26S proteasome regulatory subunit

Overview
Name26S proteasome regulatory subunit
Smed IDSMED30008939
Length (bp)549
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of 26S proteasome regulatory subunit (SMED30008939) t-SNE clustered cells

Violin plots show distribution of expression levels for 26S proteasome regulatory subunit (SMED30008939) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of 26S proteasome regulatory subunit (SMED30008939) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for 26S proteasome regulatory subunit (SMED30008939) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30008939

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30008939SMESG000047180.1 SmedASXL_007416SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
testis primordiumSMED30008939SMESG000047180.1 Contig1880_SE3GPL10652PMID:20844018
Wang et al., 2010
whole organism juvenile cDNA to DNA expression microarray evidence
neoblastSMED30008939SMESG000047180.1 SMED_06852_V2_1GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30008939SMESG000047180.1 SMED_06852_V2_1GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30008939SMESG000047180.1 SMED_35179_V2_1GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of 26S proteasome regulatory subunit vs. Ensembl Human
Match: PSMC6 (proteasome 26S subunit, ATPase 6 [Source:HGNC Symbol;Acc:HGNC:9553])

HSP 1 Score: 273.863 bits (699), Expect = 1.148e-91
Identity = 129/161 (80.12%), Postives = 147/161 (91.30%), Query Frame = 2
Query:    2 VIFMDEIDAIGGRRFNNGTSSDREIQRTLMELLNQMDGFDVLGQVKIIMATNRPDTLDPALLRPGRLDRKIEIPLPKEQGRLDILKIHSDKISKHGEIDWDSLVKLSDGFNGADMRNVCTEAGMFAIRDERDYVINQDFMKAVRKMQDMKKLESKLEYKPV 484
            +IFMDEIDAIGGRRF+ GTS+DREIQRTLMELLNQMDGFD L +VK+IMATNRPDTLDPALLRPGRLDRKI I LP EQ RLDILKIH+  I+KHGEID++++VKLSDGFNGAD+RNVCTEAGMFAIR + D+V+ +DFMKAVRK+ D KKLESKL+YKPV
Sbjct:  229 IIFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQMDGFDTLHRVKMIMATNRPDTLDPALLRPGRLDRKIHIDLPNEQARLDILKIHAGPITKHGEIDYEAIVKLSDGFNGADLRNVCTEAGMFAIRADHDFVVQEDFMKAVRKVADSKKLESKLDYKPV 389          
BLAST of 26S proteasome regulatory subunit vs. Ensembl Human
Match: PSMC6 (proteasome 26S subunit, ATPase 6 [Source:HGNC Symbol;Acc:HGNC:9553])

HSP 1 Score: 273.478 bits (698), Expect = 2.666e-91
Identity = 129/161 (80.12%), Postives = 147/161 (91.30%), Query Frame = 2
Query:    2 VIFMDEIDAIGGRRFNNGTSSDREIQRTLMELLNQMDGFDVLGQVKIIMATNRPDTLDPALLRPGRLDRKIEIPLPKEQGRLDILKIHSDKISKHGEIDWDSLVKLSDGFNGADMRNVCTEAGMFAIRDERDYVINQDFMKAVRKMQDMKKLESKLEYKPV 484
            +IFMDEIDAIGGRRF+ GTS+DREIQRTLMELLNQMDGFD L +VK+IMATNRPDTLDPALLRPGRLDRKI I LP EQ RLDILKIH+  I+KHGEID++++VKLSDGFNGAD+RNVCTEAGMFAIR + D+V+ +DFMKAVRK+ D KKLESKL+YKPV
Sbjct:  243 IIFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQMDGFDTLHRVKMIMATNRPDTLDPALLRPGRLDRKIHIDLPNEQARLDILKIHAGPITKHGEIDYEAIVKLSDGFNGADLRNVCTEAGMFAIRADHDFVVQEDFMKAVRKVADSKKLESKLDYKPV 403          
BLAST of 26S proteasome regulatory subunit vs. Ensembl Human
Match: PSMC2 (proteasome 26S subunit, ATPase 2 [Source:HGNC Symbol;Acc:HGNC:9548])

HSP 1 Score: 177.563 bits (449), Expect = 1.389e-53
Identity = 83/146 (56.85%), Postives = 109/146 (74.66%), Query Frame = 2
Query:    2 VIFMDEIDAIGGRRFNNGTSSDREIQRTLMELLNQMDGFDVLGQVKIIMATNRPDTLDPALLRPGRLDRKIEIPLPKEQGRLDILKIHSDKISKHGEIDWDSLVKLSDGFNGADMRNVCTEAGMFAIRDERDYVINQDFMKAVRKM 439
            +IF DEIDAIGG RF++G   D E+QRT++EL+NQ+DGFD  G +K++MATNRPDTLDPAL+RPGRLDRKIE  LP  +GR  I KIH+  +S   +I ++ L +L     GA++R+VCTEAGMFAIR  R     +DF++AV K+
Sbjct:  271 LIFFDEIDAIGGARFDDGAGGDNEVQRTMLELINQLDGFDPRGNIKVLMATNRPDTLDPALMRPGRLDRKIEFSLPDLEGRTHIFKIHARSMSVERDIRFELLARLCPNSTGAEIRSVCTEAGMFAIRARRKIATEKDFLEAVNKV 416          
BLAST of 26S proteasome regulatory subunit vs. Ensembl Human
Match: PSMC2 (proteasome 26S subunit, ATPase 2 [Source:HGNC Symbol;Acc:HGNC:9548])

HSP 1 Score: 177.563 bits (449), Expect = 1.389e-53
Identity = 83/146 (56.85%), Postives = 109/146 (74.66%), Query Frame = 2
Query:    2 VIFMDEIDAIGGRRFNNGTSSDREIQRTLMELLNQMDGFDVLGQVKIIMATNRPDTLDPALLRPGRLDRKIEIPLPKEQGRLDILKIHSDKISKHGEIDWDSLVKLSDGFNGADMRNVCTEAGMFAIRDERDYVINQDFMKAVRKM 439
            +IF DEIDAIGG RF++G   D E+QRT++EL+NQ+DGFD  G +K++MATNRPDTLDPAL+RPGRLDRKIE  LP  +GR  I KIH+  +S   +I ++ L +L     GA++R+VCTEAGMFAIR  R     +DF++AV K+
Sbjct:  271 LIFFDEIDAIGGARFDDGAGGDNEVQRTMLELINQLDGFDPRGNIKVLMATNRPDTLDPALMRPGRLDRKIEFSLPDLEGRTHIFKIHARSMSVERDIRFELLARLCPNSTGAEIRSVCTEAGMFAIRARRKIATEKDFLEAVNKV 416          
BLAST of 26S proteasome regulatory subunit vs. Ensembl Human
Match: PSMC5 (proteasome 26S subunit, ATPase 5 [Source:HGNC Symbol;Acc:HGNC:9552])

HSP 1 Score: 169.859 bits (429), Expect = 5.156e-51
Identity = 80/146 (54.79%), Postives = 107/146 (73.29%), Query Frame = 2
Query:    2 VIFMDEIDAIGGRRFNNGTSSDREIQRTLMELLNQMDGFDVLGQVKIIMATNRPDTLDPALLRPGRLDRKIEIPLPKEQGRLDILKIHSDKISKHGEIDWDSLVKLSDGFNGADMRNVCTEAGMFAIRDERDYVINQDFMKAVRKM 439
            +IFMDEID+IG  R   G+  D E+QRT++ELLNQ+DGF+    +K+IMATNR D LD ALLRPGR+DRKIE P P E+ RLDILKIHS K++    I+   + +L  G +GA+++ VCTEAGM+A+R+ R +V  +DF  AV K+
Sbjct:  237 IIFMDEIDSIGSSRLEGGSGGDSEVQRTMLELLNQLDGFEATKNIKVIMATNRIDILDSALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMNLTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKV 382          
BLAST of 26S proteasome regulatory subunit vs. Ensembl Celegans
Match: rpt-4 (Probable 26S proteasome regulatory subunit 10B [Source:UniProtKB/Swiss-Prot;Acc:O17071])

HSP 1 Score: 276.174 bits (705), Expect = 6.880e-93
Identity = 128/161 (79.50%), Postives = 152/161 (94.41%), Query Frame = 2
Query:    2 VIFMDEIDAIGGRRFNNGTSSDREIQRTLMELLNQMDGFDVLGQVKIIMATNRPDTLDPALLRPGRLDRKIEIPLPKEQGRLDILKIHSDKISKHGEIDWDSLVKLSDGFNGADMRNVCTEAGMFAIRDERDYVINQDFMKAVRKMQDMKKLESKLEYKPV 484
            ++FMDEIDAIGGRRF+ GTS+DREIQRTLMELLNQ+DGFD LG+VK+IMATNRPDTLDPALLRPGRLDRKIEI LP EQ RL+ILKIHS+KI+KHGEID++++VKLSDGF+ AD+RNVCTEAGMFAIR ER++VI++DFMKAVRK+ D K+LE+KL+YKPV
Sbjct:  238 IVFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQLDGFDSLGKVKVIMATNRPDTLDPALLRPGRLDRKIEIGLPNEQSRLEILKIHSNKITKHGEIDFEAVVKLSDGFSAADLRNVCTEAGMFAIRAEREFVIDEDFMKAVRKVGDAKRLETKLDYKPV 398          
BLAST of 26S proteasome regulatory subunit vs. Ensembl Celegans
Match: rpt-4 (Probable 26S proteasome regulatory subunit 10B [Source:UniProtKB/Swiss-Prot;Acc:O17071])

HSP 1 Score: 276.174 bits (705), Expect = 7.667e-93
Identity = 128/161 (79.50%), Postives = 152/161 (94.41%), Query Frame = 2
Query:    2 VIFMDEIDAIGGRRFNNGTSSDREIQRTLMELLNQMDGFDVLGQVKIIMATNRPDTLDPALLRPGRLDRKIEIPLPKEQGRLDILKIHSDKISKHGEIDWDSLVKLSDGFNGADMRNVCTEAGMFAIRDERDYVINQDFMKAVRKMQDMKKLESKLEYKPV 484
            ++FMDEIDAIGGRRF+ GTS+DREIQRTLMELLNQ+DGFD LG+VK+IMATNRPDTLDPALLRPGRLDRKIEI LP EQ RL+ILKIHS+KI+KHGEID++++VKLSDGF+ AD+RNVCTEAGMFAIR ER++VI++DFMKAVRK+ D K+LE+KL+YKPV
Sbjct:  246 IVFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQLDGFDSLGKVKVIMATNRPDTLDPALLRPGRLDRKIEIGLPNEQSRLEILKIHSNKITKHGEIDFEAVVKLSDGFSAADLRNVCTEAGMFAIRAEREFVIDEDFMKAVRKVGDAKRLETKLDYKPV 406          
BLAST of 26S proteasome regulatory subunit vs. Ensembl Celegans
Match: rpt-1 (26S proteasome regulatory subunit 7 [Source:UniProtKB/Swiss-Prot;Acc:Q18787])

HSP 1 Score: 179.104 bits (453), Expect = 1.217e-54
Identity = 82/146 (56.16%), Postives = 110/146 (75.34%), Query Frame = 2
Query:    2 VIFMDEIDAIGGRRFNNGTSSDREIQRTLMELLNQMDGFDVLGQVKIIMATNRPDTLDPALLRPGRLDRKIEIPLPKEQGRLDILKIHSDKISKHGEIDWDSLVKLSDGFNGADMRNVCTEAGMFAIRDERDYVINQDFMKAVRKM 439
            +IF DEIDA+GG RF++G   D E+QRT++EL+NQ+DGFD  G +K++MATNRPDTLDPAL+RPGRLDRK+E  LP   GR  ILKIH+ ++S   +I +D L +L     GA++R+VCTEAGMFAIR  R     +DF++A+ K+
Sbjct:  273 LIFFDEIDAVGGARFDDGQGGDNEVQRTMLELINQLDGFDPRGNIKVLMATNRPDTLDPALMRPGRLDRKVEFALPDLAGRAHILKIHAKQMSVERDIRYDLLARLCPNSTGAEIRSVCTEAGMFAIRARRKVATEKDFLEAINKV 418          
BLAST of 26S proteasome regulatory subunit vs. Ensembl Celegans
Match: rpt-1 (26S proteasome regulatory subunit 7 [Source:UniProtKB/Swiss-Prot;Acc:Q18787])

HSP 1 Score: 179.104 bits (453), Expect = 1.217e-54
Identity = 82/146 (56.16%), Postives = 110/146 (75.34%), Query Frame = 2
Query:    2 VIFMDEIDAIGGRRFNNGTSSDREIQRTLMELLNQMDGFDVLGQVKIIMATNRPDTLDPALLRPGRLDRKIEIPLPKEQGRLDILKIHSDKISKHGEIDWDSLVKLSDGFNGADMRNVCTEAGMFAIRDERDYVINQDFMKAVRKM 439
            +IF DEIDA+GG RF++G   D E+QRT++EL+NQ+DGFD  G +K++MATNRPDTLDPAL+RPGRLDRK+E  LP   GR  ILKIH+ ++S   +I +D L +L     GA++R+VCTEAGMFAIR  R     +DF++A+ K+
Sbjct:  273 LIFFDEIDAVGGARFDDGQGGDNEVQRTMLELINQLDGFDPRGNIKVLMATNRPDTLDPALMRPGRLDRKVEFALPDLAGRAHILKIHAKQMSVERDIRYDLLARLCPNSTGAEIRSVCTEAGMFAIRARRKVATEKDFLEAINKV 418          
BLAST of 26S proteasome regulatory subunit vs. Ensembl Celegans
Match: rpt-6 (Proteasome Regulatory Particle, ATPase-like [Source:UniProtKB/TrEMBL;Acc:Q9XTT9])

