  SG +++ + +D E+    +  I A D   +  + +  + V +ID NDN P F K  Y  T+ E   +   + Q+  TD+D+    +I      S      +  ++  +G L T   +DRE     +  + A++    Q   LM S   V +TI D+NDN P+F
Sbjct:   81 VQVQVDDINDNEPRF-PTLYYTLRIRESMDVNTTNPINTATDPDAGNNGTVDYTIASG---DNTATFSLGTTACPTGSTLCVITKKPLDRETTDFYQLNITATDRGTPAL--MGYCLINITILDENDHAPVFTQNSYLGSIAENTKPGVSILRVSAADRDSGSNGDIKYAI----DWDAIQSNSIFDLDSS----TGVIRTKQNLDFEVK-NSYTFNVIASDGGVPSKNDLATVTINVLDTNDNSPQLKITYLPPHNGDKAIRS----ENSLINTNIAYILVTDKDSNTNSQTELKITNGDDEGCF------KVEFLGFY---FIQLQKPLDRELVPFYNLTLNV----TDKGVPSRSTLGFVLIDVTDVNDNSPAFTSNAYTANISE-LAQNGSYVLQ-LNATDPDEGDNGTVSYSI---TGGNDLGWFQVDFQSGLVTTAKPLDREQVSSVTITITAQDHGSAPKTGSTTVTVTIIDGNDNKPRFMKSSYKGTISEGASIGATVLQVSATDVDSGDNGRITYEISSSDAQVNGLFELNTQTGVLWTKSQLDRETKSLYSFTVLAKDHGDPQ---LM-SSVKVELTISDINDNAPVF 637          

HSP 3 Score: 147.517 bits (371), Expect = 9.411e-36
Identity = 170/601 (28.29%), Postives = 274/601 (45.59%), Query Frame = 2
Query:  440 ILIKVLDENDNSPKFLPFLNPY-QTLPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTAN-----IVEHSKLV--NVISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPAR--TIVASLQVSDRDSLVTDIECSLDDYHLNFEITAINEIHPLG-HYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLT-PLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIP-QATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEAS-YQNKNLMDSECMVIITIEDVNDNPPIF 2200
            I I +LDEND++P F    N Y  ++ EN++    IL  SA D DS + G   Y I     I ++S F L       R +      LD EV + Y F + A D       D++   V I V D NDN P    T+   +     I   + L+  N+    VTD D   N Q  + I   +D      +  F+++F   L    I+L   +D E  P+ Y+  L  TD G+P  S+   V I + + ND +P           S + T   +E A+  + V  L  +D D          D+  +++ IT  N++      ++  ++ T KPLDRE    Q   + I  + QD  + P T + T+ + + D NDN P F +S Y+G + E     ATV  +      D D G N  +TY+I SS    +   F ++  +G + ++  +D E   L+SF ++A D     L S+  + + + D NDNAP+F    Y  ++ EN P   ++ Q+  TD D    N ++ Y      NN     +D ++G + T+  +D E     +++I+A++  + Y  K       +V +T+ +  DN P+F
Sbjct:  192 INITILDENDHAPVFTQ--NSYLGSIAENTKPGVSILRVSAADRDSGSNGDIKYAIDWD-AIQSNSIFDLDSSTGVIRTK----QNLDFEVKNSYTFNVIASDGGVPSKNDLA--TVTINVLDTNDNSPQLKITYLPPHNGDKAIRSENSLINTNIAYILVTDKDSNTNSQTELKITNGDD------EGCFKVEF---LGFYFIQLQKPLDRELVPF-YNLTLNVTDKGVPSRSTLGFVLIDVTDVNDNSPA--------FTSNAYTANISELAQNGSYVLQLNATDPD--------EGDNGTVSYSITGGNDLGWFQVDFQSGLVTTAKPLDRE----QVSSVTITITAQDHGSAPKTGSTTVTVTIIDGNDNKPRFMKSSYKGTISEGASIGATVLQVSAT---DVDSGDNGRITYEISSSDAQVNG-LFELNTQTGVLWTKSQLDRETKSLYSFTVLAKDHGDPQLMSSVKVELTISDINDNAPVFYPVEYFASIMENEPPG-KLLQVTATDAD-EGTNAVISYDIIGGNNNGN-FSIDSSTGVISTLASLDHEVEEFFSLIISAKDGGNKYAAKT-----AVVNVTVLNKADNLPVF 741          

HSP 4 Score: 124.405 bits (311), Expect = 1.049e-28
Identity = 169/617 (27.39%), Postives = 263/617 (42.63%), Query Frame = 2
Query:  695 LDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKL--VNVISFYVTDLDEGQNKQVSITIETENDYKKDQIKRF-FQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLV-TDIECSLDDYHLNFEITAINEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNL-TIHINLFDINDNPPVFTRS---KYQGELIENIPQATVKM-IEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGK-ISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIFSLINPAKSSLIFTINKGFRHENCQMIPYAVSDADHDEPNSDSCCILQLDNDQNGMLYLLSNTPNFLCLQNTMN--TPGIYRVSLTATDNKNNPNKSLKAKVSFNI 2509
            +DRE  ++    L+ ++  N        + V+++V DINDN P F   +YT  I E   +   N I+   TD D G N  V  TI +      D    F       P+  T  +     +D ET  + Y  N+ ATD G P L     +NI ++++ND APV          S   ++ EN      +  +  +DRDS    DI+     Y ++++    N I  L      +I T + LD E  KN Y   N+  SD     P   +L T+ IN+ D NDN P    +    + G+       + +   I  IL  DKD   N+    KI    N  D   F ++      I  ++ +D E    ++  +   DK   + S+   +++ V D NDN+P F    Y+  + E     + + Q+  TD D   +N  V Y   +  N+     VD  SG + T  P+DRE+V S+TI ITA++  S            V +TI D NDN P F      KSS   TI++G       ++  + +D D  +    +  I   D   NG+  L + T   L  ++ ++  T  +Y  ++ A D+  +P      KV   I
Sbjct:   57 IDRETTTQISLQLRTLNPSNQP------ISVQVQVDDINDNEPRFPTLYYTLRIRESMDVNTTNPIN-TATDPDAGNNGTVDYTIAS-----GDNTATFSLGTTACPTGSTLCVITKKPLDRETTDF-YQLNITATDRGTPALMGYCLINITILDENDHAPVFTQ------NSYLGSIAENTKPGVSILRVSAADRDSGSNGDIK-----YAIDWDAIQSNSIFDL-DSSTGVIRTKQNLDFE-VKNSY-TFNVIASDGG--VPSKNDLATVTINVLDTNDNSPQLKITYLPPHNGDKAIRSENSLINTNIAYILVTDKDSNTNSQTELKI---TNGDDEGCFKVEFLGFYFIQLQKPLDRELVPFYNLTLNVTDKGVPSRSTLGFVLIDVTDVNDNSPAFTSNAYTANISELAQNGSYVLQLNATDPD-EGDNGTVSY-SITGGNDLGWFQVDFQSGLVTTAKPLDREQVSSVTITITAQDHGSAPKTG----STTVTVTIIDGNDNKPRF-----MKSSYKGTISEG-ASIGATVLQVSATDVDSGDNGRITYEISSSDAQVNGLFELNTQT-GVLWTKSQLDRETKSLYSFTVLAKDH-GDPQLMSSVKVELTI 627          

HSP 5 Score: 105.145 bits (261), Expect = 8.475e-23
Identity = 160/695 (23.02%), Postives = 283/695 (40.72%), Query Frame = 2
Query:  557 AIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKLVNVISFYVTD-LDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDE---IDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRD------SLVTDIECSLDDYHLNFEITAINEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKV----RSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIFSLINPAKSSLIFTINKGFRHENCQMIPYAVSDADHDEPNSDSCCILQLDNDQNGMLYLLSNTPNFLCLQNTMNTPGIYRVSLTATDNKNNPNKSLKAKVSFNIDVRHEVSDNPFSEKSDNKVHTTKNQYYNPS 2599
            A+D DS   G  +Y I +    GN+    L      G+  L +   L + +   Y  I++A D         + V V I + D ND+  +F    +   + E+S    ++   V   LD  + K +  ++ +   +        F +D     +T  +RL  E    +  +N Y      +  D  + R    A V + + + ND APV    R    ++ S       P   I A +   + D      SLV+     +D + +N   ++  E+H             K LDRE   +  L +    +D      L +   I I + D ND  PVF  S Y   + E+    +  ++  +   DKD G+N  + Y I    N      F +++ +G++   +S+D+E  +L+   I A D     LSST  + V+V+D NDNAP+FP    + TVRENV     +G+   +D DT     I   F        +   V+  + ++ TI  ID E +     S  +++ A ++ S +    + +   + + + D NDN P F  ++P  ++   ++N         ++     D D    NS+      + +  NG   L  +T     +    + P IY++++ A+D    P++  +  VS  +     +   P    +D +   T+N+    S
Sbjct:  970 AVDQDSGKNGQLFYSIPQ----GNEEG--LFGIFPGGK--LYIRKSLLQALKGSYDLIVRATDGGVPSFS--ASVPVTIYIQDSNDHRSLFVNNTFRFAVAENSSPGTLVGTLVAHALDHSRTKDIVYSLISSESH--------FAVDVRSGQITTRVRLDREELIKNTGSNVYIMQAEAMYNDTTIKR--DKAIVIVTVTDLNDNAPVFS--RAVYAITVSELSLPGSPVFRIKA-MDADEGDNAKFFYSLVSG--TGMDKFFIN---SSTGELH-----------LSKTLDRETTSSYNLVVK--ATDASNAN-LYSTAKIEITVGDSNDQRPVFPESDYTVNITEDALIGS--LVINLNASDKDIGQNGLIKYSI---SNGNLAAMFDVESATGRLIVAKSLDFETTQLYELTITAQDHGLIPLSSTVNVTVNVLDVNDNAPLFPTQPVTLTVRENVNTGFPVGRCTASDRDTGTNAHIA--FSMYSQTPSKTFSVNSATCEITTIAAIDLETMPAGRDSFQLVVMATDQGSPK----LSTRKSITVQVTDENDNSPGF--VSPPAAAAGSSLN---------VMTITAEDPDR---NSNGKVTYSIISGNNGYFNLHPSTGQLQMIHQIPDNPTIYQLTIQASDG-GQPSRQTQTVVS--VFKEGPIGGGPTFSSADYQGSVTENKVAGTS 1594          

HSP 6 Score: 78.5666 bits (192), Expect = 1.269e-14
Identity = 70/276 (25.36%), Postives = 116/276 (42.03%), Query Frame = 2
Query: 1379 IINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTL-DKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGK---ISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPP 2194
            +I+T   +DRE      L++         L P    +++ + + DINDN P F    Y   + E++    V    PI T  D D G N  V Y I S  N+  +   T    +G    + +++ +D E    +  NI A D+    L    LI + ++D ND+AP+F +  Y  ++ EN      I ++   D D+     I          +  +  +D ++G ++T   +D E   S T  + A +       +L      V I + D NDN P
Sbjct:   50 VISTTARIDRETTTQISLQLR-------TLNPSNQPISVQVQVDDINDNEPRFPTLYYTLRIRESMD---VNTTNPINTATDPDAGNNGTVDYTIASGDNTATFSLGTTACPTGSTLCVITKKPLDRETTDFYQLNITATDRGTPALMGYCLINITILDENDHAPVFTQNSYLGSIAENTKPGVSILRVSAADRDSGSNGDIKYAIDWDAIQSNSIFDLDSSTGVIRTKQNLDFEVKNSYTFNVIASDGGVPSKNDL----ATVTINVLDTNDNSP 311          
BLAST of Protocadherin Fat 1 vs. Ensembl Nematostella
Match: EDO48237 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RKF4])

HSP 1 Score: 171.4 bits (433), Expect = 4.712e-43
Identity = 213/714 (29.83%), Postives = 325/714 (45.52%), Query Frame = 2
Query:  440 ILIKVLDENDNSPKFLPFLNPYQT-LPENSQINTVILLPSAIDLDSEAFG-IKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKLVNVI-SFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIAT--DNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMF-ENEPARTIVASLQVSDRDSLV-TDIECSLDDYHLNFEITAINEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLT-IHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQV--IHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIFSLINPAKSSLIFT-INKGFRHENCQMIPYAVSDADHDEPNSDSCCILQLDNDQNGMLYLLSNTPNFLCLQNTMNTPGI--YRVSLTATDNKNNPNK-SLKAKVSFNIDVRHEVSDNP 2539
            + I VLD NDN P F    N Y   +PE+  I   +L   A D DS + G +KY  ++     G++S F++ +   SG   + ++  LDRE +  Y   ++A D+ N      + V V+I + D+ND  P F K  Y+A I E   +  ++ +   TD D+G N +V   I + ND        FF I+     + G +R+  ++DYE       FNL+ T  D G P L +   V+I LI+ ND AP         + S   TM  EN         +Q  D+D     +I  S     L F   +INE           I+  + LDRE    +  K       +DK  P       I I L DINDNPP F++ +Y   + EN    T   +  +  +D D G    V Y I SS        F I+   G I+   +++Y    ++ F++ A D     LSSTAL+ V+V D+N +AP F +  YS  V+E+  + T +  +  TD DT    KI      SY+    V    VD+ +G +KT G +DREKV +    +TA +    Q    + ++  V I I DVNDN P+F  + P+  + +   I  G R     +I  + SDAD  + N+        + D  G  + + +T   +     ++   I  Y +++ ATD    P + S+K KV     +  +V D+P
Sbjct:  114 LTINVLDVNDNGPIFE--RNIYAADIPEDKSIGDFVLAVRASDADSGSNGEVKYCILNSD---GDNSAFSIGE--VSG--AVTVMKKLDREKVPTYTLQVQAQDQGNPPRS--ATVTVKITLLDVNDCTPQFSKKVYSATIREDVPVNQLVTTVRATDCDQGSNGEVFFEIVSGNDMN------FFSIN----RINGEVRVKQKLDYEMIGV---FNLLVTAQDKGQPFLYNQTTVDIALIDVNDNAPQF-------VSSHFQTMIPENYAVGQEFYRVQAYDKDHGTNGEITFSFMQNDLPF---SINE-------NTGGISIKEELDRE----KVPKFTFGIKARDKGVPFKEGTAQITITLLDINDNPPKFSQEEYHTSIAENSRWGT--SVLQVKAIDPDSGPTN-VVYSIVSSSGHD--RCFRINPQ-GLITLSCTLNYNTKHVYVFSVSASD---GMLSSTALVYVNVTDSNTHAPEFKRRSYSAEVKEDASLGTSVLTVLATDRDTGSNAKI------SYSIATLVPEFSVDETTGVIKTAGSLDREKVDTYRFEVTATDHGIPQ----LKAKSFVYIHIADVNDNDPVF--LKPSYEAKVREDIRPGGR-----VIEVSASDADIGK-NAQIIYSFASNGDGQGT-FTIDSTQGIIRTLKPLDRETIPEYELTVVATDQGTPPGQASVKVKV-----ILEDVKDSP 749          

HSP 2 Score: 167.548 bits (423), Expect = 6.945e-42
Identity = 153/595 (25.71%), Postives = 275/595 (46.22%), Query Frame = 2
Query:  440 ILIKVLDENDNSPKFLPFLNPYQTLPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKLVNVISFY---VTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITAINEIHPLGHYKEFIIN-----TLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIF 2200
            + I +LD ND +P+F   +    T+ E+  +N ++    A D D  + G  +++I    + GND +F  +++I     ++ +   LD E+I  +  ++ A D+      + +   V+I + D+NDN P F  + +   I E+  +     FY     D D G N +++ +   +ND           + FS +  TG I + +E+D E  P K++F + A D G+P    TA++ I L++ ND  P      K        ++ EN    T V  ++  D DS  T++  S+              +   GH + F IN     TL      + K+ Y+  ++  SD      L++   +++N+ D N + P F R  Y  E+ E+    T  +   +L  D+D G NA ++Y I     +T    F++D  +G I +  S+D EK   + F + A D     L + + + +H+ D NDN P+F KP Y   VRE++     + ++  +D D     +I+ Y   S  +      +D   G ++T+ P+DRE +    + + A ++ +   +    +   V + +EDV D+PP+F
Sbjct:  220 VKITLLDVNDCTPQFSKKVYS-ATIREDVPVNQLVTTVRATDCDQGSNGEVFFEI----VSGNDMNFFSINRING---EVRVKQKLDYEMIGVFNLLVTAQDKGQPFLYNQT--TVDIALIDVNDNAPQFVSSHFQTMIPENYAVGQ--EFYRVQAYDKDHGTNGEITFSF-MQND-----------LPFSINENTGGISIKEELDREKVP-KFTFGIKARDKGVPFKEGTAQITITLLDINDNPP------KFSQEEYHTSIAENSRWGTSVLQVKAIDPDSGPTNVVYSI--------------VSSSGHDRCFRINPQGLITLSCTLNYNTKHVYV-FSVSASDG----MLSSTALVYVNVTDSNTHAPEFKRRSYSAEVKEDASLGTSVLT--VLATDRDTGSNAKISYSI-----ATLVPEFSVDETTGVIKTAGSLDREKVDTYRFEVTATDHGIPQLKAKSFVYIHIADVNDNDPVFLKPSYEAKVREDIRPGGRVIEVSASDADIGKNAQII-YSFASNGDGQGTFTIDSTQGIIRTLKPLDRETIPEYELTVVATDQGTPPGQ----ASVKVKVILEDVKDSPPLF 752          

HSP 3 Score: 155.606 bits (392), Expect = 4.001e-38
Identity = 143/510 (28.04%), Postives = 241/510 (47.25%), Query Frame = 2
Query:  470 NSPKFLPFLNPYQTLPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISG-VEVEIKVGDINDNPPVFDKTFYTANIVEHSKLVN-VISFYVTDLDEGQNKQVSITI-ETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVI--KVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITAINEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIY---CSDQDKLTPLTTN-LTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKI 1972
            N+P     L    ++ E++++ TV+   SA D DS + G+  Y +S    + + ++F++ D+I      +     LDRE +  + F +KA   E+     + G +++ I V D+NDN P+F++  Y A+I E   + + V++   +D D G N +V   I  ++ D             FS   ++G++ ++ ++D E  P  Y+  + A D G P  S+T  V I L++ ND  P    KV         S T+ E+ P   +V +++ +D D           +  + FEI + N+++       F IN +    R   K  Y  I ++    + QDK  P   N  T+ I L D+NDN P F  S +Q  + EN   A  +    +   DKDHG N  +T+    +        F+I+ ++G IS ++ +D EK   F+F I A DK       TA I + ++D NDN P F +  Y  ++ EN    T + Q++  D D+ P N +
Sbjct:   15 NNPPQFSRLQEDASVSEDAEVGTVVATVSASDPDSGSNGMIRYSMSPSQNLMSATYFSI-DQITG---VITTKRGLDREFLDRHFFRVKA---EDGGEPSLEGYMDLTINVLDVNDNGPIFERNIYAADIPEDKSIGDFVLAVRASDADSGSNGEVKYCILNSDGDNSA----------FSIGEVSGAVTVMKKLDREKVP-TYTLQVQAQDQGNPPRSATVTVKITLLDVNDCTPQFSKKVY--------SATIREDVPVNQLVTTVRATDCD--------QGSNGEVFFEIVSGNDMN------FFSINRINGEVRVKQKLDYEMIGVFNLLVTAQDKGQPFLYNQTTVDIALIDVNDNAPQFVSSHFQTMIPENY--AVGQEFYRVQAYDKDHGTNGEITFSFMQNDLP-----FSINENTGGISIKEELDREKVPKFTFGIKARDKGVPFKEGTAQITITLLDINDNPPKFSQEEYHTSIAENSRWGTSVLQVKAIDPDSGPTNVV 477          

HSP 4 Score: 140.969 bits (354), Expect = 1.040e-33
Identity = 157/589 (26.66%), Postives = 271/589 (46.01%), Query Frame = 2
Query:  446 IKVLDENDNSPKFLPFLNPYQTL-PENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKL-VNVISFYVTDLDEGQNKQV-SITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLV-TDIECSLDDYHLNFEITAINEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIF 2200
            I ++D NDN+P+F+   + +QT+ PEN  +        A D D    G    +I+  F+  ND  F++ +        + +   LDRE + ++ F +KA D+        +  ++ I + DINDNPP F +  Y  +I E+S+   +V+     D D G    V SI   + +D       R F+I+  P    G I L   ++Y T  + Y F++ A+D     LSSTA V + + + N  AP  K  R+    S S  + E+    T V ++  +DRD+     I  S+      F +     +          I T   LDRE  K    +  +  +D   +  L     ++I++ D+NDN PVF +  Y+ ++ E+I +   ++IE +   D D GKNA + Y   S  N      FTID+  G I + + +D E    +   ++A D+      ++  + V + D  D+ P+F KP Y  TV E+ P  + +  ++    D  PE  ++    +   N+ QV  ++ N+G ++T+  +D E      + + A     +       +E  V++ ++D+NDN P+ 
Sbjct:  327 IALIDVNDNAPQFVS--SHFQTMIPENYAVGQEFYRVQAYDKDHGTNG----EITFSFM-QNDLPFSINENTGG----ISIKEELDREKVPKFTFGIKARDKGVPFKEGTA--QITITLLDINDNPPKFSQEEYHTSIAENSRWGTSVLQVKAIDPDSGPTNVVYSIVSSSGHD-------RCFRIN--PQ---GLITLSCTLNYNTK-HVYVFSVSASDG---MLSSTALVYVNVTDSNTHAPEFK--RR----SYSAEVKEDASLGTSVLTVLATDRDTGSNAKISYSIATLVPEFSVDETTGV----------IKTAGSLDRE--KVDTYRFEVTATDHG-IPQLKAKSFVYIHIADVNDNDPVFLKPSYEAKVREDI-RPGGRVIE-VSASDADIGKNAQIIYSFAS--NGDGQGTFTIDSTQGIIRTLKPLDRETIPEYELTVVATDQGTPPGQASVKVKVILEDVKDSPPLFEKPLYEVTVPEDTPPRSPVITVKAKSQDLSPETGMMYSIVRG--NSPQVFDINPNTGAIQTLMKLDYETQSEYRLTVRATLSPFF-------TETTVMVYLKDINDNTPVL 854          

HSP 5 Score: 132.494 bits (332), Expect = 3.929e-31
Identity = 119/466 (25.54%), Postives = 212/466 (45.49%), Query Frame = 2
Query:  812 DNPPVFDKTFYTANIVEHSKLVNVIS-FYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLV-TDIECSLDDYHLNFEITAINEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIFS 2203
            +NPP F +    A++ E +++  V++    +D D G N  +  ++    +        +F ID     +TG I     +D E    ++ F + A D G P L     + I +++ ND  P+ +      I +  I   E++     V +++ SD DS    +++  + +   +    +I E+          +  +K LDRE      L++     DQ    P +  +T+ I L D+ND  P F++  Y   + E++P    +++  +   D D G N  V ++I S     D  +F+I+  +G++  +Q +DYE   +F+  + A DK Q  L +   + + +ID NDNAP F   H+   + EN  V  E  +++  D D     +I      S+  N     +++N+G +     +DREKV   T  I AR++         +    + IT+ D+NDNPP FS
Sbjct:   15 NNPPQFSRLQEDASVSEDAEVGTVVATVSASDPDSGSNGMIRYSMSPSQNLMS---ATYFSID----QITGVITTKRGLDREFLD-RHFFRVKAEDGGEPSLEGYMDLTINVLDVNDNGPIFER----NIYAADIP--EDKSIGDFVLAVRASDADSGSNGEVKYCILNSDGDNSAFSIGEVSG-------AVTVMKKLDREKVPTYTLQVQA--QDQGN-PPRSATVTVKITLLDVNDCTPQFSKKVYSATIREDVP--VNQLVTTVRATDCDQGSNGEVFFEIVSGN---DMNFFSINRINGEVRVKQKLDYEMIGVFNLLVTAQDKGQPFLYNQTTVDIALIDVNDNAPQFVSSHFQTMIPENYAVGQEFYRVQAYDKDHGTNGEITF----SFMQNDLPFSINENTGGISIKEELDREKVPKFTFGIKARDKGV----PFKEGTAQITITLLDINDNPPKFS 443          

HSP 6 Score: 90.1225 bits (222), Expect = 3.487e-18
Identity = 121/452 (26.77%), Postives = 195/452 (43.14%), Query Frame = 2
Query:  392 VFSFQVDSGIKISSFYILIKVLDENDNSPKFLPFLNPYQT-LPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLL--ISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKLVN-VISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRD-SLVTDIECSLDDYHLNFEITAINEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENI--PQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKIS 1726
            VFS     G+  S+  + + V D N ++P+F      Y   + E++ + T +L   A D D+ +     Y I+           TL+ + +      ++     LDRE +  YRF + A D      +  S V + I   D+NDN PVF K  Y A + E  +    VI    +D D G+N Q+  +  +  D +       F ID +     G IR +  +D ET P +Y   ++ATD G P   ++ KV +IL +  D  P+       E     +T+ E+ P R+ V +++   +D S  T +  S+    +      + +I+P        I TL  LD E      L +      +  L+P  T  T+ + L DINDN PV         + E    P+A  K    I   D D      +T+K+    N+ +W   T++A SG++S
Sbjct:  513 VFSVSASDGMLSSTALVYVNVTDSNTHAPEFK--RRSYSAEVKEDASLGTSVLTVLATDRDTGSNAKISYSIA-----------TLVPEFSVDETTGVIKTAGSLDREKVDTYRFEVTATDHGIPQLKAKSFVYIHI--ADVNDNDPVFLKPSYEAKVREDIRPGGRVIEVSASDADIGKNAQIIYSFASNGDGQGT-----FTIDST----QGIIRTLKPLDRETIP-EYELTVVATDQGTPPGQASVKVKVILEDVKDSPPLF------EKPLYEVTVPEDTPPRSPVITVKAKSQDLSPETGMMYSI----VRGNSPQVFDINP----NTGAIQTLMKLDYETQSEYRLTV------RATLSPFFTETTVMVYLKDINDNTPVLEAFHMNINVQEGKVPPEARYK----IPAYDPDVSDK--LTFKV-MEGNAKEW--VTLNATSGELS 910          
BLAST of Protocadherin Fat 1 vs. Ensembl Nematostella
Match: EDO40470 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S751])

