ATP-dependent DNA helicase

Overview
NameATP-dependent DNA helicase
Smed IDSMED30008926
Uniprot Best hitUncharacterized protein C2orf50 OS=Homo sapiens OX=9606 GN=C2orf50 PE=1 SV=1 (E=2.92815e-19)
Length (bp)744
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of ATP-dependent DNA helicase (SMED30008926) t-SNE clustered cells

Violin plots show distribution of expression levels for ATP-dependent DNA helicase (SMED30008926) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of ATP-dependent DNA helicase (SMED30008926) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for ATP-dependent DNA helicase (SMED30008926) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30008926

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parapharyngeal regionSMED30008926SMESG000023939.1 SmedASXL_006461SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30008926SMESG000023939.1 dd_Smed_v4_6024_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30008926SMESG000023939.1 dd_Smed_v4_6024_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30008926SMESG000023939.1 dd_Smed_v4_6024_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal midlineSMED30008926SMESG000023939.1 dd_Smed_v4_6024_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult colorimetric in situ hybridization evidence
epidermisSMED30008926SMESG000023939.1 dd_Smed_v4_6024_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30008926SMESG000023939.1 dd_Smed_v4_6024_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult colorimetric in situ hybridization evidence
ventral epidermisSMED30008926SMESG000023939.1 dd_Smed_v4_6024_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of ATP-dependent DNA helicase vs. Ensembl Human
Match: C2orf50 (chromosome 2 open reading frame 50 [Source:HGNC Symbol;Acc:HGNC:26324])

HSP 1 Score: 85.1149 bits (209), Expect = 6.097e-20
Identity = 38/91 (41.76%), Postives = 57/91 (62.64%), Query Frame = 2
Query:  308 NRLWKQAIDNENRSRKNWETNWGFLKDYDEKGNYNPSSPLPETASLYSSSVPNTTSGTYGSRLESPLGKQLLLMQCKFNENVGKRKLNDDM 580
            ++LW++ ++ E R ++ W  NW FLKDYD  GN      LP+   L+S +VP++T+   GSRL++PLG+ L+ M   F E   K+KL D M
Sbjct:   69 DQLWRELLEAERRGQQRWIQNWSFLKDYDPMGNKKEPEKLPDHVPLFSDTVPSSTNQVVGSRLDTPLGQTLIRMDFFFTEGARKKKLEDQM 159          
BLAST of ATP-dependent DNA helicase vs. Ensembl Human
Match: C2orf50 (chromosome 2 open reading frame 50 [Source:HGNC Symbol;Acc:HGNC:26324])

HSP 1 Score: 85.1149 bits (209), Expect = 6.097e-20
Identity = 38/91 (41.76%), Postives = 57/91 (62.64%), Query Frame = 2
Query:  308 NRLWKQAIDNENRSRKNWETNWGFLKDYDEKGNYNPSSPLPETASLYSSSVPNTTSGTYGSRLESPLGKQLLLMQCKFNENVGKRKLNDDM 580
            ++LW++ ++ E R ++ W  NW FLKDYD  GN      LP+   L+S +VP++T+   GSRL++PLG+ L+ M   F E   K+KL D M
Sbjct:   69 DQLWRELLEAERRGQQRWIQNWSFLKDYDPMGNKKEPEKLPDHVPLFSDTVPSSTNQVVGSRLDTPLGQTLIRMDFFFTEGARKKKLEDQM 159          
BLAST of ATP-dependent DNA helicase vs. Ensembl Zebrafish
Match: si:dkey-18j18.3 (si:dkey-18j18.3 [Source:ZFIN;Acc:ZDB-GENE-090313-214])