HSP 1 Score: 167.933 bits (424), Expect = 1.802e-50
Identity = 79/146 (54.11%), Postives = 106/146 (72.60%), Query Frame = 2
Query:    2 VIFMDEIDAIGGRRFNNGTSSDREIQRTLMELLNQMDGFDVLGQVKIIMATNRPDTLDPALLRPGRLDRKIEIPLPKEQGRLDILKIHSDKISKHGEIDWDSLVKLSDGFNGADMRNVCTEAGMFAIRDERDYVINQDFMKAVRKM 439
            +IFMDEID+IG  R    +  D E+QRT++ELLNQ+DGF+    +K+IMATNR D LDPALLRPGR+DRKIE P P E+ R DILKIHS K++    I+   + +   G +GA++++VCTEAGMFA+R+ R +V  +DF  AV K+
Sbjct:  255 IIFMDEIDSIGSSRVEGSSGGDSEVQRTMLELLNQLDGFEATKNIKVIMATNRIDILDPALLRPGRIDRKIEFPAPDEKARADILKIHSRKMNLMRGINMAKIAEQIPGASGAEVKSVCTEAGMFALRERRIHVTQEDFEMAVGKV 400          
BLAST of 26S proteasome regulatory subunit vs. Ensembl Fly
Match: Rpt4 (gene:FBgn0028685 transcript:FBtr0305495)

HSP 1 Score: 285.034 bits (728), Expect = 3.246e-96
Identity = 134/161 (83.23%), Postives = 151/161 (93.79%), Query Frame = 2
Query:    2 VIFMDEIDAIGGRRFNNGTSSDREIQRTLMELLNQMDGFDVLGQVKIIMATNRPDTLDPALLRPGRLDRKIEIPLPKEQGRLDILKIHSDKISKHGEIDWDSLVKLSDGFNGADMRNVCTEAGMFAIRDERDYVINQDFMKAVRKMQDMKKLESKLEYKPV 484
            +IFMDEIDAIGGRRF+ GTS+DREIQRTLMELLNQMDGFD LGQVK+IMATNRPDTLDPALLRPGRLDRKIEIPLP EQ RL+ILKIH+ KI+KHGEID++++VKLSD FNGAD+RNVCTEAG+FAIR ER+YVI +DFMKAVRK+ D KKLESKL+YKPV
Sbjct:  237 IIFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQMDGFDSLGQVKMIMATNRPDTLDPALLRPGRLDRKIEIPLPNEQARLEILKIHALKIAKHGEIDYEAIVKLSDNFNGADLRNVCTEAGLFAIRAEREYVIQEDFMKAVRKVSDNKKLESKLDYKPV 397          
BLAST of 26S proteasome regulatory subunit vs. Ensembl Fly
Match: Rpt4R (gene:FBgn0036224 transcript:FBtr0346545)

HSP 1 Score: 267.7 bits (683), Expect = 1.884e-89
Identity = 123/161 (76.40%), Postives = 149/161 (92.55%), Query Frame = 2
Query:    2 VIFMDEIDAIGGRRFNNGTSSDREIQRTLMELLNQMDGFDVLGQVKIIMATNRPDTLDPALLRPGRLDRKIEIPLPKEQGRLDILKIHSDKISKHGEIDWDSLVKLSDGFNGADMRNVCTEAGMFAIRDERDYVINQDFMKAVRKMQDMKKLESKLEYKPV 484
            +IFMDEIDAIGGRRF+ GTS+DREIQRTLMELLNQMDGFD LGQVK+IMATNRPDTLDPALLRPGRLDRK+EIPLP E  R+DILKIH++ ++K GEID++++VKLSD FNGAD+RN+CTEAG+FA+R +R++VI +DFMKAVRK+ D KKLES+L+YKP+
Sbjct:  238 IIFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQMDGFDALGQVKMIMATNRPDTLDPALLRPGRLDRKLEIPLPNEVARMDILKIHAEPLNKRGEIDYEAVVKLSDLFNGADLRNICTEAGLFALRCDREFVIQEDFMKAVRKIADNKKLESRLDYKPI 398          
BLAST of 26S proteasome regulatory subunit vs. Ensembl Fly
Match: Rpt4R (gene:FBgn0036224 transcript:FBtr0076040)

HSP 1 Score: 267.7 bits (683), Expect = 1.884e-89
Identity = 123/161 (76.40%), Postives = 149/161 (92.55%), Query Frame = 2
Query:    2 VIFMDEIDAIGGRRFNNGTSSDREIQRTLMELLNQMDGFDVLGQVKIIMATNRPDTLDPALLRPGRLDRKIEIPLPKEQGRLDILKIHSDKISKHGEIDWDSLVKLSDGFNGADMRNVCTEAGMFAIRDERDYVINQDFMKAVRKMQDMKKLESKLEYKPV 484
            +IFMDEIDAIGGRRF+ GTS+DREIQRTLMELLNQMDGFD LGQVK+IMATNRPDTLDPALLRPGRLDRK+EIPLP E  R+DILKIH++ ++K GEID++++VKLSD FNGAD+RN+CTEAG+FA+R +R++VI +DFMKAVRK+ D KKLES+L+YKP+
Sbjct:  238 IIFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQMDGFDALGQVKMIMATNRPDTLDPALLRPGRLDRKLEIPLPNEVARMDILKIHAEPLNKRGEIDYEAVVKLSDLFNGADLRNICTEAGLFALRCDREFVIQEDFMKAVRKIADNKKLESRLDYKPI 398          
BLAST of 26S proteasome regulatory subunit vs. Ensembl Fly
Match: Rpt1 (gene:FBgn0028687 transcript:FBtr0088947)

HSP 1 Score: 179.104 bits (453), Expect = 1.663e-54
Identity = 83/146 (56.85%), Postives = 110/146 (75.34%), Query Frame = 2
Query:    2 VIFMDEIDAIGGRRFNNGTSSDREIQRTLMELLNQMDGFDVLGQVKIIMATNRPDTLDPALLRPGRLDRKIEIPLPKEQGRLDILKIHSDKISKHGEIDWDSLVKLSDGFNGADMRNVCTEAGMFAIRDERDYVINQDFMKAVRKM 439
            +IF DEIDAIGG RF++G   D E+QRT++EL+NQ+DGFD  G +K++MATNRPDTLDPAL+RPGRLDRK+E  LP + GR  I KIH+  +S   +I +D L +L     GA++R+VCTEAGMFAIR  R     +DF++AV+K+
Sbjct:  271 LIFFDEIDAIGGARFDDGAGGDNEVQRTMLELINQLDGFDPRGNIKVLMATNRPDTLDPALMRPGRLDRKVEFGLPDQDGRSHIFKIHARSMSVERDIRFDLLARLCPNSTGAEIRSVCTEAGMFAIRARRKVATEKDFLEAVKKV 416          
BLAST of 26S proteasome regulatory subunit vs. Ensembl Fly
Match: Rpt6 (gene:FBgn0020369 transcript:FBtr0077189)

HSP 1 Score: 174.096 bits (440), Expect = 7.078e-53
Identity = 81/146 (55.48%), Postives = 109/146 (74.66%), Query Frame = 2
Query:    2 VIFMDEIDAIGGRRFNNGTSSDREIQRTLMELLNQMDGFDVLGQVKIIMATNRPDTLDPALLRPGRLDRKIEIPLPKEQGRLDILKIHSDKISKHGEIDWDSLVKLSDGFNGADMRNVCTEAGMFAIRDERDYVINQDFMKAVRKM 439
            +IFMDEID+IG  R  +G+  D E+QRT++ELLNQ+DGF+    +K+IMATNR D LDPALLRPGR+DRKIE P P E+ RLDILKIHS K++    I+   + +L  G +GA+++ VCTEAGM+A+R+ R +V  +DF  AV K+
Sbjct:  244 IIFMDEIDSIGSSRIESGSGGDSEVQRTMLELLNQLDGFEATKNIKVIMATNRIDILDPALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMNLTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKV 389          
BLAST of 26S proteasome regulatory subunit vs. Ensembl Zebrafish
Match: psmc6 (proteasome 26S subunit, ATPase 6 [Source:ZFIN;Acc:ZDB-GENE-030131-304])

HSP 1 Score: 273.092 bits (697), Expect = 1.449e-91
Identity = 129/161 (80.12%), Postives = 146/161 (90.68%), Query Frame = 2
Query:    2 VIFMDEIDAIGGRRFNNGTSSDREIQRTLMELLNQMDGFDVLGQVKIIMATNRPDTLDPALLRPGRLDRKIEIPLPKEQGRLDILKIHSDKISKHGEIDWDSLVKLSDGFNGADMRNVCTEAGMFAIRDERDYVINQDFMKAVRKMQDMKKLESKLEYKPV 484
            +IFMDEIDAIGGRRF+ GTS+DREIQRTLMELLNQMDGFD L +VK+IMATNRPDTLDPALLRPGRLDRKI I LP EQ RLDILKIHS  I+KHG+ID++++VKLSDGFNGAD+RNVCTEAGMFAIR + +YV  +DFMKAVRK+ D KKLESKL+YKPV
Sbjct:  229 IIFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQMDGFDTLHRVKMIMATNRPDTLDPALLRPGRLDRKIHIELPNEQARLDILKIHSGPITKHGDIDYEAIVKLSDGFNGADLRNVCTEAGMFAIRADHEYVTQEDFMKAVRKVADSKKLESKLDYKPV 389          
BLAST of 26S proteasome regulatory subunit vs. Ensembl Zebrafish
Match: psmc6 (proteasome 26S subunit, ATPase 6 [Source:ZFIN;Acc:ZDB-GENE-030131-304])

HSP 1 Score: 273.092 bits (697), Expect = 1.449e-91
Identity = 129/161 (80.12%), Postives = 146/161 (90.68%), Query Frame = 2
Query:    2 VIFMDEIDAIGGRRFNNGTSSDREIQRTLMELLNQMDGFDVLGQVKIIMATNRPDTLDPALLRPGRLDRKIEIPLPKEQGRLDILKIHSDKISKHGEIDWDSLVKLSDGFNGADMRNVCTEAGMFAIRDERDYVINQDFMKAVRKMQDMKKLESKLEYKPV 484
            +IFMDEIDAIGGRRF+ GTS+DREIQRTLMELLNQMDGFD L +VK+IMATNRPDTLDPALLRPGRLDRKI I LP EQ RLDILKIHS  I+KHG+ID++++VKLSDGFNGAD+RNVCTEAGMFAIR + +YV  +DFMKAVRK+ D KKLESKL+YKPV
Sbjct:  229 IIFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQMDGFDTLHRVKMIMATNRPDTLDPALLRPGRLDRKIHIELPNEQARLDILKIHSGPITKHGDIDYEAIVKLSDGFNGADLRNVCTEAGMFAIRADHEYVTQEDFMKAVRKVADSKKLESKLDYKPV 389          
BLAST of 26S proteasome regulatory subunit vs. Ensembl Zebrafish
Match: psmc6 (proteasome 26S subunit, ATPase 6 [Source:ZFIN;Acc:ZDB-GENE-030131-304])

HSP 1 Score: 273.092 bits (697), Expect = 1.449e-91
Identity = 129/161 (80.12%), Postives = 146/161 (90.68%), Query Frame = 2
Query:    2 VIFMDEIDAIGGRRFNNGTSSDREIQRTLMELLNQMDGFDVLGQVKIIMATNRPDTLDPALLRPGRLDRKIEIPLPKEQGRLDILKIHSDKISKHGEIDWDSLVKLSDGFNGADMRNVCTEAGMFAIRDERDYVINQDFMKAVRKMQDMKKLESKLEYKPV 484
            +IFMDEIDAIGGRRF+ GTS+DREIQRTLMELLNQMDGFD L +VK+IMATNRPDTLDPALLRPGRLDRKI I LP EQ RLDILKIHS  I+KHG+ID++++VKLSDGFNGAD+RNVCTEAGMFAIR + +YV  +DFMKAVRK+ D KKLESKL+YKPV
Sbjct:  229 IIFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQMDGFDTLHRVKMIMATNRPDTLDPALLRPGRLDRKIHIELPNEQARLDILKIHSGPITKHGDIDYEAIVKLSDGFNGADLRNVCTEAGMFAIRADHEYVTQEDFMKAVRKVADSKKLESKLDYKPV 389          
BLAST of 26S proteasome regulatory subunit vs. Ensembl Zebrafish
Match: psmc2 (proteasome 26S subunit, ATPase 2 [Source:ZFIN;Acc:ZDB-GENE-040426-1327])

HSP 1 Score: 177.563 bits (449), Expect = 7.291e-54
Identity = 83/146 (56.85%), Postives = 109/146 (74.66%), Query Frame = 2
Query:    2 VIFMDEIDAIGGRRFNNGTSSDREIQRTLMELLNQMDGFDVLGQVKIIMATNRPDTLDPALLRPGRLDRKIEIPLPKEQGRLDILKIHSDKISKHGEIDWDSLVKLSDGFNGADMRNVCTEAGMFAIRDERDYVINQDFMKAVRKM 439
            +IF DEIDAIGG RF++G   D E+QRT++EL+NQ+DGFD  G +K++MATNRPDTLDPAL+RPGRLDRKIE  LP  +GR  I KIH+  +S   +I ++ L +L     GA++R+VCTEAGMFAIR  R     +DF++AV K+
Sbjct:  271 LIFFDEIDAIGGARFDDGAGGDNEVQRTMLELINQLDGFDPRGNIKVLMATNRPDTLDPALMRPGRLDRKIEFSLPDLEGRTHIFKIHARSMSVERDIRFELLARLCPNSTGAEIRSVCTEAGMFAIRARRKIATEKDFLEAVNKV 416          
BLAST of 26S proteasome regulatory subunit vs. Ensembl Zebrafish
Match: psmc5 (proteasome 26S subunit, ATPase 5 [Source:ZFIN;Acc:ZDB-GENE-030131-6547])