HSP 1 Score: 171.014 bits (432), Expect = 6.431e-43
Identity = 194/681 (28.49%), Postives = 296/681 (43.47%), Query Frame = 2
Query:  380 ECCTVFSFQV---DSGIKISSFYILIKVLDENDNSPKFLPFLNPYQTLPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKLVNVIS-FYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTD-IECSLDDYHLNFEITAINEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLT-PLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIH--VDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIFSLINPAKSSLIFTINKGFRHENCQMIPYAVSDADHDEPNSDSCCILQLD------NDQNGMLYLLS 2380
            E  + ++FQV   D G +  +  + + + D NDN P F P     +   EN++I   I    AID DS  F I  + I +    GN      +D    G   + L   LDRE    Y   +KAVD    D   ++   V I V D+ND PP+F K  Y   I EHS+ ++VI   +    D+G N +V  +I   N    D I             TG++ L  E+D+E  P  Y   + A D G P L   A V I +I+ ND +P         I+ R   + E+ P      ++ V D DS V   +  SL    L+   T  N     G      ++  K +D  +    Y    +    QD  + P ++   + + + D+ND  PVF    Y   ++E  P  +  +IE + T D D G+N  ++Y  DS  +++ +       + GKI  +  +D E  + ++  +IAID      SS+A + V V D NDN P F +  Y+F V+EN PV T +G +  +D D           H +Y  + QV    VD+ +GK+ T   +DRE   S    I A +  S    +    +  V + + DVND  P FS     K+    T+N+        ++    +D D   PNSD   ++         N   G+L L+S
Sbjct:  562 EVQSSYTFQVAATDGGGRSCNATVHVSLTDLNDNQPVFDPSSYSVEYF-ENTRIGQSICQLKAIDRDSPKFAITRFIIEQ----GNADEVFSVD----GSGLITLAKLLDRETQDNYLLTVKAVDGGGQDS--VNKAIVNITVLDVNDEPPIFSKAEYNFTIQEHSQALSVIGHVHAISRDKGTNAEVVYSISKGN---TDNIVLINS--------TGTLYLQSEVDHEKIPSLY-LTVQAKDKGTPPLFGYANVTIAVIDINDNSPQFN---SSSILVR---LPEDTPIGHTFYTVSVFDADSGVLGRVSFSL----LSNPGTLFNLDSNTGA-----LSLTKLIDYGNSARSY---TLPVQAQDGGSPPRSSTAMLELKVVDVNDYSPVFGNWSYTAHVLETTPPDS-NIIEVVAT-DVDSGENGRISYAFDSKVDTSKFGL----RNGGKIFIKSKLDREDIEEYNLKVIAIDHGTPRRSSSADVKVIVDDVNDNNPHFQQASYAFFVKENEPVATYLGAVSASDSDEGSNG------HVTYRFDTQVAQFIVDKQTGKITTSQVLDREAKASYVFSIVATDGGSSPRVD----KTQVTVIVRDVNDCSPKFS-----KNKYSVTVNEDL-PVGSSLLTLIATDDDQQGPNSDITYMIVAGPKAFSLNQVTGVLTLVS 1179          

HSP 2 Score: 145.591 bits (366), Expect = 4.083e-35
Identity = 161/589 (27.33%), Postives = 260/589 (44.14%), Query Frame = 2
Query:  446 IKVLDENDNSPKFLPFLNPYQTLPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKLVNVISFY---VTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITAINEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPL-TTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIF 2200
            I VLD ND  P F      + T+ E+SQ  +VI    AI  D        Y ISK    GN  +  L++   +    L L S +D E I      ++A D+            V I V DINDN P F+ +     + E + + +  +FY   V D D G   +VS ++ +            F +D +    TG++ L   IDY  +   Y+  + A D G P  SSTA + + +++ ND +PV          S +  + E  P  + +  +  +D DS         ++  +++   +  +    G      I     LDRED +   LK+       D  TP  +++  + + + D+NDN P F ++ Y   + EN P AT   +  +   D D G N +VTY+ D     T    F +D  +GKI++ Q +D E    + F+I+A D   S       + V V D ND +P F K  YS TV E++PV + +  +  TD D +  N  + Y         +   ++Q +G L  + P+DRE      + + A ++   Q+   +++   + I + DVNDN P+F
Sbjct:  691 ITVLDVNDEPPIFSKAEYNF-TIQEHSQALSVIGHVHAISRDKGTNAEVVYSISK----GNTDNIVLINSTGT----LYLQSEVDHEKIPSLYLTVQAKDKGTPPL--FGYANVTIAVIDINDNSPQFNSSSILVRLPEDTPIGH--TFYTVSVFDADSGVLGRVSFSLLSNP-------GTLFNLDSN----TGALSLTKLIDYGNSARSYTLPVQAQDGGSPPRSSTAMLELKVVDVNDYSPVFGNW------SYTAHVLETTPPDSNIIEVVATDVDSG--------ENGRISYAFDSKVDTSKFGLRNGGKIFIKSKLDREDIEEYNLKVIAI----DHGTPRRSSSADVKVIVDDVNDNNPHFQQASYAFFVKENEPVAT--YLGAVSASDSDEGSNGHVTYRFD-----TQVAQFIVDKQTGKITTSQVLDREAKASYVFSIVATDGGSSPRVDKTQVTVIVRDVNDCSPKFSKNKYSVTVNEDLPVGSSLLTLIATDDDQQGPNSDITYM---IVAGPKAFSLNQVTGVLTLVSPLDREVTHRHILHVVASDKGGNQS---LETITYIEINVLDVNDNYPVF 1224          

HSP 3 Score: 143.665 bits (361), Expect = 1.621e-34
Identity = 173/629 (27.50%), Postives = 283/629 (44.99%), Query Frame = 2
Query:  431 SFYILIKVLDENDNSPKFLPFLNPYQTLPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSH-FTLLDKI-ASGRPQLLLIS-----PLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKL-VNVISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLP-RLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLV-TDIECSLD--DYHLNFEITAINEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPIL-TLDKDHGKNAYVTYKIDSSKNSTDW-EYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIFSLINPAKSSLIFTINKGFRHENCQM 2275
            S+ +L+ V D NDNSP F+   +    + EN +     L+  A+D D  +   + Y I    + GN  + F L+ K    G     L+       +DRE +  Y   + A D  N  +     + + I V D NDN P F    Y+  I E+  +  +++    +D D G N ++  +IET +D +       F I  +  ++  ++RL    DYE     Y   + A D G   +LSS+A V I +++ ND  PVI V      +  S  + EN    T VA + VSD DS    ++  +L+  D + + +   +N+        E II   + LDRE   + +LK    C D+    P TT  +  IN+ D+ND  P F R  Y+  + EN   ATV  +  I+  +D+D G N+ + Y I ++  S  +  +F ID  SG I++   +D E+       ++  D+    LS    +IV++ D+NDN P F +  Y+ ++ EN P  + + Q+   D D   EN ++ Y   S         +D   G +     +D E   S T  + A +               V +++ D+NDN P+F   +P+  S+ +  N       CQ+
Sbjct:   41 SYTVLVYVQDLNDNSPSFVRGTSAKLVVFENDKDFRQKLI--AVDSDFGSNSTQSYTI----VSGNVGNVFKLISKRDTDGDLYADLVVNASSIGVDRERLDSYVLNISASDGGNPANHGF--LRLSITVEDTNDNKPEFSNVSYSGTIPENIDVGTSILQVSASDKDIGTNAEIQYSIETHSDPQA-----IFGIHPTTGVIVNNVRL----DYEAK-RSYLIVVKAEDKGSSHQLSSSAIVRIEVLDVNDNNPVIHV---SYTLGGSYQVTENATIGTQVARVSVSDADSGKNGEVNVTLEGGDGYFSMKFDVLND--------ESIIAVGQSLDRETHDHFFLKA--VCIDKGD-PPRTTEKSFRINVGDVNDCAPKFDRHTYETRVWEN---ATVNTLVAIVNAVDQDFGSNSELVYTIANTTESRSYLHWFAIDPSSGMITTATDLDREQIPQVVLTVLVHDRGSPPLSDNCSVIVNLTDSNDNDPYFNQSSYNASLFENSPSGSPVVQLLAQDPDIG-ENSLILY---SILTPNTPFFLDPRKGLVTNSRTLDHEVQSSYTFQVAATDGGGRS------CNATVHVSLTDLNDNQPVF---DPSSYSVEYFENTRIGQSICQL 621          

HSP 4 Score: 142.124 bits (357), Expect = 4.656e-34
Identity = 162/602 (26.91%), Postives = 266/602 (44.19%), Query Frame = 2
Query:  428 SSFYILIKVLDENDNSPKF---LPFLNPYQTLPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKLVNVISFY-VTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITAINEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIEN--IPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEAS-----YQNKNLMDSECMVIITIEDVNDNPPIF 2200
            SS  + I+VLD NDN+P           YQ + EN+ I T +   S  D DS   G     +      G D +F++   + +    + +   LDRE  +   F LKAV  +  D    +     I VGD+ND  P FD+  Y   + E++ +  +++     D D G N ++  TI   N  +      +F ID S  ++T +     ++D E  P +    ++  D G P LS    V + L + ND  P           S + ++FEN P+ + V  L   D D      E SL    + + I   N    L   K  + N+ + LD E   +   ++    +D    +    N T+H++L D+NDN PVF  S Y  E  EN  I Q+  ++      +D+D  K A   + I+        E F++D  SG I+  + +D E    +   + A+D    +  + A++ + V+D ND  PIF K  Y+FT++E+    + IG +     D     ++V    K  T+N  +I+   ++G L     +D EK+ S+ + + A+++ +     Y N         V I + D+NDN P F
Sbjct:  261 SSAIVRIEVLDVNDNNPVIHVSYTLGGSYQ-VTENATIGTQVARVSVSDADSGKNGEVNVTLE-----GGDGYFSMKFDVLNDESIIAVGQSLDRE--THDHFFLKAVCIDKGDPPRTTEKSFRINVGDVNDCAPKFDRHTYETRVWENATVNTLVAIVNAVDQDFGSNSELVYTIA--NTTESRSYLHWFAIDPSSGMITTAT----DLDREQIP-QVVLTVLVHDRGSPPLSDNCSVIVNLTDSNDNDPYFNQ------SSYNASLFENSPSGSPVVQLLAQDPDIG----ENSL----ILYSILTPNTPFFLDPRKGLVTNS-RTLDHEVQSSYTFQV--AATDGGGRS---CNATVHVSLTDLNDNQPVFDPSSYSVEYFENTRIGQSICQL----KAIDRDSPKFAITRFIIEQGNAD---EVFSVDG-SGLITLAKLLDRETQDNYLLTVKAVDGGGQDSVNKAIVNITVLDVNDEPPIFSKAEYNFTIQEHSQALSVIGHVHAISRDKGTNAEVVYSISKGNTDNIVLIN---STGTLYLQSEVDHEKIPSLYLTVQAKDKGTPPLFGYAN---------VTIAVIDINDNSPQF 807          

HSP 5 Score: 137.117 bits (344), Expect = 1.574e-32
Identity = 161/606 (26.57%), Postives = 261/606 (43.07%), Query Frame = 2
Query:  446 IKVLDENDNSPKFLPFLNPYQTLPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLISP----------LDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTAN---IVEHSKL-VNVISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITAINEIHPLGHY-----KEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTP-LTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIFS 2203
            I V D NDN P+F   ++   T+PEN  + T IL  SA D D                IG ++      +  S    +  I P          LD E    Y  ++KA D+    H+  S   V I+V D+NDN PV   ++       + E++ +   V    V+D D G+N +V++T+E  + Y        F + F        I +   +D ET+ + +    +  D G P  ++     I + + ND AP      K +  +    ++EN    T+VA +   D+D           +  L + I    E     H+        +I T   LDRE      L + ++    D+ +P L+ N ++ +NL D NDN P F +S Y   L EN P  +   +  +L  D D G+N+ + Y I +         F +D   G +++ +++D+E    ++F + A D      S  A + V + D NDN P+F    YS    EN  +   I Q++  D D+ P+  I ++  +   N  +V  VD  SG +     +DRE   +  + + A +     + N    + +V IT+ DVND PPIFS
Sbjct:  160 ITVEDTNDNKPEF-SNVSYSGTIPENIDVGTSILQVSASDKD----------------IGTNAEIQYSIETHSDPQAIFGIHPTTGVIVNNVRLDYEAKRSYLIVVKAEDK-GSSHQLSSSAIVRIEVLDVNDNNPVIHVSYTLGGSYQVTENATIGTQVARVSVSDADSGKNGEVNVTLEGGDGY--------FSMKFDVLNDESIIAVGQSLDRETHDH-FFLKAVCIDKGDPPRTTEKSFRINVGDVNDCAP------KFDRHTYETRVWENATVNTLVAIVNAVDQDFG--------SNSELVYTIANTTESRSYLHWFAIDPSSGMITTATDLDREQIPQVVLTVLVH----DRGSPPLSDNCSVIVNLTDSNDNDPYFNQSSYNASLFENSPSGS--PVVQLLAQDPDIGENSLILYSILTPNTP-----FFLDPRKGLVTNSRTLDHEVQSSYTFQVAATDG--GGRSCNATVHVSLTDLNDNQPVFDPSSYSVEYFENTRIGQSICQLKAIDRDS-PKFAITRFIIEQ-GNADEVFSVD-GSGLITLAKLLDRETQDNYLLTVKAVDGGGQDSVN----KAIVNITVLDVNDEPPIFS 704          

HSP 6 Score: 125.946 bits (315), Expect = 4.240e-29
Identity = 186/704 (26.42%), Postives = 299/704 (42.47%), Query Frame = 2
Query:  422 KISSFYILIKVLDENDNSPKFLPFLNPYQT-LPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRE-NDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKLVNVISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSI---TMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITAINEIHPLG---HYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPL-TTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIFS--------LINPAKSSLIFTINKGFRHENCQMIPYAVSDADHDEPNSDSCCILQLDNDQN--GMLYLLSNTPNFLCLQNTMNTP-GIYRVSLTATDNKNNP 2473
            K S   + I V D NDN P F    NP  T + EN  INT +    A D DS      +Y I         +HF    KI S    +    P+DRE ISEY   ++A D+   +  R  +   ++I + D+NDN P F     T  + +      V S    D D GQ   V   I + +  K           FS  L TG ++LI  +DYE  P +Y+ ++ ATD G P L+S    N+++++ ND  P           +R +   T+ EN+P  T V  +   DRDS          +  L + I +  E+       H    + N++  LDRE     +L ++          P   ++ ++ IN+ D NDNPP F       ++ EN P    ++I  +   D D+G N  V Y I S   +TD   FTI   +G++S+   +D E    +  ++ A D      ++ A I + + D NDN P+F +  YS T+ E  P  T I  +  +D D+     IV        + Y V  +D  +G + +    +    +       A++    Q ++   +   V I IED N++ P F+          N + S+L+  +                +DAD D+ +++     +LD+ +N   +  + SNT +        N P G + + + A D+ + P
Sbjct: 1310 KTSYQLVTIYVEDANDNRPTFDK--NPIITWIYENVPINTNVTTIKAHDDDSGLNSRIWYTIDSQ---SPRAHF----KINSETGLIQTTHPIDREEISEYSLKVRATDQAFTEQDRLYNTATLKIIIQDLNDNAPKFVSRNLTYVMEDEPFNFQVTSITALDPDTGQGGNVEYRIVSPDTGK-----------FSLDLKTGVLKLIGSLDYEDVP-QYTLHISATDLGSPPLTSYQLFNVVVVDVNDNPPEF---------TRDLFIGTVSENKPTGTSVVKVTAYDRDSG--------SNAELTYSIPSGVEMDKFSIDKHSGLIVTNSI--LDREKKDTYFLTVHATGVSY----PFRVSSTSVRINVMDRNDNPPKFISPVVTLKVPENSP---ARLIYTLTVQDLDYGNNTKVLYSIMSG--NTDGA-FTIGRSTGELSTTTKLDRETKASYQLSVQAKDITPPYYTAFANITIFIEDQNDNPPVFQQSLYSSTISELTPPGTSILNLTASDKDSGSNGNIVYTLSN---DTYGVYSIDSRTGIVYSAARFETSIKQEYNFFCIAKD----QGQDPKMAIVPVRIKIEDKNNHAPQFTKTPYEVHIFPNTSASALVTMV--------------TATDADTDK-STNGKVTYRLDDSKNSTSLFVVESNTGSVRTSAGFSNPPQGRHALYIIAEDHGSPP 1941          

HSP 7 Score: 119.398 bits (298), Expect = 4.033e-27
Identity = 174/749 (23.23%), Postives = 313/749 (41.79%), Query Frame = 2
Query:  437 YILIKVLDEN--DNSPKFLPFLNPYQTLPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEV-EIKVGDINDNPPVFDKTFYTANIVEHSKLVN---VISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLI--ATDNGLPRLSSTAKVNIILINKNDQAPVIKVI---------RKGEIVSRSITMFENEPARTI----------VASLQVS--DRDSLVTDIECSLDDYHLNFEITAINEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHG-KNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIFSLINPAKSSLIFTINKGFRHENCQMIPYAVSDADHDEPNSDSCCILQLDNDQNGMLYLLSNTPNFLCLQNTMN--TPGIYRVSLT--ATDNKNNPNKSLKAKVSFNIDVRHEVSDNPFSEKSDNKVHTTKN 2581
            Y +++++  N  D+ P+FL       ++PENS++ + I    A    S+A      +++   + GN      +D   +G   +     LD E    +R  L A  +       ++G  + +I V D NDN P F  +   A + E +       V+    TD+D G N +V+ +I T N+         F ID +    TG I     +D ET     SF+L+   TD+G+P  S+  +V +++ + ND  P+   +         R G +V+  +    ++ +R            +A L+VS  D+DS       S      +F IT  ++I         +I+  + +D    ++ +++I +   DQ  + P    + + I    I    P F    Y G++ EN    T  +   +   D   G     ++Y I++S       YF I   SG IS  + +DYE  + F   + AID    +      + ++V D ND  P+F +  Y     E +PV T +  +   D D+    ++  +F     ++     +D+ +G ++T   +D E +++  + + A +E S      M ++  V I + D+NDNPP+F +  P    ++  +    R        Y ++  D D   +       +     G L+L+     +L    T +     +Y+ SLT  ATD  N P   L + ++  ++V  E   +P   + D K     N
Sbjct: 1945 YGIVQIVIGNIQDDPPRFLNQTPARVSIPENSKVGSYITTVRA-RASSDA------QVTYSIISGNKGRAFYVDPF-TGVISVASADALDYESTKNFRLHLVATPQ---GWVSLNGYMILDINVIDRNDNSPAFHPSNMLAQLAEDTGAFKPRFVVKVTATDVDSGTNGKVTYSIWTGNE------AGVFTIDST----TGEITTAKLLDRETTA---SFDLVIRGTDSGIPPKSTNCQVKVVVTDLNDNPPLFDPLSEVNIREDTRTGAVVTSVVATDTDKESRLTYNLKSASTPGIAILRVSATDQDS------GSNAQIKYSFPITNSDQIDYKIDADTGVISARRTIDVRI-RDSFIQIPVQAMDQ-GVPPQRALVYVRI----IITREPKFELPSYFGKVPENAMMGTSVLT--VRVTDNAAGLPLGRISYNIENSN------YFRIGQRSGVISVNKPLDYETKRRFLLVVSAIDDTAPSKPVRVPVYINVSDVNDEKPVFGQSGYMAQWSEGIPVGTIVVNVSAADKDSGANGRV--WFAIQSGDDKGSFAIDRKTGVIRTQRALDHETIKTHHVSVRATDEGSPP----MHTDVSVTIRVLDLNDNPPVFRVPGPNDVQVLENLPLNSRL-------YEINATDRDSGANARLSFTVIGGTGQG-LFLIDKFSGWLTTNITFDYENTAVYQYSLTIKATDAGNPP---LSSNITIIVNVADEDEYDPSFNRMDYKFDVPGN 2632          

HSP 8 Score: 119.013 bits (297), Expect = 6.539e-27
Identity = 156/617 (25.28%), Postives = 262/617 (42.46%), Query Frame = 2
Query:  386 CTVFSFQVDSGIKISSFYILIKVLDENDNSPKFLPFLNPYQTL--PENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGN-DSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHS-KLVNVISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRD---SLVTDIECSLDDYHLNFEITAINEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKIS--SRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTE--IGQIETTDLDTRPENKIVKYFHKSYTNN-YQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIF 2200
             TV +  V    ++SS  + I V+D NDN PK   F++P  TL  PENS    +  L +  DLD   +G    K+    + GN D  FT    I     +L   + LDRE  + Y+  ++A D     +   + + + I+  D NDNPPVF ++ Y++ I E +    ++++   +D D G N  +  T+  +           + ID    ++  + R    I  E     Y+F  IA D G     +   V I + +KN+ AP              + +F N  A  +V  +  +D D   S    +   LDD   +  +  +      G  +     +  P  R         + I   D     PL     + I + +I D+PP F     Q     +IP+ + K+   I T+      +A VTY I S         F +D  +G IS  S  ++DYE  K F  +++A  +   +L+   ++ ++VID NDN+P F   +    + E+        + ++  TD+D+    K+    +  +T N   V  +D  +G++ T   +DRE   S  ++I   +           + C V + + D+NDNPP+F
Sbjct: 1614 LTVHATGVSYPFRVSSTSVRINVMDRNDNPPK---FISPVVTLKVPENSPARLIYTL-TVQDLD---YG-NNTKVLYSIMSGNTDGAFT----IGRSTGELSTTTKLDRETKASYQLSVQAKDITPPYYTAFANITIFIE--DQNDNPPVFQQSLYSSTISELTPPGTSILNLTASDKDSGSNGNIVYTLSNDT-------YGVYSIDSRTGIVYSAARFETSIKQE-----YNFFCIAKDQGQDPKMAIVPVRIKIEDKNNHAPQFTK------TPYEVHIFPNTSASALVTMVTATDADTDKSTNGKVTYRLDDSKNSTSLFVVES--NTGSVRTSAGFSNPPQGRH-------ALYIIAEDHGS-PPLRGYGIVQIVIGNIQDDPPRFLN---QTPARVSIPENS-KVGSYITTVRARASSDAQVTYSIISGNKG---RAFYVDPFTGVISVASADALDYESTKNFRLHLVATPQGWVSLNGYMILDINVIDRNDNSPAFHPSNMLAQLAEDTGAFKPRFVVKVTATDVDSGTNGKVT---YSIWTGNEAGVFTIDSTTGEITTAKLLDRETTASFDLVIRGTDSGIPPKS----TNCQVKVVVTDLNDNPPLF 2174          

HSP 9 Score: 117.472 bits (293), Expect = 1.662e-26
Identity = 182/642 (28.35%), Postives = 286/642 (44.55%), Query Frame = 2
Query:  326 QSAETYNSQQSSHSCKYDECCTVFSFQVDSGIKISSFYILIKVLDENDNSPKFLPFLNPYQ-TLPENSQINTVILLPSAIDLDSEA--FGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVE-VEIKVGDINDNPPVF--DKTFYTANIVEHSKLVNVIS-FYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYE-TNPYKYSFNLIATDNGLPRLSSTAK-VNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEIT-AINEIHPLGHYK----EFIINTLKPLDREDDKNQYLKINI---YCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIF 2200
            Q+ +   SQ      K     ++ +    S  ++    + + V D ND SPKF    N Y  T+ E+  + + +L   A D D +     I Y  ++ P        F+L +++      L L+SPLDREV   +R IL  V  +   ++ +  +  +EI V D+NDN PVF  + TF T  + E   + +V++     D D+G N +V   I   N          F+I+ +    TG I  +  +D+E TN  +Y   + ATD G  +  ++ + V I + + ND  P      K  I++    ++EN P  T V +++  D            DD  LN  I   I+   P  H+K      +I T  P+DRE+     LK+       ++QD+L       T+ I + D+NDN P F  S+    ++E+ P      +  I  LD D G+   V Y+I     S D   F++D  +G +    S+DYE    ++ +I A D     L+S  L  V V+D NDN P F +  +  TV EN P  T + ++   D D+   N  + Y   S         +D++SG + T   +DREK  +  + + A    SY       S   V I + D NDNPP F
Sbjct: 1067 QTGKITTSQVLDREAKASYVFSIVATDGGSSPRVDKTQVTVIVRDVNDCSPKFSK--NKYSVTVNEDLPVGSSLLTLIATDDDQQGPNSDITYMIVAGP------KAFSL-NQVTG---VLTLVSPLDREVT--HRHILHVVASDKGGNQSLETITYIEINVLDVNDNYPVFINETTFKT--VPEKLPIGSVVAAVLAVDSDQGDNGKVRYKIVNGN------TDGTFKINET----TGVISTLRALDFEVTN--RYVLRVSATDMGKKQQKTSYQLVTIYVEDANDNRPTFD---KNPIITW---IYENVPINTNVTTIKAHD------------DDSGLNSRIWYTIDSQSPRAHFKINSETGLIQTTHPIDREEISEYSLKVRATDQAFTEQDRLY---NTATLKIIIQDLNDNAPKFV-SRNLTYVMEDEPFNF--QVTSITALDPDTGQGGNVEYRI----VSPDTGKFSLDLKTGVLKLIGSLDYEDVPQYTLHISATDLGSPPLTSYQLFNVVVVDVNDNPPEFTRDLFIGTVSENKPTGTSVVKVTAYDRDSG-SNAELTYSIPSGV-EMDKFSIDKHSGLIVTNSILDREKKDTYFLTVHATG-VSYP---FRVSSTSVRINVMDRNDNPPKF 1646          