HSP 1 Score: 69.3218 bits (168), Expect = 2.713e-14
Identity = 35/104 (33.65%), Postives = 58/104 (55.77%), Query Frame = 2
Query:  284 EKREPEVYNRLWKQAIDNENRSRKNWETNWGFLKDYDEKGNYNPSSPLPETASLYSSSVPNTTSGTYGSRLESPLGKQLLLMQ--CKFNENVGKRKLNDDMTCC 589
            + R+P   +++W++ +  E    K WE NW FL ++D+ G+    +PLP + SLYS  +PNT++  +GS L + LG +L+ +        N  K K N +M  C
Sbjct:   52 DSRDPVKQDQVWREFVRAERSGVKEWEKNWSFLMNFDQLGHPRTETPLPNSVSLYSDRLPNTSNQMFGSSLYTELGNELVRLDNLLILTSNHRKAKRNPEMQPC 155          
BLAST of ATP-dependent DNA helicase vs. Ensembl Zebrafish
Match: si:dkey-18j18.3 (si:dkey-18j18.3 [Source:ZFIN;Acc:ZDB-GENE-090313-214])

HSP 1 Score: 69.3218 bits (168), Expect = 2.713e-14
Identity = 35/104 (33.65%), Postives = 58/104 (55.77%), Query Frame = 2
Query:  284 EKREPEVYNRLWKQAIDNENRSRKNWETNWGFLKDYDEKGNYNPSSPLPETASLYSSSVPNTTSGTYGSRLESPLGKQLLLMQ--CKFNENVGKRKLNDDMTCC 589
            + R+P   +++W++ +  E    K WE NW FL ++D+ G+    +PLP + SLYS  +PNT++  +GS L + LG +L+ +        N  K K N +M  C
Sbjct:   52 DSRDPVKQDQVWREFVRAERSGVKEWEKNWSFLMNFDQLGHPRTETPLPNSVSLYSDRLPNTSNQMFGSSLYTELGNELVRLDNLLILTSNHRKAKRNPEMQPC 155          
BLAST of ATP-dependent DNA helicase vs. Ensembl Zebrafish
Match: si:dkey-18j18.3 (si:dkey-18j18.3 [Source:ZFIN;Acc:ZDB-GENE-090313-214])

HSP 1 Score: 69.3218 bits (168), Expect = 2.713e-14
Identity = 35/104 (33.65%), Postives = 58/104 (55.77%), Query Frame = 2
Query:  284 EKREPEVYNRLWKQAIDNENRSRKNWETNWGFLKDYDEKGNYNPSSPLPETASLYSSSVPNTTSGTYGSRLESPLGKQLLLMQ--CKFNENVGKRKLNDDMTCC 589
            + R+P   +++W++ +  E    K WE NW FL ++D+ G+    +PLP + SLYS  +PNT++  +GS L + LG +L+ +        N  K K N +M  C
Sbjct:   52 DSRDPVKQDQVWREFVRAERSGVKEWEKNWSFLMNFDQLGHPRTETPLPNSVSLYSDRLPNTSNQMFGSSLYTELGNELVRLDNLLILTSNHRKAKRNPEMQPC 155          
BLAST of ATP-dependent DNA helicase vs. Ensembl Zebrafish
Match: si:dkey-18j18.3 (si:dkey-18j18.3 [Source:ZFIN;Acc:ZDB-GENE-090313-214])

HSP 1 Score: 69.3218 bits (168), Expect = 2.713e-14
Identity = 35/104 (33.65%), Postives = 58/104 (55.77%), Query Frame = 2
Query:  284 EKREPEVYNRLWKQAIDNENRSRKNWETNWGFLKDYDEKGNYNPSSPLPETASLYSSSVPNTTSGTYGSRLESPLGKQLLLMQ--CKFNENVGKRKLNDDMTCC 589
            + R+P   +++W++ +  E    K WE NW FL ++D+ G+    +PLP + SLYS  +PNT++  +GS L + LG +L+ +        N  K K N +M  C
Sbjct:   52 DSRDPVKQDQVWREFVRAERSGVKEWEKNWSFLMNFDQLGHPRTETPLPNSVSLYSDRLPNTSNQMFGSSLYTELGNELVRLDNLLILTSNHRKAKRNPEMQPC 155          
BLAST of ATP-dependent DNA helicase vs. Ensembl Xenopus
Match: C2orf50 (chromosome 2 open reading frame 50 [Source:NCBI gene;Acc:100379859])

