inositol phosphoceramide mannosyltransferase 2-like

Overview
Nameinositol phosphoceramide mannosyltransferase 2-like
Smed IDSMED30008902
Length (bp)1059
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of inositol phosphoceramide mannosyltransferase 2-like (SMED30008902) t-SNE clustered cells

Violin plots show distribution of expression levels for inositol phosphoceramide mannosyltransferase 2-like (SMED30008902) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of inositol phosphoceramide mannosyltransferase 2-like (SMED30008902) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for inositol phosphoceramide mannosyltransferase 2-like (SMED30008902) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30008902

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30008902SMESG000059799.1 SmedASXL_071927SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30008902SMESG000059812.1 SMESG000045480.1 SMESG000045292.1 SMESG000045267.1 SMESG000037990.1 dd_Smed_v4_2174_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
gutSMED30008902SMESG000059812.1 SMESG000045480.1 SMESG000045292.1 SMESG000045267.1 SMESG000037990.1 dd_Smed_v4_2174_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30008902SMESG000059812.1 SMESG000045480.1 SMESG000045292.1 SMESG000045267.1 SMESG000037990.1 dd_Smed_v4_2174_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30008902SMESG000059799.1 dd_Smed_v6_14075_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30008902SMESG000059812.1 SMESG000045480.1 SMESG000045292.1 SMESG000045267.1 SMESG000037990.1 OX_Smed_1.0.16424ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Category 4 cellSMED30008902SMESG000059812.1 SMESG000045480.1 SMESG000045292.1 SMESG000045267.1 SMESG000037990.1 dd_Smed_v4_2174_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30008902SMESG000059812.1 SMESG000045480.1 SMESG000045292.1 SMESG000045267.1 SMESG000037990.1 dd_Smed_v4_2174_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of inositol phosphoceramide mannosyltransferase 2-like vs. UniProt/SwissProt
Match: sp|P33300|SUR1_YEAST (Mannosyl phosphorylinositol ceramide synthase SUR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUR1 PE=1 SV=1)

HSP 1 Score: 95.5153 bits (236), Expect = 9.379e-21
Identity = 77/247 (31.17%), Postives = 114/247 (46.15%), Query Frame = 1
Query:  178 FTICLVIAIIFLLFN------SYNVKYVI---NFEPPEFIYEQNVTKIIHFYWKNKEIPDLFLDFMKTWQE------DCFKDWKFMFWTDKDNYNLIKTFYPWFLKTYNEFPWNIFRADVSRYFYLFHYGGIYTDLDNECLRPFEHLLQNYSLVFGAMKGQYLGTNLKEGYVQNSFMYSRPRQTFWMELLNDILMSKG-----TGSVEVQTGPVLLSKRIALYRE-RLNSSDDMMIYSPNYFNPFSW 855
            F I L+++II+  F+         VK  I   +  P      Q + KIIH  +K ++IP+        W+E      D   D+K++ WTD+  Y  IK  YPWFL T+  + + I RAD  RYF L HYGG+Y DLD+ C R  + LL   + +    K   LG       V N  M S PR  F+++ L  +            ++   TGP+ LS     Y+  R+  +  + I  P Y+   S+
Sbjct:   11 FNILLLLSIIYYTFDLLTLCIDDTVKDAILEEDLNPDAPPKPQLIPKIIHQTYKTEDIPE-------HWKEGRQKCLDLHPDYKYILWTDEMAYEFIKEEYPWFLDTFENYKYPIERADAIRYFILSHYGGVYIDLDDGCERKLDPLLAFPAFL---RKTSPLG-------VSNDVMGSVPRHPFFLKALKSLKHYDKYWFIPYMTIMGSTGPLFLSVIWKQYKRWRIPKNGTVRILQPAYYKMHSY 240          
BLAST of inositol phosphoceramide mannosyltransferase 2-like vs. UniProt/SwissProt
Match: sp|Q10323|IMT3_SCHPO (Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1)