HSP 10 Score: 98.5969 bits (244), Expect = 1.057e-20
Identity = 143/571 (25.04%), Postives = 244/571 (42.73%), Query Frame = 2
Query:  410 DSGIKISSFYILIKVL--DENDNSPKFLPFLNPYQTLPENSQINTVILLPSAIDLDSEA---FGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLISPL------------DREVISEYRFI------------LKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKL-VNVISFYVTDLDEGQN-KQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLI--ATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITAINEIHPLG-HYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQG----ELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLF--SFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTN 2002
            DSGI   S    +KV+  D NDN P F P       + E+++   V+    A D D E+   + +K        ++      +  D+ +    Q+    P+            D  VIS  R I            ++A+D+     R +  V + I         P F+   Y   + E++ +  +V++  VTD   G    ++S  IE  N ++  Q              +G I +   +DYET   K  F L+  A D+  P       V I + + ND+ PV    + G +   S    E  P  TIV ++  +D+DS          +  + F I + ++        K  +I T + LD E  K  +  +++  +D+    P+ T++++ I + D+NDNPPVF   +  G    +++EN+P  + ++ E I   D+D G NA +++ +      T    F ID  SG +++  + DYE   ++  S  I A D     LSS   IIV+V D ++  P F +  Y F V  N  +   +GQ+  TD D+  + ++   F+   +N
Sbjct: 2148 DSGIPPKSTNCQVKVVVTDLNDNPPLFDPLSE--VNIREDTRTGAVVTSVVATDTDKESRLTYNLKSASTPGIAIL----RVSATDQDSGSNAQIKYSFPITNSDQIDYKIDADTGVISARRTIDVRIRDSFIQIPVQAMDQGVPPQRALVYVRIIIT------REPKFELPSYFGKVPENAMMGTSVLTVRVTDNAAGLPLGRISYNIENSNYFRIGQ-------------RSGVISVNKPLDYET---KRRFLLVVSAIDDTAPSKPVRVPVYINVSDVNDEKPVFG--QSGYMAQWS----EGIPVGTIVVNVSAADKDSGA--------NGRVWFAIQSGDDKGSFAIDRKTGVIRTQRALDHETIKTHH--VSVRATDEGS-PPMHTDVSVTIRVLDLNDNPPVF---RVPGPNDVQVLENLPLNS-RLYE-INATDRDSGANARLSFTV---IGGTGQGLFLIDKFSGWLTTNITFDYENTAVYQYSLTIKATDAGNPPLSSNITIIVNVADEDEYDPSFNRMDYKFDVPGNAKIGDFVGQVTATDRDSGDQGRVFFVFYNPTSN 2665          
BLAST of Protocadherin Fat 1 vs. Ensembl Nematostella
Match: EDO46189 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQM0])

HSP 1 Score: 167.548 bits (423), Expect = 6.906e-42
Identity = 182/705 (25.82%), Postives = 307/705 (43.55%), Query Frame = 2
Query:  440 ILIKVLDENDNSPKFLPFLNPYQ-TLPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKLVNVI-SFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITAINEIHPLG-HYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIFSLINPAKSSLIFTINKGFRHENCQMIPYAVSDADHDEPNSDSCCILQLDNDQNGMLYLLSNTPNFLCLQNTMN--TPGIYRVSLTATDNKNNPNKSLKAKVSFNIDVRHEVSDNP 2539
            ++I V DENDN+P+F   LN Y   + EN+    V ++ +A D DS       Y      L   ++ F +  K      ++  ++PLD E    Y   + A D ++     +      I V D+NDN P F  + Y   + E   + +++      DLD G N ++S ++ + +         +F +D       G IR     D ET    Y   L A D G P  S  A V I +++ ND  PV    +    V   + +         + ++  SD+D        + ++  L +  T+ N  H         ++   + LD E   +  L +++  +D+    PLT    + IN+ DINDNPPVF+ S YQ  + EN P  T      +   D+D   N  + + I       D   FTID  +G IS  +S DYE    +   + A D+       TA + + + D ND++P+F   +YS  + E+  + + +  +  TDLD+ P  ++   +     N     ++D NSG ++    +DRE   S ++ + AR+  S        S   V I ++D+NDN PIF      +   +F +++       Q+   A +DAD D  N D    L  + D    ++ ++ +   + L+  ++      Y V++TA D    P++S    V   +D   +V+DNP
Sbjct:   56 VVIDVKDENDNAPEFP--LNSYVFNIRENTPAAQVAIV-TATDRDSGTNAAITYS-----LFSGENKFMMNSKTG----EIRTVTPLDHETKDSYTMRISAFDGKHTTFVPL------ITVDDVNDNAPFFALSVYKTGVYEDVAVGSIVRQLTAVDLDVGINARLSYSLVSGD-------TSYFTVD-----SQGVIRTKGAFDRETKA-SYQVALRAQDGGSPSRSGQATVEIEILDVNDNRPVFSSAQYTASVDEDVAI------GAAMVTVTASDKD--------NGNNADLRYSFTSGNTNHAFTLDAVTGVVTVSRSLDFEQRSSYALGLSV--TDRGS-PPLTDTSHLLINVNDINDNPPVFSPSAYQSRVKENTPAGT-----QVSATDRDSSTNGALVFGI---IKGNDDGVFTIDGSTGIISIAKSPDYENKTRYDLTVQARDRGVPVKYDTAQVTIFIEDVNDHSPVFSPSNYSKQIPESTVIGSTVVTVTATDLDSGPRGRL--EYRLISGNVKGAFNIDANSGSIRVSSELDRETTPSYSLQVEARDGGSTSRS----SSTRVTIALQDINDNSPIF------QGPYVFRVSES-SSPGHQIGQVAATDAD-DSSNGDVRYALSDNTD----VFSINTSTGLITLKTQLDYEKKTQYMVTVTAKDG-GTPSRSSLTVVKVMVD---DVNDNP 682          

HSP 2 Score: 158.688 bits (400), Expect = 3.438e-39
Identity = 164/601 (27.29%), Postives = 270/601 (44.93%), Query Frame = 2
Query:  440 ILIKVLDENDNSPKFLPFLNPYQ-TLPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEH-SKLVNVISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITAINEIHPLG-HYKEFIINTLKPLDREDDKNQYL--KINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIP-QATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIFSLINPAKS 2224
            + I + D NDNSP F     PY   + E+S     I   +A D D  + G   Y +S      N   F+    I +    + L + LD E  ++Y   + A D        ++   V++ V D+NDNPP F K+ YT  + E+ +  V V     TD D G N ++S +I + N+     + RF          TG I     +D ET    YS  + A D  L R  +   VNI + ++ND  P      +         + E+ P  T V  L  +DRD           +  + + I + N+ +      +  I++    LDRE   +  L  K +   S Q  +T      +IH+++ D+NDN P F +S + GE+ E+    +TV  ++     DKD G N  +T  +    +    + FTID+ +G + S+  +DYE    +   + A D    + S+TA + + +I+ NDN P F  P    ++ E+V +NT + ++  TD D  P       F     N      +DQ+SG +     +DRE   + T+++ A  E   Q +++ ++  + ++   DVNDN P+F+  + AKS
Sbjct:  569 VTIALQDINDNSPIFQ---GPYVFRVSESSSPGHQIGQVAATDADDSSNGDVRYALSD-----NTDVFS----INTSTGLITLKTQLDYEKKTQYMVTVTAKDGGTPSRSSLT--VVKVMVDDVNDNPPQFAKSLYTCTVGENLAAGVAVCYVTATDADSGANGKISYSILSGNENMAFAMDRF----------TGEITTRVPLDRET-IASYSLTINADDGSLVRFMAATTVNISIADENDNQPTFTGPSR-------FNISEDSPTGTRVGQLTATDRDIG--------PNGAVTYAIISGNQGNSFQLDPRSGILSVRSTLDRETIPSYTLVVKASDAGSPQQSITA-----SIHVSVLDVNDNAPRFEKSLFSGEIREDASVHSTVLQVK---VEDKDEGSNGAITLSLSGEGS----DNFTIDS-TGFVLSKTPLDYETTAAYQLTVTARDGGSPSKSATAQVKITIINVNDNVPSFVSPAQVTSIPEDVAINTHVVKLNATDSDGTPLT-----FDIVEGNAGSSFKIDQSSGLISVAKRLDRETTANYTLVVRA-TETGSQGESVYNNATIRVL---DVNDNAPVFNPGSYAKS 1107          

HSP 3 Score: 156.762 bits (395), Expect = 1.294e-38
Identity = 168/610 (27.54%), Postives = 277/610 (45.41%), Query Frame = 2
Query:  440 ILIKVLDENDNSPKFLPFLNPYQTLPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKL-VNVISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITAINEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIF---SLI-----NPAKSSLIFTI 2242
            I + VLD NDN+P+F   L   + + E++ +++ +L     D D  + G     +S     G+D +FT+          +L  +PLD E  + Y+  + A  R+       +  +V+I + ++NDN P F       +I E   +  +V+    TD D        +T     D  +      F+ID S  L++ + RL    D ET    Y+  + AT+ G    S      I +++ ND APV      G   S + ++ EN P    VA +  +DRD    + E +   Y L+   T+  E++P       ++ T +PLDRED  +  L++      +   + +   +T+ IN  D+NDN P F++SKY   + EN    +   I  +L  D D G N  VTY I S  +      F ID+ +G+I+    +D E    ++  I A D       STA + + V D NDN+PIF     S+ + E V + + +  +  TD   R E    + F+     +     ++  +G L     I+RE V + T+ I A +  S     +M S+  + + + DVNDNPP+F   S I     N A+S+ + T+
Sbjct:  880 IHVSVLDVNDNAPRFEKSLFSGE-IREDASVHSTVLQVKVEDKDEGSNGAITLSLSGE---GSD-NFTI-----DSTGFVLSKTPLDYETTAAYQLTVTA--RDGGSPSKSATAQVKITIINVNDNVPSFVSPAQVTSIPEDVAINTHVVKLNATDSD-----GTPLTF----DIVEGNAGSSFKIDQSSGLISVAKRL----DRETTA-NYTLVVRATETGSQGESVYNNATIRVLDVNDNAPVFN---PG---SYAKSLHENLPIGQTVAKVTATDRD----EGENAKVTYELSVGDTSKFEVNP----ATGLVTTKRPLDREDQASYSLRVTAMDHGKPSQSAVAA-ITLTIN--DLNDNSPQFSQSKYTLTVTENTANGS--NILRVLASDPDAGANGRVTYSIISGNH---GNAFRIDSTTGRITVVGVVDREALASYNLTISAKDSGVPPWVSTAFVAITVADENDNSPIFASNETSYGIDEGVSIGSRVAVVTATD---RDEGSNAQVFYSIVRGDTSAFAINAMNGVLTVKKEINRETVPTYTLTIRASDRGS----PMMTSDKELTVVVNDVNDNPPVFNSQSYIGSVRENSAQSTSVLTV 1434          

HSP 4 Score: 154.066 bits (388), Expect = 1.007e-37
Identity = 171/611 (27.99%), Postives = 270/611 (44.19%), Query Frame = 2
Query:  419 IKISSFYILIKVLDENDNSPKFLPFLNPYQTLPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKLVNVIS-FYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSI---TMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITAINEIHPLGHYK-EFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTR-SKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIFSLINPAKSSLI 2233
            +K  +  + I + D ND+SP F P  N  + +PE++ I + ++  +A DLDS   G   Y++    + GN      +D   +    + + S LDRE    Y   ++A  R+       S   V I + DINDN P+F +  Y   + E S   + I     TD D+  N  V   +    D             FS +  TG I L  ++DYE    +Y   + A D G P  SS   V +++ + ND  P           ++S+   T+ EN  A   V  +  +D DS          +  +++ I + NE       +    I T  PLDRE   +  L IN   +D   L       T++I++ D NDN P FT  S++   + E+ P  T   +  +   D+D G N  VTY I S         F +D  SG +S R ++D E    ++  + A D      S TA I V V+D NDNAP F K  +S  +RE+  V++ + Q++  D D      I        ++N+ +     ++G + +  P+D E   +  + +TAR+  S        +   V ITI +VNDN P F  ++PA+ + I
Sbjct:  457 VKYDTAQVTIFIEDVNDHSPVFSPS-NYSKQIPESTVIGSTVVTVTATDLDSGPRGRLEYRL----ISGNVKGAFNID---ANSGSIRVSSELDRETTPSYSLQVEA--RDGGSTSRSSSTRVTIALQDINDNSPIF-QGPYVFRVSESSSPGHQIGQVAATDADDSSNGDVRYALSDNTDV------------FSINTSTGLITLKTQLDYE-KKTQYMVTVTAKDGGTPSRSSLTVVKVMVDDVNDNPPQF---------AKSLYTCTVGENLAAGVAVCYVTATDADSGA--------NGKISYSILSGNENMAFAMDRFTGEITTRVPLDRETIASYSLTIN---ADDGSLVRFMAATTVNISIADENDNQPTFTGPSRFN--ISEDSPTGT--RVGQLTATDRDIGPNGAVTYAIISGNQ---GNSFQLDPRSGILSVRSTLDRETIPSYTLVVKASDAGSPQQSITASIHVSVLDVNDNAPRFEKSLFSGEIREDASVHSTVLQVKVEDKDEGSNGAITLSLSGEGSDNFTI----DSTGFVLSKTPLDYETTAAYQLTVTARDGGSPSKS----ATAQVKITIINVNDNVPSF--VSPAQVTSI 1006          

HSP 5 Score: 153.295 bits (386), Expect = 1.382e-37
Identity = 168/602 (27.91%), Postives = 272/602 (45.18%), Query Frame = 2
Query:  410 DSGIK--ISSFYILIKVLDENDNSPKFLPFLNPYQTLPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHS-KLVNVISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITAINEIHPLG-HYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLT-IHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIF 2200
            DSG+   +S+ ++ I V DENDNSP F      Y  + E   I + + + +A D D  +    +Y I +    G+ S F     I +    L +   ++RE +  Y   ++A DR +      S  E+ + V D+NDNPPVF+   Y  ++ E+S +  +V++    D D G N  +  +I + ND K+      F+I+ +    +G I     +D+E    +Y   + ATD+   + ++   V I +IN ND  P           + + ++ EN P  T V  +  SDRDS  +          L++ I    +        +  II+T   LDRE      +++ +     D   P  +NLT + I + D NDN P F  S Y   ++EN   ++      +   D D G NA +TY +  S+N    + F I A SG I+  Q +D E    +   I A D      +S+  I V VID ND+ P+        +VREN P  T + +I  +D DT    ++   F      +  V  +D  +G + T  P+DRE+    T+ I   ++ +    ++ D    VII + D +DN P F
Sbjct: 1282 DSGVPPWVSTAFVAITVADENDNSPIFASNETSYG-IDEGVSIGSRVAVVTATDRDEGSNAQVFYSIVR----GDTSAF----AINAMNGVLTVKKEINRETVPTYTLTIRASDRGS--PMMTSDKELTVVVNDVNDNPPVFNSQSYIGSVRENSAQSTSVLTVAADDSDVGANAVLRYSIISGNDEKR------FKINST----SGVIMTTTPLDFE-EKSQYGLEVTATDS---KYTAKTNVTIRVINLNDITPAFTQ------QNYTASVRENSPTSTSVVKVSASDRDSFGS----------LSYSIVGGKDSDKFSIDQRSGIISTADVLDRELVSLYAIQVRV----TDAGNPPLSNLTWVTIKILDENDNSPKFDSSSYSSSILENSAPSSFSF--KLAATDADEGTNARITYNL--SRN----DAFMIGASSGVITLAQPLDRENKSTYDLAIQARDHGTPPQASSITIRVTVIDINDHRPLINSSSLRGSVRENQPKETHVMRILASDADTGLNAELT--FSLLSNEHKSVFTLDNTTGDISTKVPLDREQQAVYTLRIGVADKGNPSLSSVAD----VIIDVIDEDDNCPRF 1824          

HSP 6 Score: 138.658 bits (348), Expect = 5.201e-33
Identity = 168/599 (28.05%), Postives = 272/599 (45.41%), Query Frame = 2
Query:  209 YAVTEKASPFSLIDNRLSVVSNIDRE--SICPIKNSLNDYDQSAETYNSQQSSHSCKYD---ECCTVFSFQV---DSG--IKISSFYILIKVLDENDNSPKF--LPFLNPYQTLPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDS-HFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKL-VNVISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEIT---AINEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTP-LTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLD 1951
            Y + E  S    I +R++VV+  DR+  S   +  S+   D SA   N+     + K +   E    ++  +   D G  +  S   + + V D NDN P F    ++    ++ ENS  +T +L  +A D D  A  +  Y I    + GND   F    KI S    ++  +PLD E  S+Y   + A D      +  +   V I+V ++ND  P F +  YTA++ E+S    +V+    +D D   +   SI    ++D             FS    +G I   D +D E     Y+  +  TD G P LS+   V I ++++ND +P      K +  S S ++ EN    +    L  +D D               N  IT   + N+   +G     +I   +PLDRE+     L I      +D  TP   +++TI + + DIND+ P+   S  +G + EN P+ T  M   IL  D D G NA +T+ + S+++ +    FT+D  +G IS++  +D E+  +++  I   DK   +LSS A +I+ VID +DN P F    Y+ T+ E++P    I Q+   D+D
Sbjct: 1315 YGIDEGVS----IGSRVAVVTATDRDEGSNAQVFYSIVRGDTSAFAINAMNGVLTVKKEINRETVPTYTLTIRASDRGSPMMTSDKELTVVVNDVNDNPPVFNSQSYIG---SVRENSAQSTSVLTVAADDSDVGANAVLRYSI----ISGNDEKRF----KINSTSGVIMTTTPLDFEEKSQYGLEVTATD-----SKYTAKTNVTIRVINLNDITPAFTQQNYTASVRENSPTSTSVVKVSASDRDSFGSLSYSIVGGKDSD------------KFSIDQRSGIISTADVLDRELVSL-YAIQVRVTDAGNPPLSNLTWVTIKILDENDNSP------KFDSSSYSSSILENSAPSSFSFKLAATDADE------------GTNARITYNLSRNDAFMIGA-SSGVITLAQPLDRENKSTYDLAIQA----RDHGTPPQASSITIRVTVIDINDHRPLINSSSLRGSVRENQPKETHVM--RILASDADTGLNAELTFSLLSNEHKS---VFTLDNTTGDISTKVPLDREQQAVYTLRIGVADKGNPSLSSVADVIIDVIDEDDNCPRFQPTEYNVTISESLPRGASIVQVTARDID 1852          

HSP 7 Score: 137.117 bits (344), Expect = 1.547e-32
Identity = 142/514 (27.63%), Postives = 226/514 (43.97%), Query Frame = 2
Query:  695 LDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKLVNVISFYVTDLDEGQNKQVSITI-ETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINK-NDQAP--VIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITAINEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTP-LTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIFSLINPAK 2221
             DRE  S YR  + A D  N  H+  + V +++K  D NDN P F    Y  NI E++    V     TD D G N  ++ ++   EN +  +               TG IR +  +D+ET    Y+  + A D        T  V +I ++  ND AP   + V + G        ++E+    +IV  L   D D     I   L  Y L    T+   +   G     +I T    DRE  K  Y    +    QD  +P  +   T+ I + D+NDN PVF+ ++Y   + E++  A    +  +   DKD+G NA + Y   S   +     FT+DA +G ++  +S+D+E+   ++  +   D+    L+ T+ ++++V D NDN P+F    Y   V+EN P  T   Q+  TD D+     +V    K   N+  V  +D ++G +      D E      + + AR+    +   +      V I IEDVND+ P+FS  N +K
Sbjct:   28 FDRESESRYRLTVLAQDAANRCHKGRTVVVIDVK--DENDNAPEFPLNSYVFNIRENTPAAQVAIVTATDRDSGTNAAITYSLFSGENKFMMNS-------------KTGEIRTVTPLDHETKD-SYTMRISAFDG-----KHTTFVPLITVDDVNDNAPFFALSVYKTG--------VYEDVAVGSIVRQLTAVDLD---VGINARLS-YSLVSGDTSYFTVDSQG-----VIRTKGAFDRET-KASY---QVALRAQDGGSPSRSGQATVEIEILDVNDNRPVFSSAQYTASVDEDV--AIGAAMVTVTASDKDNGNNADLRYSFTSGNTN---HAFTLDAVTGVVTVSRSLDFEQRSSYALGLSVTDRGSPPLTDTSHLLINVNDINDNPPVFSPSAYQSRVKENTPAGT---QVSATDRDSSTNGALVFGIIKG--NDDGVFTIDGSTGIISIAKSPDYENKTRYDLTVQARD----RGVPVKYDTAQVTIFIEDVNDHSPVFSPSNYSK 485          

HSP 8 Score: 137.117 bits (344), Expect = 1.656e-32
Identity = 164/599 (27.38%), Postives = 255/599 (42.57%), Query Frame = 2
Query:  440 ILIKVLDENDNSPKFLPFLNPYQTLPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKLVNVISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENE-PARTIVASLQVSDRDSLVTDIECSLDDY---HLNFEITAINEIHPLG-HYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATV--KMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYT----NNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIFS 2203
            + I++LD NDN P F        ++ E+  I   ++  +A D D+       Y     F  GN +H   LD +      + +   LD E  S Y   L   DR +    D S   + I V DINDNPPVF  + Y + + E++     +S   TD D   N  +   I   ND         F ID S    TG I +    DYE N  +Y   + A D G+P    TA+V I + + ND +PV            S + +  + P  T++ S       ++VT     LD      L + + + N             I     LDRE   +  L++    +     T  +++  + I L DINDN P+F     QG  +  + +++     I  +   D D   N  V Y +     S + + F+I+  +G I+ +  +DYEK   +   + A D    + SS  ++ V V D NDN P F K  Y+ TV EN+     +  +  TD D+    KI      SY+    N      +D+ +G++ T  P+DRE + S ++ I A + +  +    M +   V I+I D NDN P F+
Sbjct:  257 VEIEILDVNDNRPVF-SSAQYTASVDEDVAIGAAMVTVTASDKDNGNNADLRYS----FTSGNTNHAFTLDAVTG---VVTVSRSLDFEQRSSYALGLSVTDRGSPPLTDTS--HLLINVNDINDNPPVFSPSAYQSRVKENTPAGTQVS--ATDRDSSTNGALVFGIIKGND------DGVFTIDGS----TGIISIAKSPDYE-NKTRYDLTVQARDRGVPVKYDTAQVTIFIEDVNDHSPVF-----------SPSNYSKQIPESTVIGS-------TVVTVTATDLDSGPRGRLEYRLISGNVKGAFNIDANSGSIRVSSELDRETTPSYSLQVE---ARDGGSTSRSSSTRVTIALQDINDNSPIF-----QGPYVFRVSESSSPGHQIGQVAATDADDSSNGDVRYAL-----SDNTDVFSINTSTGLITLKTQLDYEKKTQYMVTVTAKDGGTPSRSSLTVVKVMVDDVNDNPPQFAKSLYTCTVGENLAAGVAVCYVTATDADSGANGKI------SYSILSGNENMAFAMDRFTGEITTRVPLDRETIASYSLTINADDGSLVR---FM-AATTVNISIADENDNQPTFT 791          

HSP 9 Score: 119.398 bits (298), Expect = 3.602e-27
Identity = 148/610 (24.26%), Postives = 265/610 (43.44%), Query Frame = 2
Query:  422 KISSFYILIKVLDENDNSPKFLPFLNPYQ--TLPENSQINTVILLPSAIDLDSE--AFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKLVNVIS-FYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITAINEIHPLGHYKEFIINT-------LKPLDREDDKNQYLKINIYCSDQD-KLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIFSLIN 2212
            K ++  + I +++ NDN P    F++P Q  ++PE+  INT ++  +A D D     F I        F I   S    + K             LDRE  + Y  +++A   E     +       I+V D+NDN PVF+   Y  ++ E+  +   ++    TD DEG+N +V+  +   +  K       F+++ +  L+T + R +D  D  +    YS  + A D+G P  S+ A + + + + ND +P     +       ++T+ EN    + +  +  SD D+          +  + + I + N      H   F I++       +  +DRE         N+  S +D  + P  +   + I + D NDN P+F  ++    + E +   +   +  +   D+D G NA V Y I       D   F I+A +G ++ ++ I+ E    ++  I A D+    ++S   + V V D NDN P+F    Y  +VREN   +T +  +   D D    N +++Y   S  N+ +   ++  SG + T  P+D E+     + +TA  ++ Y  K        V I + ++ND  P F+  N
Sbjct:  977 KSATAQVKITIINVNDNVPS---FVSPAQVTSIPEDVAINTHVVKLNATDSDGTPLTFDIVEGNAGSSFKIDQSSGLISVAK------------RLDRETTANYTLVVRAT--ETGSQGESVYNNATIRVLDVNDNAPVFNPGSYAKSLHENLPIGQTVAKVTATDRDEGENAKVTYELSVGDTSK-------FEVNPATGLVT-TKRPLDREDQAS----YSLRVTAMDHGKPSQSAVAAITLTINDLNDNSPQFSQSKY------TLTVTENTANGSNILRVLASDPDAGA--------NGRVTYSIISGN------HGNAFRIDSTTGRITVVGVVDRE----ALASYNLTISAKDSGVPPWVSTAFVAITVADENDNSPIFASNETSYGIDEGVSIGS--RVAVVTATDRDEGSNAQVFYSIVRG----DTSAFAINAMNGVLTVKKEINRETVPTYTLTIRASDRGSPMMTSDKELTVVVNDVNDNPPVFNSQSYIGSVRENSAQSTSVLTVAADDSDV-GANAVLRYSIIS-GNDEKRFKINSTSGVIMTTTPLDFEEKSQYGLEVTA-TDSKYTAK------TNVTIRVINLNDITPAFTQQN 1518          

HSP 10 Score: 78.9518 bits (193), Expect = 9.903e-15
Identity = 53/176 (30.11%), Postives = 90/176 (51.14%), Query Frame = 2
Query: 1682 DWEYFTIDADSGKISS-RQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIFSL 2206
            D   FTID+ +G I++  +  D E    +   ++A D          ++++ V D NDNAP FP   Y F +REN P   ++  +  TD D+   N  + Y   S  N +    ++  +G+++T+ P+D E   S T+ I+A     +  K+   +  + +IT++DVNDN P F+L
Sbjct:    8 DQGMFTIDSSTGSITTTGRKFDRESESRYRLTVLAQDAANRCHKGRTVVVIDVKDENDNAPEFPLNSYVFNIRENTPA-AQVAIVTATDRDS-GTNAAITYSLFSGENKFM---MNSKTGEIRTVTPLDHETKDSYTMRISA-----FDGKH---TTFVPLITVDDVNDNAPFFAL 170          
BLAST of Protocadherin Fat 1 vs. Ensembl Nematostella
Match: EDO46417 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQ19])