HSP 1 Score: 72.7886 bits (177), Expect = 2.068e-15
Identity = 32/92 (34.78%), Postives = 52/92 (56.52%), Query Frame = 2
Query:  305 YNRLWKQAIDNENRSRKNWETNWGFLKDYDEKGNYNPSSPLPETASLYSSSVPNTTSGTYGSRLESPLGKQLLLMQCKFNENVGKRKLNDDM 580
            ++++W++ ++ E R  K W  NWGFLK+YD  GN      LP+   ++S  +PNT +   GSR+ + LGK L+ M         K+KL  ++
Sbjct:   64 HDQVWREFVEAERRGGKRWHENWGFLKEYDSMGNKKEVEELPKEVPVFSDQIPNTANQAIGSRMNTELGKTLVHMDYFLTGGNQKKKLGSEL 155          
BLAST of ATP-dependent DNA helicase vs. Ensembl Mouse
Match: 2410004P03Rik (RIKEN cDNA 2410004P03 gene [Source:MGI Symbol;Acc:MGI:1920917])

HSP 1 Score: 78.9518 bits (193), Expect = 5.598e-18
Identity = 36/91 (39.56%), Postives = 55/91 (60.44%), Query Frame = 2
Query:  308 NRLWKQAIDNENRSRKNWETNWGFLKDYDEKGNYNPSSPLPETASLYSSSVPNTTSGTYGSRLESPLGKQLLLMQCKFNENVGKRKLNDDM 580
            ++LW++ ++ E R ++ W  NWGFLKDYD  GN      LP +   +S + P +T+   GSR+++PLGK L  M   F E   KRK +D++
Sbjct:   56 DQLWRELVEAEARGQRRWAENWGFLKDYDPLGNKKEPQELPASVPFFSDTFPCSTNREVGSRVDTPLGKALGHMDFFFVEGTRKRKPDDEL 146          
BLAST of ATP-dependent DNA helicase vs. Ensembl Mouse
Match: 2410004P03Rik (RIKEN cDNA 2410004P03 gene [Source:MGI Symbol;Acc:MGI:1920917])

HSP 1 Score: 58.151 bits (139), Expect = 1.278e-10
Identity = 24/63 (38.10%), Postives = 38/63 (60.32%), Query Frame = 2
Query:  308 NRLWKQAIDNENRSRKNWETNWGFLKDYDEKGNYNPSSPLPETASLYSSSVPNTTSGTYGSRL 496
            ++LW++ ++ E R ++ W  NWGFLKDYD  GN      LP +   +S + P +T+   GSR+
Sbjct:   56 DQLWRELVEAEARGQRRWAENWGFLKDYDPLGNKKEPQELPASVPFFSDTFPCSTNREVGSRV 118          
BLAST of ATP-dependent DNA helicase vs. UniProt
Match: sp|Q96LR7|CB050_HUMAN (Uncharacterized protein C2orf50 OS=Homo sapiens OX=9606 GN=C2orf50 PE=1 SV=1)

HSP 1 Score: 85.1149 bits (209), Expect = 2.928e-19
Identity = 38/91 (41.76%), Postives = 57/91 (62.64%), Query Frame = 2
Query:  308 NRLWKQAIDNENRSRKNWETNWGFLKDYDEKGNYNPSSPLPETASLYSSSVPNTTSGTYGSRLESPLGKQLLLMQCKFNENVGKRKLNDDM 580
            ++LW++ ++ E R ++ W  NW FLKDYD  GN      LP+   L+S +VP++T+   GSRL++PLG+ L+ M   F E   K+KL D M
Sbjct:   69 DQLWRELLEAERRGQQRWIQNWSFLKDYDPMGNKKEPEKLPDHVPLFSDTVPSSTNQVVGSRLDTPLGQTLIRMDFFFTEGARKKKLEDQM 159          
BLAST of ATP-dependent DNA helicase vs. UniProt
Match: sp|Q1JPL0|CB050_BOVIN (Uncharacterized protein C2orf50 homolog OS=Bos taurus OX=9913 PE=2 SV=2)