HSP 1 Score: 169.859 bits (429), Expect = 4.543e-51
Identity = 80/146 (54.79%), Postives = 107/146 (73.29%), Query Frame = 2
Query:    2 VIFMDEIDAIGGRRFNNGTSSDREIQRTLMELLNQMDGFDVLGQVKIIMATNRPDTLDPALLRPGRLDRKIEIPLPKEQGRLDILKIHSDKISKHGEIDWDSLVKLSDGFNGADMRNVCTEAGMFAIRDERDYVINQDFMKAVRKM 439
            +IFMDEID+IG  R   G+  D E+QRT++ELLNQ+DGF+    +K+IMATNR D LD ALLRPGR+DRKIE P P E+ RLDILKIHS K++    I+   + +L  G +GA+++ VCTEAGM+A+R+ R +V  +DF  AV K+
Sbjct:  245 IIFMDEIDSIGSSRLEGGSGGDSEVQRTMLELLNQLDGFEATKNIKVIMATNRIDILDSALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMNLTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKV 390          
BLAST of 26S proteasome regulatory subunit vs. Ensembl Xenopus
Match: psmc6 (proteasome 26S subunit, ATPase 6 [Source:NCBI gene;Acc:394968])

HSP 1 Score: 276.944 bits (707), Expect = 3.471e-93
Identity = 130/161 (80.75%), Postives = 148/161 (91.93%), Query Frame = 2
Query:    2 VIFMDEIDAIGGRRFNNGTSSDREIQRTLMELLNQMDGFDVLGQVKIIMATNRPDTLDPALLRPGRLDRKIEIPLPKEQGRLDILKIHSDKISKHGEIDWDSLVKLSDGFNGADMRNVCTEAGMFAIRDERDYVINQDFMKAVRKMQDMKKLESKLEYKPV 484
            +IFMDEIDAIGGRRF+ GTS+DREIQRTLMELLNQMDGFD L +VK+IMATNRPDTLDPALLRPGRLDRKI I LP EQ RLDILKIH+  I+KHGEID++++VKLSDGFNGAD+RNVCTEAGMFAIR +RD+V+ +DFMKAVRK+ D KKLESKL+YKPV
Sbjct:  206 IIFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQMDGFDTLHRVKMIMATNRPDTLDPALLRPGRLDRKIHIELPNEQARLDILKIHAGPITKHGEIDYEAIVKLSDGFNGADLRNVCTEAGMFAIRADRDFVVQEDFMKAVRKVADSKKLESKLDYKPV 366          
BLAST of 26S proteasome regulatory subunit vs. Ensembl Xenopus
Match: psmc6 (proteasome 26S subunit, ATPase 6 [Source:NCBI gene;Acc:394968])

HSP 1 Score: 275.018 bits (702), Expect = 7.101e-93
Identity = 130/161 (80.75%), Postives = 148/161 (91.93%), Query Frame = 2
Query:    2 VIFMDEIDAIGGRRFNNGTSSDREIQRTLMELLNQMDGFDVLGQVKIIMATNRPDTLDPALLRPGRLDRKIEIPLPKEQGRLDILKIHSDKISKHGEIDWDSLVKLSDGFNGADMRNVCTEAGMFAIRDERDYVINQDFMKAVRKMQDMKKLESKLEYKPV 484
            +IFMDEIDAIGGRRF+ GTS+DREIQRTLMELLNQMDGFD L +VK+IMATNRPDTLDPALLRPGRLDRKI I LP EQ RLDILKIH+  I+KHGEID++++VKLSDGFNGAD+RNVCTEAGMFAIR +RD+V+ +DFMKAVRK+ D KKLESKL+YKPV
Sbjct:  172 IIFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQMDGFDTLHRVKMIMATNRPDTLDPALLRPGRLDRKIHIELPNEQARLDILKIHAGPITKHGEIDYEAIVKLSDGFNGADLRNVCTEAGMFAIRADRDFVVQEDFMKAVRKVADSKKLESKLDYKPV 332          
BLAST of 26S proteasome regulatory subunit vs. Ensembl Xenopus
Match: psmc6 (proteasome 26S subunit, ATPase 6 [Source:NCBI gene;Acc:394968])

HSP 1 Score: 276.174 bits (705), Expect = 2.886e-92
Identity = 130/161 (80.75%), Postives = 148/161 (91.93%), Query Frame = 2
Query:    2 VIFMDEIDAIGGRRFNNGTSSDREIQRTLMELLNQMDGFDVLGQVKIIMATNRPDTLDPALLRPGRLDRKIEIPLPKEQGRLDILKIHSDKISKHGEIDWDSLVKLSDGFNGADMRNVCTEAGMFAIRDERDYVINQDFMKAVRKMQDMKKLESKLEYKPV 484
            +IFMDEIDAIGGRRF+ GTS+DREIQRTLMELLNQMDGFD L +VK+IMATNRPDTLDPALLRPGRLDRKI I LP EQ RLDILKIH+  I+KHGEID++++VKLSDGFNGAD+RNVCTEAGMFAIR +RD+V+ +DFMKAVRK+ D KKLESKL+YKPV
Sbjct:  259 IIFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQMDGFDTLHRVKMIMATNRPDTLDPALLRPGRLDRKIHIELPNEQARLDILKIHAGPITKHGEIDYEAIVKLSDGFNGADLRNVCTEAGMFAIRADRDFVVQEDFMKAVRKVADSKKLESKLDYKPV 419          
BLAST of 26S proteasome regulatory subunit vs. Ensembl Xenopus
Match: pip5k1a (phosphatidylinositol-4-phosphate 5-kinase, type I, alpha [Source:Xenbase;Acc:XB-GENE-5748350])

HSP 1 Score: 177.948 bits (450), Expect = 4.139e-54
Identity = 83/146 (56.85%), Postives = 109/146 (74.66%), Query Frame = 2
Query:    2 VIFMDEIDAIGGRRFNNGTSSDREIQRTLMELLNQMDGFDVLGQVKIIMATNRPDTLDPALLRPGRLDRKIEIPLPKEQGRLDILKIHSDKISKHGEIDWDSLVKLSDGFNGADMRNVCTEAGMFAIRDERDYVINQDFMKAVRKM 439
            +IF DEIDAIGG RF++G   D E+QRT++EL+NQ+DGFD  G +K++MATNRPDTLDPAL+RPGRLDRKIE  LP  +GR  I KIH+  +S   +I ++ L +L     GA++R+VCTEAGMFAIR  R     +DF++AV K+
Sbjct:  236 LIFFDEIDAIGGARFDDGAGGDNEVQRTMLELINQLDGFDPRGNIKVLMATNRPDTLDPALMRPGRLDRKIEFSLPDLEGRTHIFKIHARSMSVERDIRFELLARLCPNSTGAEIRSVCTEAGMFAIRARRKVATEKDFLEAVNKV 381          
BLAST of 26S proteasome regulatory subunit vs. Ensembl Xenopus
Match: pip5k1a (phosphatidylinositol-4-phosphate 5-kinase, type I, alpha [Source:Xenbase;Acc:XB-GENE-5748350])

HSP 1 Score: 177.948 bits (450), Expect = 4.229e-54
Identity = 83/146 (56.85%), Postives = 109/146 (74.66%), Query Frame = 2
Query:    2 VIFMDEIDAIGGRRFNNGTSSDREIQRTLMELLNQMDGFDVLGQVKIIMATNRPDTLDPALLRPGRLDRKIEIPLPKEQGRLDILKIHSDKISKHGEIDWDSLVKLSDGFNGADMRNVCTEAGMFAIRDERDYVINQDFMKAVRKM 439
            +IF DEIDAIGG RF++G   D E+QRT++EL+NQ+DGFD  G +K++MATNRPDTLDPAL+RPGRLDRKIE  LP  +GR  I KIH+  +S   +I ++ L +L     GA++R+VCTEAGMFAIR  R     +DF++AV K+
Sbjct:  236 LIFFDEIDAIGGARFDDGAGGDNEVQRTMLELINQLDGFDPRGNIKVLMATNRPDTLDPALMRPGRLDRKIEFSLPDLEGRTHIFKIHARSMSVERDIRFELLARLCPNSTGAEIRSVCTEAGMFAIRARRKVATEKDFLEAVNKV 381          
BLAST of 26S proteasome regulatory subunit vs. Ensembl Mouse
Match: Psmc6 (proteasome (prosome, macropain) 26S subunit, ATPase, 6 [Source:MGI Symbol;Acc:MGI:1914339])

HSP 1 Score: 273.863 bits (699), Expect = 7.881e-92
Identity = 129/161 (80.12%), Postives = 147/161 (91.30%), Query Frame = 2
Query:    2 VIFMDEIDAIGGRRFNNGTSSDREIQRTLMELLNQMDGFDVLGQVKIIMATNRPDTLDPALLRPGRLDRKIEIPLPKEQGRLDILKIHSDKISKHGEIDWDSLVKLSDGFNGADMRNVCTEAGMFAIRDERDYVINQDFMKAVRKMQDMKKLESKLEYKPV 484
            +IFMDEIDAIGGRRF+ GTS+DREIQRTLMELLNQMDGFD L +VK+IMATNRPDTLDPALLRPGRLDRKI I LP EQ RLDILKIH+  I+KHGEID++++VKLSDGFNGAD+RNVCTEAGMFAIR + D+V+ +DFMKAVRK+ D KKLESKL+YKPV
Sbjct:  229 IIFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQMDGFDTLHRVKMIMATNRPDTLDPALLRPGRLDRKIHIDLPNEQARLDILKIHAGPITKHGEIDYEAIVKLSDGFNGADLRNVCTEAGMFAIRADHDFVVQEDFMKAVRKVADSKKLESKLDYKPV 389          
BLAST of 26S proteasome regulatory subunit vs. Ensembl Mouse
Match: Psmc2 (proteasome (prosome, macropain) 26S subunit, ATPase 2 [Source:MGI Symbol;Acc:MGI:109555])

HSP 1 Score: 177.563 bits (449), Expect = 1.771e-53
Identity = 83/146 (56.85%), Postives = 109/146 (74.66%), Query Frame = 2
Query:    2 VIFMDEIDAIGGRRFNNGTSSDREIQRTLMELLNQMDGFDVLGQVKIIMATNRPDTLDPALLRPGRLDRKIEIPLPKEQGRLDILKIHSDKISKHGEIDWDSLVKLSDGFNGADMRNVCTEAGMFAIRDERDYVINQDFMKAVRKM 439
            +IF DEIDAIGG RF++G   D E+QRT++EL+NQ+DGFD  G +K++MATNRPDTLDPAL+RPGRLDRKIE  LP  +GR  I KIH+  +S   +I ++ L +L     GA++R+VCTEAGMFAIR  R     +DF++AV K+
Sbjct:  313 LIFFDEIDAIGGARFDDGAGGDNEVQRTMLELINQLDGFDPRGNIKVLMATNRPDTLDPALMRPGRLDRKIEFSLPDLEGRTHIFKIHARSMSVERDIRFELLARLCPNSTGAEIRSVCTEAGMFAIRARRKIATEKDFLEAVNKV 458          
BLAST of 26S proteasome regulatory subunit vs. Ensembl Mouse
Match: Psmc5 (protease (prosome, macropain) 26S subunit, ATPase 5 [Source:MGI Symbol;Acc:MGI:105047])

HSP 1 Score: 169.859 bits (429), Expect = 4.648e-51
Identity = 80/146 (54.79%), Postives = 107/146 (73.29%), Query Frame = 2
Query:    2 VIFMDEIDAIGGRRFNNGTSSDREIQRTLMELLNQMDGFDVLGQVKIIMATNRPDTLDPALLRPGRLDRKIEIPLPKEQGRLDILKIHSDKISKHGEIDWDSLVKLSDGFNGADMRNVCTEAGMFAIRDERDYVINQDFMKAVRKM 439
            +IFMDEID+IG  R   G+  D E+QRT++ELLNQ+DGF+    +K+IMATNR D LD ALLRPGR+DRKIE P P E+ RLDILKIHS K++    I+   + +L  G +GA+++ VCTEAGM+A+R+ R +V  +DF  AV K+
Sbjct:  245 IIFMDEIDSIGSSRLEGGSGGDSEVQRTMLELLNQLDGFEATKNIKVIMATNRIDILDSALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMNLTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKV 390          
BLAST of 26S proteasome regulatory subunit vs. Ensembl Mouse
Match: Psmc3 (proteasome (prosome, macropain) 26S subunit, ATPase 3 [Source:MGI Symbol;Acc:MGI:1098754])

HSP 1 Score: 167.162 bits (422), Expect = 3.598e-50
Identity = 78/158 (49.37%), Postives = 115/158 (72.78%), Query Frame = 2
Query:    2 VIFMDEIDAIGGRRFNNGTSSDREIQRTLMELLNQMDGFDVLGQVKIIMATNRPDTLDPALLRPGRLDRKIEIPLPKEQGRLDILKIHSDKISKHGEIDWDSLVKLSDGFNGADMRNVCTEAGMFAIRDERDYVINQDFMKAVRKMQDMKKLESKLEY 475
            +IF+DE+DAIG +RF++  + DRE+QRT++ELLNQ+DGF    QVK+I ATNR D LDPALLR GRLDRKIE P+P E+ R  I++IHS K++   +++++ L + +D FNGA  + VC EAGM A+R     + ++D+M+ + ++Q  KK  + L+Y
Sbjct:  243 IIFIDELDAIGTKRFDSEKAGDREVQRTMLELLNQLDGFQPNTQVKVIAATNRVDILDPALLRSGRLDRKIEFPMPNEEARARIMQIHSRKMNVSPDVNYEELARCTDDFNGAQCKAVCVEAGMIALRRGATELTHEDYMEGILEVQAKKK--ANLQY 398          
BLAST of 26S proteasome regulatory subunit vs. Ensembl Mouse
Match: Psmc3 (proteasome (prosome, macropain) 26S subunit, ATPase 3 [Source:MGI Symbol;Acc:MGI:1098754])