HSP 1 Score: 163.696 bits (413), Expect = 1.197e-40
Identity = 179/653 (27.41%), Postives = 298/653 (45.64%), Query Frame = 2
Query:  296 PIK-NSLNDYDQSAETYNSQQSSHSCKYDECC---TVFSFQVDSGIKISSFY----ILIKVLDENDNSPKFLPFLNPYQTLPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFL-IGNDSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKL-VNVISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQID-FSPSLMT-GSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITAINEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDH---GKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKN-KLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPID--REKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIF 2200
            P+K N+  D   S ET    +++    Y++       F  QV +  + ++ Y    + I + D ND+ P F    N    + EN+ I T ++   A D D+   G+  Y     FL  G+D HF +   + SG   L      DRE  S +  I+ A D+ N+       V V++ V D ND+PP FD+  +  ++ E + +  +++    TD D G N ++   I   +       + +F +   S S  T G +++   +D+ET    Y+ ++ ATD    R S+T +V I + + ND  P+   +    ++S   T   +E   + V  L+V   D+   +I+ +L+     F I A  E    G +   I    +PLDRE         N+   D       T +  I IN+ DINDN P F  S Y G + EN    T  M   +   D D    G NA + Y +  +        F IDA++  +++ + +D E +   F+  ++A D+  + LS+T +  ++V DAND+AP+F K  +  TV E+V     +  +  TD DT P  ++   F  ++ N     +VD + G +   G ++    K  ++T+ ++ R      +    +S   V+ITI D NDN PIF
Sbjct: 1752 PVKANADIDEKFSVETNGQIKTASQLDYEQLSPGDKTFKLQVRAQEENTNLYSTCSVAITLEDVNDDKPTF-DLGNYDARVRENAPIGTTVITIKATDRDTGDAGVVTY-----FLKAGSDEHFAI--DVNSG--TLTTKKSFDREGQSLFSVIVIARDKGNNPGALSEEVAVKVLVVDENDSPPQFDQAEFQTSVSESATIGTSILEVVATDQDIGDNAKLEYFISGGDG------RFWFAVQTISKSGRTYGEVQVDARLDFETKS-SYTIDVTATDG---RFSATTRVLITITDANDIVPMFMTLTTPTLLSPIYTGRVSEMTGSGVEVLKVYAVDTDSPNIQYTLEGSSSYFTIAARQE---GGKFVGIISTGSQPLDRE--ATPIFSFNVLAKDGVH----TGSAYIEINVTDINDNQPRFPNSLYVGYVEENKAAGTSVMY--VQAHDDDDPYLGGNAEIRYTLTDNAGGK----FKIDANTALVTTEEILDRETSPNSFTITVLATDQGANKLSTTKVATIYVTDANDHAPVFTKRIFRGTVSEDVRPGYVVTSVSATDTDTGPNAEL--EFVVTHGNEPAAFYVDPSKGTVHVSGILNYTLRKSYNLTVTVSDRGMPVLSD----NSPAYVLITITDANDNAPIF 2363          

HSP 2 Score: 132.109 bits (331), Expect = 7.020e-31
Identity = 157/615 (25.53%), Postives = 266/615 (43.25%), Query Frame = 2
Query:  440 ILIKVLDENDNSPKFLPFLNPYQTLP-------ENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLIS---PLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKLVNVISFYVTDLDE-----GQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEI-DYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVI-KVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITAINEIHPLGHY---KEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLT---IHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADS---GKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKY--FHKSYTNNYQ--VIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPP 2194
            +LI + D ND  P F+    P    P       E +     +L   A+D DS    I+Y       L G+ S+FT+  +   G+   ++ +   PLDRE    + F + A      D        +EI V DINDN P F  + Y    VE +K       YV   D+     G N ++  T+ T+N   K      F+ID + +L+T      +EI D ET+P  ++  ++ATD G  +LS+T    I + + ND APV  K I +G       T+ E+     +V S+  +D D+          +  L F +T  NE  P   Y    +  ++    L+    K+  L + +     D+  P+ ++ +   + I + D NDN P+F  ++Y   + E++   +  ++  +  +D D G NA   + I +  N  D      + D+   G + +R  +D E   +    I A  KD   L+  A + + ++D NDN P F  P +   ++ENV V   + ++   D DT+       Y  ++ + + N+   +  +   +  + + G  DRE + + TI I   +       N       V + ++D NDN P
Sbjct: 2022 VLITITDANDIVPMFMTLTTPTLLSPIYTGRVSEMTGSGVEVLKVYAVDTDSP--NIQYT------LEGSSSYFTIAARQEGGKFVGIISTGSQPLDREATPIFSFNVLA-----KDGVHTGSAYIEINVTDINDNQPRFPNSLYVG-YVEENKAAGTSVMYVQAHDDDDPYLGGNAEIRYTL-TDNAGGK------FKIDANTALVT-----TEEILDRETSPNSFTITVLATDQGANKLSTTKVATIYVTDANDHAPVFTKRIFRG-------TVSEDVRPGYVVTSVSATDTDTG--------PNAELEFVVTHGNE--PAAFYVDPSKGTVHVSGILNYTLRKSYNLTVTV----SDRGMPVLSDNSPAYVLITITDANDNAPIFIPNQYNKTVAEDLAVGSPVVV--VTAVDYDSGDNAKFVFDI-TGGNPDDLFEVVPNPDNSSLGIVRTRLPLDRETTPIHHLEITA--KDTGGLTGKAHVWLTLLDVNDNGPWFQPPFFVGKIKENVNVKQFVTKVSANDPDTKNNGAPFTYAIYNGTVSGNFAFDIATITNVTTDMSSSGTFDRETMTTWTIGIAGTDSGRPAKSNF----TYVYVDVQDDNDNEP 2580          

HSP 3 Score: 115.931 bits (289), Expect = 4.944e-26
Identity = 166/618 (26.86%), Postives = 267/618 (43.20%), Query Frame = 2
Query:  440 ILIKVLDENDNSPKFLPFLNPYQT-LPENSQINTVILLPSAIDLD-SEAFGIKYYKISKPFLIGNDSHFTLLDKI--ASGR--PQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFD--------KTFYTANIVEHSK-LVNVISFYVTDLDEGQNKQVSITIETENDY----KKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIECSLDDY-HLNFEITAINEIHPLGHYK----EFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLS--STALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNN---YQVIHVDQNS--GKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIF 2200
            + + V+DEND+ P+F      +QT + E++ I T IL   A D D  +   ++Y      F+ G D  F    +    SGR   ++ + + LD E  S Y      +D    D R  +   V I + D ND  P+F            YT  + E +   V V+  Y  D D   +  +  T+E  + Y     + +  +F  I     + TGS      +D E  P  +SFN++A D G+   S+  ++N+  IN N Q      +  G +        EN+ A T V  +Q  D D          D Y   N EI      +  G +K      ++ T + LDRE   N +  I +  +DQ     L+T     I + D ND+ PVFT+  ++G + E++    V  +  +   D D G NA + + +    +  +   F +D   G +     ++Y   K ++  +   D+    LS  S A +++ + DANDNAPIF    Y+ TV E++ V + +  +   D D+    K V  F  +  N    ++V+    NS  G ++T  P+DRE      + ITA++      K        V +T+ DVNDN P F
Sbjct: 1914 VKVLVVDENDSPPQFDQ--AEFQTSVSESATIGTSILEVVATDQDIGDNAKLEY------FISGGDGRFWFAVQTISKSGRTYGEVQVDARLDFETKSSY-----TIDVTATDGRFSATTRVLITITDANDIVPMFMTLTTPTLLSPIYTGRVSEMTGSGVEVLKVYAVDTD---SPNIQYTLEGSSSYFTIAARQEGGKFVGI-----ISTGS----QPLDREATPI-FSFNVLAKD-GVHTGSAYIEINVTDINDN-QPRFPNSLYVGYVE-------ENKAAGTSVMYVQAHDDD----------DPYLGGNAEIRYTLTDNAGGKFKIDANTALVTTEEILDRETSPNSF-TITVLATDQGA-NKLSTTKVATIYVTDANDHAPVFTKRIFRGTVSEDVRPGYV--VTSVSATDTDTGPNAELEFVV---THGNEPAAFYVDPSKGTVHVSGILNYTLRKSYNLTVTVSDRGMPVLSDNSPAYVLITITDANDNAPIFIPNQYNKTVAEDLAVGSPVVVVTAVDYDSGDNAKFV--FDITGGNPDDLFEVVPNPDNSSLGIVRTRLPLDRETTPIHHLEITAKDTGGLTGK------AHVWLTLLDVNDNGPWF 2471          

HSP 4 Score: 96.6709 bits (239), Expect = 4.421e-20
Identity = 144/674 (21.36%), Postives = 270/674 (40.06%), Query Frame = 2
Query:  431 SFYILIKVLDENDNSPKFLPFLNPYQTLPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLISPLDREVISE-YRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSK-LVNVISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNG-LPRLSSTAKVNIILINKND-----------------QAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHL----NFEITAINEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLT-PLTTNLTIHINLFDIND--NPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIFSLINPAKSSLIFTINKGFRHENCQMIPYAVSDADHDEPNSDSCCILQLDNDQNGMLY 2371
            ++ + I V D N+  P F           E +Q  TV  L      D +  GI  Y+I    + GN+  + + +    G  + L++   +  ++ +  R  +    R ND         ++I + D N+NPPVF+K+ YT  + E +  + +++     D D G+N  +   +    D+  D I             TG IR I  +D+++   + +  + A D G  P+    A VN+ +  ++D                 + PV       E  S ++++ E+ P    +  ++ +D D+  T+ +     Y L    NF I + + +  L    E+         + +     + + +  +D++  +  L+ ++ + I + D++D  N PVF  +  Q EL  +   A  + I  +   D D G +  V Y I      +    F + A +G +     +D EK   +   I A DK     SS   ++V + D +D+ P F +P Y     E  P NT +  ++  D D     + V Y   +  ++++++     SG + T GPID     S   L+      +Y        +  V IT +   ++PP+F                       +  PYAVS  ++    ++  C+  +D     ++Y
Sbjct:  115 AWTLRITVTDTNNFQPTFGADFYLGYIAEEAAQGTTVGGLEKCHAEDKDRSGIDRYEI----VSGNERGYFVAETKTVGAQKFLVLKATNTRIVRDPARPSITLTVRANDGGGLHGTTRIQIDIQDTNNNPPVFEKSEYTVTVGEDTPVMTSILRVRARDADIGRNGGIYYYLRNTQDFTIDAI-------------TGVIRPIRMLDFQSGQQR-TLEVTARDRGSSPK---AANVNVQVTIRSDISGYPPVVVPSSSSDRNRPPVFP-----EGSSFTLSIREDFPVNGAIQVVKANDPDAGSTNGQLR---YSLSGNNNFAIDSTSGVVTLQTQLEY---------KGNPAQDVIDLVVTATDRNGQSGALSASVNLKIEVLDVDDNNNAPVF--NPQQLELTVSEDSAVGRTIRRVSATDSDDGSDGQVVYSI---IQGSGLGVFQVQATTGDLIVAAPLDREKMSFYDLVIKAEDKATFPKSSNLYVMVKIQDVDDHFPQFTQPMYYAKAPEKSPENTFVTVVKVVDHDL---GESVSY-SITGASSFKIV---PTSGLILTTGPIDLTTEPSTYELVVTATSTNYGTTKRATGQVNVEITSK--TESPPVF-----------------------KNTPYAVSVPENQGSIANLVCVAAIDTKGQPVIY 713          

HSP 5 Score: 84.3445 bits (207), Expect = 2.724e-16
Identity = 145/628 (23.09%), Postives = 263/628 (41.88%), Query Frame = 2
Query:  413 SGIKISSFYILIKVLDENDNSPKFLPFLNPYQ---TLPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHS---KLVNVISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDN--GLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIEC--SLDDYHLNFEITAINEIHPLG-HYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTP--LTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVK--MIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSG--KISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYF-----HKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIFSLINPAKSSL 2230
            SG   +S  + I+VLD +DN+    P  NP Q   T+ E+S +   I   SA D D  + G   Y I +   +G       + ++ +    L++ +PLDRE +S Y  ++KA D+        S + V +K+ D++D+ P F +  Y A   E S     V V+   V D D G++   SIT  +            F+I   P+  +G I     ID  T P  Y   + AT    G  +  +T +VN+ + +K +  PV                F+N P      ++ V +    + ++ C  ++D        +  +   P G   K    ++L+  D E       K  I  S Q  + P  +T++  + I + D  D PP F++S+Y+  + E    A+V+  +   I  +D+D   +  +   ++   +    +Y ++  D G  K    +++D      F+F++   DK+   + +T  + V V D N   P+F +  +  +  + +P +T + Q+   D D     ++             T+ Y    VD +       G I+   + +   L   + +A       +++   V I++   +D P  FS  NP  +S+
Sbjct:  447 SGALSASVNLKIEVLDVDDNNNA--PVFNPQQLELTVSEDSAVGRTIRRVSATDSDDGSDGQVVYSIIQGSGLG-------VFQVQATTGDLIVAAPLDREKMSFYDLVIKAEDKAT--FPKSSNLYVMVKIQDVDDHFPQFTQPMYYAKAPEKSPENTFVTVVK--VVDHDLGESVSYSITGASS-----------FKI--VPT--SGLILTTGPIDLTTEPSTYELVVTATSTNYGTTK-RATGQVNVEITSKTESPPV----------------FKNTPY-----AVSVPENQGSIANLVCVAAIDTKGQPVIYSIESRGEPFGIDSKSGRFSSLQSFDYETAD----KYRIQISAQSGIAPNIMTSSSDVAITIKDEKD-PPQFSQSEYKVSVPEG---ASVRSTLSRGIRFVDEDT-LSTQLECSMEEMTSRIPLDYLSVVQDGGECKFVIEKTLDTFVASKFTFDMKVTDKNFPGMFATTKVEVTVTDTNTYTPVFSRTSFWASKPDTLPTDTSVMQLPIIDKDMGSLGEVTYQLIDPTVSAGETSGYDRFRVDDS-------GMIESTNILTANTLYKLQAKAKDGGSPALEATVDVFISVYPSSDTPVRFSQ-NPYSASI 1007          

HSP 6 Score: 82.0333 bits (201), Expect = 1.154e-15
Identity = 135/532 (25.38%), Postives = 224/532 (42.11%), Query Frame = 2
Query:  674 QLLLISPLDREVISEYRFILKAVDRENDDHRDI-SGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKL-VNVISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNG--LPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQ-VSDRDSLVTDIECSLDDYHLNFEITAINEIHPLGH-YKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSK--------YQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDA--DSGKI-----SSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKV-RSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIFS 2203
            Q+   S LD E +S      K   R  +++ ++ S   V I + D+ND+ P FD   Y A + E++ +   VI+   TD D G    V+  ++  +D         F ID +    +G++      D E     +S  +IA D G     LS    V ++++++ND  P          VS S T+        +VA+ Q + D   L  +   S  D    F   A+  I   G  Y E  ++    LD E  K+ Y  I++  +D       +    + I + D ND  P+F            Y G + E +  + V++++ +  +D D   +  + Y ++ S +     YFTI A  + GK      +  Q +D E   +FSFN++A D   +    +A I ++V D NDN P FP   Y   V EN    T +  ++  D D        +  +    N      +D N+  + T   +DRE    S TI + A +    Q  N + +  +  I + D ND+ P+F+
Sbjct: 1770 QIKTASQLDYEQLSPGDKTFKLQVRAQEENTNLYSTCSVAITLEDVNDDKPTFDLGNYDARVRENAPIGTTVITIKATDRDTGDAGVVTYFLKAGSD-------EHFAIDVN----SGTLTTKKSFDREGQSL-FSVIVIARDKGNNPGALSEEVAVKVLVVDENDSPPQFDQAEFQTSVSESATI--GTSILEVVATDQDIGDNAKL--EYFISGGDGRFWF---AVQTISKSGRTYGEVQVDAR--LDFET-KSSY-TIDVTATDGR----FSATTRVLITITDANDIVPMFMTLTTPTLLSPIYTGRVSE-MTGSGVEVLK-VYAVDTD---SPNIQYTLEGSSS-----YFTIAARQEGGKFVGIISTGSQPLDREATPIFSFNVLAKDGVHTG---SAYIEINVTDINDNQPRFPNSLYVGYVEENKAAGTSVMYVQAHDDDDPYLGGNAEIRYTLTDNAGGKFKIDANTALVTTEEILDRETSPNSFTITVLATD----QGANKLSTTKVATIYVTDANDHAPVFT 2257          

HSP 7 Score: 80.1073 bits (196), Expect = 4.687e-15
Identity = 128/568 (22.54%), Postives = 232/568 (40.85%), Query Frame = 2
Query:  716 EYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKLVNVIS----FYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHL-----NFEITAINEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINL-FDIN--------------DNPPVFTR-SKYQGELIENIPQATVKMIEPILTLDKDHGK-NAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKN---KLFSFNIIAIDKD-QSN-LSSTALIIVHVIDAND--NAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIFS-----LINPAKS--SLIFTINKGFRHENCQMIPYAVSDA 2299
            E  ++L  + R+           + I V D N+  P F   FY   I E +     +      +  D D     +  I    E  Y   + K      F   L   + R++ +      P + S  L    N    L  T ++ I + + N+  PV       E    ++T+ E+ P  T +  L+V  RD+   DI  +   Y+      +F I AI            +I  ++ LD +  + + L++     D+   +P   N+ + + +  DI+              + PPVF   S +   + E+ P      I+ +   D D G  N  + Y +  + N      F ID+ SG ++ +  ++Y+ N    +    + A D++ QS  LS++  + + V+D +D  NAP+F       TV E+  V   I ++  TD D   + ++V    +   +   V  V   +G L    P+DREK+    ++I A ++A++       S   V++ I+DV+D+ P F+        P KS  +   T+ K   H+  + + Y+++ A
Sbjct:   95 ENLYVLTVLRRQRGMTEGGIAWTLRITVTDTNNFQPTFGADFYLGYIAEEAAQGTTVGGLEKCHAEDKDRSGIDRYEIVSGNERGYFVAETKTVGAQKFL-VLKATNTRIVRD------PARPSITLTVRANDGGGLHGTTRIQIDIQDTNNNPPVF------EKSEYTVTVGEDTPVMTSI--LRVRARDA---DIGRNGGIYYYLRNTQDFTIDAITG----------VIRPIRMLDFQSGQQRTLEVT--ARDRGS-SPKAANVNVQVTIRSDISGYPPVVVPSSSSDRNRPPVFPEGSSFTLSIREDFP--VNGAIQVVKANDPDAGSTNGQLRYSLSGNNN------FAIDSTSGVVTLQTQLEYKGNPAQDVIDLVVTATDRNGQSGALSASVNLKIEVLDVDDNNNAPVFNPQQLELTVSEDSAVGRTIRRVSATDSDDGSDGQVVYSIIQG--SGLGVFQVQATTGDLIVAAPLDREKMSFYDLVIKAEDKATFPKS----SNLYVMVKIQDVDDHFPQFTQPMYYAKAPEKSPENTFVTVVKVVDHDLGESVSYSITGA 617          

HSP 8 Score: 78.1814 bits (191), Expect = 1.691e-14
Identity = 116/486 (23.87%), Postives = 207/486 (42.59%), Query Frame = 2
Query:  779 VEVEIKVGDINDNPPVFDKTFYTANIVEHSKLVNVISFYVTDLDEGQNKQVSITI---ETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYE-TNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEIT-AINEIHPLGHYKEFIINT----LKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHG-KNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKI-VKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIFS 2203
            V+V I V   +D P  F +  Y+A+I E+S L N   F  T    G +  ++ ++   + EN          F ID S     G + L+ ++D E T  YK       T   L  L++  +  + + + ND  P+    R    V++   +    PA TI+A+L+  D D               N ++T +I    P      F I+T    LK   +      Y +I +  +D+    P  +  T+ + + +I   PPVF ++KY  ++ EN      K+ + ++++   +G  NA + Y   S       + F ID+ SG+I+  Q +D E    ++  +     +  + +    ++V + D ND++P F K  Y F   E++   T IG++  TD D+    +I  ++ + S   +     +DQ +G                 I + +     Y++  + +    V I + D+NDN P FS
Sbjct:  982 VDVFISVYPSSDTPVRFSQNPYSASIAENSPL-NTEVFRATATKSGSSSGIAYSLVGGQIENG------NTMFSIDSS-----GRVLLLRQLDRERTKSYKLYVRGTYTGGSL-TLATDVECLVTVTDVNDNTPLFTFDR----VNKQFVVDNYAPANTIIATLRAVDSDE------------GANAQVTMSIQGTVP--SNAPFTIDTPSNVLKTTTKLSTVIDY-QITVRATDKGS-PPQYSETTVIVKVLNIQ-TPPVFGQAKYTVDVQEN-----TKVGQQVISVKATYGDSNALLQYSFVSGNLG---DAFCIDS-SGQITVAQPLDREVLPSYTLRVRVALGNNEDFTE---VVVSLTDINDDSPTFTKSVYEFFANEDISSGTSIGKVAATDRDSGSHGQISYRFLYASDIQSMDKFDLDQTTG----------------IISLASGKSLDYEDITIAE----VRIYLRDINDNDPKFS 1401          

HSP 9 Score: 77.411 bits (189), Expect = 3.406e-14
Identity = 180/731 (24.62%), Postives = 305/731 (41.72%), Query Frame = 2
Query:  440 ILIKVLDENDNSPKFLPFLNPYQTLP-ENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANI-VEHSKLVNVISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMT--GSIRLIDEIDYETNPYKYSFNLIATDNGLP--RLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITAIN-----EIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSD-QDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENI--PQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTA-LIIVHVIDANDNAP---IFPKPHYSFTVRENVP-------VNTEIGQIETTDLDTRPENKIVKYFH-KSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIFSLINPAKSSLIFTINKGFRHENCQMIPYAVSDADHDEPNSDSCCI---LQLDNDQNGMLYLLSNTPNFLCLQNTMNTPG--IYRVSLTATDNKNNPNKSLKAKVSFNIDVRHEVSDNP 2539
            +++ + D ND+SP F   +  Y+    E+    T I   +A D DS + G    +IS  FL  +D                  I  +D+  + +   I+     ++ D+ DI+  EV I + DINDN P F    Y A + ++   L +V+    TDLD   N ++  +I   N       +  FQ+      +T  G IR+   +        +   L A D+G P  + S   +VN+ L    D  P  K +    IV+ +  +  N+  R  VA    S+                L +EI + N      I+P       +I T + LD E +   Y+ +NI   D +D+    + ++ + IN+ +INDN P+F   +  G++   +  P A   +   +  +DKD G   Y    I++        YFTID + G++  +  +    +  F F I A D        TA +++V V       P   I P+   + TV   VP       VN+++ ++        P  K + Y   K+  +  +   V+ N G++KT   +D E++         +  A  +N NL  S C V IT+EDVND+ P F L N                EN  +    ++    D    D+  +   L+  +D++  + + S T   L  + + +  G  ++ V + A D  NNP  +L  +V+  + V  E +D+P
Sbjct: 1294 VVVSLTDINDDSPTFTKSV--YEFFANEDISSGTSIGKVAATDRDSGSHG----QISYRFLYASD------------------IQSMDKFDLDQTTGIISLASGKSLDYEDITIAEVRIYLRDINDNDPKFSAASYHAKLSLDAPVLEHVVQVTATDLDTANNGRIRYSIVAGNQ------EGAFQV------LTDNGLIRVAKSLT-TVAASSFLLTLEAADSGDPERKGSVNVQVNVFL---PDGPP--KFVLDPVIVNATEGIAANQ--RVAVAKAATSE---------------ALKYEILSGNTNDMFAINP----SSGVILTTRELDYE-EATGYI-MNIIARDTRDR----SASVQVIINVVNINDNEPMFP-GETNGQIDRKVAGPFAPGVIATRLTAVDKDIGDRVYYKISIEAEN------YFTID-ERGQLICKNDLKGIASP-FRFTIEARDGGLPQKVHTANVLLVFVNYRPKQQPVRVIVPETTRAXTVITRVPRILESLSVNSDVLKVSA----QAPGGKSIVYSPVKANADIDEKFSVETN-GQIKTASQLDYEQLSPGDKTFKLQVRAQEENTNLY-STCSVAITLEDVNDDKPTFDLGN----------YDARVRENAPIGTTVITIKATDRDTGDAGVVTYFLKAGSDEHFAIDVNSGT---LTTKKSFDREGQSLFSVIVIARDKGNNPG-ALSEEVAVKVLVVDE-NDSP 1925          

HSP 10 Score: 68.5514 bits (166), Expect = 1.373e-11
Identity = 93/402 (23.13%), Postives = 156/402 (38.81%), Query Frame = 2
Query: 1415 DKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQAT-VKMIEPILTLDKDH-GKNAY-------VTYKIDSSKNSTDWEYFTIDADSGKI---SSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDV-----------NDNPPIFSLINPAKSSLIFTINKGFRHENCQMIPYAVSDADHDEPNSDSCCILQLDNDQNGMLYLLSNTPNFLCLQNTMNTPG-----IYRVSLTATDNKNNPNKSLKAKVSFNIDVRHEVSDN 2536
            D  + L +      Q  +T      T+ I + D N+  P F    Y G + E   Q T V  +E     DKD  G + Y         Y +  +K     ++  + A + +I    +R SI           +     D   L  T  I + + D N+N P+F K  Y+ TV E+ PV T I ++   D D      I  Y       N Q   +D  +G ++ I  +D +  +  T+ +TAR+  S      ++ +  +   I               + PP+F    P  SS   +I + F       +   V   D D  +++      L  + N   + + +T   + LQ  +   G     +  + +TATD +N  + +L A V+  I+V  +V DN
Sbjct:   92 DGEENLYVLTVLRRQRGMTEGGIAWTLRITVTDTNNFQPTFGADFYLGYIAEEAAQGTTVGGLEKCHAEDKDRSGIDRYEIVSGNERGYFVAETKTVGAQKFLVLKATNTRIVRDPARPSI----------TLTVRANDGGGLHGTTRIQIDIQDTNNNPPVFEKSEYTVTVGEDTPVMTSILRVRARDADIGRNGGIYYYLR-----NTQDFTIDAITGVIRPIRMLDFQSGQQRTLEVTARDRGSSPKAANVNVQVTIRSDISGYPPVVVPSSSSDRNRPPVF----PEGSSFTLSIREDFPVNGAIQV---VKANDPDAGSTNGQLRYSLSGNNN---FAIDSTSGVVTLQTQLEYKGNPAQDVIDLVVTATD-RNGQSGALSASVNLKIEV-LDVDDN 466          