HSP 1 Score: 80.4925 bits (197), Expect = 1.503e-17
Identity = 36/91 (39.56%), Postives = 58/91 (63.74%), Query Frame = 2
Query:  308 NRLWKQAIDNENRSRKNWETNWGFLKDYDEKGNYNPSSPLPETASLYSSSVPNTTSGTYGSRLESPLGKQLLLMQCKFNENVGKRKLNDDM 580
            ++LW++ ++ E RS++ W  NW FLKDYD  GN      LP+    +S +VPN+T+   GSR+++PLGK L+ +   F E   K+KL +++
Sbjct:   64 DQLWRELLEAERRSQQRWAQNWSFLKDYDPMGNKKEPVKLPDHVPRFSDTVPNSTNRAVGSRVDTPLGKTLIGLDFFFVEGARKKKLEEEL 154          
BLAST of ATP-dependent DNA helicase vs. TrEMBL
Match: gnl|BL_ORD_ID|15776963 (tr|A0A1I8HVT8|A0A1I8HVT8_9PLAT Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig028872g1 PE=4 SV=1)

HSP 1 Score: 113.62 bits (283), Expect = 5.598e-28
Identity = 53/148 (35.81%), Postives = 92/148 (62.16%), Query Frame = 2
Query:  143 MERQTSGMLFSYYEKSLFHEKCAPHREMSKRSDLLPPGEVLSGMVALEKREPEVYNRLWKQAIDNENRSRKNWETNWGFLKDYDEKGNYNPSSPLPETASLYSSSVPNTTSGTYGSRLESPLGKQLLLMQCKFNENVGKRKLNDDMTC 586
            M+R+ +G+LFSY+ KS +HE+C P +  S ++      + L+    L K +    +++W+Q ++NE+R  K WE NWGF+ ++D+KGN      L E ++++S+S PNT +G YG R+ +  G++L+ MQ KF+    + K + D+ C
Sbjct:    1 MQREATGVLFSYFNKSQYHERCVPAQ--STQAAAAAAEKPLTS-AELRKMDAVGQDKVWRQYVENESRHNKQWEQNWGFMAEFDQKGNKKERKVLAEESTVFSTSFPNTDAGNYGHRVNTATGQRLMEMQRKFDAANKRSKPDKDIVC 145          
BLAST of ATP-dependent DNA helicase vs. TrEMBL
Match: gnl|BL_ORD_ID|20349579 (tr|A0A1S3HQB0|A0A1S3HQB0_LINUN uncharacterized protein C2orf50-like isoform X2 OS=Lingula unguis OX=7574 GN=LOC106156843 PE=4 SV=1)

HSP 1 Score: 113.62 bits (283), Expect = 6.271e-28
Identity = 59/151 (39.07%), Postives = 89/151 (58.94%), Query Frame = 2
Query:  143 MERQTSGMLFSYYEK---SLFHEKCAPHREMSKRSDLLPPGEVLSGMVALEKREPEVYNRLWKQAIDNENRSRKNWETNWGFLKDYDEKGNYNPSSPLPETASLYSSSVPNTTSGTYGSRLESPLGKQLLLMQCKFNENVGKRKLNDDMTC 586
            M R+TSG++FSY  K   S +H++C P  +   +++   P +  S     EK +    + +WKQ++  E    K W  NWGFL ++D KGN     PLPETA+ +S +VPNT SG YGSRL + LGK++  ++ +F     K+KL+ D+ C
Sbjct:    1 MHRETSGVMFSYLNKTKPSAYHDRCIP-TDSKVQTNFAEPSKAYSN-ADYEKCDQVTQDTIWKQSVAKETTGAKQWSENWGFLTEFDPKGNPKEKEPLPETATRFSDNVPNTNSGNYGSRLNTDLGKRMQNLEFQFYAEGRKKKLDGDIIC 149          
BLAST of ATP-dependent DNA helicase vs. TrEMBL
Match: gnl|BL_ORD_ID|15797741 (tr|A0A1I8HRW5|A0A1I8HRW5_9PLAT Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig028872g2 PE=4 SV=1)