HSP 1 Score: 90.8929 bits (224), Expect = 3.195e-19
Identity = 46/99 (46.46%), Postives = 61/99 (61.62%), Query Frame = 1
Query:  283 VTKIIHFYWKNKEIPDLFLDFMKTWQEDCFKDWKFMFWTDKDNYNLIKTFYPWFLKTYNEFPWNIFRADVSRYFYLFHYGGIYTDLDNECLRPFEHLLQ 579
            + KIIH  WK  EIP+ ++   K+   D   D++++ WTD+     I T YPWFL  Y+ +P+NI RADV RYF L+ YGGIY DLD  C R  + LL 
Sbjct:   57 IPKIIHQTWKTNEIPEKWVGAQKS-CIDLHPDYEYVLWTDESMREFIATDYPWFLTQYDSYPYNIERADVVRYFILYKYGGIYLDLDVGCNRTLDPLLH 154          
BLAST of inositol phosphoceramide mannosyltransferase 2-like vs. UniProt/SwissProt
Match: sp|P38287|CSH1_YEAST (Mannosyl phosphorylinositol ceramide synthase CSH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CSH1 PE=1 SV=1)

HSP 1 Score: 88.5817 bits (218), Expect = 2.556e-18
Identity = 62/197 (31.47%), Postives = 97/197 (49.24%), Query Frame = 1
Query:  253 EPPEFIYEQNVTKIIHFYWKNKEIPDLFLDFMKTWQE--DCFKDWKFMFWTDKDNYNLIKTFYPWFLKTYNEFPWNIFRADVSRYFYLFHYGGIYTDLDNECLRPFEHLLQNYSLVFGAMKGQYLGTNLKEGYVQNSFMYSRPRQTFWMELLNDILMSKGT-----GSVEVQTGPVLLSKRIALYRERLNSSDDMMI 822
             PP+ I      KIIH  +K  +IP+    ++K  Q+  D   D+ ++ WTD+ +   IK  YPWFL T+  + + I RAD  RYF L HYGGIY DLD+ C R  + LL+            +L      G V N  M S PR  F+++++  +   K        ++   TGP+ +S     Y+   N++++  +
Sbjct:   57 SPPQLI-----PKIIHQTYKTNDIPE---QWVKGRQKCIDLHPDYTYILWTDEMSDTFIKQEYPWFLDTFRSYEYPIERADAIRYFILSHYGGIYIDLDDGCERRLDPLLK---------VPAFLRKTSPTG-VSNDVMGSVPRHPFFLKVIKSLKHYKKNWYIPYMTIMGSTGPLFISVVWKQYKRWSNTAENGAV 235          
BLAST of inositol phosphoceramide mannosyltransferase 2-like vs. UniProt/SwissProt
Match: sp|Q9UT67|IMT2_SCHPO (Inositol phosphoceramide mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC4F11.04c PE=3 SV=1)

HSP 1 Score: 88.1965 bits (217), Expect = 2.586e-18
Identity = 44/104 (42.31%), Postives = 64/104 (61.54%), Query Frame = 1
Query:  274 EQNVTKIIHFYWKNKEIPDLFLDFMKTWQEDCF---KDWKFMFWTDKDNYNLIKTFYPWFLKTYNEFPWNIFRADVSRYFYLFHYGGIYTDLDNECLRPFEHLL 576
            E  + KIIH  WK  E+P+ +    K  Q+ C     D++++ WTD+ + N I   YPWFL  ++ +P+N+ RADV RYF L+HYGG Y DLD+ C +  + LL
Sbjct:   79 EPVIPKIIHQTWKTTEVPEGW----KGAQQSCIDLHPDYEYILWTDEMSRNFIADNYPWFLPYFDAYPFNVQRADVIRYFVLYHYGGNYIDLDDGCRQRLDSLL 178          
BLAST of inositol phosphoceramide mannosyltransferase 2-like vs. UniProt/SwissProt
Match: sp|O14084|IMT1_SCHPO (Inositol phosphoceramide mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=imt1 PE=3 SV=2)

HSP 1 Score: 82.0333 bits (201), Expect = 3.146e-16
Identity = 49/179 (27.37%), Postives = 91/179 (50.84%), Query Frame = 1
Query:  277 QNVTKIIHFYWKNKEIPDLFLDFMKTW--QEDCFKDWKFMFWTDKDNYNLIKTFYPWFLKTYNEFPWNIFRADVSRYFYLFHYGGIYTDLDNECLRPFEHLLQNYSLVFGAMKGQYLGTNLKEGYVQNSFMYSRPRQTFWMELLNDILMSK-------GTGSVEVQTGPVLLSKRIALY 786
            + + ++IH  WK++ IP+ + + + +   Q      W+F+ WTD+   + +   Y WF+  ++ +P+NI + D +RYF L+HYGG+Y DLD  C +P + LL   + +        L +    GY  N +  + P+  F  + +++  +SK          +V +  GP+ LS +   Y
Sbjct:   62 EKIPRVIHQLWKDENIPERWSNTVNSCRRQHPDENGWQFILWTDEKIMSFMNENYSWFMPVFHSYPYNIQKFDAARYFILYHYGGVYMDLDIGCKKPMDPLLSKATFI--------LPSTEPIGY-SNDWFAATPKHPFLYQAIHN--LSKFNHRYFTKYPTVFLSAGPLFLSYQFCKY 229          
BLAST of inositol phosphoceramide mannosyltransferase 2-like vs. TrEMBL
Match: A0A267DNA2 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig018427g2 PE=4 SV=1)