HSP 1 Score: 167.548 bits (423), Expect = 6.762e-50
Identity = 78/158 (49.37%), Postives = 115/158 (72.78%), Query Frame = 2
Query:    2 VIFMDEIDAIGGRRFNNGTSSDREIQRTLMELLNQMDGFDVLGQVKIIMATNRPDTLDPALLRPGRLDRKIEIPLPKEQGRLDILKIHSDKISKHGEIDWDSLVKLSDGFNGADMRNVCTEAGMFAIRDERDYVINQDFMKAVRKMQDMKKLESKLEY 475
            +IF+DE+DAIG +RF++  + DRE+QRT++ELLNQ+DGF    QVK+I ATNR D LDPALLR GRLDRKIE P+P E+ R  I++IHS K++   +++++ L + +D FNGA  + VC EAGM A+R     + ++D+M+ + ++Q  KK  + L+Y
Sbjct:  285 IIFIDELDAIGTKRFDSEKAGDREVQRTMLELLNQLDGFQPNTQVKVIAATNRVDILDPALLRSGRLDRKIEFPMPNEEARARIMQIHSRKMNVSPDVNYEELARCTDDFNGAQCKAVCVEAGMIALRRGATELTHEDYMEGILEVQAKKK--ANLQY 440          
BLAST of 26S proteasome regulatory subunit vs. UniProt/SwissProt
Match: sp|O17071|PRS10_CAEEL (Probable 26S proteasome regulatory subunit 10B OS=Caenorhabditis elegans OX=6239 GN=rpt-4 PE=1 SV=2)

HSP 1 Score: 276.174 bits (705), Expect = 9.753e-92
Identity = 128/161 (79.50%), Postives = 152/161 (94.41%), Query Frame = 2
Query:    2 VIFMDEIDAIGGRRFNNGTSSDREIQRTLMELLNQMDGFDVLGQVKIIMATNRPDTLDPALLRPGRLDRKIEIPLPKEQGRLDILKIHSDKISKHGEIDWDSLVKLSDGFNGADMRNVCTEAGMFAIRDERDYVINQDFMKAVRKMQDMKKLESKLEYKPV 484
            ++FMDEIDAIGGRRF+ GTS+DREIQRTLMELLNQ+DGFD LG+VK+IMATNRPDTLDPALLRPGRLDRKIEI LP EQ RL+ILKIHS+KI+KHGEID++++VKLSDGF+ AD+RNVCTEAGMFAIR ER++VI++DFMKAVRK+ D K+LE+KL+YKPV
Sbjct:  246 IVFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQLDGFDSLGKVKVIMATNRPDTLDPALLRPGRLDRKIEIGLPNEQSRLEILKIHSNKITKHGEIDFEAVVKLSDGFSAADLRNVCTEAGMFAIRAEREFVIDEDFMKAVRKVGDAKRLETKLDYKPV 406          
BLAST of 26S proteasome regulatory subunit vs. UniProt/SwissProt
Match: sp|P62334|PRS10_MOUSE (26S proteasome regulatory subunit 10B OS=Mus musculus OX=10090 GN=Psmc6 PE=1 SV=1)

HSP 1 Score: 273.863 bits (699), Expect = 5.513e-91
Identity = 129/161 (80.12%), Postives = 147/161 (91.30%), Query Frame = 2
Query:    2 VIFMDEIDAIGGRRFNNGTSSDREIQRTLMELLNQMDGFDVLGQVKIIMATNRPDTLDPALLRPGRLDRKIEIPLPKEQGRLDILKIHSDKISKHGEIDWDSLVKLSDGFNGADMRNVCTEAGMFAIRDERDYVINQDFMKAVRKMQDMKKLESKLEYKPV 484
            +IFMDEIDAIGGRRF+ GTS+DREIQRTLMELLNQMDGFD L +VK+IMATNRPDTLDPALLRPGRLDRKI I LP EQ RLDILKIH+  I+KHGEID++++VKLSDGFNGAD+RNVCTEAGMFAIR + D+V+ +DFMKAVRK+ D KKLESKL+YKPV
Sbjct:  229 IIFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQMDGFDTLHRVKMIMATNRPDTLDPALLRPGRLDRKIHIDLPNEQARLDILKIHAGPITKHGEIDYEAIVKLSDGFNGADLRNVCTEAGMFAIRADHDFVVQEDFMKAVRKVADSKKLESKLDYKPV 389          
BLAST of 26S proteasome regulatory subunit vs. UniProt/SwissProt
Match: sp|P62335|PRS10_ICTTR (26S proteasome regulatory subunit 10B OS=Ictidomys tridecemlineatus OX=43179 GN=PSMC6 PE=2 SV=1)

HSP 1 Score: 273.863 bits (699), Expect = 5.513e-91
Identity = 129/161 (80.12%), Postives = 147/161 (91.30%), Query Frame = 2
Query:    2 VIFMDEIDAIGGRRFNNGTSSDREIQRTLMELLNQMDGFDVLGQVKIIMATNRPDTLDPALLRPGRLDRKIEIPLPKEQGRLDILKIHSDKISKHGEIDWDSLVKLSDGFNGADMRNVCTEAGMFAIRDERDYVINQDFMKAVRKMQDMKKLESKLEYKPV 484
            +IFMDEIDAIGGRRF+ GTS+DREIQRTLMELLNQMDGFD L +VK+IMATNRPDTLDPALLRPGRLDRKI I LP EQ RLDILKIH+  I+KHGEID++++VKLSDGFNGAD+RNVCTEAGMFAIR + D+V+ +DFMKAVRK+ D KKLESKL+YKPV
Sbjct:  229 IIFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQMDGFDTLHRVKMIMATNRPDTLDPALLRPGRLDRKIHIDLPNEQARLDILKIHAGPITKHGEIDYEAIVKLSDGFNGADLRNVCTEAGMFAIRADHDFVVQEDFMKAVRKVADSKKLESKLDYKPV 389          
BLAST of 26S proteasome regulatory subunit vs. UniProt/SwissProt
Match: sp|P62333|PRS10_HUMAN (26S proteasome regulatory subunit 10B OS=Homo sapiens OX=9606 GN=PSMC6 PE=1 SV=1)

HSP 1 Score: 273.863 bits (699), Expect = 5.513e-91
Identity = 129/161 (80.12%), Postives = 147/161 (91.30%), Query Frame = 2
Query:    2 VIFMDEIDAIGGRRFNNGTSSDREIQRTLMELLNQMDGFDVLGQVKIIMATNRPDTLDPALLRPGRLDRKIEIPLPKEQGRLDILKIHSDKISKHGEIDWDSLVKLSDGFNGADMRNVCTEAGMFAIRDERDYVINQDFMKAVRKMQDMKKLESKLEYKPV 484
            +IFMDEIDAIGGRRF+ GTS+DREIQRTLMELLNQMDGFD L +VK+IMATNRPDTLDPALLRPGRLDRKI I LP EQ RLDILKIH+  I+KHGEID++++VKLSDGFNGAD+RNVCTEAGMFAIR + D+V+ +DFMKAVRK+ D KKLESKL+YKPV
Sbjct:  229 IIFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQMDGFDTLHRVKMIMATNRPDTLDPALLRPGRLDRKIHIDLPNEQARLDILKIHAGPITKHGEIDYEAIVKLSDGFNGADLRNVCTEAGMFAIRADHDFVVQEDFMKAVRKVADSKKLESKLDYKPV 389          
BLAST of 26S proteasome regulatory subunit vs. UniProt/SwissProt
Match: sp|Q54PJ1|PRS10_DICDI (26S proteasome regulatory subunit 10B OS=Dictyostelium discoideum OX=44689 GN=psmC6 PE=1 SV=1)

HSP 1 Score: 271.166 bits (692), Expect = 7.587e-90
Identity = 125/161 (77.64%), Postives = 145/161 (90.06%), Query Frame = 2
Query:    2 VIFMDEIDAIGGRRFNNGTSSDREIQRTLMELLNQMDGFDVLGQVKIIMATNRPDTLDPALLRPGRLDRKIEIPLPKEQGRLDILKIHSDKISKHGEIDWDSLVKLSDGFNGADMRNVCTEAGMFAIRDERDYVINQDFMKAVRKMQDMKKLESKLEYKPV 484
            VIFMDEIDAIGGRRF+ GTS+DREIQRTLMELLNQMDGFD L +VKIIMATNRPD LDPALLRPGRLDRKIEIPLP E GR+D+LKIH+  I+KHG++D++++ KL+DGFN AD+RNVCTEAGMFAIR ERDYV+ +DFMKAVRK Q+ KKLE KL+Y+ V
Sbjct:  233 VIFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQMDGFDTLSKVKIIMATNRPDVLDPALLRPGRLDRKIEIPLPNEAGRVDVLKIHAANITKHGDVDYEAIAKLADGFNAADLRNVCTEAGMFAIRAERDYVMEEDFMKAVRKCQEAKKLEGKLDYQKV 393          
BLAST of 26S proteasome regulatory subunit vs. TrEMBL
Match: A0A183WUT2 (Uncharacterized protein OS=Trichobilharzia regenti OX=157069 GN=TRE_LOCUS15883 PE=3 SV=1)

HSP 1 Score: 286.96 bits (733), Expect = 9.866e-97
Identity = 133/161 (82.61%), Postives = 149/161 (92.55%), Query Frame = 2
Query:    2 VIFMDEIDAIGGRRFNNGTSSDREIQRTLMELLNQMDGFDVLGQVKIIMATNRPDTLDPALLRPGRLDRKIEIPLPKEQGRLDILKIHSDKISKHGEIDWDSLVKLSDGFNGADMRNVCTEAGMFAIRDERDYVINQDFMKAVRKMQDMKKLESKLEYKPV 484
            +IFMDEIDAIGGRRF  GTS+DREIQRTLMELLNQMDGFD LGQVK+IMATNRPDTLDPALLRPGRLDRKIEIPLP EQ R+D+LKIH+  I+KHGEIDW+++VKLSDGFNGAD+RNVCTEAGMFAIR ERDY + +DFMKAVRK+ D KKLE+KL+YKPV
Sbjct:   12 IIFMDEIDAIGGRRFTEGTSADREIQRTLMELLNQMDGFDALGQVKMIMATNRPDTLDPALLRPGRLDRKIEIPLPNEQARMDVLKIHAAPIAKHGEIDWEAVVKLSDGFNGADLRNVCTEAGMFAIRAERDYTVEEDFMKAVRKIADAKKLETKLDYKPV 172          
BLAST of 26S proteasome regulatory subunit vs. TrEMBL
Match: A0A023FUA7 (Putative 26s proteasome regulatory complex atpase rpt4 (Fragment) OS=Amblyomma parvum OX=251391 PE=2 SV=1)

HSP 1 Score: 287.345 bits (734), Expect = 2.242e-96
Identity = 134/161 (83.23%), Postives = 151/161 (93.79%), Query Frame = 2
Query:    2 VIFMDEIDAIGGRRFNNGTSSDREIQRTLMELLNQMDGFDVLGQVKIIMATNRPDTLDPALLRPGRLDRKIEIPLPKEQGRLDILKIHSDKISKHGEIDWDSLVKLSDGFNGADMRNVCTEAGMFAIRDERDYVINQDFMKAVRKMQDMKKLESKLEYKPV 484
            VIFMDEIDAIGGRRF+ GTS+DREIQRTLMELLNQMDGFD LGQVKIIMATNRPDTLDPALLRPGRLDRKIEIPLP EQ RLDI+KIH+  I+KHGE+DW+++VKLSDGFNGAD+RNVCTEAGMFAIR +R++V+ +DFMKAVRK+ D KKLESKL+YKPV
Sbjct:   49 VIFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQMDGFDSLGQVKIIMATNRPDTLDPALLRPGRLDRKIEIPLPNEQARLDIVKIHAAPITKHGEVDWEAVVKLSDGFNGADLRNVCTEAGMFAIRADREFVVEEDFMKAVRKVADNKKLESKLDYKPV 209          
BLAST of 26S proteasome regulatory subunit vs. TrEMBL
Match: A0A4Z2D8E7 (26S proteasome regulatory subunit 10B OS=Schistosoma japonicum OX=6182 GN=EWB00_003530 PE=3 SV=1)

HSP 1 Score: 289.271 bits (739), Expect = 5.272e-96
Identity = 135/161 (83.85%), Postives = 149/161 (92.55%), Query Frame = 2
Query:    2 VIFMDEIDAIGGRRFNNGTSSDREIQRTLMELLNQMDGFDVLGQVKIIMATNRPDTLDPALLRPGRLDRKIEIPLPKEQGRLDILKIHSDKISKHGEIDWDSLVKLSDGFNGADMRNVCTEAGMFAIRDERDYVINQDFMKAVRKMQDMKKLESKLEYKPV 484
            +IFMDEIDAIGGRRF  GTS+DREIQRTLMELLNQMDGFD LGQVK+IMATNRPDTLDPALLRPGRLDRKIEIPLP EQ RLD+LKIH+  I+KHGEIDW+++VKLSDGFNGAD+RNVCTEAGMFAIR ERDY I +DFMKAVRK+ D KKLE+KL+YKPV
Sbjct:  122 IIFMDEIDAIGGRRFTEGTSADREIQRTLMELLNQMDGFDALGQVKMIMATNRPDTLDPALLRPGRLDRKIEIPLPNEQARLDVLKIHAAPIAKHGEIDWEAVVKLSDGFNGADLRNVCTEAGMFAIRAERDYTIEEDFMKAVRKIADAKKLETKLDYKPV 282          
BLAST of 26S proteasome regulatory subunit vs. TrEMBL
Match: A0A5K4EAI9 (Putative 26s protease regulatory subunit S10b OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 288.5 bits (737), Expect = 1.029e-95
Identity = 134/161 (83.23%), Postives = 149/161 (92.55%), Query Frame = 2
Query:    2 VIFMDEIDAIGGRRFNNGTSSDREIQRTLMELLNQMDGFDVLGQVKIIMATNRPDTLDPALLRPGRLDRKIEIPLPKEQGRLDILKIHSDKISKHGEIDWDSLVKLSDGFNGADMRNVCTEAGMFAIRDERDYVINQDFMKAVRKMQDMKKLESKLEYKPV 484
            +IFMDEIDAIGGRRF  GTS+DREIQRTLMELLNQMDGFD LGQVK+IMATNRPDTLDPALLRPGRLDRKIEIPLP EQ R+D+LKIH+  I+KHGEIDW+++VKLSDGFNGAD+RNVCTEAGMFAIR ERDY I +DFMKAVRK+ D KKLE+KL+YKPV
Sbjct:  128 IIFMDEIDAIGGRRFTEGTSADREIQRTLMELLNQMDGFDALGQVKMIMATNRPDTLDPALLRPGRLDRKIEIPLPNEQARMDVLKIHAAPIAKHGEIDWEAVVKLSDGFNGADLRNVCTEAGMFAIRAERDYTIEEDFMKAVRKIADAKKLETKLDYKPV 288          
BLAST of 26S proteasome regulatory subunit vs. TrEMBL
Match: A0A3M6TL43 (AAA domain-containing protein (Fragment) OS=Pocillopora damicornis OX=46731 GN=pdam_00001335 PE=3 SV=1)