HSP 1 Score: 113.62 bits (283), Expect = 6.575e-28
Identity = 53/148 (35.81%), Postives = 92/148 (62.16%), Query Frame = 2
Query:  143 MERQTSGMLFSYYEKSLFHEKCAPHREMSKRSDLLPPGEVLSGMVALEKREPEVYNRLWKQAIDNENRSRKNWETNWGFLKDYDEKGNYNPSSPLPETASLYSSSVPNTTSGTYGSRLESPLGKQLLLMQCKFNENVGKRKLNDDMTC 586
            M+R+ +G+LFSY+ KS +HE+C P +  S ++      + L+    L K +    +++W+Q ++NE+R  K WE NWGF+ ++D+KGN      L E ++++S+S PNT +G YG R+ +  G++L+ MQ KF+    + K + D+ C
Sbjct:    1 MQREATGVLFSYFNKSQYHERCVPAQ--STQAAAAAAEKPLTS-AELRKMDAVGQDKVWRQYVENESRHNKQWEQNWGFMAEFDQKGNKKERKVLAEESTVFSTSFPNTDAGNYGHRVNTATGQRLMDMQRKFDAANKRSKPDKDIVC 145          
BLAST of ATP-dependent DNA helicase vs. TrEMBL
Match: gnl|BL_ORD_ID|15729129 (tr|R7T8J8|R7T8J8_CAPTE Uncharacterized protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_208392 PE=4 SV=1)

HSP 1 Score: 108.997 bits (271), Expect = 4.932e-26
Identity = 54/150 (36.00%), Postives = 88/150 (58.67%), Query Frame = 2
Query:  149 RQTSGMLFSYYEKSLFHEKCAPHREMSKR----SDLLPPGEVLSGMVALEKREPEVYNRLWKQAIDNENRSRKNWETNWGFLKDYDEKGNYNPSSPLPETASLYSSSVPNTTSGTYGSRLESPLGKQLLLMQCKFNENVGKRKLNDDMTC 586
            +QTSG++FSY +KS FH+ C P +E+ +R    +  +P G    G     K +    + +WKQ ++ E +  + W  NWGFL ++DEKG   P    PE  + +S  +PNT +G YGSRL +P+ + +  ++ +FN    +RKL+++M C
Sbjct:    2 QQTSGLMFSYMKKSEFHQNCIP-KEVKEREAAVAASIPTGGAKVGDATFAKLDVVTQDTIWKQCVNVEKKGAQEWAKNWGFLTEFDEKGEPRPPKEEPEKVTQFSDILPNTNAGNYGSRLTTPVAQNIQDLEHRFNSQNRRRKLDNEMVC 150          
BLAST of ATP-dependent DNA helicase vs. TrEMBL
Match: gnl|BL_ORD_ID|20620190 (tr|A0A0B6YWI9|A0A0B6YWI9_9EUPU Uncharacterized protein OS=Arion vulgaris OX=1028688 GN=ORF39515 PE=4 SV=1)