HSP 11 Score: 55.0694 bits (131), Expect = 2.178e-7
Identity = 113/504 (22.42%), Postives = 197/504 (39.09%), Query Frame = 2
Query:  725 FILKAVDRENDDHRDISGVEVEIKVGDINDN--PPVFDKTFYTANIVEHSKLVNVIS-FYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMF-----ENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITAIN--EIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQ-IETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIFS 2203
             ++ A DR        + V ++I+V D++DN   PVF+       + E S +   I     TD D+G + QV  +I   +          FQ+  +    TG + +   +D E   + Y   + A D      SS   V + + + +D  P             +  M+     E  P  T V  ++V D D         L +  +++ IT  +  +I P       +I T  P+D   + + Y  +    S     T   T   +++ +    ++PPVF  + Y   + EN  Q ++  +  +  +D    K   V Y I+S       E F ID+ SG+ SS QS DYE    +   I A      N+ +++  +   I    + P F +  Y  +V E   V + + + I   D DT            +       + V Q+ G+ K +  I++     +    T   + + +N   M +   V +T+ D N   P+FS
Sbjct:  436 LVVTATDRNGQSGALSASVNLKIEVLDVDDNNNAPVFNPQQLELTVSEDSAVGRTIRRVSATDSDDGSDGQVVYSIIQGSGLG------VFQVQAT----TGDLIVAAPLDREKMSF-YDLVIKAEDKATFPKSSNLYVMVKIQDVDDHFPQF-----------TQPMYYAKAPEKSPENTFVTVVKVVDHD---------LGE-SVSYSITGASSFKIVPTSG----LILTTGPIDLTTEPSTYELVVTATSTNYGTTKRATG-QVNVEITSKTESPPVFKNTPYAVSVPEN--QGSIANLVCVAAIDT---KGQPVIYSIESRG-----EPFGIDSKSGRFSSLQSFDYETADKYRIQISAQSGIAPNIMTSSSDVAITIKDEKDPPQFSQSEYKVSVPEGASVRSTLSRGIRFVDEDTLSTQLECSMEEMTSRIPLDYLSVVQDGGECKFV--IEKTLDTFVASKFTFDMKVTDKNFPGMFATTKVEVTVTDTNTYTPVFS 890          
BLAST of Protocadherin Fat 1 vs. Ensembl Medaka
Match: dchs1a (protocadherin-16 [Source:NCBI gene;Acc:101175097])

HSP 1 Score: 192.2 bits (487), Expect = 4.730e-49
Identity = 151/525 (28.76%), Postives = 252/525 (48.00%), Query Frame = 2
Query:  671 PQLLLISP----------LDREVISEYRFILKAVDREND-DHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKLVNVISFYVT-DLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITAINEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIEN---IPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIF 2200
            P LL + P          LD E  S    ++KA D   D   R  S V   + V D NDN PVF  +    +++E   +  V+ F +  D D+G+N +V+  I++ N              FS +  TGS+ +   +D E     ++  ++A D+G+P+ SS+  + I +I+ ND+ P+ +  +    +S      EN+PA T V ++  SD D  +          H  F I ++  +          I T K LDRE        + +Y  D   L P     T+ I + D+NDN P+F R  Y  E+ EN   +P  T++  +P      D G +  + Y+I +   S D   F +D  SG +S+ + +D EK   +S  I+A D+ + +LSST+ + V V+D NDN+P F    Y+  + E VP+ + + +++  D D  P ++++ +  +   + +    +D+N+G++ T  P+DRE+  S T  + A + +    +N   S   V I I+DVNDN P F
Sbjct: 1355 PGLLTLDPVTGILSLGHKLDYETTSTLILVVKATDSAVDVSQRRWSSVTASVYVTDENDNLPVF-MSPTAVSVMEDQTMGFVVLFVIARDADQGENGRVTYRIQSGNTRGT----------FSLNSNTGSLSISKPLDREEQDV-FNLTIVAEDHGIPQHSSSQLLRIHVIDVNDETPLFEEAQYEAQIS------ENQPAGTTVLTVSASDSDQGINGQITYGGISHGAFSINSVTGV----------ITTTKSLDRE--SQDCYTVTVYAKD-GGLPPNYAKATVKIKVVDVNDNAPIFGRLYYNVEVPENQEALPLFTLRATDP------DAGSSGEINYRIAAGDPSGD---FHLDRHSGVLSTSRPLDREKTAGYSLTIVAQDQGRPSLSSTSTVKVAVLDINDNSPQFQSNSYTADISEGVPIGSLVLEVKARDADFGPNSQVMYFLSRGSKSMFV---IDENTGRIITAAPLDRERTASYTFEVCATDSSPADPRN---STAQVTIYIQDVNDNAPFF 1833          

HSP 2 Score: 157.532 bits (397), Expect = 2.529e-38
Identity = 167/599 (27.88%), Postives = 279/599 (46.58%), Query Frame = 2
Query:  440 ILIKVLDENDNSPKFLPFLNPYQTLPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSH-FTLLDKIASGRP---QLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKLVN-VISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRD-SLVTDIECSLDDYHLNFEITAINEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATV--KMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQV---IHVDQNSGKLKTIGPIDREKV-RSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIF 2200
            + IKV D ND++PKF      +Q +PE + I T   L  A+D D      + Y I      GN    FTL  +  S       L++ + LDRE  S Y   L+A D  +    D   + ++I V DINDN PVF ++ Y   I E+ +  N ++  + +D DEGQN  VS  I    + ++    ++F ID      +G I L   +D+E     +   + A DN      S A V + + + ND  P + +I   E  S  I+  E       VA + V+D D     ++  SL+     F +T  + I        +++   + LDRE+ ++ Y ++ +  +D     PL    +  I + D+NDNPP+F +  Y+    + IP+       +  +   DKD G N  ++Y I   + S    +F+ID+ +G I++   +DYEKN   S  ++A D     LSSTA++ + + D NDN P+F +  Y+ +++EN    T I ++   D D      +   +  +  +N  +     + + +G++ T   +DR++   S    + A +         + SE  V + +ED+NDN P F
Sbjct:    8 VTIKVNDINDHAPKFPRKRAKFQ-IPEQTAIGTRFPLEPAVDKDKGQLTTQGYLIKD----GNTGQAFTLETRRGSNEVLYLDLVVNTILDREKRSTYTLTLEAFDGGSPIRTD--QMTLDITVQDINDNAPVFQQSRYHTIISENLQPGNSILQVFASDSDEGQNGMVSYEI----NRRQSDPDQYFVIDSH----SGVITLNKPLDFEMR-RVHELVIQAQDNATQPEVSNAFVTVHVRDYNDNQPTMTIIFLSEDGSPRIS--EGAQPGQYVARISVTDPDYGEYANVNVSLEGGDGKFALTTKDSII-------YLVCVDQILDREE-RDTY-ELRVMATDSGS-PPLRAESSFIIEVTDVNDNPPLFDQPVYR----QAIPEVVFPGSFVLQVTARDKDQGPNGDISYSILKDQ-SVYHSWFSIDSVTGIITTSSQLDYEKNPNPSITVVASDGGNPPLSSTAVVNILLQDINDNEPVFERNFYNVSIKENTAPGTCILEVTAVDADGGTFGSVT--YSLASGSNIAISSQFTIGKETGQICTNAVLDRDQGPDSFDFTVMAVDGGG------LSSEAYVRVDLEDINDNRPAF 565          

HSP 3 Score: 123.635 bits (309), Expect = 7.239e-28
Identity = 158/595 (26.55%), Postives = 257/595 (43.19%), Query Frame = 2
Query:  428 SSFYILIKVLDENDNSPKFLPFLNPYQT-LPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVF--DKTFYTANIVEHSKLVNVISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITAINEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIFS 2203
            S+  + + VLD NDNSP+F    N Y   + E   I +++L   A D D        Y +S+    G+ S F + +   +GR  ++  +PLDRE  + Y F + A D    D R+ S  +V I + D+NDN P F  D      ++   S    + +    D D G N  V         Y+     R F I+     +TG I+  ++    T   + +  + A D G P  SS   V I +  ++ Q   I+  R    V+R +++ EN    T+V  +Q    D   T I  S+   +   +   IN +       E  +   + LD E+     L +    +        ++ + +++ L D+NDN P F    Y   + E   Q+    I  I   D D G+N  VTY I SS  S     F ID  +G IS+   +D E        + A D+    L+ +A + V ++D NDN P+ P P     V E+  + T I Q+   D+D+ P      +   S  + + + H     G +   G +D E+ R+   L    +++++Q      SE  + + ++DVNDN P F+
Sbjct: 1710 STSTVKVAVLDINDNSPQFQS--NSYTADISEGVPIGSLVLEVKARDADFGPNSQVMYFLSR----GSKSMFVIDEN--TGR--IITAAPLDRERTASYTFEVCATDSSPADPRN-STAQVTIYIQDVNDNAPFFIQDPLIVNISVSNLSTRRVLATMKAEDKDFGANGSVF--------YRFAIPVRGFTINS----LTGDIQATEKPQTLTQSQR-TLIVQAMDQGKPAQSSLGVVIIYIREQSYQG--IRFSR----VARDVSLQENAVKGTVVTKIQAQYPDGSKTGISHSIFSGN-RMDAFGINPV-----TGEIWVQKSEGLDFEETPRLRLVVKAETASS------SSYMAVNLILQDVNDNLPRFQLQNYVAFIRE--AQSHDFPIIQIAANDLDQGQNGQVTYSIRSSSQS---NLFKIDPLTGSISTAAIMDREIWTQTKLVVTATDRGTPRLAGSATLTVIIVDLNDNRPMIPLPR-EIRVPEDTLLGTVITQVTGNDVDSGPPLSYTLHLDGSSQDMFGIHHF---GGGVSLTGQLDYEE-RTWYTLTVRTSDSTHQ------SEANLTVLVDDVNDNAPSFT 2246          

HSP 4 Score: 119.783 bits (299), Expect = 9.052e-27
Identity = 155/604 (25.66%), Postives = 254/604 (42.05%), Query Frame = 2
Query:  428 SSFYILIKVLDENDNSPKF-LPFLNPYQTLPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLISPLDREVISE-YRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSK----LVNVISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITAINEIHPLGHYK----EFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKY-FHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVI-ITIEDVNDNPPIFS 2203
            S+  + I + D NDN P F   F N   ++ EN+   T IL  +A+D D   FG   Y ++    I   S FT+  +      Q+   + LDR+   + + F + AVD         S   V + + DINDN P F    Y  N+   S     +  V+++   D D G+N +++       D        +F ++      TG I L   I  + N       + A D G       AKVNI ++      PV       E      T+ E+    T+V ++Q S +  +  DI              AI+   P G++        + T  PLD E   +    +N+    +    P+     +HIN+ D+NDNPPVF  S  +  L+    +    ++  +   DKD G N  +++  D S      + F+ID +SG+I    S+ YE    +   +IA D     LSST +++VH+   N+  P+F   +Y   ++E  P+NT   Q+     D      ++   +H     +     +  +SG L     +DRE V+ + +L      AS  + +L  +    + I++ D NDN P F+
Sbjct:  440 STAVVNILLQDINDNEPVFERNFYN--VSIKENTAPGTCILEVTAVDADGGTFGSVTYSLASGSNIAISSQFTIGKETG----QICTNAVLDRDQGPDSFDFTVMAVDGGGLS----SEAYVRVDLEDINDNRPAFYPLGYAVNLSTQSAPGTYVAKVMAY---DPDLGENGRITYKTVPGGD------SPYFTLNKD----TGVISLSRSIYGKANSV-IPIVVSAQDGGGLFALVNAKVNISIVAGLVAPPVF------EQTQYHFTVSEDALRGTMVGTVQASSKTGISRDISY------------AISSGDPTGYFTVDPDTGALRTSLPLDHESQAS----LNLDLQARSGSPPVFGQTRVHINIADVNDNPPVFLPSSSESLLLPEHTEMGT-VVYRVQAEDKDSGVNEELSF--DLSFPIGLQKVFSIDRNSGEIRLVGSLCYETTPRYDLQVIAKDSGVPQLSSTLMLVVHIQAENNQGPVFDTLNYCVDLKEGTPMNTRFLQVRALSRDIPGSGLLIPLTYHLRPDGDAGAFGIASDSGWLFVKSTLDRE-VKDMYLLTVL---ASVGHGHLRKTGSATVRISVTDENDNSPRFT 990          

HSP 5 Score: 107.071 bits (266), Expect = 7.802e-23
Identity = 156/617 (25.28%), Postives = 265/617 (42.95%), Query Frame = 2
Query:  428 SSFYILIKVLDENDNSPKFLPFLNPYQTLPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKLVN-VISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFS-PSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSD----RDSLVTDIECSLDDYHLNFEITAINEIHPLGHYKEFIINTLKPLDRED-DKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIFSLINPAKSSLIFTINKGFR 2257
             S  + + ++D NDN P  +P     + +PE++ + TVI   +  D+DS    + Y       L G+      +     G   + L   LD E  + Y   ++  D  +    +++     + V D+NDN P F    Y   +VEH    + +I+   TD D G N +++  + +         K  F ID S  +L TG      E DYE +P      + A D G P LSST  V I + + ND AP+ K  +    VS      E+    + V +L   D    RD+   D   +  +    F+I +   +H L       + +L  +++ D +      + +  SD+  +   ++++++ I++ D NDNPP F+R+ Y   L E     T   I  +   D D   N  V Y I S   +     F +D+ +G +  ++ +D  K +L S  I+    D     + A + + V D ND+ P FP  H + +++EN P N+ +  +   D D      +  +   S     + I ++Q SG+++T    D EK  S   +  A +  +Y           V IT ED  D  P+F+      S L+F + +G +
Sbjct: 2127 GSATLTVIIVDLNDNRP-MIPLPREIR-VPEDTLLGTVITQVTGNDVDSGP-PLSYTL----HLDGSSQDMFGIHHFGGG---VSLTGQLDYEERTWYTLTVRTSDSTHQSEANLT-----VLVDDVNDNAPSFTHDLYQVTVVEHLPAGSAIITVTATDRDSGNNGKITYRVMSTT-------KGIFYIDPSNGTLFTGQNT---EFDYE-HPSILVV-VEAQDQGFPPLSSTTTVQIQVSDVNDNAPIFKQSKYTATVS------EDGLLGSTVLTLDPVDGDLFRDNCGFDFAIASGNLGNAFQIES--SVHFLEGRGFQTVGSLILVEKLDFEALPSYNLTVVVSDR-GIPQHSSSVSVLISVKDANDNPPAFSRTDYTVVLSEGTAAGT--EILHLSASDPDSAPNGEVQYFISSGDET---HLFQMDSWTGALRLQRPLD-SKTQL-SHTIVVQAVDGQGHYALAPVHIEVKDINDHKPFFPLQHITASIKENQPENSLVTILHAIDQDRGAFGMLTYHMLDSPKEGVEGILINQTSGEVRTRSAFDFEKKNSFHFVAIAVDPGNYS----ATVTVQVYITGEDEYD--PVFT-----SSELLFEVPEGAK 2689          

HSP 6 Score: 105.531 bits (262), Expect = 2.285e-22
Identity = 149/613 (24.31%), Postives = 256/613 (41.76%), Query Frame = 2
Query:  428 SSFYILIKVLDENDNSPKFLPFLNPYQTLPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKLVNVISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSIT--MFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITAINEIHPLGHYKEFIIN-------TLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIP---QATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNN-YQVIHVDQNSGKL---KTIGPIDREKVRSITILITAR--NEASYQNKNLMDSECMVIITIEDVNDNPPIFSLIN 2212
            SS  + I V+D ND +P F       Q + EN    T +L  SA D D    G   Y        G  SH      I S    +     LDRE    Y   + A  ++     + +   V+IKV D+NDN P+F + +Y   + E+ + + + +   TD D G + +++  I    D   D     F +D    +++ S  L  E         YS  ++A D G P LSST+ V + +++ ND +P        +  S S T  + E  P  ++V  L+V  RD+          D+  N ++         G    F+I+       T  PLDRE  +       +  +D     P  +   + I + D+NDN P F     Q  LI NI     +T +++  +   DKD G N  V Y+      +     FTI++ +G I + +          +  + A+D+ +   SS  ++I+++ + +     F +     +++EN    T + +I+       P+       H  ++ N      ++  +G++   K+ G +D E+   + +++ A   + +SY   NL+         ++DVNDN P F L N
Sbjct: 1504 SSQLLRIHVIDVNDETPLFEEAQYEAQ-ISENQPAGTTVLTVSASDSDQGINGQITY--------GGISHGAF--SINSVTGVITTTKSLDRESQDCYTVTVYA--KDGGLPPNYAKATVKIKVVDVNDNAPIFGRLYYNVEVPENQEALPLFTLRATDPDAGSSGEINYRIAA-GDPSGD-----FHLDRHSGVLSTSRPLDRE-----KTAGYSLTIVAQDQGRPSLSSTSTVKVAVLDINDNSP--------QFQSNSYTADISEGVPIGSLV--LEVKARDA----------DFGPNSQVMYFLS---RGSKSMFVIDENTGRIITAAPLDRE--RTASYTFEVCATDSSPADPRNSTAQVTIYIQDVNDNAPFF----IQDPLIVNISVSNLSTRRVLATMKAEDKDFGANGSVFYRF-----AIPVRGFTINSLTGDIQATEKPQTLTQSQRTLIVQAMDQGKPAQSSLGVVIIYIREQSYQGIRFSRVARDVSLQENAVKGTVVTKIQAQ----YPDGSKTGISHSIFSGNRMDAFGINPVTGEIWVQKSEG-LDFEETPRLRLVVKAETASSSSYMAVNLI---------LQDVNDNLPRFQLQN 2044          

HSP 7 Score: 104.375 bits (259), Expect = 4.459e-22
Identity = 165/708 (23.31%), Postives = 288/708 (40.68%), Query Frame = 2
Query:  203 KIYAVTEKASPFSLIDNRLSVVSNI----------DRESICPIKNSLNDYDQSAETYNSQQSSHSCKYDECCTVFSFQVDSGIKISSFYILIKVLDENDNSPKFLPFLNPYQTLPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDIND--NPPVFDKTFYTANIVEHSKLVNVISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNL-IATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITAINEIHPLGHYKEFIINTLKPLDREDDKNQYL---------KINIYCSDQDKLTP-LTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLD-KDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIA-IDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIFSLINPAKSSLIFTINKG 2251
            ++ AV      F  +   L+  SNI          +   IC   N++ D DQ  ++++              TV +  VD G   S  Y+ + + D NDN P F P L     L   S   T +    A D D    G   YK     + G DS +  L+K         +IS L R +  +   ++  V    D     + V  ++ +  +     PPVF++T Y   + E +    ++         G ++ +S  I + +         +F +D  P   TG++R    +D+E+   + S NL +   +G P +    +V+I + + ND  PV        ++    T        T+V  +Q  D+DS V + E S D   L+F         P+G  K F I      DR   + + +         + ++    +D   P L++ L + +++   N+  PVF    Y  +L E  P  T  +    L+ D    G    +TY +   +   D   F I +DSG +  + ++D E   ++   ++A +       + +A + + V D NDN+P F +      VREN+P  T  G +   D D+ P  ++      S+ +  +   ++ ++G++ T   +DRE+  S  + +   +  S        +   V IT+ D NDN P F    P K S+I  + +G
Sbjct:  479 EVTAVDADGGTFGSVTYSLASGSNIAISSQFTIGKETGQIC--TNAVLDRDQGPDSFD-------------FTVMA--VDGGGLSSEAYVRVDLEDINDNRPAFYP-LGYAVNLSTQSAPGTYVAKVMAYDPDLGENGRITYKT----VPGGDSPYFTLNKDTG------VIS-LSRSIYGKANSVIPIVVSAQDGGGLFALVNAKVNISIVAGLVAPPVFEQTQYHFTVSEDALRGTMVGTVQASSKTGISRDISYAISSGDPTG------YFTVD--PD--TGALRTSLPLDHES---QASLNLDLQARSGSPPVFGQTRVHINIADVNDNPPVFLPSSSESLLLPEHTEMG-----TVVYRVQAEDKDSGVNE-ELSFD---LSF---------PIGLQKVFSI------DRNSGEIRLVGSLCYETTPRYDLQVIAKDSGVPQLSSTLMLVVHIQAENNQGPVFDTLNYCVDLKEGTPMNTRFLQVRALSRDIPGSGLLIPLTYHL---RPDGDAGAFGIASDSGWLFVKSTLDREVKDMYLLTVLASVGHGHLRKTGSATVRISVTDENDNSPRFTQERIFMAVRENLPAGTGFGHVLAKDRDSGPNGRL----SYSFLHPNRHFQINTHTGEISTRMTLDREQQSSHQLAVVVHDGGSPSRT----ATGTVFITVLDDNDNDPTFIHGQPGK-SIIIQVTEG 1108          

HSP 8 Score: 95.9005 bits (237), Expect = 2.178e-19
Identity = 159/613 (25.94%), Postives = 248/613 (40.46%), Query Frame = 2
Query:  422 KISSFYILIKVLDENDNSPKFLP---FLNPYQTLPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVF-----DKTFYTANIVEHSKLVNVISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSL----VTDIECSLDDYHLNFEITAINEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLF--DINDNPPVFTRSKYQGELIENI-PQATVKMIEPILTLDKDH-GKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNI----IAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIF 2200
            K  S  + I V DENDNSP+F     F+   + LP  +    V+    A D DS   G   Y    P     + HF    +I +   ++     LDRE  S ++  +  V       R  +G  V I V D NDN P F      K+         S  V + +    D DEG+N  V  ++      +           FS + + G +R      Y     +YS  + ATD GLP  S++  + I +++ N      +   + +  S S    E+    +I+ S+ + DR  L    VT       D    F +  +     L H          PLD E +    L+I +   D   L P  ++L +H+++   D ND+ P F        + EN+ P ++V   +     D+D  G N+ + Y I     ST     T+D  +G +S    +DYE        +     A+D  Q   SS     V+V D NDN P+F  P  + +V E+  +   +  +   D D + EN  V Y  +S  N      ++ N+G L    P+DRE+     + I A +    Q+     S  ++ I + DVND  P+F
Sbjct:  969 KTGSATVRISVTDENDNSPRFTQERIFMAVRENLPAGTGFGHVL----AKDRDSGPNGRLSYSFLHP-----NRHF----QINTHTGEISTRMTLDREQQSSHQLAV-VVHDGGSPSRTATGT-VFITVLDDNDNDPTFIHGQPGKSIIIQVTEGQSPGVLLGTLQAKDPDEGENGTVFYSLSGPRAER-----------FSLNAINGELRSSSPFSYSERA-EYSLMVTATDRGLPPRSASCSLAIQVLSIN------RPQTQTKFHSISFNSVEDTSPGSIIGSVCLHDRGGLEEGKVTYTVVGGTDRDGTFVLDRLTGDVYLAH----------PLDYEQEVRYNLEIEV---DDFSLVPPRSSL-VHLDIIIEDNNDHTPEFAEDPITIVISENMDPGSSVYTFQ---ATDRDGSGANSAIKYSILHQSPSTPG-LLTLDPVTGILSLGHKLDYETTSTLILVVKATDSAVDVSQRRWSSVT-ASVYVTDENDNLPVFMSP-TAVSVMEDQTMGFVVLFVIARDAD-QGENGRVTYRIQS-GNTRGTFSLNSNTGSLSISKPLDREEQDVFNLTIVAEDHGIPQHS----SSQLLRIHVIDVNDETPLF 1522          

HSP 9 Score: 75.0998 bits (183), Expect = 4.197e-13
Identity = 162/694 (23.34%), Postives = 285/694 (41.07%), Query Frame = 2
Query:  380 ECCTVFSFQV---DSGIK--ISSFYILIKVLDENDNSPKFLPFLNPYQTLPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDH-RDISGVEVEIKVGDINDNPPVF--DKTFYTA--NIVEHSKLVNVISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLN------FEITAINEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQAT-VKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWE-YFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVH----VIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKY--FHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIFSLINPAKSSLIFTINKGFRHENCQMIPYAVS-DADHDEPNSDSCCILQLDNDQNGMLYLLSNT 2386
            E    +  QV   DSG+    S+  +++ +  EN+  P F   LN    L E + +NT  L   A+  D    G+           G+   F     IAS    L + S LDREV   Y  +L  +      H R      V I V D NDN P F  ++ F     N+   +   +V++    D D G N ++S +    N        R FQI+      TG I     +D E     +   ++  D G P  ++T  V I +++ ND  P     + G+ +   +T  E +    ++ +LQ  D D    + E     Y L+      F + AIN     G  +     +  P    + + +Y  + +  +D+  L P + + ++ I +  IN  P   T++K+      ++   +   +I  +   D+   +   VTY +      TD +  F +D  +G +     +DYE+   ++   + I+ D  +L      +VH    + D ND+ P F +   +  + EN+   + +   + TD D    N  +KY   H+S  +   ++ +D  +G L     +D E   ++ +++ A + A   ++    S     + + D NDN P+F  ++P   S++     GF      ++ + ++ DAD  E N      +Q  N + G   L SNT
Sbjct:  841 ETTPRYDLQVIAKDSGVPQLSSTLMLVVHIQAENNQGPVF-DTLNYCVDLKEGTPMNTRFLQVRALSRDIPGSGLLIPLTYHLRPDGDAGAF----GIASDSGWLFVKSTLDREVKDMY--LLTVLASVGHGHLRKTGSATVRISVTDENDNSPRFTQERIFMAVRENLPAGTGFGHVLA---KDRDSGPNGRLSYSFLHPN--------RHFQIN----THTGEISTRMTLDREQQS-SHQLAVVVHDGGSPSRTATGTVFITVLDDNDNDPTFIHGQPGKSIIIQVT--EGQSPGVLLGTLQAKDPD----EGENGTVFYSLSGPRAERFSLNAIN-----GELR-----SSSPFSYSE-RAEY-SLMVTATDR-GLPPRSASCSLAIQVLSIN-RPQ--TQTKFHSISFNSVEDTSPGSIIGSVCLHDRGGLEEGKVTYTV---VGGTDRDGTFVLDRLTGDVYLAHPLDYEQEVRYN---LEIEVDDFSLVPPRSSLVHLDIIIEDNNDHTPEFAEDPITIVISENMDPGSSVYTFQATDRDGSGANSAIKYSILHQS-PSTPGLLTLDPVTGILSLGHKLDYETTSTLILVVKATDSAVDVSQRRW-SSVTASVYVTDENDNLPVF--MSPTAVSVMEDQTMGF------VVLFVIARDADQGE-NGRVTYRIQSGNTR-GTFSLNSNT 1471          