HSP 1 Score: 188.348 bits (477), Expect = 8.961e-54
Identity = 103/278 (37.05%), Postives = 144/278 (51.80%), Query Frame = 1
Query:  175 LFTICLVIAIIF----LLFNSYNVKYVINFEPPEFIYEQNVTKIIHFYWKNKEIPDLFLDFMKTWQEDCFKDWKFMFWTDKDNYNLIKTFYPWFLKTYNEFPWNIFRADVSRYFYLFHYGGIYTDLDNECLRPFEHLLQNYSLVFGAMKGQYLGTNLKEGYVQNSFMYSRPRQTFWMELLNDI---LMSKGTGSVEVQTGPVLLSKRIALYRERLNSSDDMMIYSPNYFNPFSWIDNSKVDPNCKSHNKMTLENLNKCRSSMISKGSYVVQYHAHSWG 987
            L  ICLV   +     LLF+   +      +      E  +  IIH  WK + +P       ++    C  + +   WTD DN +L+K  Y W L  Y++    + RAD+ RY YL H+GGIY DLD  CL+ F  LL    L FG M GQ++ +++   YVQNSFM SRP+  FW+ LL+ I   L S+  G  E  TGP+++   +  Y    +   D+ I+ P YFNPFSWI N +  P+CK+H  M+      C  S    G+YVVQ H+ SW 
Sbjct:   15 LAAICLVAIAMARYRNLLFSCSTLSTAEESDAESPSGEAGIPCIIHQSWKTRTLPSPRATRWRSTWLKCLPNCRHYLWTDADNRDLVKRHYSWLLNFYDKLKSGVQRADLVRYLYLLHFGGIYADLDTVCLKDFRPLLNGLGLAFGGMDGQWI-SSVNGSYVQNSFMASRPKHPFWIGLLHRIVRRLDSRKQGGAEESTGPLIMMAELKQYLA--DGHTDVRIFPPIYFNPFSWITNRR--PDCKTHGAMSDSEEATCIKSF--AGAYVVQMHSKSWA 285          
BLAST of inositol phosphoceramide mannosyltransferase 2-like vs. TrEMBL
Match: A0A267H9I3 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig018427g1 PE=4 SV=1)