HSP 1 Score: 105.145 bits (261), Expect = 1.419e-24
Identity = 55/152 (36.18%), Postives = 84/152 (55.26%), Query Frame = 2
Query:  137 SVMERQTSGMLFSYYEKSLFHEKCAPHREMSKR--SDLLPPGEVLSGMVALEKREPEVYNRLWKQAIDNENRSRKNWETNWGFLKDYDEKGNYNPSSPLPETASLYSSSVPNTTSGTYGSRLESPLGKQLLLMQCKFNENVGKRKLNDDMTC 586
            S   ++TSG+LFSY  +S +HE C P   +     SD     ++        K +    + +W+QA+  E    KNWE +WGFL +YD KGN    + LP T++++S SVPNT SG YG R  +  G+ +L ++ KF     ++K++ DM C
Sbjct:    2 STGTQETSGLLFSYVSQSQYHESCIPKNVIQAHASSDHGKSQKINDN----SKSDAVSQDAVWRQALQKERLCLKNWEDSWGFLTNYDAKGNIKEKTELPATSNMFSDSVPNTISGNYGYRQATETGRSMLSLEKKFFAENRRQKMSSDMIC 149          
BLAST of ATP-dependent DNA helicase vs. Ensembl Cavefish
Match: si:dkey-18j18.3 (chromosome 25 C2orf50 homolog [Source:NCBI gene;Acc:103042477])

HSP 1 Score: 70.4774 bits (171), Expect = 9.041e-15
Identity = 32/82 (39.02%), Postives = 49/82 (59.76%), Query Frame = 2
Query:  284 EKREPEVYNRLWKQAIDNENRSRKNWETNWGFLKDYDEKGNYNPSSPLPETASLYSSSVPNTTSGTYGSRLESPLGKQLLLM 529
            + R P   +++W++ +  E    K WE NW FLKD+D+ G      PLP    LYS ++PNT++   GSR+ + LGK+L+ M
Sbjct:   53 DTRNPVKQDQVWREFVRAERTGVKEWEKNWSFLKDFDQLGRPRTEPPLPTYVPLYSDTLPNTSNQMLGSRMCTELGKELMRM 134          
BLAST of ATP-dependent DNA helicase vs. Ensembl Cavefish
Match: si:dkey-18j18.3 (chromosome 25 C2orf50 homolog [Source:NCBI gene;Acc:103042477])

HSP 1 Score: 70.0922 bits (170), Expect = 9.410e-15
Identity = 32/82 (39.02%), Postives = 49/82 (59.76%), Query Frame = 2
Query:  284 EKREPEVYNRLWKQAIDNENRSRKNWETNWGFLKDYDEKGNYNPSSPLPETASLYSSSVPNTTSGTYGSRLESPLGKQLLLM 529
            + R P   +++W++ +  E    K WE NW FLKD+D+ G      PLP    LYS ++PNT++   GSR+ + LGK+L+ M
Sbjct:   52 DTRNPVKQDQVWREFVRAERTGVKEWEKNWSFLKDFDQLGRPRTEPPLPTYVPLYSDTLPNTSNQMLGSRMCTELGKELMRM 133          
BLAST of ATP-dependent DNA helicase vs. Ensembl Nematostella
Match: EDO33226 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SSW7])

HSP 1 Score: 71.633 bits (174), Expect = 9.725e-16
Identity = 39/115 (33.91%), Postives = 58/115 (50.43%), Query Frame = 2
Query:  188 SLFHEKCAPHREMSKRSDLLPPGEVLSGMVALEKREPEVYNRLWKQAIDNENRSRKNWETNWGFLKDYDEKGNYNPSSPLPETASLYSSSVPNTTSGTYGSRLESPLGKQLLLMQ 532
            S++HEKC P + + +R    PP        A      E  + +WK    NE +  + WE NWGFLKD+D KG   P   LP   S++S   PNTT+   G R++S   + +  ++
Sbjct:   30 SMYHEKCTP-KSLKERVKSAPPRTFSEREYARCDVVKE--DEIWKNQCRNEGKMTRKWEENWGFLKDFDPKGRPKPKKELPAEVSVFSKQSPNTTNQHIGRRVKSAPARSMQRLE 141          
BLAST of ATP-dependent DNA helicase vs. Planmine SMEST
Match: SMESG000023939.1 (SMESG000023939.1)