HSP 1 Score: 292.738 bits (748), Expect = 1.359e-95
Identity = 138/161 (85.71%), Postives = 151/161 (93.79%), Query Frame = 2
Query:    2 VIFMDEIDAIGGRRFNNGTSSDREIQRTLMELLNQMDGFDVLGQVKIIMATNRPDTLDPALLRPGRLDRKIEIPLPKEQGRLDILKIHSDKISKHGEIDWDSLVKLSDGFNGADMRNVCTEAGMFAIRDERDYVINQDFMKAVRKMQDMKKLESKLEYKPV 484
            +IFMDEIDAIGGRRF+ GTS+DREIQRTLMELLNQMDGFD LGQVKIIMATNRPDTLDPALLRPGRLDRKIEIPLP EQ R+DILKIHS KI+KHGEID++++VKLSDGFNGAD+RNVCTEAGMFAIR ERDYVI +DFMKA RK+ D KKLESKL+YKPV
Sbjct:  256 IIFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQMDGFDALGQVKIIMATNRPDTLDPALLRPGRLDRKIEIPLPNEQARMDILKIHSAKITKHGEIDYEAVVKLSDGFNGADLRNVCTEAGMFAIRAERDYVIEEDFMKAARKVSDNKKLESKLDYKPV 416          
BLAST of 26S proteasome regulatory subunit vs. Ensembl Cavefish
Match: psmc6 (proteasome 26S subunit, ATPase 6 [Source:NCBI gene;Acc:103029726])

HSP 1 Score: 276.174 bits (705), Expect = 7.578e-93
Identity = 131/161 (81.37%), Postives = 147/161 (91.30%), Query Frame = 2
Query:    2 VIFMDEIDAIGGRRFNNGTSSDREIQRTLMELLNQMDGFDVLGQVKIIMATNRPDTLDPALLRPGRLDRKIEIPLPKEQGRLDILKIHSDKISKHGEIDWDSLVKLSDGFNGADMRNVCTEAGMFAIRDERDYVINQDFMKAVRKMQDMKKLESKLEYKPV 484
            +IFMDEIDAIGGRRF+ GTS+DREIQRTLMELLNQMDGFD L +VK+IMATNRPDTLDPALLRPGRLDRKI I LP EQ RLDILKIHS  I+KHG+ID++++VKLSDGFNGAD+RNVCTEAGMFAIR +RDYV  +DFMKAVRK+ D KKLESKL+YKPV
Sbjct:  229 IIFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQMDGFDTLHRVKMIMATNRPDTLDPALLRPGRLDRKIHIELPNEQARLDILKIHSGPITKHGDIDYEAIVKLSDGFNGADLRNVCTEAGMFAIRADRDYVTQEDFMKAVRKVADSKKLESKLDYKPV 389          
BLAST of 26S proteasome regulatory subunit vs. Ensembl Cavefish
Match: psmc6 (proteasome 26S subunit, ATPase 6 [Source:NCBI gene;Acc:103029726])

HSP 1 Score: 274.633 bits (701), Expect = 1.454e-92
Identity = 131/161 (81.37%), Postives = 147/161 (91.30%), Query Frame = 2
Query:    2 VIFMDEIDAIGGRRFNNGTSSDREIQRTLMELLNQMDGFDVLGQVKIIMATNRPDTLDPALLRPGRLDRKIEIPLPKEQGRLDILKIHSDKISKHGEIDWDSLVKLSDGFNGADMRNVCTEAGMFAIRDERDYVINQDFMKAVRKMQDMKKLESKLEYKPV 484
            +IFMDEIDAIGGRRF+ GTS+DREIQRTLMELLNQMDGFD L +VK+IMATNRPDTLDPALLRPGRLDRKI I LP EQ RLDILKIHS  I+KHG+ID++++VKLSDGFNGAD+RNVCTEAGMFAIR +RDYV  +DFMKAVRK+ D KKLESKL+YKPV
Sbjct:  205 IIFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQMDGFDTLHRVKMIMATNRPDTLDPALLRPGRLDRKIHIELPNEQARLDILKIHSGPITKHGDIDYEAIVKLSDGFNGADLRNVCTEAGMFAIRADRDYVTQEDFMKAVRKVADSKKLESKLDYKPV 365          
BLAST of 26S proteasome regulatory subunit vs. Ensembl Cavefish
Match: psmc2 (proteasome 26S subunit, ATPase 2 [Source:NCBI gene;Acc:103035644])

HSP 1 Score: 177.178 bits (448), Expect = 3.512e-54
Identity = 83/146 (56.85%), Postives = 109/146 (74.66%), Query Frame = 2
Query:    2 VIFMDEIDAIGGRRFNNGTSSDREIQRTLMELLNQMDGFDVLGQVKIIMATNRPDTLDPALLRPGRLDRKIEIPLPKEQGRLDILKIHSDKISKHGEIDWDSLVKLSDGFNGADMRNVCTEAGMFAIRDERDYVINQDFMKAVRKM 439
            +IF DEIDAIGG RF++G   D E+QRT++EL+NQ+DGFD  G +K++MATNRPDTLDPAL+RPGRLDRKIE  LP  +GR  I KIH+  +S   +I ++ L +L     GA++R+VCTEAGMFAIR  R     +DF++AV K+
Sbjct:  231 LIFFDEIDAIGGARFDDGAGGDNEVQRTMLELINQLDGFDPRGNIKVLMATNRPDTLDPALMRPGRLDRKIEFSLPDLEGRTHIFKIHARSMSVERDIRFELLARLCPNSTGAEIRSVCTEAGMFAIRARRKIATEKDFLEAVNKV 376          
BLAST of 26S proteasome regulatory subunit vs. Ensembl Cavefish
Match: psmc2 (proteasome 26S subunit, ATPase 2 [Source:NCBI gene;Acc:103035644])

HSP 1 Score: 177.563 bits (449), Expect = 7.174e-54
Identity = 83/146 (56.85%), Postives = 109/146 (74.66%), Query Frame = 2
Query:    2 VIFMDEIDAIGGRRFNNGTSSDREIQRTLMELLNQMDGFDVLGQVKIIMATNRPDTLDPALLRPGRLDRKIEIPLPKEQGRLDILKIHSDKISKHGEIDWDSLVKLSDGFNGADMRNVCTEAGMFAIRDERDYVINQDFMKAVRKM 439
            +IF DEIDAIGG RF++G   D E+QRT++EL+NQ+DGFD  G +K++MATNRPDTLDPAL+RPGRLDRKIE  LP  +GR  I KIH+  +S   +I ++ L +L     GA++R+VCTEAGMFAIR  R     +DF++AV K+
Sbjct:  271 LIFFDEIDAIGGARFDDGAGGDNEVQRTMLELINQLDGFDPRGNIKVLMATNRPDTLDPALMRPGRLDRKIEFSLPDLEGRTHIFKIHARSMSVERDIRFELLARLCPNSTGAEIRSVCTEAGMFAIRARRKIATEKDFLEAVNKV 416          
BLAST of 26S proteasome regulatory subunit vs. Ensembl Cavefish
Match: psmc5 (proteasome 26S subunit, ATPase 5 [Source:NCBI gene;Acc:103027731])

HSP 1 Score: 170.244 bits (430), Expect = 1.327e-51
Identity = 80/146 (54.79%), Postives = 107/146 (73.29%), Query Frame = 2
Query:    2 VIFMDEIDAIGGRRFNNGTSSDREIQRTLMELLNQMDGFDVLGQVKIIMATNRPDTLDPALLRPGRLDRKIEIPLPKEQGRLDILKIHSDKISKHGEIDWDSLVKLSDGFNGADMRNVCTEAGMFAIRDERDYVINQDFMKAVRKM 439
            +IFMDEID+IG  R   G+  D E+QRT++ELLNQ+DGF+    +K+IMATNR D LD ALLRPGR+DRKIE P P E+ RLDILKIHS K++    I+   + +L  G +GA+++ VCTEAGM+A+R+ R +V  +DF  AV K+
Sbjct:  226 IIFMDEIDSIGSSRLEGGSGGDSEVQRTMLELLNQLDGFEATKNIKVIMATNRIDILDSALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMNLTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKV 371          
BLAST of 26S proteasome regulatory subunit vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001244.1 (pep scaffold:Pmarinus_7.0:GL482260:6416:9764:-1 gene:ENSPMAG00000001115.1 transcript:ENSPMAT00000001244.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 177.178 bits (448), Expect = 2.113e-54
Identity = 83/146 (56.85%), Postives = 109/146 (74.66%), Query Frame = 2
Query:    2 VIFMDEIDAIGGRRFNNGTSSDREIQRTLMELLNQMDGFDVLGQVKIIMATNRPDTLDPALLRPGRLDRKIEIPLPKEQGRLDILKIHSDKISKHGEIDWDSLVKLSDGFNGADMRNVCTEAGMFAIRDERDYVINQDFMKAVRKM 439
            +IF DEIDAIGG RF++G   D E+QRT++EL+NQ+DGFD  G +K++MATNRPDTLDPAL+RPGRLDRKIE  LP  +GR  I KIH+  +S   +I ++ L +L     GA++R+VCTEAGMFAIR  R     +DF++AV K+
Sbjct:  279 LIFFDEIDAIGGARFDDGAGGDNEVQRTMLELINQLDGFDPRGNIKVLMATNRPDTLDPALMRPGRLDRKIEFGLPDLEGRTHIFKIHARSMSVERDIRFELLARLCPNSTGAEIRSVCTEAGMFAIRARRKVATEKDFLEAVNKV 424          
BLAST of 26S proteasome regulatory subunit vs. Ensembl Sea Lamprey
Match: psmc5 (proteasome 26S subunit, ATPase 5 [Source:ZFIN;Acc:ZDB-GENE-030131-6547])

HSP 1 Score: 173.326 bits (438), Expect = 3.939e-53
Identity = 81/146 (55.48%), Postives = 108/146 (73.97%), Query Frame = 2
Query:    2 VIFMDEIDAIGGRRFNNGTSSDREIQRTLMELLNQMDGFDVLGQVKIIMATNRPDTLDPALLRPGRLDRKIEIPLPKEQGRLDILKIHSDKISKHGEIDWDSLVKLSDGFNGADMRNVCTEAGMFAIRDERDYVINQDFMKAVRKM 439
            +IFMDEID+IG  R   G+  D E+QRT++ELLNQ+DGF+    +K+IMATNR D LDPALLRPGR+DRKIE P P E+ RLDILKIHS K++    I+   + +L  G +GA+++ VCTEAGM+A+R+ R +V  +DF  AV K+
Sbjct:  249 IIFMDEIDSIGSSRLEGGSGGDSEVQRTMLELLNQLDGFEATKNIKVIMATNRIDILDPALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMNLTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKV 394          
BLAST of 26S proteasome regulatory subunit vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010299.1 (pep scaffold:Pmarinus_7.0:GL479893:343:6144:1 gene:ENSPMAG00000009320.1 transcript:ENSPMAT00000010299.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 166.007 bits (419), Expect = 2.294e-50
Identity = 78/158 (49.37%), Postives = 114/158 (72.15%), Query Frame = 2
Query:    2 VIFMDEIDAIGGRRFNNGTSSDREIQRTLMELLNQMDGFDVLGQVKIIMATNRPDTLDPALLRPGRLDRKIEIPLPKEQGRLDILKIHSDKISKHGEIDWDSLVKLSDGFNGADMRNVCTEAGMFAIRDERDYVINQDFMKAVRKMQDMKKLESKLEY 475
            +IF+DE+DAIG +RF++  + DRE+QRT++ELLNQ+DGF    QVK+I ATNR D LDPALLR GRLDRKIE P+P E+ R  I++IHS K++   +++++ L + +D FNGA  + VC EAGM A+R     + ++D+M  + ++Q  KK  + L+Y
Sbjct:  258 IIFIDELDAIGTKRFDSEKAGDREVQRTMLELLNQLDGFQPNTQVKVIAATNRVDILDPALLRSGRLDRKIEFPMPNEEARARIMQIHSRKMNVSPDVNFEELARCTDDFNGAQCKAVCVEAGMIALRRGATELTHEDYMDGILEVQAKKK--ANLQY 413          
BLAST of 26S proteasome regulatory subunit vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006168.1 (pep scaffold:Pmarinus_7.0:GL486395:211235:217029:-1 gene:ENSPMAG00000005566.1 transcript:ENSPMAT00000006168.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 122.094 bits (305), Expect = 2.499e-34
Identity = 59/104 (56.73%), Postives = 76/104 (73.08%), Query Frame = 2
Query:    2 VIFMDEIDAIGGRRFNNGTSSDREIQRTLMELLNQMDGFDVLGQVKIIMATNRPDTLDPALLRPGRLDRKIEIPLPKEQGRLDILKIHSDKISKHGEIDWDSLV 313
            +IF+DEIDAI  +RF+  T +DRE+QR L+ELLNQMDGFD    VK+IMATNR DTLDPALLRPGRLDRKIE P+P  + +  I    + K++   E+D +  +
Sbjct:  216 IIFIDEIDAIATKRFDAQTGADREVQRILLELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPMPDRRQKRLIFSTVTAKMNLSEEVDLEDCI 319          
BLAST of 26S proteasome regulatory subunit vs. Ensembl Sea Lamprey
Match: si:ch1073-174d20.2 (si:ch1073-174d20.2 [Source:ZFIN;Acc:ZDB-GENE-121214-51])