HSP 10 Score: 53.5286 bits (127), Expect = 1.545e-6
Identity = 78/297 (26.26%), Postives = 128/297 (43.10%), Query Frame = 2
Query:  458 DENDNSPKFLPFLNPYQTLPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKLVNVIS-FYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFE-NEPAR--TIVASLQVSDRDSLVTDIEC-SLDDYHLNFEI 1333
            D NDN P F    +    L E +   T IL  SA D DS   G   Y IS     G+++H   +D        L L  PLD +    +  +++AVD +   H  ++ V +E+K  DIND+ P F     TA+I E+    ++++  +  D D G    ++  +    D  K+ ++         +  +G +R     D+E     + F  IA D G    S+T  V + +  +++  PV          + S  +FE  E A+   ++ ++Q  D D  V  I   SL +    FE+
Sbjct: 2459 DANDNPPAF-SRTDYTVVLSEGTAAGTEILHLSASDPDSAPNGEVQYFISS----GDETHLFQMDSWTGA---LRLQRPLDSKTQLSHTIVVQAVDGQG--HYALAPVHIEVK--DINDHKPFFPLQHITASIKENQPENSLVTILHAIDQDRGAFGMLTYHML---DSPKEGVEGILI-----NQTSGEVRTRSAFDFEKK-NSFHFVAIAVDPG--NYSATVTVQVYITGEDEYDPVF---------TSSELLFEVPEGAKKGQVIGTVQARDEDEGVDGIVLYSLSESSPYFEV 2723          
BLAST of Protocadherin Fat 1 vs. Ensembl Medaka
Match: ENSORLT00000005325.2 (protocadherin-16 [Source:NCBI gene;Acc:101171352])

HSP 1 Score: 190.66 bits (483), Expect = 1.633e-48
Identity = 166/592 (28.04%), Postives = 274/592 (46.28%), Query Frame = 2
Query:  446 IKVLDENDNSPKFLPFLNPYQ-TLPENSQINTVILLPSAIDLDSEAFGIKY-YKISKPFLIGNDSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDREND-DHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKLVNVISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITAINE----IHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIF 2200
            I V D ND++P+F    +P    +PEN +    I    A D D      +  Y I   +     S    LD ++     L +   LDRE       +++A D+  D   R    V   + V D NDNPPVF      + + +      ++     D DEG+N +VS  I++ N+  +          FS S  TGS+ ++  +D E     ++  ++A D+G+P+LS++  + + +I+ ND+AP+ +    G  V       EN+   T V  +  +DRD           + H+ +    + E    I+PL      +I T K LD E  +N Y+ + +Y  D   L P      + + + D+NDN PVF +  Y  E+ EN P   +  ++     D D G    + YKI +     D   F + + +G +S+   +D EK   ++  ++A+D+    LS+TA + V V+D NDN+P+F K  Y+  V EN     ++ Q+  TD+D     KI+ +  +     +    VD+++G++ T  P+DREK+ S    + A + +     N   S   V +TI DVNDN P F
Sbjct: 1406 INVQDSNDHAPQFSE--DPVTIVIPENKEPGASIYAFQAGDQDGSGPNSELRYSIEHQWP--QTSDLLALDPLSG---VLTIRQQLDRESTPFLYLVVRATDQAVDLSQRRWGSVTARLFVKDENDNPPVFSSPSAISVMEDQPVGFVILHVMAHDADEGENGRVSYRIQSGNNAGR----------FSLSPNTGSLSILKALDREEQEV-FNLTIVAEDHGIPQLSTSQVLCVQVIDVNDEAPMFQQAEFGTHV------MENKGPGTTVLKVTATDRDQG--------SNGHITY--GGVTEDGFVINPL----TGVITTTKELDAEL-QNHYV-LTVYARD-GGLPPNFAKAVVRVEVQDVNDNAPVFAKMWYGLEVPENQPAVELCFVK---ATDPDSGPGGELEYKIAAGDPDGD---FQLHSRTGALSTSHGLDREKKPKYTLEVVAVDRGSPALSATATVEVKVLDVNDNSPVFSKNSYTVEVLENAEEGYQVLQVSATDVDEGLNGKILYFLSQEADGAFA---VDEDTGRITTAAPLDREKLASYNFRVFAVDLSPSVPIN---SSAQVKVTILDVNDNAPFF 1944          

HSP 2 Score: 169.088 bits (427), Expect = 7.430e-42
Identity = 172/608 (28.29%), Postives = 276/608 (45.39%), Query Frame = 2
Query:  413 SGIKISSFYILIKVLDENDNSPKFLPFLNPYQTLPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQL---LLISPL-DREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEH-SKLVNVISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLI--ATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRD-SLVTDIECSLDDYHLNFEITAINEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATV--KMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQV-IHVDQNSGKLKTIGPIDR-EKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIF 2200
            +GI I    + I V D ND++P+F P       +PE++ + T   L  A D D +    + Y I +    GN  H   L+   S    L   L++S L DRE  S Y  +++A D      R +  + +E+ V DIND+ PVF+++ Y A I E   +  +++  +  D DEG N  V   I    + ++   +R+F ID    L +G I L   +DYE    K    L+  A DN      + A V I + + ND  P + +I   E  S  I+  E       VA + V+D D     ++  SL+     F +T  + I        ++I   + LDRE+  +  L++    +      PL    +  I + D+NDNPP+F +  Y+    + IP+       +  +   DKD G N  V Y +   K     ++F+ID  +G I++  ++D+E     S  +IA D  +  LSSTA + + V D NDNAP+F    Y+ +V+EN P  T   ++  TD D      I            Q    +++ +G+L T   +DR E +    + +TA +         + S   V + + D+NDN P F
Sbjct:  106 TGITIE---VSITVNDINDHAPEF-PKKKALLKIPEHTVVGTRFSLDPATDADKDQLTTQGYAIKE----GNVGHMFKLESKRSANKVLYLDLVVSGLLDREKRSSYSLVIEAFD--GGSPRRVGFMTLEVTVTDINDHAPVFNQSRYHAIISESLPQGSSILQVFAADEDEGDNGLVLYEI----NRRQSDPERYFVID----LKSGVITLNRPLDYE---LKRVHELVVQARDNASQPEVTNAFVTIHVRDFNDNQPTMTIIFLSEDGSPRIS--EGAQPGQYVARISVTDPDYGEYANVNVSLEGGDGKFALTTKDSII-------YLIYVDQVLDREERDSYDLRV---MATDSGTPPLRAESSFTIQVTDVNDNPPLFDQQAYR----QTIPEVVYPGSFVLQVTARDKDQGPNGDVRYSLLKGK-----KWFSIDPITGIITTATALDFESEPAPSVTVIATDGGRPPLSSTAKVDIVVQDVNDNAPVFSSNFYNVSVKENTPAGTCFLEVSATDEDRGSFGTITYALTLKSGGTVQTPFTINKQTGQLCTASALDRDEGLEKYDLTVTATDGGG------LSSAVGVRVKVMDINDNRPTF 665          

HSP 3 Score: 152.525 bits (384), Expect = 9.488e-37
Identity = 169/609 (27.75%), Postives = 266/609 (43.68%), Query Frame = 2
Query:  422 KISSFYILIKVLDENDNSPKF-LPFLNPYQT--LPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLI---SPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKLVN-VISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITAINEIHPLGHYKEFIIN-------TLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITAR--NEASYQNKNLMDSECMVIITIEDVNDNPPIF 2200
            ++++ ++ I V D NDN P   + FL+   +  + E +Q    +   S  D D   +G +Y  ++   L G D  F L  K +     + LI     LDRE    Y   + A D      R  S     I+V D+NDNPP+FD+  Y   I E     + V+     D D+G N  V         Y   + K++F ID     +TG I     +D+E+ P   S  +IATD G P LSSTAKV+I++ + ND APV            ++++ EN PA T    +  +D D        S         + +   +        F IN       T   LDR++   +Y  + +  +D   L+   + + + + + DINDN P F    Y   L  +    T   +  +   D D G+N  +TY+     +S    +FT++ D+G IS  +S+  + N + S  I A+D D       A + V ++  + ++P+F +  Y FTV E+V   T +G +      T+       Y+  S  +      VD  SG ++T  P+D E   S+ + I AR  +  SY           V I+I D+NDN P F
Sbjct:  325 EVTNAFVTIHVRDFNDNQPTMTIIFLSEDGSPRISEGAQPGQYVARISVTDPD---YG-EYANVNVS-LEGGDGKFALTTKDSI----IYLIYVDQVLDREERDSYDLRVMATDSGTPPLRAES--SFTIQVTDVNDNPPLFDQQAYRQTIPEVVYPGSFVLQVTARDKDQGPNGDVR--------YSLLKGKKWFSID----PITGIITTATALDFESEPAP-SVTVIATDGGRPPLSSTAKVDIVVQDVNDNAPVFSS------NFYNVSVKENTPAGTCFLEVSATDED------RGSFGTITYALTLKSGGTVQ-----TPFTINKQTGQLCTASALDRDEGLEKY-DLTVTATDGGGLS---SAVGVRVKVMDINDNRPTFYPVLYTVSLSTHSAPGT--SVVKVTANDPDAGENGRITYRTVPGGSS---PFFTLNKDTGVISLSRSLHSKANTVISMVITAVDGDGLTAPVNARVNVSIVGGSTSSPVFEQAQYFFTVSEDVLRGTAVGVVRAA---TKTGVSKGIYYSISSGDPDGYFTVDSTSGTIRTALPLDHETCSSLDLEIQARYGSPPSY-------GISRVHISISDINDNAPTF 873          

HSP 4 Score: 136.732 bits (343), Expect = 6.783e-32
Identity = 165/605 (27.27%), Postives = 269/605 (44.46%), Query Frame = 2
Query:  440 ILIKVLDENDNSPKFLPFLNPYQTLPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIASGR-------PQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKLVN-VISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLI--ATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLN------FEI-TAINEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIFS 2203
            + + ++D+NDNSP  +P     + +PEN+ I T I L +  D+DS            P L    S+  LLD  A G+         + +  PLD E  + Y   ++A D ++    +I+     I V DINDN P+F    Y  ++ EH+   + VI+   TD D G+N +V+  + +         +  F ID  PS  T  I    E D    P + S N++  A+D G P LSS   V + + + ND APV        +VS      +  P  T++   +  D D  ++   C  D    N      F+I +++  +   G      +   + LD E  K+ Y  + +  SD+  +   ++++   I + D+NDNPPVF+R +Y   L E     T   I  +   D D   NA V Y I S     +   F+ID  +G +  ++++D E        I A D       +   +IV V D NDN P FP    + T++EN+P N+ +  +   D DT    ++  Y  +   +      ++QNSG++++  P D EK+ S   +  A +  ++           V +T ED  D  P+F+
Sbjct: 2240 LTVIIIDQNDNSPT-IPLPQEIR-IPENTLIGTEITLVTGNDVDS-----------SPAL----SYSLLLDPTALGKFGIHRYTGGVSITGPLDFEEKTWYTVTVQATDSQHQTEANIT-----IVVEDINDNAPLFTHDLYQISLPEHTPPGSAVITVTATDRDSGENGRVNYRVMSST-------QEGFYID--PSNGTLFINHRAEFD----PERPSVNIVIEASDGGSPALSSLTTVQVHISDINDNAPVFHQSEYRAMVSE-----DTFPGSTLLI-FEAFDND--LSRENCGFDFAIANGNEGNVFQIESSVRFLEGRGFQTVGTLLLAEGLDFET-KSLY-NLTVVVSDR-GVPQRSSSVAALITIGDVNDNPPVFSRPEYTVALSEGAVSGT--EIIRLTATDPDSTPNAEVQYTISSGD---EMNLFSIDQWTGALRLQRALDREHQSTHVVIIQATDG--QGYFALVPVIVDVKDVNDNHPYFPVETLTATIQENLPANSPVTVLHAIDHDTGVFGQLKYYMMERSGSGRDSFVIEQNSGEVRSKIPFDFEKINSFNFVAVAVDSGNHSAT----VTVQVFVTGEDEYD--PLFT 2785          

HSP 5 Score: 128.642 bits (322), Expect = 2.036e-29
Identity = 136/537 (25.33%), Postives = 240/537 (44.69%), Query Frame = 2
Query:  593 YYKISKPFLIGN-DSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEH-SKLVNVI-SFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITAINEIHPLGHYKE----FIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIF----PKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITI 2170
            YY IS     G+ D +FT+     + R  L    PLD E  S     ++A       +  IS   V I + DINDN P F  +   + ++   +K+  VI     TD D G N Q+S  + +         +R F ID      +G +RLI  + Y++ P +Y   +IA D G P+LSST  + + +  ++ Q P        + ++  + + EN P  T    ++  +R++       S     +++ +    +    G   +    F+ ++L   DRE  K+ YL + +  + +   T  T + T+ + + D NDN P  ++ +    + EN+   T      +   D+D G NA +TY++  +      ++F I++ +G+IS+R ++D E+   +   ++  D      S+T    + V+D ND+AP F    P     F VRE +P  T +G +   D D   EN  V Y      +  +   ++ N+G+LKT  P+   +    T  +TA +  +      + S C + I +
Sbjct:  805 YYSISS----GDPDGYFTVDSTSGTIRTAL----PLDHETCSSLDLEIQARYGSPPSY-GIS--RVHISISDINDNAPTFLPSSSESLLLPEVTKMGTVIYRIQATDKDSGHNGQLSFDLISAGAAGSSG-QRTFGIDRG----SGEVRLIGSLSYDSVP-RYDLQVIAKDGGAPQLSSTFTLVVHIQAQDAQGPNF------DTLTYRVELRENAPLNTRFLQVRALNREASGNGGSSSSISSSISYRLRPDGDAAGFGIMPDSGWLFVRSSL---DREA-KDMYL-LTVLATSRHSGTGRTGSATVRVTVTDENDNSPRLSQERVFLAVRENLVAGT--GFGRVSATDRDAGLNARLTYRLLHAD-----KHFQINSQTGEISTRLALDREQQSSYQLFVVVQDGGTPPRSATGTAHISVLDENDHAPTFTHVRPDTERMFEVREGLPSGTMVGSVAAKDPD-EGENGTVYYSLSG--SRVERFSLNPNTGELKTASPLRWAERAEYTFTLTAADHGTPG----LSSTCQIRIQV 1299          

HSP 6 Score: 121.324 bits (303), Expect = 3.298e-27
Identity = 153/597 (25.63%), Postives = 258/597 (43.22%), Query Frame = 2
Query:  446 IKVLDENDNSPKFL-------PFLNPYQTLPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKLVNVI-SFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATD--NGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFEN-EPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITAINEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIFS 2203
            I VLDEND++P F              + LP  + + +V    +A D D    G  YY +S   +      F+L         +L   SPL     +EY F L A D         S  ++ I+V   + + P  +    T N+VE +   ++I S    D  E    +  +T    +   +D     F +D     + G + L+ E+DYE     Y+ ++  +D     P  S   K+ I + + ND AP             +I + EN EP  +I A  Q  D+D    + E      H   + + +  + PL      ++   + LDRE     YL +       D       ++T  + + D NDNPPVF+ S     ++E+ P   V  I  ++  D D G+N  V+Y+I S  N+     F++  ++G +S  +++D E+ ++F+  I+A D     LS++ ++ V VID ND AP+F +  +   V EN    T + ++  TD D      I    +   T +  VI  +  +G + T   +D E      + + AR+     N     ++ +V + ++DVNDN P+F+
Sbjct: 1189 ISVLDENDHAPTFTHVRPDTERMFEVREGLPSGTMVGSV----AAKDPDEGENGTVYYSLSGSRV----ERFSLNPNTG----ELKTASPLRWAERAEYTFTLTAADHGTPGLS--STCQIRIQVISSSRSIPKPNVLSMTLNVVEGTAPGSIIGSVGQVDKPESNVLEGQVTYLVVDGTDRDGT---FMVD----RLRGDVYLVRELDYEKG-SSYTLHVEVSDFSKAFPN-SYLVKLEINVQDSNDHAPQFSED------PVTIVIPENKEPGASIYA-FQAGDQDGSGPNSELRYSIEHQWPQTSDLLALDPLSG----VLTIRQQLDRESTPFLYLVVRATDQAVDLSQRRWGSVTARLFVKDENDNPPVFS-SPSAISVMEDQPVGFV--ILHVMAHDADEGENGRVSYRIQSGNNAG---RFSLSPNTGSLSILKALDREEQEVFNLTIVAEDHGIPQLSTSQVLCVQVIDVNDEAPMFQQAEFGTHVMENKGPGTTVLKVTATDRDQGSNGHIT---YGGVTEDGFVI--NPLTGVITTTKELDAELQNHYVLTVYARDGGLPPNF----AKAVVRVEVQDVNDNAPVFA 1736          

HSP 7 Score: 116.316 bits (290), Expect = 1.092e-25
Identity = 157/599 (26.21%), Postives = 250/599 (41.74%), Query Frame = 2
Query:  446 IKVLDENDNSPKFLPFLNPYQT-LPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKLVNVISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKV---------NIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIECSL---DDYHLNFEITAINEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIFS 2203
            +KVLD NDNSP F    N Y   + EN++    +L  SA D+D    G   Y +S+      D  F + +   +GR  +   +PLDRE ++ Y F + AVD       + S  +V++ + D+NDN P F +      +        + +    D D G N  V     T        +K      FS + +TG I+  + +   T   + +  + A D G P  S+   V         N I  +KN               +R +++ EN    T VA  Q    D     I  SL   +  HL F+I++           E  + +   LD E+     L +      + +    T+ +  ++ L D+NDN P F    Y   + E   Q     I  ++  D D G+N  VTY I SS  S     F ID  +G I++   +D E        + A D+    L+  A + V +ID NDN+P  P P     + EN  + TEI  +   D+D+ P          +    +  IH  + +G +   GP+D E+    T+ + A  ++ +Q      +E  + I +ED+NDN P+F+
Sbjct: 1827 VKVLDVNDNSPVFSK--NSYTVEVLENAEEGYQVLQVSATDVDEGLNGKILYFLSQE----ADGAFAVDED--TGR--ITTAAPLDREKLASYNFRVFAVDLSPSVPIN-SSAQVKVTILDVNDNAPFFIQDPLIIEVSSRRSQRVLATMKAEDKDFGANGSVFYRFATP-------VK-----GFSINSLTGEIQATEPLGSLTQAQR-TLIVEAMDQGSPAQSAHGVVVVYVKEVEYNGIRFSKN---------------ARDVSIQENASKGTAVAQAQAEYPDGTRQGISYSLFSGNKKHL-FKISS--------STGEIWVESSNGLDFEETPRLRLVV------KAETVSSTSFMAFNLVLQDVNDNLPRFQLQNYVAFMKE--AQGYEMPIIQVVAEDVDQGQNGQVTYSIQSSSMSG---LFKIDPVTGSITTTAIMDREIFTQTKLVVTATDRGSPRLAGLATLTVIIIDQNDNSPTIPLPQ-EIRIPENTLIGTEITLVTGNDVDSSPALSYSLLLDPTALGKFG-IH--RYTGGVSITGPLDFEEKTWYTVTVQA-TDSQHQ------TEANITIVVEDINDNAPLFT 2355          

HSP 8 Score: 115.546 bits (288), Expect = 1.725e-25
Identity = 117/485 (24.12%), Postives = 218/485 (44.95%), Query Frame = 2
Query:  779 VEVEIKVGDINDNPPVFDKTFYTANIVEHSK-LVNVISFYVTDLD-EGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGL---PRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITAINEIHPLGHYK----EFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKI-VKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIFS 2203
            V++EI V D ND+ P F +   T  I E+ +   ++ +F   D D  G N ++  +IE    ++  Q      +D     ++G + +  ++D E+ P+ Y   + ATD  +    R   +    + + ++ND  PV            +I++ E++P   ++  +   D D          ++  +++ I + N     G +        ++ LK LDRE+   +   + I   D   +  L+T+  + + + D+ND  P+F ++++   ++EN    T  +   +   D+D G N ++TY           + F I+  +G I++ + +D E    +   + A D       + A++ V V D NDNAP+F K  Y   V EN P   E+  ++ TD D+ P  ++  K        ++Q +H    +G L T   +DREK    T+ + A +  S      + +   V + + DVNDN P+FS
Sbjct: 1402 VKLEINVQDSNDHAPQFSEDPVTIVIPENKEPGASIYAFQAGDQDGSGPNSELRYSIE----HQWPQTSDLLALD----PLSGVLTIRQQLDRESTPFLY-LVVRATDQAVDLSQRRWGSVTARLFVKDENDNPPVFSS-------PSAISVMEDQPVGFVILHVMAHDADEG--------ENGRVSYRIQSGNNA---GRFSLSPNTGSLSILKALDREE--QEVFNLTIVAEDH-GIPQLSTSQVLCVQVIDVNDEAPMFQQAEFGTHVMENKGPGTTVL--KVTATDRDQGSNGHITY------GGVTEDGFVINPLTGVITTTKELDAELQNHYVLTVYARDGGLPPNFAKAVVRVEVQDVNDNAPVFAKMWYGLEVPENQPA-VELCFVKATDPDSGPGGELEYKIAAGDPDGDFQ-LH--SRTGALSTSHGLDREKKPKYTLEVVAVDRGS----PALSATATVEVKVLDVNDNSPVFS 1840          

HSP 9 Score: 115.546 bits (288), Expect = 1.925e-25
Identity = 155/606 (25.58%), Postives = 249/606 (41.09%), Query Frame = 2
Query:  446 IKVLDENDNSPKFLP-FLNPYQTLPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLISPLDR-EVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSK-LVNVISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITAINEIHPLGHYK----EFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLT-IHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSS--KNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQV--------IHVDQNSGKLKTIGPIDREK--VRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIFS 2203
            I V D NDN+P F   F N   ++ EN+   T  L  SA D D  +FG   Y ++        + FT+  +      QL   S LDR E + +Y   + A D         S V V +KV DINDN P F    YT ++  HS    +V+     D D G+N +++                FF ++      TG I L   +  + N    S  + A D         A+VN+ ++  +  +PV       E      T+ E+    T V  ++ + +  +   I  S            I+   P G++        I T  PLD E   +  L+I          +P +  ++ +HI++ DINDN P F  S  +  L+  + +    +I  I   DKD G N  +++ + S+    S+    F ID  SG++    S+ Y+    +   +IA D     LSST  ++VH+   +   P F    Y   +REN P+NT   Q+    L+             S + +Y++          +  +SG L     +DRE   +  +T+L T+R+  + +  +       V +T+ D NDN P  S
Sbjct:  546 IVVQDVNDNAPVFSSNFYN--VSVKENTPAGTCFLEVSATDEDRGSFGTITYALTLKSGGTVQTPFTINKQTG----QLCTASALDRDEGLEKYDLTVTATDGGGLS----SAVGVRVKVMDINDNRPTFYPVLYTVSLSTHSAPGTSVVKVTANDPDAGENGRITYRTVPGGS------SPFFTLNKD----TGVISLSRSLHSKANTV-ISMVITAVDGDGLTAPVNARVNVSIVGGSTSSPVF------EQAQYFFTVSEDVLRGTAVGVVRAATKTGVSKGIYYS------------ISSGDPDGYFTVDSTSGTIRTALPLDHETCSSLDLEIQARYG-----SPPSYGISRVHISISDINDNAPTFLPSSSESLLLPEVTKMGT-VIYRIQATDKDSGHNGQLSFDLISAGAAGSSGQRTFGIDRGSGEVRLIGSLSYDSVPRYDLQVIAKDGGAPQLSSTFTLVVHIQAQDAQGPNFDTLTYRVELRENAPLNTRFLQVRA--LNREASGNGGSSSSISSSISYRLRPDGDAAGFGIMPDSGWLFVRSSLDREAKDMYLLTVLATSRHSGTGRTGS-----ATVRVTVTDENDNSPRLS 1099          

HSP 10 Score: 109.768 bits (273), Expect = 1.074e-23
Identity = 147/614 (23.94%), Postives = 265/614 (43.16%), Query Frame = 2
Query:  410 DSGI-KISSFYIL-IKVLDENDNSPKFLPFLNPYQTLPENSQINTVILLPSAIDLDSEAFG-IKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKLVNVISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIECSLDD---YHLNFEIT---AINEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKL--KTIGPIDREKVRSITILITAR--NEASYQNKNLMDSECMVIITIEDVNDNPPIFSLIN 2212
            D GI ++S+  +L ++V+D ND +P F         + EN    T +L  +A D D  + G I Y  +++   + N     L   I + +        LD E+ + Y  +L    R+     + +   V ++V D+NDN PVF K +Y   + E+   V +     TD D G   ++   I   +             DF     TG++     +D E  P KY+  ++A D G P LS+TA V + +++ ND +PV          S ++ + EN  A      LQVS      TD++  L+    Y L+ E     A++E           I T  PLDRE  K       ++  D     P+ ++  + + + D+NDN P F +      +IE   + + +++  +   DKD G N  V Y+      +T  + F+I++ +G+I + + +        +  + A+D+     S+  +++V+V +   N   F K     +++EN    T + Q +    D   +      F     N   +  +  ++G++  ++   +D E+   + +++ A   +  S+   NL+         ++DVNDN P F L N
Sbjct: 1607 DHGIPQLSTSQVLCVQVIDVNDEAPMFQQAEFGTHVM-ENKGPGTTVLKVTATDRDQGSNGHITYGGVTEDGFVIN----PLTGVITTTKE-------LDAELQNHY--VLTVYARDGGLPPNFAKAVVRVEVQDVNDNAPVFAKMWYGLEVPENQPAVELCFVKATDPDSGPGGELEYKIAAGDP----------DGDFQLHSRTGALSTSHGLDREKKP-KYTLEVVAVDRGSPALSATATVEVKVLDVNDNSPVFSK------NSYTVEVLEN--AEEGYQVLQVS-----ATDVDEGLNGKILYFLSQEADGAFAVDE-------DTGRITTAAPLDRE--KLASYNFRVFAVDLSPSVPINSSAQVKVTILDVNDNAPFFIQDPL---IIEVSSRRSQRVLATMKAEDKDFGANGSVFYRF-----ATPVKGFSINSLTGEIQATEPLGSLTQAQRTLIVEAMDQGSPAQSAHGVVVVYVKEVEYNGIRFSKNARDVSIQENASKGTAVAQAQAEYPDGTRQGISYSLFSG---NKKHLFKISSSTGEIWVESSNGLDFEETPRLRLVVKAETVSSTSFMAFNLV---------LQDVNDNLPRFQLQN 2153          