HSP 1 Score: 187.578 bits (475), Expect = 1.582e-53
Identity = 103/278 (37.05%), Postives = 143/278 (51.44%), Query Frame = 1
Query:  175 LFTICLVIAIIF----LLFNSYNVKYVINFEPPEFIYEQNVTKIIHFYWKNKEIPDLFLDFMKTWQEDCFKDWKFMFWTDKDNYNLIKTFYPWFLKTYNEFPWNIFRADVSRYFYLFHYGGIYTDLDNECLRPFEHLLQNYSLVFGAMKGQYLGTNLKEGYVQNSFMYSRPRQTFWMELLNDI---LMSKGTGSVEVQTGPVLLSKRIALYRERLNSSDDMMIYSPNYFNPFSWIDNSKVDPNCKSHNKMTLENLNKCRSSMISKGSYVVQYHAHSWG 987
            L  ICLV   +     LLF+   +             E  +  IIH  WK + +P       ++    C  + +   WTD DN +L+K  Y W L  Y++    + RAD+ RY YL H+GGIY DLD  CL+ F  LL    L FG M GQ++ +++   YVQNSFM SRP+  FW+ LL+ I   L S+  G  E  TGP+++   +  Y    +   D+ I+ P YFNPFSWI N +  P+CK+H  M+      C  S    G+YVVQ H+ SW 
Sbjct:   15 LAAICLVAIAMARYRNLLFSCSTLSTAEESGAESPSGEAGIPCIIHQSWKTRTLPSPRATRWRSTWLKCLPNCRHYLWTDADNRDLVKRHYSWLLNFYDKLKSGVQRADLVRYLYLLHFGGIYADLDTVCLKDFRPLLNGLGLAFGGMDGQWI-SSVNGSYVQNSFMASRPKHPFWIGLLHRIVRRLDSRKQGGAEESTGPLIMMAELKQYLA--DGHTDVRIFPPIYFNPFSWITNRR--PDCKTHGAMSDSEEATCVKSF--AGAYVVQMHSKSWA 285          
BLAST of inositol phosphoceramide mannosyltransferase 2-like vs. TrEMBL
Match: A0A1I8H5Y8 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 187.963 bits (476), Expect = 2.226e-53
Identity = 99/255 (38.82%), Postives = 152/255 (59.61%), Query Frame = 1
Query:  271 YEQNVTKIIHFYWKNKEIPDLFLDFMKTWQEDCFKDWKFMFWTDKDNYNLIKTFYPWFLKTYNEFPWNIFRADVSRYFYLFHYGGIYTDLDNECLRPFEHLLQNYSLVFGAMKGQYLGTN-----LKEGYVQNSFMYSRPRQTFWMELLNDILMSKGTGSVEV-QTGPVLLSKRIALYRE--------RLNSSDDMMIYSPNYFNPFSW-IDNSKVDPNCKSHNKMT-LENLNKCRSSMISKGSYVVQYHAHSWG 987
            +   + +I+H  W ++++P+ F ++ +++   CF D++   WTDKDN  LI   YPWFL+ Y+     + RADVSR FY++HYGG+Y DLD ECLR F HLL N SLVFGAM+G  + +      + EG ++NSFMYSRPR  F+ +L+  + ++  TG + +  +GP L+   I   R+        R++  D + +Y P YFNP+SW + NS+   +C+ + +      L +CR S   + SYV+QYH   W 
Sbjct:   58 FSGPLVRIVHQSWASRKLPEQFAEWSRSFSA-CFPDFRRRLWTDKDNRQLIARHYPWFLRRYDSLARGVQRADVSRLFYMYHYGGLYCDLDCECLRDFRHLLANASLVFGAMQGLMIRSPRDPAYVAEGQIENSFMYSRPRHPFFWDLI--VYLNATTGEMPIMSSGPYLIMSGIHAARQLGIAPSGIRVDGRDFLTVYPPAYFNPYSWMLLNSR---HCRLYGRFENRAQLRQCRDSF--QDSYVMQYHTQVWA 304          
BLAST of inositol phosphoceramide mannosyltransferase 2-like vs. TrEMBL
Match: A0A267F5L2 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig014144g3 PE=4 SV=1)

HSP 1 Score: 187.963 bits (476), Expect = 2.671e-53
Identity = 99/255 (38.82%), Postives = 152/255 (59.61%), Query Frame = 1
Query:  271 YEQNVTKIIHFYWKNKEIPDLFLDFMKTWQEDCFKDWKFMFWTDKDNYNLIKTFYPWFLKTYNEFPWNIFRADVSRYFYLFHYGGIYTDLDNECLRPFEHLLQNYSLVFGAMKGQYLGTN-----LKEGYVQNSFMYSRPRQTFWMELLNDILMSKGTGSVEV-QTGPVLLSKRIALYRE--------RLNSSDDMMIYSPNYFNPFSW-IDNSKVDPNCKSHNKMT-LENLNKCRSSMISKGSYVVQYHAHSWG 987
            +   + +I+H  W ++++P+ F ++ +++   CF D++   WTDKDN  LI   YPWFL+ Y+     + RADVSR FY++HYGG+Y DLD ECLR F HLL N SLVFGAM+G  + +      + EG ++NSFMYSRPR  F+ +L+  + ++  TG + +  +GP L+   I   R+        R++  D + +Y P YFNP+SW + NS+   +C+ + +      L +CR S   + SYV+QYH   W 
Sbjct:   58 FSGPLVRIVHQSWASRKLPEQFAEWSRSFSA-CFPDFRRRLWTDKDNRQLIARHYPWFLRRYDSLAPGVQRADVSRLFYMYHYGGLYCDLDCECLRDFRHLLANASLVFGAMQGLMIRSPRDPAYVAEGQIENSFMYSRPRHPFFWDLI--VYLNATTGEMPIMSSGPYLIMSGIHAARQLGIAPSGIRVDGRDFLTVYPPAYFNPYSWMLLNSR---HCRLYGRFENRAQLRQCRDSF--QDSYVMQYHTQVWA 304          
BLAST of inositol phosphoceramide mannosyltransferase 2-like vs. TrEMBL
Match: A0A267DTA4 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig010228g2 PE=4 SV=1)