HSP 1 Score: 113.235 bits (282), Expect = 2.799e-31
Identity = 59/150 (39.33%), Postives = 87/150 (58.00%), Query Frame = 2
Query:    2 VIFMDEIDAIGGRRFNNGTSSDREIQRTLMELLNQMDGFDVLGQVKIIMATNRPDTLDPALLRPGRLDRKIEIPLPKEQGRLDILKIHSDKISKHGEIDWDS----LVKLSDGFNGADMRNVCTEAGMFAIRDERDYVINQDFMKAVRKM 439
            ++F+DEIDA+G +R         E + TL +LL +MDGF+    V ++  TNRPD LDPALLRPGR DR+I +  P  +GR  I K+H   +     +D  +    L  L+ GF GAD+ NVC EA + A R   + +  + F +A+ ++
Sbjct:   18 ILFIDEIDAVGRKRGRGNFGGQSEQENTLNQLLVEMDGFNTTTNV-VLAGTNRPDILDPALLRPGRFDRQIFVGAPDIKGRASIFKVHLKPLKTELALDKAAISRKLAALTPGFTGADIANVCNEAALIAARHLNEAISEKHFEQAIERV 166          
BLAST of 26S proteasome regulatory subunit vs. Ensembl Yeast
Match: RPT4 (ATPase of the 19S regulatory particle of the 26S proteasome; one of six ATPases of the regulatory particle; involved in degradation of ubiquitinated substrates; contributes preferentially to ERAD; required for spindle pole body duplication; mainly nuclear localization [Source:SGD;Acc:S000005785])

HSP 1 Score: 249.98 bits (637), Expect = 7.945e-83
Identity = 116/159 (72.96%), Postives = 137/159 (86.16%), Query Frame = 2
Query:    2 VIFMDEIDAIGGRRFNNGTSSDREIQRTLMELLNQMDGFDVLGQVKIIMATNRPDTLDPALLRPGRLDRKIEIPLPKEQGRLDILKIHSDKISKHGEIDWDSLVKLSDGFNGADMRNVCTEAGMFAIRDERDYVINQDFMKAVRKMQDMKKLESKLEYK 478
            +IFMDE+DAIGGRRF+ GTS+DREIQRTLMELL QMDGFD LGQ KIIMATNRPDTLDPALLRPGRLDRK+EIPLP E GRL+I KIH+ K+ K GE D+++ VK+SDGFNGAD+RN  TEAG FAIRD+RD++   D MKAVRK+ ++KKLE  +EY+
Sbjct:  277 IIFMDEVDAIGGRRFSEGTSADREIQRTLMELLTQMDGFDNLGQTKIIMATNRPDTLDPALLRPGRLDRKVEIPLPNEAGRLEIFKIHTAKVKKTGEFDFEAAVKMSDGFNGADIRNCATEAGFFAIRDDRDHINPDDLMKAVRKVAEVKKLEGTIEYQ 435          
BLAST of 26S proteasome regulatory subunit vs. Ensembl Yeast
Match: RPT1 (ATPase of the 19S regulatory particle of the 26S proteasome; one of six ATPases of the regulatory particle; involved in the degradation of ubiquitinated substrates; required for optimal CDC20 transcription; interacts with Rpn12p and Ubr1p; mutant has aneuploidy tolerance [Source:SGD;Acc:S000001628])

HSP 1 Score: 177.948 bits (450), Expect = 1.298e-54
Identity = 83/159 (52.20%), Postives = 111/159 (69.81%), Query Frame = 2
Query:    2 VIFMDEIDAIGGRRFNNGTSSDREIQRTLMELLNQMDGFDVLGQVKIIMATNRPDTLDPALLRPGRLDRKIEIPLPKEQGRLDILKIHSDKISKHGEIDWDSLVKLSDGFNGADMRNVCTEAGMFAIRDERDYVINQDFMKAVRK-MQDMKKLESKLEY 475
            +IF DEIDA+GG RF++G   D E+QRT++EL+ Q+DGFD  G +K++ ATNRP+TLDPALLRPGR+DRK+E  LP  +GR +I +IHS  +S    I W+ + +L     GA++R+VCTEAGMFAIR  R     +DF+KAV K +   KK  S   Y
Sbjct:  305 IIFFDEIDAVGGARFDDGAGGDNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLKAVDKVISGYKKFSSTSRY 463          
BLAST of 26S proteasome regulatory subunit vs. Ensembl Yeast
Match: RPT5 (ATPase of the 19S regulatory particle of the 26S proteasome; one of six ATPases of the regulatory particle; involved in the degradation of ubiquitinated substrates; recruited to the GAL1-10 promoter region upon induction of transcription; similar to human TBP1 [Source:SGD;Acc:S000005643])

HSP 1 Score: 167.162 bits (422), Expect = 7.329e-51
Identity = 78/150 (52.00%), Postives = 110/150 (73.33%), Query Frame = 2
Query:    2 VIFMDEIDAIGGRRFNNGTSSDREIQRTLMELLNQMDGFDVLGQVKIIMATNRPDTLDPALLRPGRLDRKIEIPLPKEQGRLDILKIHSDKISKHGEIDWDSLVKLSDGFNGADMRNVCTEAGMFAIRDERDYVINQDFMKAVRKMQDMK 451
            +IF+DE+DAIG +RF++  S DRE+QRT++ELLNQ+DGF    +VK++ ATNR D LDPALLR GRLDRKIE PLP E  R  IL+IHS K++   +I+W  L + +D FNGA ++ V  EAGM A+R+ +  V ++DF++ + ++Q  K
Sbjct:  277 IIFIDELDAIGTKRFDSEKSGDREVQRTMLELLNQLDGFSSDDRVKVLAATNRVDVLDPALLRSGRLDRKIEFPLPSEDSRAQILQIHSRKMTTDDDINWQELARSTDEFNGAQLKAVTVEAGMIALRNGQSSVKHEDFVEGISEVQARK 426          
BLAST of 26S proteasome regulatory subunit vs. Ensembl Yeast
Match: RPT6 (ATPase of the 19S regulatory particle of the 26S proteasome; one of six ATPases of the regulatory particle; involved in the degradation of ubiquitinated substrates; bound by ubiquitin-protein ligases Ubr1p and Ufd4p; localized mainly to the nucleus throughout the cell cycle; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000003016])

HSP 1 Score: 160.229 bits (404), Expect = 2.383e-48
Identity = 77/148 (52.03%), Postives = 104/148 (70.27%), Query Frame = 2
Query:    2 VIFMDEIDAIGGRRFNNGTSSDREIQRTLMELLNQMDGFDVLGQVKIIMATNRPDTLDPALLRPGRLDRKIEIPLPKEQGRLDILKIHSDKISKHGEIDWDSLVKLSDGFNGADMRNVCTEAGMFAIRDERDYVINQDFMKAVRKMQD 445
            +IFMDEID+IG  R       D E+QRT++ELLNQ+DGF+    +KIIMATNR D LDPALLRPGR+DRKIE P P    R +IL+IHS K++    I+   + +  +G +GAD++ VCTEAGM+A+R+ R +V  +DF  AV K+ +
Sbjct:  244 IIFMDEIDSIGSTRVEGSGGGDSEVQRTMLELLNQLDGFETSKNIKIIMATNRLDILDPALLRPGRIDRKIEFPPPSVAARAEILRIHSRKMNLTRGINLRKVAEKMNGCSGADVKGVCTEAGMYALRERRIHVTQEDFELAVGKVMN 391          
BLAST of 26S proteasome regulatory subunit vs. Ensembl Yeast
Match: RPT2 (ATPase of the 19S regulatory particle of the 26S proteasome; one of six ATPases of the regulatory particle; involved in the degradation of ubiquitinated substrates; required for normal peptide hydrolysis by the core 20S particle; N-myristoylation of Rpt2p at Gly2 is involved in regulating the proper intracellular distribution of proteasome activity by controlling the nuclear localization of the 26S proteasome [Source:SGD;Acc:S000002165])

HSP 1 Score: 150.599 bits (379), Expect = 1.790e-44
Identity = 74/157 (47.13%), Postives = 112/157 (71.34%), Query Frame = 2
Query:    2 VIFMDEIDAIGGRRFNNGTSSDREIQRTLMELLNQMDGFDVLGQVKIIMATNRPDTLDPALLRPGRLDRKIEIPLPKEQGRLDILKIHSDKISKHGEIDWDSLVKLSDGFNGADMRNVCTEAGMFAIRDERDYVINQDFMKAVRKMQDMKKLESKLE 472
            ++F+DEIDAIG +R+++ +  +REIQRT++ELLNQ+DGFD  G VK+IMATN+ +TLDPAL+RPGR+DRKI    P    +  IL IH+ K++   +++ ++LV   D  +GAD++ +CTEAG+ A+R+ R  V  +DF +A  ++    K+E  LE
Sbjct:  278 IVFIDEIDAIGTKRYDSNSGGEREIQRTMLELLNQLDGFDDRGDVKVIMATNKIETLDPALIRPGRIDRKILFENPDLSTKKKILGIHTSKMNLSEDVNLETLVTTKDDLSGADIQAMCTEAGLLALRERRMQVTAEDFKQAKERVMK-NKVEENLE 433          
BLAST of 26S proteasome regulatory subunit vs. Ensembl Nematostella
Match: EDO34160 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SQ60])

HSP 1 Score: 290.426 bits (742), Expect = 8.732e-99
Identity = 136/161 (84.47%), Postives = 152/161 (94.41%), Query Frame = 2
Query:    2 VIFMDEIDAIGGRRFNNGTSSDREIQRTLMELLNQMDGFDVLGQVKIIMATNRPDTLDPALLRPGRLDRKIEIPLPKEQGRLDILKIHSDKISKHGEIDWDSLVKLSDGFNGADMRNVCTEAGMFAIRDERDYVINQDFMKAVRKMQDMKKLESKLEYKPV 484
            +IFMDEIDAIGGRRF+ GTS+DREIQRTLMELLNQMDGFDVLGQVK+IMATNRPDTLDPALLRPGRLDRKIEI LP EQ R+DILKIHS +I+KHGEID++++VKLSDGFNGAD+RNVCTEAGMFAIR ERDYVI +DFMKAVRK+ D KKLESKL+YKP+
Sbjct:  231 IIFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQMDGFDVLGQVKMIMATNRPDTLDPALLRPGRLDRKIEIALPNEQARMDILKIHSSRITKHGEIDYEAVVKLSDGFNGADLRNVCTEAGMFAIRGERDYVIEEDFMKAVRKVSDNKKLESKLDYKPI 391          
BLAST of 26S proteasome regulatory subunit vs. Ensembl Nematostella
Match: EDO37473 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFJ3])

HSP 1 Score: 177.178 bits (448), Expect = 3.208e-54
Identity = 81/146 (55.48%), Postives = 109/146 (74.66%), Query Frame = 2
Query:    2 VIFMDEIDAIGGRRFNNGTSSDREIQRTLMELLNQMDGFDVLGQVKIIMATNRPDTLDPALLRPGRLDRKIEIPLPKEQGRLDILKIHSDKISKHGEIDWDSLVKLSDGFNGADMRNVCTEAGMFAIRDERDYVINQDFMKAVRKM 439
            ++F DEIDAIGG RF++G   D E+QRT++EL+NQ+DGFD  G +K++MATNRPDTLDPAL+RPGRLDRK+E  LP  +GR  I KIH+  +S   +I ++ L +L     GA++R+VCTEAGMFAIR  R     +DF++AV K+
Sbjct:  272 IVFFDEIDAIGGARFDDGAGGDNEVQRTMLELINQLDGFDPRGNIKVLMATNRPDTLDPALMRPGRLDRKVEFGLPDLEGRAHIFKIHARSMSVERDIRYELLARLCPNSTGAEIRSVCTEAGMFAIRARRKVATEKDFLEAVNKV 417          
BLAST of 26S proteasome regulatory subunit vs. Ensembl Nematostella
Match: EDO49524 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGH4])

HSP 1 Score: 168.703 bits (426), Expect = 3.322e-51
Identity = 79/146 (54.11%), Postives = 106/146 (72.60%), Query Frame = 2
Query:    2 VIFMDEIDAIGGRRFNNGTSSDREIQRTLMELLNQMDGFDVLGQVKIIMATNRPDTLDPALLRPGRLDRKIEIPLPKEQGRLDILKIHSDKISKHGEIDWDSLVKLSDGFNGADMRNVCTEAGMFAIRDERDYVINQDFMKAVRKM 439
            +IFMDEID+IG  R   G+  D E+QRT++ELLNQ+DGF+    +K+IMATNR D LD ALLRPGR+DRKIE P P E+ R DILKIHS K++    I+   + +L  G +GA+++ VCTEAGM+A+R+ R +V  +DF  AV K+
Sbjct:  237 IIFMDEIDSIGSSRLEGGSGGDSEVQRTMLELLNQLDGFEATKNIKVIMATNRIDILDSALLRPGRIDRKIEFPPPNEEARQDILKIHSRKMNLTRGINLKKIAELMPGASGAEIKGVCTEAGMYALRERRVHVTQEDFEMAVTKV 382          
BLAST of 26S proteasome regulatory subunit vs. Ensembl Nematostella
Match: EDO37502 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFP4])