HSP 1 Score: 308.145 bits (788), Expect = 5.961e-108
Identity = 148/149 (99.33%), Postives = 148/149 (99.33%), Query Frame = 2
Query:  143 MERQTSGMLFSYYEKSLFHEKCAPHREMSKRSDLLPPGEVLSGMVALEKREPEVYNRLWKQAIDNENRSRKNWETNWGFLKDYDEKGNYNPSSPLPETASLYSSSVPNTTSGTYGSRLESPLGKQLLLMQCKFNENVGKRKLNDDMTCC 589
            MERQTSGMLFSYYEKSLFHEKCAPHREMSKRSDLLPPGEVLSGMVALEKREPEVYNRLWKQAIDNENRSRKNWETNWGFLKDYDEKGNYNPSSPLPETASLYSSSVPNTTSGTYGSRLESPLGKQLLLMQCKFNENVGKRKLND MTCC
Sbjct:    1 MERQTSGMLFSYYEKSLFHEKCAPHREMSKRSDLLPPGEVLSGMVALEKREPEVYNRLWKQAIDNENRSRKNWETNWGFLKDYDEKGNYNPSSPLPETASLYSSSVPNTTSGTYGSRLESPLGKQLLLMQCKFNENVGKRKLNDGMTCC 149          
The following BLAST results are available for this feature:
BLAST of ATP-dependent DNA helicase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 2
Match NameE-valueIdentityDescription
C2orf506.097e-2041.76chromosome 2 open reading frame 50 [Source:HGNC Sy... [more]
C2orf506.097e-2041.76chromosome 2 open reading frame 50 [Source:HGNC Sy... [more]
back to top
BLAST of ATP-dependent DNA helicase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of ATP-dependent DNA helicase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of ATP-dependent DNA helicase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
si:dkey-18j18.32.713e-1433.65si:dkey-18j18.3 [Source:ZFIN;Acc:ZDB-GENE-090313-2... [more]
si:dkey-18j18.32.713e-1433.65si:dkey-18j18.3 [Source:ZFIN;Acc:ZDB-GENE-090313-2... [more]
si:dkey-18j18.32.713e-1433.65si:dkey-18j18.3 [Source:ZFIN;Acc:ZDB-GENE-090313-2... [more]
si:dkey-18j18.32.713e-1433.65si:dkey-18j18.3 [Source:ZFIN;Acc:ZDB-GENE-090313-2... [more]
back to top
BLAST of ATP-dependent DNA helicase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
C2orf502.068e-1534.78chromosome 2 open reading frame 50 [Source:NCBI ge... [more]
back to top
BLAST of ATP-dependent DNA helicase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
2410004P03Rik5.598e-1839.56RIKEN cDNA 2410004P03 gene [Source:MGI Symbol;Acc:... [more]
2410004P03Rik1.278e-1038.10RIKEN cDNA 2410004P03 gene [Source:MGI Symbol;Acc:... [more]
back to top
BLAST of ATP-dependent DNA helicase vs. UniProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 2
Match NameE-valueIdentityDescription
sp|Q96LR7|CB050_HUMAN2.928e-1941.76Uncharacterized protein C2orf50 OS=Homo sapiens OX... [more]
sp|Q1JPL0|CB050_BOVIN1.503e-1739.56Uncharacterized protein C2orf50 homolog OS=Bos tau... [more]
back to top
BLAST of ATP-dependent DNA helicase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
gnl|BL_ORD_ID|157769635.598e-2835.81tr|A0A1I8HVT8|A0A1I8HVT8_9PLAT Uncharacterized pro... [more]
gnl|BL_ORD_ID|203495796.271e-2839.07tr|A0A1S3HQB0|A0A1S3HQB0_LINUN uncharacterized pro... [more]
gnl|BL_ORD_ID|157977416.575e-2835.81tr|A0A1I8HRW5|A0A1I8HRW5_9PLAT Uncharacterized pro... [more]
gnl|BL_ORD_ID|157291294.932e-2636.00tr|R7T8J8|R7T8J8_CAPTE Uncharacterized protein OS=... [more]
gnl|BL_ORD_ID|206201901.419e-2436.18tr|A0A0B6YWI9|A0A0B6YWI9_9EUPU Uncharacterized pro... [more]
back to top
BLAST of ATP-dependent DNA helicase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
si:dkey-18j18.39.041e-1539.02chromosome 25 C2orf50 homolog [Source:NCBI gene;Ac... [more]
si:dkey-18j18.39.410e-1539.02chromosome 25 C2orf50 homolog [Source:NCBI gene;Ac... [more]
back to top
BLAST of ATP-dependent DNA helicase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of ATP-dependent DNA helicase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of ATP-dependent DNA helicase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO332269.725e-1633.91Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of ATP-dependent DNA helicase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of ATP-dependent DNA helicase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000023939.15.961e-10899.33SMESG000023939.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30008926 ID=SMED30008926|Name=ATP-dependent DNA helicase|organism=Schmidtea mediterranea sexual|type=transcript|length=744bp
TTTACAGAATTTCAGAAGCTAATAATTTGCTACTATAATTTTCATTGGTT
TGTCATATTTGCTCTGAAAATAACGGTATGCCGTTTCATTTACATAATTT
TGGATTTTATTTTCAGAAGTTTATTGACTGATATATTCTGTAATGGAGAG
ACAAACCAGTGGAATGCTCTTCAGTTATTATGAAAAAAGTCTATTTCATG
AGAAATGTGCACCTCATAGAGAAATGTCAAAAAGAAGTGATCTCCTTCCA
CCGGGCGAAGTTCTATCTGGAATGGTAGCATTAGAGAAAAGGGAACCAGA
AGTCTACAACAGACTTTGGAAACAGGCTATTGATAATGAAAATAGATCAA
GAAAAAATTGGGAAACCAACTGGGGATTTCTGAAAGACTATGATGAAAAA
GGAAATTATAATCCCTCTTCACCTTTACCAGAAACTGCATCATTATATTC
ATCTTCCGTCCCAAACACAACAAGTGGGACATACGGATCAAGACTCGAGT
CTCCTCTGGGAAAGCAATTACTGCTTATGCAATGTAAATTTAATGAAAAT
GTCGGCAAACGTAAACTAAATGATGACATGACGTGCTGCTGACAACAGAA
TTATAAAATATGTCAAATTCATTTGATTGTTTGTTCAATATATGAGCAAT
GATGAAATAAAGATTGGTATTTATGTTGTAACTACGGTAAAATATTCATT
AAATTTACTGAGTTTGTTTATGTAAGCTATTATATATATATTAT
back to top