HSP 11 Score: 108.227 bits (269), Expect = 3.544e-23
Identity = 157/626 (25.08%), Postives = 265/626 (42.33%), Query Frame = 2
Query:  383 CCTVFSFQVDSGI-KISSFYILIKVLDENDNSPKFLPFLNPYQTLPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVF-------DKTFYTANIVEHSKLVNVISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITAINEIHPLGHYKEFIINTLKP---LDREDD--KNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENI-PQATVKMIEPILTLDKDH-GKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDK----DQSNLSS-TALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIF 2200
              TV +    SG  +  S  + + V DENDNSP+ L     +  + EN    T     SA D D+       Y+     L+  D HF    +I S   ++     LDRE  S Y+  +  V       R  +G    I V D ND+ P F       ++ F     +    +V  ++    D DEG+N  V  ++         +++RF     +P+  TG ++    + +     +Y+F L A D+G P LSST ++ I +I+ +   P      K  ++S ++ + E     +I+ S+   D+       E ++ +  + + +     +        F+++ L+    L RE D  K     +++  SD  K  P +  + + IN+ D ND+ P F+       + EN  P A++   +     D+D  G N+ + Y I+     T  +   +D  SG ++ RQ +D E        + A D+     Q    S TA + V   D NDN P+F  P  + +V E+ PV   I  +   D D   EN  V Y  +S  NN     +  N+G L  +  +DRE+     + I A +    Q    + +  ++ + + DVND  P+F
Sbjct: 1064 LLTVLATSRHSGTGRTGSATVRVTVTDENDNSPR-LSQERVFLAVRENLVAGTGFGRVSATDRDAGLNARLTYR-----LLHADKHF----QINSQTGEISTRLALDREQQSSYQLFV-VVQDGGTPPRSATGT-AHISVLDENDHAPTFTHVRPDTERMFEVREGLPSGTMVGSVA--AKDPDEGENGTVYYSL------SGSRVERF---SLNPN--TGELKTASPLRWAER-AEYTFTLTAADHGTPGLSSTCQIRIQVISSSRSIP------KPNVLSMTLNVVEGTAPGSIIGSVGQVDKP------ESNVLEGQVTYLV-----VDGTDRDGTFMVDRLRGDVYLVRELDYEKGSSYTLHVEVSDFSKAFPNSYLVKLEINVQDSNDHAPQFSEDPVTIVIPENKEPGASIYAFQ---AGDQDGSGPNSELRYSIEHQWPQTS-DLLALDPLSGVLTIRQQLDRESTPFLYLVVRATDQAVDLSQRRWGSVTARLFVK--DENDNPPVFSSPS-AISVMEDQPVGFVILHVMAHDAD-EGENGRVSYRIQS-GNNAGRFSLSPNTGSLSILKALDREEQEVFNLTIVAEDHGIPQ----LSTSQVLCVQVIDVNDEAPMF 1633          

HSP 12 Score: 96.6709 bits (239), Expect = 1.191e-19
Identity = 124/518 (23.94%), Postives = 228/518 (44.02%), Query Frame = 2
Query:  440 ILIKVLDENDNSPKFLPFLNPYQ-TLPENSQINTVILLPSAIDLDSEAFGIKYYKI----SKPFLIGNDSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHS---KLVNVISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMT-GSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSR---SITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITAINEIHPLGHYKEFI--INTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLD 1951
            I I V D NDN+P F   L  YQ +LPE++   + ++  +A D DS   G   Y++     + F I   +    ++  A   P+   ++            +++A D  +     ++ V+V I   DINDN PVF ++ Y A + E +     + +   +  DL   +N      I   N+    QI+   +        T G++ L + +D+ET    Y+  ++ +D G+P+ SS+    I + + ND  PV          SR   ++ + E   + T +  L  +D DS          +  + + I++ +E++ L    ++   +   + LDRE      + I    +D      L   + + +++ D+NDN P F        + EN+P  +   +  +  +D D G    + Y +   ++ +  + F I+ +SG++ S+   D+EK  + SFN +A+  D  N S+T  + V V   ++  P+F    ++F V E       IGQ+   D D
Sbjct: 2340 ITIVVEDINDNAPLFTHDL--YQISLPEHTPPGSAVITVTATDRDSGENGRVNYRVMSSTQEGFYIDPSNGTLFINHRAEFDPERPSVN-----------IVIEASDGGSPALSSLTTVQVHIS--DINDNAPVFHQSEYRAMVSEDTFPGSTLLIFEAFDNDLSR-ENCGFDFAIANGNEGNVFQIESSVRFLEGRGFQTVGTLLLAEGLDFETKSL-YNLTVVVSDRGVPQRSSSVAALITIGDVNDNPPVF---------SRPEYTVALSEGAVSGTEIIRLTATDPDST--------PNAEVQYTISSGDEMN-LFSIDQWTGALRLQRALDREHQSTHVVIIQ--ATDGQGYFAL---VPVIVDVKDVNDNHPYFPVETLTATIQENLPANSPVTV--LHAIDHDTGVFGQLKYYM-MERSGSGRDSFVIEQNSGEVRSKIPFDFEK--INSFNFVAVAVDSGNHSATVTVQVFVTGEDEYDPLFTSTDFAFEVPEGAKKGQSIGQVLARDED 2812          

HSP 13 Score: 88.5817 bits (218), Expect = 3.126e-17
Identity = 146/665 (21.95%), Postives = 267/665 (40.15%), Query Frame = 2
Query:  371 KYDECCTVFSFQVDSGIKISSFYILIKVLDENDNSPKFLPFLNPYQTLPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKLVNVISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNL-IATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITAINEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIY---CSDQDKLTP-LTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQAT----VKMI--EPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDK-DQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQN------SGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIFSLINPAKSSLIFTINKGFRHENCQMIPYAVSDADHDE 2311
            KYD   T      D G   S+  + +KV+D NDN P F P L    +L  +S   T ++  +A D D+   G   Y+     + G  S F  L+K       + L   L  +  +    ++ AVD +       + V V I  G  +   PVF++  Y   + E       +         G +K +  +I + +         +F +D +    +G+IR    +D+ET     S +L I    G P     ++V+I + + ND AP         ++   +T        T++  +Q +D+DS          +  L+F++ +       G  + F I+      R      Y  +  Y      +D   P L++  T+ +++   +   P F    Y+ EL EN P  T    V+ +  E           ++ ++Y++   +   D   F I  DSG +  R S+D E   ++   ++A  +   +  + +A + V V D NDN+P   +      VREN+   T  G++  TD D     ++           Y+++H D++      +G++ T   +DRE+  S  + +  ++  +        +     I++ D ND+ P F+ + P  +  +F + +G       +   A  D D  E
Sbjct:  632 KYDLTVTA----TDGGGLSSAVGVRVKVMDINDNRPTFYPVLYTV-SLSTHSAPGTSVVKVTANDPDAGENGRITYRT----VPGGSSPFFTLNKDTG---VISLSRSLHSKANTVISMVITAVDGDGLTAPVNARVNVSIVGGSTSS--PVFEQAQYFFTVSEDVLRGTAVGVVRAATKTGVSKGIYYSISSGDP------DGYFTVDST----SGTIRTALPLDHETC---SSLDLEIQARYGSPPSYGISRVHISISDINDNAPTFLPSSSESLLLPEVTKMG-----TVIYRIQATDKDSG--------HNGQLSFDLISAGAAGSSGQ-RTFGIDRGSGEVRLIGSLSYDSVPRYDLQVIAKDGGAPQLSSTFTLVVHIQAQDAQGPNFDTLTYRVELRENAPLNTRFLQVRALNREASGNGGSSSSISSSISYRL---RPDGDAAGFGIMPDSGWLFVRSSLDREAKDMYLLTVLATSRHSGTGRTGSATVRVTVTDENDNSPRLSQERVFLAVRENLVAGTGFGRVSATDRDAGLNARL----------TYRLLHADKHFQINSQTGEISTRLALDREQQSSYQLFVVVQDGGTPPRS----ATGTAHISVLDENDHAPTFTHVRP-DTERMFEVREGL-PSGTMVGSVAAKDPDEGE 1236          

HSP 14 Score: 87.4261 bits (215), Expect = 6.916e-17
Identity = 127/506 (25.10%), Postives = 210/506 (41.50%), Query Frame = 2
Query:  734 KAVDRENDDHRD-----ISGV--EVEIKVGDINDNPPVFDKTFYTANIVEHSKLVNVISF-YVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPS---LMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITAINEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFT---RSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPID--REKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIFS 2203
            + +DRE  DH       ++G+  EV I V DIND+ P F K      I EH+ +    S    TD D+ Q       I      K+  +   F+++   S   ++   + +   +D E     YS  + A D G PR      + + + + ND APV    R   I+S S+      P  + +  +  +D D    + +  L  Y +N    +  E + +   K  +I   +PLD E  +   L +    +  +   P  TN  + I++ D NDN P  T    S+     I    Q   + +  I   D D+G+ A V   ++       +   T D+    I   Q +D E+   +   ++A D     L + +   + V D NDN P+F +  Y  T+ E V   + + Q+   D D  P N  V+Y   S     +   +D  +G + T   +D   E   S+T++      A+   +  + S   V I ++DVNDN P+FS
Sbjct:   88 RRLDREERDHYSFIAVTMTGITIEVSITVNDINDHAPEFPKKKALLKIPEHTVVGTRFSLDPATDADKDQLTTQGYAI------KEGNVGHMFKLESKRSANKVLYLDLVVSGLLDREKR-SSYSLVIEAFDGGSPRRVGFMTLEVTVTDINDHAPVFNQSRYHAIISESL------PQGSSILQVFAADED----EGDNGLVLYEINRR-QSDPERYFVIDLKSGVITLNRPLDYELKRVHELVVQ---ARDNASQPEVTNAFVTIHVRDFNDNQPTMTIIFLSEDGSPRISEGAQPG-QYVARISVTDPDYGEYANVNVSLEGGDGK--FALTTKDSIIYLIYVDQVLDREERDSYDLRVMATDSGTPPLRAESSFTIQVTDVNDNPPLFDQQAYRQTIPEVVYPGSFVLQVTARDKDQGP-NGDVRY---SLLKGKKWFSIDPITGIITTATALDFESEPAPSVTVI------ATDGGRPPLSSTAKVDIVVQDVNDNAPVFS 559          
BLAST of Protocadherin Fat 1 vs. Ensembl Medaka
Match: pcdh1b (protocadherin-1 [Source:NCBI gene;Acc:101174755])

HSP 1 Score: 184.882 bits (468), Expect = 2.952e-47
Identity = 198/702 (28.21%), Postives = 325/702 (46.30%), Query Frame = 2
Query:  185 DKHQRYKIYAVTEKASPFSLIDNRLSVVSN----IDRESICPIKNSLNDYDQSAETYNSQQSSHSCKYDECCTVFSFQVD---SGIKISSFYI--LIKVLDENDNSPKFL-PFLNPYQTLPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSH----FTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKLVN-VISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSIT--MFENEPARTIVASLQVSDRD----SLVTDIECSLDDYHLNFEITAINEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIFSLINPAKSS 2227
            D    YK+    E  SP+  +D++   +      IDRE++   +N   D                   D+C   F   +     GI +    I  +I+VLD NDN+P+F  P L    ++PEN+   T+  +P A+D DS + G+  Y +S     G D++      + + +    PQ+++I  LDRE    Y   ++ VD         S   + I V D NDN P F+K  Y A + E+S   + V+     D D G N  +  ++   +D     ++R  +ID S    TG I +   +D E +     F ++A D G    SS A+V I + ++ND AP I++   G ++ ++    + E+ P  T VA +QVSDRD    ++VT +      + L     + N+       +++ + T   LD E  K+   +I I   D       +TN ++ + + DINDN P F+ +  +    E+  Q   K+I+ + T D D G NA + Y I  S  ++    F I++++G+I  R  +D E  + + F + A DK   + + TA+++++V D NDN P F    YSF+V EN+P    +G +  +D D + EN  V  F +   +N + I +   +G + +    DREK  + T  + A +           S   V I + D NDN P  +   PA SS
Sbjct:   66 DSGHLYKL----EVGSPYLRVDSKTGEIYTTEIPIDRETLSDCRNLFED-------------------DKCFLEFEVSITDMVKGIGLGPRLIEGIIEVLDINDNTPQFSSPILT--LSIPENTHTGTLFSIPVAVDRDSGSNGVAEYALSA----GPDANQLFGLQVAEDVDEKIPQVIVIGNLDREKKDSYDLNIRVVDGGKPPR--ASSALLRITVTDQNDNAPKFEKNQYEAELPENSPPGHSVLQVRANDADTGANGDIDYSLHQASD----TVQRLLRIDRS----TGIIYVKGLVDREEDNL-LKFYVVARDRGPNSKSSKAQVTISIKDQNDNAPAIEIRGIGLVIHQNFVANISEDMPIGTPVALVQVSDRDEGENAVVTCVVAGDVPFQLRPASESAND-----RKRKYFLQTTTLLDYERIKD--YRIEIVAVDSGNPALSSTN-SLKVQVTDINDNTPSFSPALLEVNFAED-NQPGDKVIDVVAT-DADSGVNAELVYSIIESSAAS---LFEINSNTGEIRVRNQLDREDVERYEFGVAAADKGVPSKTGTAIVVINVEDRNDNDPKFMLSGYSFSVNENMPPLNPVGVVTVSDAD-KGENSQVTLFVEP--DNGKFI-IQNGTGTILSSISFDREKESTYTFRLKAVDAGDPPRS----SYVGVTINVLDENDNAPYVT--KPANSS 704          
BLAST of Protocadherin Fat 1 vs. Ensembl Medaka
Match: pcdh1b (protocadherin-1 [Source:NCBI gene;Acc:101174755])

HSP 1 Score: 185.267 bits (469), Expect = 3.750e-47
Identity = 197/702 (28.06%), Postives = 325/702 (46.30%), Query Frame = 2
Query:  185 DKHQRYKIYAVTEKASPFSLIDNRLSVVSN----IDRESICPIKNSLNDYDQSAETYNSQQSSHSCKYDECCTVFSFQVD---SGIKISSFYI--LIKVLDENDNSPKFL-PFLNPYQTLPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSH----FTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKLVN-VISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSIT--MFENEPARTIVASLQVSDRD----SLVTDIECSLDDYHLNFEITAINEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIFSLINPAKSS 2227
            D    YK+    E  SP+  +D++   +      IDRE++   +N   D                   D+C   F   +     GI +    I  +I+VLD NDN+P+F  P L    ++PEN+   T+  +P A+D DS + G+  Y +S     G D++      + + +    PQ+++I  LDRE    Y   ++ VD         S   + I V D NDN P F+K  Y A + E+S   + V+     D D G N  +  ++   +D     ++R  +ID S    TG I +   +D E +     F ++A D G    SS A+V I + ++ND AP I++   G ++ ++    + E+ P  T VA +QVSDRD    ++VT +      + L     + N+       +++ + T   LD E  K+   +I I   D       +TN ++ + + DINDN P F+ +  +    E+  Q   K+I+ ++  D D G NA + Y I  S  ++    F I++++G+I  R  +D E  + + F + A DK   + + TA+++++V D NDN P F    YSF+V EN+P    +G +  +D D + EN  V  F +   +N + I +   +G + +    DREK  + T  + A +           S   V I + D NDN P  +   PA SS
Sbjct:   66 DSGHLYKL----EVGSPYLRVDSKTGEIYTTEIPIDRETLSDCRNLFED-------------------DKCFLEFEVSITDMVKGIGLGPRLIEGIIEVLDINDNTPQFSSPILT--LSIPENTHTGTLFSIPVAVDRDSGSNGVAEYALSA----GPDANQLFGLQVAEDVDEKIPQVIVIGNLDREKKDSYDLNIRVVDGGKPPR--ASSALLRITVTDQNDNAPKFEKNQYEAELPENSPPGHSVLQVRANDADTGANGDIDYSLHQASD----TVQRLLRIDRS----TGIIYVKGLVDREEDNL-LKFYVVARDRGPNSKSSKAQVTISIKDQNDNAPAIEIRGIGLVIHQNFVANISEDMPIGTPVALVQVSDRDEGENAVVTCVVAGDVPFQLRPASESAND-----RKRKYFLQTTTLLDYERIKD--YRIEIVAVDSGNPALSSTN-SLKVQVTDINDNTPSFSPALLEVNFAEDN-QPGDKVID-VVATDADSGVNAELVYSIIESSAAS---LFEINSNTGEIRVRNQLDREDVERYEFGVAAADKGVPSKTGTAIVVINVEDRNDNDPKFMLSGYSFSVNENMPPLNPVGVVTVSDAD-KGENSQVTLFVEP--DNGKFI-IQNGTGTILSSISFDREKESTYTFRLKAVDAGDPPRS----SYVGVTINVLDENDNAPYVT--KPANSS 704          
BLAST of Protocadherin Fat 1 vs. Ensembl Medaka
Match: pcdh7b (protocadherin 7 [Source:NCBI gene;Acc:101166584])

HSP 1 Score: 184.111 bits (466), Expect = 7.804e-47
Identity = 156/537 (29.05%), Postives = 257/537 (47.86%), Query Frame = 2
Query:  434 FYILIKVLDENDNSPKFLPFLNPYQTLP--ENSQINTVILLPSAIDLDSEAFGIKYYKI--------------------SKPFLIGNDSHFTLLDKIA-----SGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKLVN-VISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRS--ITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITAINEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTP-LTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLD 1951
            F   + +LD NDN+P    F +P  TL   EN  I T+ LLP+A D D    GI+ Y++                     + F  G         ++A       +PQL++   LDRE    Y   L+   R+  D    S   + + + D+NDN P F+K+ Y A++ E+S   + ++     D D G N Q    IE       + ++R  ++D S    TG + ++  ID E    +  F ++A D G P     A V + + ++ND  P I++ + G I  +     + E+    T +A +QVSDRD     I        + F++   +E+    + K++ ++T  PLD E  +    + N+     D  +P LT+N ++ + + D NDNPP+F+++  Q    EN   A  + +  +   D D GKNA ++Y +DSS N      F+ID+DSG I    ++D E+ + + F +IA DK  + L  +A ++V V D NDN P F +  ++F V+EN+  N+ +G +   D D
Sbjct:  123 FEGKVIILDINDNTPS---FPSPVLTLSVEENRPIGTLYLLPTATDRDFGRNGIERYELIQDNGENSRRSGSSGDSYSGKRRFDEGASRSSVFELQVADTTDGEKQPQLIIKGALDREQRDSYELTLRV--RDGGDPPRSSQAILRVMITDVNDNNPRFEKSVYEADLPENSSPGSPILQLKAADADVGVNGQ----IEYVFGAATESVRRLLRLDES----TGWLSVLHRIDRE-EVSQLRFTVMARDRGQPPKMDKATVVLNIKDENDNVPAIEIRKIGRIFLKDGVANVAEDVVVDTPIALVQVSDRDQGENGIVTCTVVGDVPFQLKPASEMEGEQNKKKYFLHTSAPLDYETTQ----EYNVVIVAVDSGSPSLTSNNSLLVKVGDTNDNPPIFSKNVVQVSFPEN--NAPGERVTTVTATDADSGKNAEISYSLDSSVNG----IFSIDSDSGDIRVNTNLDREQKERYEFKVIAKDKGINTLQGSATVVVLVDDKNDNEPKFMQDVFTFYVKENLDPNSPVGMVTVIDAD 635          

HSP 2 Score: 97.8265 bits (242), Expect = 3.552e-20
Identity = 147/546 (26.92%), Postives = 242/546 (44.32%), Query Frame = 2
Query:  410 DSGIKISSFYILIKVL--DENDNSPKFLPFLNPYQT-LPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFD-----KTFY---TANIVEHSKLVNVISFY-VTDLDEGQNKQVSITI------------ETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIK--VIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLV-TDIECSLDDYHLNFEITAINEIHPL-GHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENI-PQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKP-HYSFT-VRENVPVNTEIGQIETTDLDT 1954
            D G    S   +++V+  D NDN+P+F   +  Y+  LPENS   + IL   A D D    G    +I   F    +S   LL ++      L ++  +DRE +S+ RF + A DR      D + V + IK  D NDN P  +     + F     AN+ E   +   I+   V+D D+G+N  V+ T+            E E +  K   K++F    +P            +DYET   +Y+  ++A D+G P L+S   + + + + ND  P+    V++        ++  EN      V ++  +D DS    +I  SLD        +++N I  +     +  +NT   LDRE  +    K+    +    +  L  + T+ + + D NDN P F +  +   + EN+ P + V M+     +D D G+NA +   I+  +     E  T     G I S  S D E+   ++F + A+D      S+TA + + V+D NDNAP    P + S+T +  +  V T +  +  TD DT
Sbjct:  250 DGGDPPRSSQAILRVMITDVNDNNPRFEKSV--YEADLPENSSPGSPILQLKAADADVGVNG----QIEYVFGAATESVRRLL-RLDESTGWLSVLHRIDREEVSQLRFTVMARDRGQPPKMDKATVVLNIK--DENDNVPAIEIRKIGRIFLKDGVANVAEDVVVDTPIALVQVSDRDQGENGIVTCTVVGDVPFQLKPASEMEGEQNK---KKYFLHTSAP------------LDYETT-QEYNVVIVAVDSGSPSLTSNNSLLVKVGDTNDNPPIFSKNVVQ--------VSFPENNAPGERVTTVTATDADSGKNAEISYSLD--------SSVNGIFSIDSDSGDIRVNT--NLDREQKERYEFKV---IAKDKGINTLQGSATVVVLVDDKNDNEPKFMQDVFTFYVKENLDPNSPVGMV---TVIDADKGQNAEMGLFIEEEEEIFSIENET-----GTIFSTLSFDREQKTTYTFRVKAVDGGDPPRSATATVSLFVMDENDNAPTVTFPINSSYTLLPPSSTVRTVVRTVIATDTDT 741          

HSP 3 Score: 81.6481 bits (200), Expect = 3.539e-15
Identity = 80/289 (27.68%), Postives = 128/289 (44.29%), Query Frame = 2
Query: 1400 LDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTL---DKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAP---------IFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKY-------FHKSYTNNYQVIHVDQNSGK--LKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIFS 2203
            LDRE   +  L + +         P ++   + + + D+NDN P F +S Y+ +L EN    +     PIL L   D D G N  + Y   ++  S       +D  +G +S    ID E+     F ++A D+ Q      A +++++ D NDN P         IF K   +  V E+V V+T I  ++ +D D + EN IV         F     +    +  +QN  K  L T  P+D E  +   ++I A +  S      + S   +++ + D NDNPPIFS
Sbjct:  234 LDREQRDSYELTLRVRDGGD---PPRSSQAILRVMITDVNDNNPRFEKSVYEADLPENSSPGS-----PILQLKAADADVGVNGQIEYVFGAATESV-RRLLRLDESTGWLSVLHRIDREEVSQLRFTVMARDRGQPPKMDKATVVLNIKDENDNVPAIEIRKIGRIFLKDGVA-NVAEDVVVDTPIALVQVSDRD-QGENGIVTCTVVGDVPFQLKPASE---MEGEQNKKKYFLHTSAPLDYETTQEYNVVIVAVDSGSPS----LTSNNSLLVKVGDTNDNPPIFS 504          

HSP 4 Score: 77.0258 bits (188), Expect = 8.118e-14
Identity = 117/515 (22.72%), Postives = 204/515 (39.61%), Query Frame = 2
Query:  782 EVEIKVGDINDNPPVFDKTFYTANIVEHSKLVNVISF-YVTDLDEGQNKQVSITIETEND---------YKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPY-------------KYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLV-TDIECSLDDYHLNFEITAINEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSK----YQGELIENIPQATV--KMIEPILTLDKDHGKNAYVTYKIDSS-----KNSTDWE-------YFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIF 2200
            E ++ + DINDN P F     T ++ E+  +  +      TD D G+N      +  +N                KR F    S S +   +++ D  D E  P               Y   L   D G P  SS A + +++ + ND  P      + E       + EN    + +  L+ +D D  V   IE     Y       ++  +  L     + ++ L  +DRE+     L+  +   D+ +  P     T+ +N+ D NDN P     K    +  + + N+ +  V    I  +   D+D G+N  VT  +        K +++ E       YF        + +   +DYE  + ++  I+A+D    +L+S   ++V V D NDN PIF K     +  EN      +  +  TD D+  +N  + Y   S  N   +  +D +SG ++    +DRE+       + A+++      N +     V++ ++D NDN P F
Sbjct:  124 EGKVIILDINDNTPSFPSPVLTLSVEENRPIGTLYLLPTATDRDFGRNGIERYELIQDNGENSRRSGSSGDSYSGKRRFDEGASRSSVF-ELQVADTTDGEKQPQLIIKGALDREQRDSYELTLRVRDGGDPPRSSQAILRVMITDVNDNNP------RFEKSVYEADLPENSSPGSPILQLKAADADVGVNGQIE-----YVFGAATESVRRLLRLDESTGW-LSVLHRIDREEVSQ--LRFTVMARDRGQ-PPKMDKATVVLNIKDENDNVPAIEIRKIGRIFLKDGVANVAEDVVVDTPIALVQVSDRDQGENGIVTCTVVGDVPFQLKPASEMEGEQNKKKYF--------LHTSAPLDYETTQEYNVVIVAVDSGSPSLTSNNSLLVKVGDTNDNPPIFSKNVVQVSFPENNAPGERVTTVTATDADSG-KNAEISYSLDSSVNG--IFSIDSDSGDIRVNTNLDREQKERYEFKVIAKDKG----INTLQGSATVVVLVDDKNDNEPKF 607          
BLAST of Protocadherin Fat 1 vs. Planmine SMEST
Match: SMESG000042045.1 (SMESG000042045.1)