HSP 1 Score: 164.851 bits (416), Expect = 1.852e-49
Identity = 77/151 (50.99%), Postives = 110/151 (72.85%), Query Frame = 2
Query:    2 VIFMDEIDAIGGRRFNNGTSSDREIQRTLMELLNQMDGFDVLGQVKIIMATNRPDTLDPALLRPGRLDRKIEIPLPKEQGRLDILKIHSDKISKHGEIDWDSLVKLSDGFNGADMRNVCTEAGMFAIRDERDYVINQDFMKAVRKMQDMKK 454
            +IF+DE+DAIG +RF++  + DRE+QRT++ELLNQ+DGF     +K+I ATNR D LDPALLR GRLDRKIE P P ++ R  IL+IHS K++  G++++D L + +D FNGA ++ VC EAGM A+R E   V ++D+M  + ++   KK
Sbjct:  271 IIFIDELDAIGTKRFDSEKAGDREVQRTMLELLNQLDGFSSHHDIKVIAATNRVDILDPALLRSGRLDRKIEFPNPDQEARARILQIHSRKMNVSGDVNFDELSRCTDDFNGAMLKAVCVEAGMIALRREATEVCHEDYMDGIMEVNAKKK 421          
BLAST of 26S proteasome regulatory subunit vs. Ensembl Nematostella
Match: EDO43481 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RYL2])

HSP 1 Score: 157.532 bits (397), Expect = 8.126e-47
Identity = 81/158 (51.27%), Postives = 109/158 (68.99%), Query Frame = 2
Query:    2 VIFMDEIDAIGGRRFNNGTSSDREIQRTLMELLNQMDGFDVLGQVKIIMATNRPDTLDPALLRPGRLDRKIEIPLPKEQGRLDILKIHSDKISKHGEIDWDSLVKLSDGFNGADMRNVCTEAGMFAIRDERDYVINQDFMKAVRKMQDMKKLESKLEY 475
            +IF+DEIDAI  +RF+  T +DRE+QR L+ELLNQMDGFD    VK+IMATNR DTLDPALLRPGRLDRKIE PLP  + +  I    ++K++   E+D +  V   D  +GAD+  VC EAGM A+R+ R  ++ +DF K  +   ++KK E + E+
Sbjct:  260 IIFIDEIDAIATKRFDAQTGADREVQRILLELLNQMDGFDQNVNVKVIMATNRQDTLDPALLRPGRLDRKIEFPLPDRRQKRLIFSTITNKMNLSEEVDLEDYVARPDKISGADINAVCQEAGMQAVRENRYIILAKDFEKGYK--NNVKKDEQEHEF 415          
BLAST of 26S proteasome regulatory subunit vs. Ensembl Medaka
Match: psmc6 (proteasome 26S subunit, ATPase 6 [Source:NCBI gene;Acc:101172300])

HSP 1 Score: 276.559 bits (706), Expect = 4.666e-93
Identity = 130/161 (80.75%), Postives = 147/161 (91.30%), Query Frame = 2
Query:    2 VIFMDEIDAIGGRRFNNGTSSDREIQRTLMELLNQMDGFDVLGQVKIIMATNRPDTLDPALLRPGRLDRKIEIPLPKEQGRLDILKIHSDKISKHGEIDWDSLVKLSDGFNGADMRNVCTEAGMFAIRDERDYVINQDFMKAVRKMQDMKKLESKLEYKPV 484
            +IFMDEIDAIGGRRF+ GTS+DREIQRTLMELLNQMDGFD L +VK+IMATNRPDTLDPALLRPGRLDRKI I LP EQ RLDILKIHS  I+KHGEID++++VKLSDGFNGAD+RNVCTEAG+FAIR +R+YV  +DFMKAVRK+ D KKLESKL+YKPV
Sbjct:  229 IIFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQMDGFDTLHRVKMIMATNRPDTLDPALLRPGRLDRKIHIELPNEQARLDILKIHSSPITKHGEIDYEAIVKLSDGFNGADLRNVCTEAGLFAIRSDREYVTQEDFMKAVRKVADSKKLESKLDYKPV 389          
BLAST of 26S proteasome regulatory subunit vs. Ensembl Medaka
Match: psmc2 (proteasome 26S subunit, ATPase 2 [Source:NCBI gene;Acc:101175703])

HSP 1 Score: 177.178 bits (448), Expect = 3.344e-54
Identity = 83/146 (56.85%), Postives = 109/146 (74.66%), Query Frame = 2
Query:    2 VIFMDEIDAIGGRRFNNGTSSDREIQRTLMELLNQMDGFDVLGQVKIIMATNRPDTLDPALLRPGRLDRKIEIPLPKEQGRLDILKIHSDKISKHGEIDWDSLVKLSDGFNGADMRNVCTEAGMFAIRDERDYVINQDFMKAVRKM 439
            +IF DEIDAIGG RF++G   D E+QRT++EL+NQ+DGFD  G +K++MATNRPDTLDPAL+RPGRLDRKIE  LP  +GR  I KIH+  +S   +I ++ L +L     GA++R+VCTEAGMFAIR  R     +DF++AV K+
Sbjct:  231 LIFFDEIDAIGGARFDDGAGGDNEVQRTMLELINQLDGFDPRGNIKVLMATNRPDTLDPALMRPGRLDRKIEFSLPDLEGRTHIFKIHARSMSVERDIRFELLARLCPNSTGAEIRSVCTEAGMFAIRARRKIATEKDFLEAVNKV 376          
BLAST of 26S proteasome regulatory subunit vs. Ensembl Medaka
Match: psmc2 (proteasome 26S subunit, ATPase 2 [Source:NCBI gene;Acc:101175703])

HSP 1 Score: 177.563 bits (449), Expect = 6.688e-54
Identity = 83/146 (56.85%), Postives = 109/146 (74.66%), Query Frame = 2
Query:    2 VIFMDEIDAIGGRRFNNGTSSDREIQRTLMELLNQMDGFDVLGQVKIIMATNRPDTLDPALLRPGRLDRKIEIPLPKEQGRLDILKIHSDKISKHGEIDWDSLVKLSDGFNGADMRNVCTEAGMFAIRDERDYVINQDFMKAVRKM 439
            +IF DEIDAIGG RF++G   D E+QRT++EL+NQ+DGFD  G +K++MATNRPDTLDPAL+RPGRLDRKIE  LP  +GR  I KIH+  +S   +I ++ L +L     GA++R+VCTEAGMFAIR  R     +DF++AV K+
Sbjct:  271 LIFFDEIDAIGGARFDDGAGGDNEVQRTMLELINQLDGFDPRGNIKVLMATNRPDTLDPALMRPGRLDRKIEFSLPDLEGRTHIFKIHARSMSVERDIRFELLARLCPNSTGAEIRSVCTEAGMFAIRARRKIATEKDFLEAVNKV 416          
BLAST of 26S proteasome regulatory subunit vs. Ensembl Medaka
Match: psmc5 (proteasome 26S subunit, ATPase 5 [Source:NCBI gene;Acc:101158979])

HSP 1 Score: 169.474 bits (428), Expect = 3.421e-51
Identity = 80/146 (54.79%), Postives = 107/146 (73.29%), Query Frame = 2
Query:    2 VIFMDEIDAIGGRRFNNGTSSDREIQRTLMELLNQMDGFDVLGQVKIIMATNRPDTLDPALLRPGRLDRKIEIPLPKEQGRLDILKIHSDKISKHGEIDWDSLVKLSDGFNGADMRNVCTEAGMFAIRDERDYVINQDFMKAVRKM 439
            +IFMDEID+IG  R   G+  D E+QRT++ELLNQ+DGF+    +K+IMATNR D LD ALLRPGR+DRKIE P P E+ RLDILKIHS K++    I+   + +L  G +GA+++ VCTEAGM+A+R+ R +V  +DF  AV K+
Sbjct:  237 IIFMDEIDSIGSSRLEGGSGGDSEVQRTMLELLNQLDGFEATKNIKVIMATNRIDILDSALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMNLTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKV 382          
BLAST of 26S proteasome regulatory subunit vs. Ensembl Medaka
Match: psmc5 (proteasome 26S subunit, ATPase 5 [Source:NCBI gene;Acc:101158979])

HSP 1 Score: 169.859 bits (429), Expect = 3.667e-51
Identity = 80/146 (54.79%), Postives = 107/146 (73.29%), Query Frame = 2
Query:    2 VIFMDEIDAIGGRRFNNGTSSDREIQRTLMELLNQMDGFDVLGQVKIIMATNRPDTLDPALLRPGRLDRKIEIPLPKEQGRLDILKIHSDKISKHGEIDWDSLVKLSDGFNGADMRNVCTEAGMFAIRDERDYVINQDFMKAVRKM 439
            +IFMDEID+IG  R   G+  D E+QRT++ELLNQ+DGF+    +K+IMATNR D LD ALLRPGR+DRKIE P P E+ RLDILKIHS K++    I+   + +L  G +GA+++ VCTEAGM+A+R+ R +V  +DF  AV K+
Sbjct:  245 IIFMDEIDSIGSSRLEGGSGGDSEVQRTMLELLNQLDGFEATKNIKVIMATNRIDILDSALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMNLTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKV 390          
BLAST of 26S proteasome regulatory subunit vs. Planmine SMEST
Match: SMESG000047180.1 (SMESG000047180.1)

HSP 1 Score: 332.798 bits (852), Expect = 2.888e-115
Identity = 161/161 (100.00%), Postives = 161/161 (100.00%), Query Frame = 2
Query:    2 VIFMDEIDAIGGRRFNNGTSSDREIQRTLMELLNQMDGFDVLGQVKIIMATNRPDTLDPALLRPGRLDRKIEIPLPKEQGRLDILKIHSDKISKHGEIDWDSLVKLSDGFNGADMRNVCTEAGMFAIRDERDYVINQDFMKAVRKMQDMKKLESKLEYKPV 484
            VIFMDEIDAIGGRRFNNGTSSDREIQRTLMELLNQMDGFDVLGQVKIIMATNRPDTLDPALLRPGRLDRKIEIPLPKEQGRLDILKIHSDKISKHGEIDWDSLVKLSDGFNGADMRNVCTEAGMFAIRDERDYVINQDFMKAVRKMQDMKKLESKLEYKPV
Sbjct:  230 VIFMDEIDAIGGRRFNNGTSSDREIQRTLMELLNQMDGFDVLGQVKIIMATNRPDTLDPALLRPGRLDRKIEIPLPKEQGRLDILKIHSDKISKHGEIDWDSLVKLSDGFNGADMRNVCTEAGMFAIRDERDYVINQDFMKAVRKMQDMKKLESKLEYKPV 390          
BLAST of 26S proteasome regulatory subunit vs. Planmine SMEST
Match: SMESG000047188.1 (SMESG000047188.1)

HSP 1 Score: 293.123 bits (749), Expect = 1.097e-99
Identity = 134/161 (83.23%), Postives = 152/161 (94.41%), Query Frame = 2
Query:    2 VIFMDEIDAIGGRRFNNGTSSDREIQRTLMELLNQMDGFDVLGQVKIIMATNRPDTLDPALLRPGRLDRKIEIPLPKEQGRLDILKIHSDKISKHGEIDWDSLVKLSDGFNGADMRNVCTEAGMFAIRDERDYVINQDFMKAVRKMQDMKKLESKLEYKPV 484
            VIFMDEIDAIGGRRF+ GTS+DREIQRTLMELLNQMDGFD LGQVKIIMATNRPDTLDPALLRPGRLDRKIEIPLP EQ R+D+LKIH+  +SKHG+IDW+++VKLSDGFNGAD+RNVCTEAGMFAIR+ER+Y+I +DFMKAVRK+ D KKLESKL+YKP+
Sbjct:  222 VIFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQMDGFDALGQVKIIMATNRPDTLDPALLRPGRLDRKIEIPLPNEQARMDVLKIHASTLSKHGDIDWEAIVKLSDGFNGADLRNVCTEAGMFAIRNEREYIIEEDFMKAVRKLADSKKLESKLDYKPI 382          
BLAST of 26S proteasome regulatory subunit vs. Planmine SMEST
Match: SMESG000047188.1 (SMESG000047188.1)

HSP 1 Score: 292.738 bits (748), Expect = 1.335e-99
Identity = 134/161 (83.23%), Postives = 152/161 (94.41%), Query Frame = 2
Query:    2 VIFMDEIDAIGGRRFNNGTSSDREIQRTLMELLNQMDGFDVLGQVKIIMATNRPDTLDPALLRPGRLDRKIEIPLPKEQGRLDILKIHSDKISKHGEIDWDSLVKLSDGFNGADMRNVCTEAGMFAIRDERDYVINQDFMKAVRKMQDMKKLESKLEYKPV 484
            VIFMDEIDAIGGRRF+ GTS+DREIQRTLMELLNQMDGFD LGQVKIIMATNRPDTLDPALLRPGRLDRKIEIPLP EQ R+D+LKIH+  +SKHG+IDW+++VKLSDGFNGAD+RNVCTEAGMFAIR+ER+Y+I +DFMKAVRK+ D KKLESKL+YKP+
Sbjct:  215 VIFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQMDGFDALGQVKIIMATNRPDTLDPALLRPGRLDRKIEIPLPNEQARMDVLKIHASTLSKHGDIDWEAIVKLSDGFNGADLRNVCTEAGMFAIRNEREYIIEEDFMKAVRKLADSKKLESKLDYKPI 375          
BLAST of 26S proteasome regulatory subunit vs. Planmine SMEST
Match: SMESG000035469.1 (SMESG000035469.1)