protein sequence of SMED30008926-orf-1

>SMED30008926-orf-1 ID=SMED30008926-orf-1|Name=SMED30008926-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=150bp
MERQTSGMLFSYYEKSLFHEKCAPHREMSKRSDLLPPGEVLSGMVALEKR
EPEVYNRLWKQAIDNENRSRKNWETNWGFLKDYDEKGNYNPSSPLPETAS
LYSSSVPNTTSGTYGSRLESPLGKQLLLMQCKFNENVGKRKLNDDMTCC*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0000166nucleotide binding
GO:0003678DNA helicase activity
GO:0004386helicase activity
GO:0005524ATP binding
GO:0016787hydrolase activity
Vocabulary: biological process
TermDefinition
GO:0000723telomere maintenance
GO:0006281DNA repair
GO:0006310DNA recombination
GO:0006974cellular response to DNA damage stimulus
GO:0032508DNA duplex unwinding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000032dorsal midline
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
PLANA:0000096ventral epidermis
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000420parapharyngeal region
Vocabulary: INTERPRO
TermDefinition
IPR020339Uncharacterised_C20orf85
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePANTHERPTHR31909:SF2RIKEN CDNA 2410004P03 GENEcoord: 56..149
NoneNo IPR availablePANTHERPTHR31909FAMILY NOT NAMEDcoord: 56..149
NoneNo IPR availablePRODOMPD297655coord: 56..121
e-value: 0.004
score: 91.0