HSP 1 Score: 2038.08 bits (5279), Expect = 0.000e+0
Identity = 1027/1028 (99.90%), Postives = 1027/1028 (99.90%), Query Frame = 2
Query:   83 SNFLEMISVKENIYYSQPLLDLEKVLKNRTIIPYDKHQRYKIYAVTEKASPFSLIDNRLSVVSNIDRESICPIKNSLNDYDQSAETYNSQQSSHSCKYDECCTVFSFQVDSGIKISSFYILIKVLDENDNSPKFLPFLNPYQTLPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKLVNVISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITAINEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIFSLINPAKSSLIFTINKGFRHENCQMIPYAVSDADHDEPNSDSCCILQLDNDQNGMLYLLSNTPNFLCLQNTMNTPGIYRVSLTATDNKNNPNKSLKAKVSFNIDVRHEVSDNPFSEKSDNKVHTTKNQYYNPSRFSXXXXXXXXXXXXXXXXXXXXXXFYRYLSYNPDNISNIYGKTTETMVVREVDKNSTQFKLYPNNYQQNIWIPEDLRLISNLNSETKENASWSRTMKNNEWVNDKSFYSYQVQDSSQMSNLPDLNRSANLGYEALCLVASSGNEYFSVDGKEMNSLTTSPCFPKSPEIPNTSPNCKETEMKYCQTSFV 3166
            SNFLEMISVKENIYYSQPLLDLEKVLKNRTIIPYDKHQRYKIYAVTEKASPFSLIDNRLSVVSNIDRESICPIKNSLNDYDQSAETYNSQQSSHSCKYDECCTVFSFQVDSGIKISSFYILIKVLDENDNSPKFLPFLNPYQTLPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKLVNVISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITAINEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQA VKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIFSLINPAKSSLIFTINKGFRHENCQMIPYAVSDADHDEPNSDSCCILQLDNDQNGMLYLLSNTPNFLCLQNTMNTPGIYRVSLTATDNKNNPNKSLKAKVSFNIDVRHEVSDNPFSEKSDNKVHTTKNQYYNPSRFSLIIIIIVVVIVCILIITFVLLIFYRYLSYNPDNISNIYGKTTETMVVREVDKNSTQFKLYPNNYQQNIWIPEDLRLISNLNSETKENASWSRTMKNNEWVNDKSFYSYQVQDSSQMSNLPDLNRSANLGYEALCLVASSGNEYFSVDGKEMNSLTTSPCFPKSPEIPNTSPNCKETEMKYCQTSFV
Sbjct:   18 SNFLEMISVKENIYYSQPLLDLEKVLKNRTIIPYDKHQRYKIYAVTEKASPFSLIDNRLSVVSNIDRESICPIKNSLNDYDQSAETYNSQQSSHSCKYDECCTVFSFQVDSGIKISSFYILIKVLDENDNSPKFLPFLNPYQTLPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKLVNVISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITAINEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQAPVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIFSLINPAKSSLIFTINKGFRHENCQMIPYAVSDADHDEPNSDSCCILQLDNDQNGMLYLLSNTPNFLCLQNTMNTPGIYRVSLTATDNKNNPNKSLKAKVSFNIDVRHEVSDNPFSEKSDNKVHTTKNQYYNPSRFSLIIIIIVVVIVCILIITFVLLIFYRYLSYNPDNISNIYGKTTETMVVREVDKNSTQFKLYPNNYQQNIWIPEDLRLISNLNSETKENASWSRTMKNNEWVNDKSFYSYQVQDSSQMSNLPDLNRSANLGYEALCLVASSGNEYFSVDGKEMNSLTTSPCFPKSPEIPNTSPNCKETEMKYCQTSFV 1045          
BLAST of Protocadherin Fat 1 vs. Planmine SMEST
Match: SMESG000042045.1 (SMESG000042045.1)

HSP 1 Score: 2028.45 bits (5254), Expect = 0.000e+0
Identity = 1022/1023 (99.90%), Postives = 1022/1023 (99.90%), Query Frame = 2
Query:   98 MISVKENIYYSQPLLDLEKVLKNRTIIPYDKHQRYKIYAVTEKASPFSLIDNRLSVVSNIDRESICPIKNSLNDYDQSAETYNSQQSSHSCKYDECCTVFSFQVDSGIKISSFYILIKVLDENDNSPKFLPFLNPYQTLPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKLVNVISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITAINEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIFSLINPAKSSLIFTINKGFRHENCQMIPYAVSDADHDEPNSDSCCILQLDNDQNGMLYLLSNTPNFLCLQNTMNTPGIYRVSLTATDNKNNPNKSLKAKVSFNIDVRHEVSDNPFSEKSDNKVHTTKNQYYNPSRFSXXXXXXXXXXXXXXXXXXXXXXFYRYLSYNPDNISNIYGKTTETMVVREVDKNSTQFKLYPNNYQQNIWIPEDLRLISNLNSETKENASWSRTMKNNEWVNDKSFYSYQVQDSSQMSNLPDLNRSANLGYEALCLVASSGNEYFSVDGKEMNSLTTSPCFPKSPEIPNTSPNCKETEMKYCQTSFV 3166
            MISVKENIYYSQPLLDLEKVLKNRTIIPYDKHQRYKIYAVTEKASPFSLIDNRLSVVSNIDRESICPIKNSLNDYDQSAETYNSQQSSHSCKYDECCTVFSFQVDSGIKISSFYILIKVLDENDNSPKFLPFLNPYQTLPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKLVNVISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITAINEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQA VKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIFSLINPAKSSLIFTINKGFRHENCQMIPYAVSDADHDEPNSDSCCILQLDNDQNGMLYLLSNTPNFLCLQNTMNTPGIYRVSLTATDNKNNPNKSLKAKVSFNIDVRHEVSDNPFSEKSDNKVHTTKNQYYNPSRFSLIIIIIVVVIVCILIITFVLLIFYRYLSYNPDNISNIYGKTTETMVVREVDKNSTQFKLYPNNYQQNIWIPEDLRLISNLNSETKENASWSRTMKNNEWVNDKSFYSYQVQDSSQMSNLPDLNRSANLGYEALCLVASSGNEYFSVDGKEMNSLTTSPCFPKSPEIPNTSPNCKETEMKYCQTSFV
Sbjct:    1 MISVKENIYYSQPLLDLEKVLKNRTIIPYDKHQRYKIYAVTEKASPFSLIDNRLSVVSNIDRESICPIKNSLNDYDQSAETYNSQQSSHSCKYDECCTVFSFQVDSGIKISSFYILIKVLDENDNSPKFLPFLNPYQTLPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKLVNVISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITAINEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQAPVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIFSLINPAKSSLIFTINKGFRHENCQMIPYAVSDADHDEPNSDSCCILQLDNDQNGMLYLLSNTPNFLCLQNTMNTPGIYRVSLTATDNKNNPNKSLKAKVSFNIDVRHEVSDNPFSEKSDNKVHTTKNQYYNPSRFSLIIIIIVVVIVCILIITFVLLIFYRYLSYNPDNISNIYGKTTETMVVREVDKNSTQFKLYPNNYQQNIWIPEDLRLISNLNSETKENASWSRTMKNNEWVNDKSFYSYQVQDSSQMSNLPDLNRSANLGYEALCLVASSGNEYFSVDGKEMNSLTTSPCFPKSPEIPNTSPNCKETEMKYCQTSFV 1023          
BLAST of Protocadherin Fat 1 vs. Planmine SMEST
Match: SMESG000048159.1 (SMESG000048159.1)

HSP 1 Score: 452.21 bits (1162), Expect = 7.265e-141
Identity = 290/836 (34.69%), Postives = 460/836 (55.02%), Query Frame = 2
Query:   83 SNFLEMISVKENIYYSQPLLDLEKVLKNRTIIPYDKHQRYKIYAVTEK-ASPFSLIDNRLSVVSN-IDRESICPIKNSLNDYDQSAETYNSQQSSHSCKYDECCTVFSFQVDSGIKISSFYILIKVLDENDNSPKFLPFLNPYQTLPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTL-LDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKLVNVISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDFSPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITAINEIHPLGHYKEFIINTLKPLDREDDKNQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSNLSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNYQVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNL--MDSECMVIITIEDVNDNPPIFSLINPAKSSLIFTINKGFRHENCQMIPYAVSDADHDEPNSDSCCILQLDNDQNGMLYLLSNTPNFLCLQNTMNTPGIYRVSLTATDNKNNPNKSLKAKVSFNI----DVRHEVSDNPFSEKSDNK 2563
            S  L+ I++ EN    Q L +L ++L ++T +P+    + +I ++ E    PF L  N+L   +N ++RE++C         D   E     +    CK D CC +  FQ  +     +F+ILIK+LD+ND +P+F     P+  +PEN ++  VI LP A+D DSE + ++ Y +S  + +     F L +      RPQL++ S LD E I++Y F L A D +     +     +EI++ D+NDN P F++  Y ANI E+ +   +I F V+D D G+N  V++ I      K D++ + F+I F        + LI+ +DYET+P+ + F L+ATD G P LSS+A+V I L N ND  P IK  + G  VS S+++ E  PA ++V  ++V+D D+    I C L DY+  F + + ++ + L +YK F + T+  +DRE +   +L+I I C+D +    +TTN +++I + D+NDN P+F++  Y G + EN     V   +PI+  D+D G N    + ++  +N +D   F ID  SGKI +++S+DYE    F F IIAIDK    L+S++ I ++V+D NDNAP F + HY F V ENV V  +IG ++ TD DT  +NK + Y  +   ++     +D+ +G L+T  P+DRE + SI+I +TA+N   Y +  +   DSE  V+I + DVNDN P F      K  + F + +      C  +PY V D D    N  +CC   L+ND N +  L+++TP+++CLQ        Y V+L A D   N    L +K+SF +    D   ++S + FS   D++
Sbjct:   19 SEVLKTITITENDMSIQVLANLTEILASKTNLPHSFLSKVEIVSLLENDLPPFKLQLNQLIQPNNGVNREAVC--------RDNPGE-----KVRKFCKADLCCKLIGFQYLTPTDPGTFFILIKILDQNDKAPQFSSIKRPFFKIPENVEVGKVIDLPMAVDSDSEKYSVRRYSLSYIYHLDQTHDFRLHVTNDNPPRPQLIVNSKLDYEKINKYVFRLFAYDFDEKSIGNSCSTTIEIEIEDLNDNVPKFNQLTYNANIDENKRDDKLIKFTVSDPDSGRNGIVTVNIVD----KTDELSKRFKI-FEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDADTHSNMIHCKLVDYNDLFYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGNVDENQVNVVVNFPKPIIVTDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQATDDDTDRKNKDIFYSIEPKGDHSSYFDIDRYTGDLRTRKPLDRETLESISIKVTAKNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAPKFIPRLNMKQKVEFIVEQFVDGNTCTELPYTVQDIDDGGINGQNCCYTILENDYNKLFSLMTDTPSYICLQRKPEKYQSYTVTLIARDRPPNVEGGLTSKISFPVLIINDPHSKISTSGFSNHPDSR 836          
BLAST of Protocadherin Fat 1 vs. Planmine SMEST
Match: SMESG000053174.1 (SMESG000053174.1)

HSP 1 Score: 442.58 bits (1137), Expect = 1.364e-137
Identity = 286/845 (33.85%), Postives = 460/845 (54.44%), Query Frame = 2
Query:   89 FLEMISVKENIYYSQPLLDLEKVLKNRTIIPYDKHQRYKIYAVTEKASPFSLIDN--RLSVVSNIDRESICPIKNSLNDYDQSAETYNSQQSSHSCKYDECCTVFSFQVD-SGIKISSFYILIKVLDENDNSPKFLPFLNPYQTLPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKLVNVISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDF---SPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITAINEIHPLGHYKEFIINTLKPLDREDDK----NQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSN-LSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNY--QVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIFSLINPAKSSLIFTINKGFRHENCQMIPYAVSDADHDEPNSDSCCILQLDNDQNGMLYLLSNTPNFLCLQNTMNTPGIYRVSLTATDNKNNPNKSLKAKVSFNIDVRHEVSDNPFSEKSDNKVHTTKNQ 2584
            F+    + EN    + + +L+ +L +++ I   K +  KI+  T   +   ++D+   L V   IDRE +CP +  L            Q +        CC +  FQ+  +  ++ S +I + V DENDN+P F     PY T+ EN  +   I LP A DLD+  F +  YK+  PF +GN S F L      G P L++ S LDRE  S Y F L A+D   + +R+    E+ IK+ DINDN P F++  Y   I E+  +  +    VTD DE +N ++ + +       ++ I + F +D    S   +   +R I+ +DYE   + + F ++A D G   LSSTA + I ++N ND +P I+ +R G+ ++   ++ E   +  I+A +QVSD DS++  ++CSL        I      HP+  YK+F + T + +DRE ++    +  + + + C D D   PL TN +I I + D+NDNPP FT++ Y G++ ENI    V M   I   DKD   N  VTY I   KNS++  YF ID+ +GKI + QS D+EK  ++SF ++A D+   N LSS++ IIV + D NDNAP F + H++F V ENV +   IGQI  TD D+ PE+K +++  KS + N   ++I +D  +G+++T  PIDREK  +IT  + ++N +   N   +  E M++IT+ D+ND+PP F L +P+KS LI ++    + + C+ IP+ V DAD D  N + CC+++L ++ NG+L L  +T N +C+           V+L A+D     N S++ +++F I     ++D   + +S N+  +++NQ
Sbjct:   20 FIHEFHITENSKIYKTIFNLKTLLISKSKIDSSKAKDCKIFMSTVINNGLFILDSDSNLKVSKQIDREELCPPQMML------------QLNKVCGSIHTCCHILDFQISCNNEEMQSNFIRVFVDDENDNNPVFPIVQTPYCTIEENKPLGYRIPLPKAQDLDNATFSVSSYKLELPFKLGNSSDFELAKHFKDGVPYLIITSTLDREKTSMYTFTLIAIDGV-EGNRNTGKTEITIKIRDINDNAPKFERPIYIRTIKENVIVDPIFQILVTDEDEDENGRIDLKMHNSG---QEWINKIFTLDILDQSIGKVQAQVRAINNLDYEQLYHSFEFKIVAQDGGRNSLSSTATLRIQILNVNDMSPEIRFVRNGQQITGGFSIDEGTLSNKILAYVQVSDADSMINQLQCSLLTPRNILMIEESRFRHPVNIYKQFSLRTTQNIDREANEPFLIDSKIIVTVQCDDYDNEIPLNTNASIFIIINDVNDNPPKFTQNVYYGQIEENINNHEVFMNAAIHAADKDLHLNGKVTYHIQDFKNSSNAMYFRIDSQNGKIYNSQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAPQFSQSHFAFFVDENVEIGHLIGQINATDRDSLPEHKDIRFIVKSDSQNRASKLITLDPLTGQIRTRYPIDREKTSTITFFVESKNPSRIFND--LIQEAMIVITVRDLNDSPPTFRLKDPSKSQLIISLETLQQGQICESIPFEVEDAD-DNNNVNPCCVVRLKHNYNGLLSLADDTQNIICINQVPKKVKSLPVTLIASDKHG--NDSIETEITFKILF---INDPNVATQSKNQPPSSRNQ 840          
BLAST of Protocadherin Fat 1 vs. Planmine SMEST
Match: SMESG000053174.1 (SMESG000053174.1)

HSP 1 Score: 437.573 bits (1124), Expect = 1.984e-136
Identity = 276/790 (34.94%), Postives = 435/790 (55.06%), Query Frame = 2
Query:  248 DNRLSVVSNIDRESICPIKNSLNDYDQSAETYNSQQSSHSCKYDECCTVFSFQVD-SGIKISSFYILIKVLDENDNSPKFLPFLNPYQTLPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKLVNVISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDF---SPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITAINEIHPLGHYKEFIINTLKPLDREDDK----NQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQATVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSN-LSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNY--QVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIFSLINPAKSSLIFTINKGFRHENCQMIPYAVSDADHDEPNSDSCCILQLDNDQNGMLYLLSNTPNFLCLQNTMNTPGIYRVSLTATDNKNNPNKSLKAKVSFNIDVRHEVSDNPFSEKSDNKVHTTKNQ 2584
            D+ L V   IDRE +CP +  L            Q +        CC +  FQ+  +  ++ S +I + V DENDN+P F     PY T+ EN  +   I LP A DLD+  F +  YK+  PF +GN S F L      G P L++ S LDRE  S Y F L A+D   + +R+    E+ IK+ DINDN P F++  Y   I E+  +  +    VTD DE +N ++ + +       ++ I + F +D    S   +   +R I+ +DYE   + + F ++A D G   LSSTA + I ++N ND +P I+ +R G+ ++   ++ E   +  I+A +QVSD DS++  ++CSL        I      HP+  YK+F + T + +DRE ++    +  + + + C D D   PL TN +I I + D+NDNPP FT++ Y G++ ENI    V M   I   DKD   N  VTY I   KNS++  YF ID+ +GKI + QS D+EK  ++SF ++A D+   N LSS++ IIV + D NDNAP F + H++F V ENV +   IGQI  TD D+ PE+K +++  KS + N   ++I +D  +G+++T  PIDREK  +IT  + ++N +   N   +  E M++IT+ D+ND+PP F L +P+KS LI ++    + + C+ IP+ V DAD D  N + CC+++L ++ NG+L L  +T N +C+           V+L A+D     N S++ +++F I     ++D   + +S N+  +++NQ
Sbjct:   15 DSNLKVSKQIDREELCPPQMML------------QLNKVCGSIHTCCHILDFQISCNNEEMQSNFIRVFVDDENDNNPVFPIVQTPYCTIEENKPLGYRIPLPKAQDLDNATFSVSSYKLELPFKLGNSSDFELAKHFKDGVPYLIITSTLDREKTSMYTFTLIAIDGV-EGNRNTGKTEITIKIRDINDNAPKFERPIYIRTIKENVIVDPIFQILVTDEDEDENGRIDLKMHNSG---QEWINKIFTLDILDQSIGKVQAQVRAINNLDYEQLYHSFEFKIVAQDGGRNSLSSTATLRIQILNVNDMSPEIRFVRNGQQITGGFSIDEGTLSNKILAYVQVSDADSMINQLQCSLLTPRNILMIEESRFRHPVNIYKQFSLRTTQNIDREANEPFLIDSKIIVTVQCDDYDNEIPLNTNASIFIIINDVNDNPPKFTQNVYYGQIEENINNHEVFMNAAIHAADKDLHLNGKVTYHIQDFKNSSNAMYFRIDSQNGKIYNSQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAPQFSQSHFAFFVDENVEIGHLIGQINATDRDSLPEHKDIRFIVKSDSQNRASKLITLDPLTGQIRTRYPIDREKTSTITFFVESKNPSRIFND--LIQEAMIVITVRDLNDSPPTFRLKDPSKSQLIISLETLQQGQICESIPFEVEDAD-DNNNVNPCCVVRLKHNYNGLLSLADDTQNIICINQVPKKVKSLPVTLIASDKHG--NDSIETEITFKILF---INDPNVATQSKNQPPSSRNQ 780          
The following BLAST results are available for this feature:
BLAST of Protocadherin Fat 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CELSR31.226e-4727.20cadherin EGF LAG seven-pass G-type receptor 3 [Sou... [more]
FAT42.049e-4729.25FAT atypical cadherin 4 [Source:HGNC Symbol;Acc:HG... [more]
CELSR22.707e-4627.71cadherin EGF LAG seven-pass G-type receptor 2 [Sou... [more]
PCDHB85.634e-4633.21protocadherin beta 8 [Source:HGNC Symbol;Acc:HGNC:... [more]
PCDH11.319e-4526.22protocadherin 1 [Source:HGNC Symbol;Acc:HGNC:8655][more]
back to top
BLAST of Protocadherin Fat 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fmi-13.835e-3826.11FlaMIngo (Cadherin plus 7TM domain) homolog [Sour... [more]
fmi-12.534e-3727.95FlaMIngo (Cadherin plus 7TM domain) homolog [Sour... [more]
cdh-11.632e-2825.62CaDHerin family [Source:UniProtKB/TrEMBL;Acc:Q5F4... [more]
hmr-12.171e-2426.51Cadherin-related hmr-1 [Source:UniProtKB/Swiss-Pr... [more]
hmr-12.171e-2426.51Cadherin-related hmr-1 [Source:UniProtKB/Swiss-Pr... [more]
back to top
BLAST of Protocadherin Fat 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ds1.192e-4628.76gene:FBgn0284247 transcript:FBtr0078045[more]
ds1.192e-4628.76gene:FBgn0284247 transcript:FBtr0343249[more]
stan3.282e-4126.59gene:FBgn0024836 transcript:FBtr0304900[more]
stan3.698e-4126.59gene:FBgn0024836 transcript:FBtr0304899[more]
stan3.698e-4126.59gene:FBgn0024836 transcript:FBtr0300578[more]
back to top
BLAST of Protocadherin Fat 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
LO018022.11.342e-5130.02FAT atypical cadherin 4 [Source:NCBI gene;Acc:1018... [more]
LO018022.11.818e-5130.02FAT atypical cadherin 4 [Source:NCBI gene;Acc:1018... [more]
pcdh113.951e-5030.02protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-... [more]
pcdh114.231e-5029.91protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-... [more]
pcdh7b6.091e-5029.33protocadherin 7b [Source:ZFIN;Acc:ZDB-GENE-081104-... [more]
back to top
BLAST of Protocadherin Fat 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000039438.15.847e-5029.01pep primary_assembly:Xenopus_tropicalis_v9.1:3:183... [more]
ENSXETT00000047801.11.537e-4929.17protocadherin 11 X-linked [Source:NCBI gene;Acc:10... [more]
ENSXETT00000047798.11.904e-4929.17protocadherin 11 X-linked [Source:NCBI gene;Acc:10... [more]
ENSXETT00000047804.11.908e-4929.17protocadherin 11 X-linked [Source:NCBI gene;Acc:10... [more]
ENSXETT00000027730.13.584e-4828.37uncharacterized LOC100145174 [Source:Xenbase;Acc:X... [more]
back to top
BLAST of Protocadherin Fat 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Fat46.091e-4929.67FAT atypical cadherin 4 [Source:MGI Symbol;Acc:MGI... [more]
Celsr31.604e-4825.88cadherin, EGF LAG seven-pass G-type receptor 3 [So... [more]
Celsr31.604e-4825.88cadherin, EGF LAG seven-pass G-type receptor 3 [So... [more]
Celsr31.605e-4825.88cadherin, EGF LAG seven-pass G-type receptor 3 [So... [more]
Celsr31.605e-4825.88cadherin, EGF LAG seven-pass G-type receptor 3 [So... [more]
back to top
BLAST of Protocadherin Fat 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q2PZL6|FAT4_MOUSE4.261e-4829.67Protocadherin Fat 4 OS=Mus musculus OX=10090 GN=Fa... [more]
sp|Q91ZI0|CELR3_MOUSE1.122e-4725.88Cadherin EGF LAG seven-pass G-type receptor 3 OS=M... [more]
sp|O88278|CELR3_RAT1.685e-4727.03Cadherin EGF LAG seven-pass G-type receptor 3 OS=R... [more]
sp|Q9NYQ7|CELR3_HUMAN5.888e-4727.20Cadherin EGF LAG seven-pass G-type receptor 3 OS=H... [more]
sp|Q6V0I7|FAT4_HUMAN9.839e-4729.25Protocadherin Fat 4 OS=Homo sapiens OX=9606 GN=FAT... [more]
back to top
BLAST of Protocadherin Fat 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A087VWC52.415e-11430.96Uncharacterized protein OS=Echinococcus multilocul... [more]
A0A068WEQ79.278e-11431.12Protocadherin 2 gamma c6 sCP1 OS=Echinococcus gran... [more]
A0A074ZYB31.017e-10629.26Uncharacterized protein OS=Opisthorchis viverrini ... [more]
A0A3R7D3G07.528e-10629.26Protocadherin Fat 1 OS=Clonorchis sinensis OX=7992... [more]
A0A5K3F6N98.075e-10630.36Uncharacterized protein OS=Mesocestoides corti OX=... [more]
back to top
BLAST of Protocadherin Fat 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dchs1b2.067e-5129.17dachsous cadherin-related 1b [Source:ZFIN;Acc:ZDB-... [more]
ENSAMXT00000036438.11.243e-4928.73pep primary_assembly:Astyanax_mexicanus-2.0:20:107... [more]
pcdh1a2.099e-4928.93protocadherin 1a [Source:ZFIN;Acc:ZDB-GENE-091116-... [more]
pcdh1a2.698e-4928.93protocadherin 1a [Source:ZFIN;Acc:ZDB-GENE-091116-... [more]
pcdh114.773e-4929.84protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-... [more]
back to top
BLAST of Protocadherin Fat 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000010725.12.245e-4925.35pep scaffold:Pmarinus_7.0:GL479425:26296:30457:-1 ... [more]
pcdh113.339e-4727.91protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-... [more]
ENSPMAT00000008517.12.300e-3926.04pep scaffold:Pmarinus_7.0:GL476786:43429:129410:1 ... [more]
ENSPMAT00000009557.18.630e-3725.35pep scaffold:Pmarinus_7.0:GL476748:59426:101420:1 ... [more]
ENSPMAT00000006996.12.500e-3527.59pep scaffold:Pmarinus_7.0:GL476780:2096:143714:1 g... [more]
back to top
BLAST of Protocadherin Fat 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protocadherin Fat 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO354121.260e-4628.86Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO482374.712e-4329.83Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO404706.431e-4328.49Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO461896.906e-4225.82Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO464171.197e-4027.41Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Protocadherin Fat 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dchs1a4.730e-4928.76protocadherin-16 [Source:NCBI gene;Acc:101175097][more]
ENSORLT00000005325.21.633e-4828.04protocadherin-16 [Source:NCBI gene;Acc:101171352][more]
pcdh1b2.952e-4728.21protocadherin-1 [Source:NCBI gene;Acc:101174755][more]
pcdh1b3.750e-4728.06protocadherin-1 [Source:NCBI gene;Acc:101174755][more]
pcdh7b7.804e-4729.05protocadherin 7 [Source:NCBI gene;Acc:101166584][more]
back to top
BLAST of Protocadherin Fat 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5