HSP 1 Score: 292.352 bits (747), Expect = 3.321e-99
Identity = 134/161 (83.23%), Postives = 152/161 (94.41%), Query Frame = 2
Query:    2 VIFMDEIDAIGGRRFNNGTSSDREIQRTLMELLNQMDGFDVLGQVKIIMATNRPDTLDPALLRPGRLDRKIEIPLPKEQGRLDILKIHSDKISKHGEIDWDSLVKLSDGFNGADMRNVCTEAGMFAIRDERDYVINQDFMKAVRKMQDMKKLESKLEYKPV 484
            VIFMDEIDAIGGRRF+ GTS+DREIQRTLMELLNQMDGFD LGQVKIIMATNRPDTLDPALLRPGRLDRKIEIPLP EQ R+D+LKIH+  +SKHG+IDW+++VKLSDGFNGAD+RNVCTEAGMFAIR+ER+Y+I +DFMKAVRK+ D KKLESKL+YKP+
Sbjct:  236 VIFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQMDGFDALGQVKIIMATNRPDTLDPALLRPGRLDRKIEIPLPNEQARMDVLKIHASTLSKHGDIDWEAIVKLSDGFNGADLRNVCTEAGMFAIRNEREYIIEEDFMKAVRKLADSKKLESKLDYKPI 396          
BLAST of 26S proteasome regulatory subunit vs. Planmine SMEST
Match: SMESG000062610.1 (SMESG000062610.1)

HSP 1 Score: 269.626 bits (688), Expect = 2.455e-90
Identity = 128/161 (79.50%), Postives = 144/161 (89.44%), Query Frame = 2
Query:    2 VIFMDEIDAIGGRRFNNGTSSDREIQRTLMELLNQMDGFDVLGQVKIIMATNRPDTLDPALLRPGRLDRKIEIPLPKEQGRLDILKIHSDKISKHGEIDWDSLVKLSDGFNGADMRNVCTEAGMFAIRDERDYVINQDFMKAVRKMQDMKKLESKLEYKPV 484
            VIFMDEIDAIGG+RF +G SSDREIQRTLMELLNQMDGFD LG+VKIIMATNRPD LDPAL+RPGR+DRKIEI LP E  RLDIL IHS K+SKHGE D+D ++K+S+GFNGAD+RNVCTEAGMFA+R ER YVIN+DF+KAVRK+ D KKLESKLEYK V
Sbjct:  234 VIFMDEIDAIGGKRFTDGNSSDREIQRTLMELLNQMDGFDTLGKVKIIMATNRPDILDPALIRPGRIDRKIEISLPNEVARLDILNIHSSKLSKHGEFDFDFIIKMSEGFNGADLRNVCTEAGMFAMRAERMYVINEDFVKAVRKVGDSKKLESKLEYKAV 394          
The following BLAST results are available for this feature:
BLAST of 26S proteasome regulatory subunit vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PSMC61.148e-9180.12proteasome 26S subunit, ATPase 6 [Source:HGNC Symb... [more]
PSMC62.666e-9180.12proteasome 26S subunit, ATPase 6 [Source:HGNC Symb... [more]
PSMC21.389e-5356.85proteasome 26S subunit, ATPase 2 [Source:HGNC Symb... [more]
PSMC21.389e-5356.85proteasome 26S subunit, ATPase 2 [Source:HGNC Symb... [more]
PSMC55.156e-5154.79proteasome 26S subunit, ATPase 5 [Source:HGNC Symb... [more]
back to top
BLAST of 26S proteasome regulatory subunit vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rpt-46.880e-9379.50Probable 26S proteasome regulatory subunit 10B [S... [more]
rpt-47.667e-9379.50Probable 26S proteasome regulatory subunit 10B [S... [more]
rpt-11.217e-5456.1626S proteasome regulatory subunit 7 [Source:UniPr... [more]
rpt-11.217e-5456.1626S proteasome regulatory subunit 7 [Source:UniPr... [more]
rpt-61.802e-5054.11Proteasome Regulatory Particle, ATPase-like [Sour... [more]
back to top
BLAST of 26S proteasome regulatory subunit vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Rpt43.246e-9683.23gene:FBgn0028685 transcript:FBtr0305495[more]
Rpt4R1.884e-8976.40gene:FBgn0036224 transcript:FBtr0346545[more]
Rpt4R1.884e-8976.40gene:FBgn0036224 transcript:FBtr0076040[more]
Rpt11.663e-5456.85gene:FBgn0028687 transcript:FBtr0088947[more]
Rpt67.078e-5355.48gene:FBgn0020369 transcript:FBtr0077189[more]
back to top
BLAST of 26S proteasome regulatory subunit vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
psmc61.449e-9180.12proteasome 26S subunit, ATPase 6 [Source:ZFIN;Acc:... [more]
psmc61.449e-9180.12proteasome 26S subunit, ATPase 6 [Source:ZFIN;Acc:... [more]
psmc61.449e-9180.12proteasome 26S subunit, ATPase 6 [Source:ZFIN;Acc:... [more]
psmc27.291e-5456.85proteasome 26S subunit, ATPase 2 [Source:ZFIN;Acc:... [more]
psmc54.543e-5154.79proteasome 26S subunit, ATPase 5 [Source:ZFIN;Acc:... [more]
back to top
BLAST of 26S proteasome regulatory subunit vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
psmc63.471e-9380.75proteasome 26S subunit, ATPase 6 [Source:NCBI gene... [more]
psmc67.101e-9380.75proteasome 26S subunit, ATPase 6 [Source:NCBI gene... [more]
psmc62.886e-9280.75proteasome 26S subunit, ATPase 6 [Source:NCBI gene... [more]
pip5k1a4.139e-5456.85phosphatidylinositol-4-phosphate 5-kinase, type I,... [more]
pip5k1a4.229e-5456.85phosphatidylinositol-4-phosphate 5-kinase, type I,... [more]
back to top
BLAST of 26S proteasome regulatory subunit vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Psmc67.881e-9280.12proteasome (prosome, macropain) 26S subunit, ATPas... [more]
Psmc21.771e-5356.85proteasome (prosome, macropain) 26S subunit, ATPas... [more]
Psmc54.648e-5154.79protease (prosome, macropain) 26S subunit, ATPase ... [more]
Psmc33.598e-5049.37proteasome (prosome, macropain) 26S subunit, ATPas... [more]
Psmc36.762e-5049.37proteasome (prosome, macropain) 26S subunit, ATPas... [more]
back to top
BLAST of 26S proteasome regulatory subunit vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O17071|PRS10_CAEEL9.753e-9279.50Probable 26S proteasome regulatory subunit 10B OS=... [more]
sp|P62334|PRS10_MOUSE5.513e-9180.1226S proteasome regulatory subunit 10B OS=Mus muscu... [more]
sp|P62335|PRS10_ICTTR5.513e-9180.1226S proteasome regulatory subunit 10B OS=Ictidomys... [more]
sp|P62333|PRS10_HUMAN5.513e-9180.1226S proteasome regulatory subunit 10B OS=Homo sapi... [more]
sp|Q54PJ1|PRS10_DICDI7.587e-9077.6426S proteasome regulatory subunit 10B OS=Dictyoste... [more]
back to top
BLAST of 26S proteasome regulatory subunit vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A183WUT29.866e-9782.61Uncharacterized protein OS=Trichobilharzia regenti... [more]
A0A023FUA72.242e-9683.23Putative 26s proteasome regulatory complex atpase ... [more]
A0A4Z2D8E75.272e-9683.8526S proteasome regulatory subunit 10B OS=Schistoso... [more]
A0A5K4EAI91.029e-9583.23Putative 26s protease regulatory subunit S10b OS=S... [more]
A0A3M6TL431.359e-9585.71AAA domain-containing protein (Fragment) OS=Pocill... [more]
back to top
BLAST of 26S proteasome regulatory subunit vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
psmc67.578e-9381.37proteasome 26S subunit, ATPase 6 [Source:NCBI gene... [more]
psmc61.454e-9281.37proteasome 26S subunit, ATPase 6 [Source:NCBI gene... [more]
psmc23.512e-5456.85proteasome 26S subunit, ATPase 2 [Source:NCBI gene... [more]
psmc27.174e-5456.85proteasome 26S subunit, ATPase 2 [Source:NCBI gene... [more]
psmc51.327e-5154.79proteasome 26S subunit, ATPase 5 [Source:NCBI gene... [more]
back to top
BLAST of 26S proteasome regulatory subunit vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000001244.12.113e-5456.85pep scaffold:Pmarinus_7.0:GL482260:6416:9764:-1 ge... [more]
psmc53.939e-5355.48proteasome 26S subunit, ATPase 5 [Source:ZFIN;Acc:... [more]
ENSPMAT00000010299.12.294e-5049.37pep scaffold:Pmarinus_7.0:GL479893:343:6144:1 gene... [more]
ENSPMAT00000006168.12.499e-3456.73pep scaffold:Pmarinus_7.0:GL486395:211235:217029:-... [more]
si:ch1073-174d20.22.799e-3139.33si:ch1073-174d20.2 [Source:ZFIN;Acc:ZDB-GENE-12121... [more]
back to top
BLAST of 26S proteasome regulatory subunit vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
RPT47.945e-8372.96ATPase of the 19S regulatory particle of the 26S p... [more]
RPT11.298e-5452.20ATPase of the 19S regulatory particle of the 26S p... [more]
RPT57.329e-5152.00ATPase of the 19S regulatory particle of the 26S p... [more]
RPT62.383e-4852.03ATPase of the 19S regulatory particle of the 26S p... [more]
RPT21.790e-4447.13ATPase of the 19S regulatory particle of the 26S p... [more]
back to top
BLAST of 26S proteasome regulatory subunit vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO341608.732e-9984.47Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO374733.208e-5455.48Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO495243.322e-5154.11Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO375021.852e-4950.99Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO434818.126e-4751.27Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of 26S proteasome regulatory subunit vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
psmc64.666e-9380.75proteasome 26S subunit, ATPase 6 [Source:NCBI gene... [more]
psmc23.344e-5456.85proteasome 26S subunit, ATPase 2 [Source:NCBI gene... [more]
psmc26.688e-5456.85proteasome 26S subunit, ATPase 2 [Source:NCBI gene... [more]
psmc53.421e-5154.79proteasome 26S subunit, ATPase 5 [Source:NCBI gene... [more]
psmc53.667e-5154.79proteasome 26S subunit, ATPase 5 [Source:NCBI gene... [more]
back to top
BLAST of 26S proteasome regulatory subunit vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000047180.12.888e-115100.00SMESG000047180.1[more]
SMESG000047188.11.097e-9983.23SMESG000047188.1[more]
SMESG000047188.11.335e-9983.23SMESG000047188.1[more]
SMESG000035469.13.321e-9983.23SMESG000035469.1[more]
SMESG000062610.12.455e-9079.50SMESG000062610.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30008939 ID=SMED30008939|Name=26S proteasome regulatory subunit|organism=Schmidtea mediterranea sexual|type=transcript|length=549bp
TGTTATATTTATGGATGAAATAGACGCGATCGGTGGAAGACGGTTTAATA
ATGGCACAAGCTCTGATAGAGAAATTCAAAGAACTCTCATGGAATTGCTT
AACCAAATGGATGGGTTTGATGTATTGGGTCAGGTTAAAATTATTATGGC
AACTAATCGACCCGACACTCTCGATCCAGCATTGCTTAGACCAGGAAGAC
TGGATAGAAAAATTGAAATACCACTTCCAAAAGAACAAGGTCGATTGGAT
ATTCTTAAAATCCATAGTGACAAAATATCAAAACACGGAGAAATCGATTG
GGATTCTTTAGTCAAACTATCTGATGGATTTAATGGAGCAGATATGAGAA
ATGTTTGCACCGAAGCAGGAATGTTTGCTATTCGCGATGAAAGAGATTAT
GTGATCAACCAAGATTTCATGAAGGCCGTAAGAAAGATGCAAGACATGAA
GAAATTGGAATCTAAGCTGGAATATAAACCGGTGTAAAATGATAATTTTA
AAAATTATTTTCAATTTTTATATAAATATATGAATTTGTGTAAAAAAAA
back to top

protein sequence of SMED30008939-orf-1

>SMED30008939-orf-1 ID=SMED30008939-orf-1|Name=SMED30008939-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=162bp
VIFMDEIDAIGGRRFNNGTSSDREIQRTLMELLNQMDGFDVLGQVKIIMA
TNRPDTLDPALLRPGRLDRKIEIPLPKEQGRLDILKIHSDKISKHGEIDW
DSLVKLSDGFNGADMRNVCTEAGMFAIRDERDYVINQDFMKAVRKMQDMK
KLESKLEYKPV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0008540proteasome regulatory particle, base subcomplex
GO:0000502proteasome complex
GO:0000932P-body
GO:0005634nucleus
GO:0005737cytoplasm
GO:0022624proteasome accessory complex
Vocabulary: biological process
TermDefinition
GO:0030433ubiquitin-dependent ERAD pathway
GO:0006511ubiquitin-dependent protein catabolic process
GO:0030163protein catabolic process
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000429neoblast
PLANA:0002109X1 cell
PLANA:0003304testis primordium
Vocabulary: INTERPRO
TermDefinition
IPR041569AAA_lid_3
IPR035263PSMC6
IPR027417P-loop_NTPase
IPR003959ATPase_AAA_core
IPR003960ATPase_AAA_CS
Vocabulary: molecular function
TermDefinition
GO:0005524ATP binding
GO:0000166nucleotide binding
GO:0016787hydrolase activity
GO:0016887ATPase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:1.10.8.60coord: 76..147
e-value: 8.6E-21
score: 75.5
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 1..75
e-value: 8.9E-25
score: 89.5
NoneNo IPR availablePANTHERPTHR2307326S PROTEASE REGULATORY SUBUNITcoord: 1..161
NoneNo IPR availableCDDcd00009AAAcoord: 1..75
e-value: 8.14374E-9
score: 49.4519
IPR003959ATPase, AAA-type, corePFAMPF00004AAAcoord: 1..75
e-value: 5.1E-19
score: 69.0
IPR041569AAA ATPase, AAA+ lid domainPFAMPF17862AAA_lid_3coord: 98..140
e-value: 1.7E-11
score: 43.8
IPR03526326S proteasome regulatory subunit 10BPANTHERPTHR23073:SF7626S PROTEASOME REGULATORY SUBUNIT 10Bcoord: 1..161
IPR003960ATPase, AAA-type, conserved sitePROSITEPS00674AAAcoord: 45..63
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 1..153