HSP 1 Score: 187.193 bits (474), Expect = 3.796e-53
Identity = 106/241 (43.98%), Postives = 143/241 (59.34%), Query Frame = 1
Query:  280 NVTKIIHFYWKNKEIPDLFLDFMKTWQEDCFKDWKFMFWTDKDNYNLIKTFYPWFLKTYNEFPWNIFRADVSRYFYLFHYGGIYTDLDNECLRPFEHLLQNYSLVFGAMKGQYLGTNLKEGYVQNSFMYS-RPRQTFWMELLNDI---LMSKGTGSVEVQTGPVLLSKRIALYRERLNSSDDMMIYSPNYFNPFSW-IDNSKVDPNCKSHNKMTLENLNKCRSSMISKGSYVVQYHAHSWG 987
            N+ KI+H  WK +++P   + +  +W+  CF DW++  WTD+DN  L++  Y WFL  YN   +NI RAD++RYFYL+H+GGIYTDLD  C++ FEHLL   +LVFGAM      + L    VQNSFM S RP   FWM LL  I     +   G  E  TGP +L + + LY  R N+S D+ +Y   YFNPFSW + NSK+   CK   +M+      C +S     ++VVQ H  SWG
Sbjct:   69 NIIKILHQSWKTRQLPARAVRWSASWKS-CFPDWEWRLWTDQDNLALVRDHYAWFLPVYNGQRYNIERADLARYFYLYHFGGIYTDLDTVCMKNFEHLLHLETLVFGAMDTHPGDSVLPGQLVQNSFMASLRPGHPFWMRLLRRIERNFNAGKRGRPEDNTGPTVLMEELRLY-VRSNAS-DVKVYPGKYFNPFSWTLRNSKI---CKDFGQMSDSVEKICINSFPK--AFVVQLHTQSWG 301          
BLAST of inositol phosphoceramide mannosyltransferase 2-like vs. Ensembl Yeast
Match: SUR1 (Mannosylinositol phosphorylceramide (MIPC) synthase catalytic subunit; forms a complex with regulatory subunit Csg2p; function in sphingolipid biosynthesis is overlapping with that of Csh1p; SUR1 has a paralog, CSH1, that arose from the whole genome duplication [Source:SGD;Acc:S000005978])

HSP 1 Score: 95.5153 bits (236), Expect = 1.351e-22
Identity = 77/247 (31.17%), Postives = 114/247 (46.15%), Query Frame = 1
Query:  178 FTICLVIAIIFLLFN------SYNVKYVI---NFEPPEFIYEQNVTKIIHFYWKNKEIPDLFLDFMKTWQE------DCFKDWKFMFWTDKDNYNLIKTFYPWFLKTYNEFPWNIFRADVSRYFYLFHYGGIYTDLDNECLRPFEHLLQNYSLVFGAMKGQYLGTNLKEGYVQNSFMYSRPRQTFWMELLNDILMSKG-----TGSVEVQTGPVLLSKRIALYRE-RLNSSDDMMIYSPNYFNPFSW 855
            F I L+++II+  F+         VK  I   +  P      Q + KIIH  +K ++IP+        W+E      D   D+K++ WTD+  Y  IK  YPWFL T+  + + I RAD  RYF L HYGG+Y DLD+ C R  + LL   + +    K   LG       V N  M S PR  F+++ L  +            ++   TGP+ LS     Y+  R+  +  + I  P Y+   S+
Sbjct:   11 FNILLLLSIIYYTFDLLTLCIDDTVKDAILEEDLNPDAPPKPQLIPKIIHQTYKTEDIPE-------HWKEGRQKCLDLHPDYKYILWTDEMAYEFIKEEYPWFLDTFENYKYPIERADAIRYFILSHYGGVYIDLDDGCERKLDPLLAFPAFL---RKTSPLG-------VSNDVMGSVPRHPFFLKALKSLKHYDKYWFIPYMTIMGSTGPLFLSVIWKQYKRWRIPKNGTVRILQPAYYKMHSY 240          
BLAST of inositol phosphoceramide mannosyltransferase 2-like vs. Ensembl Yeast
Match: CSH1 (Mannosylinositol phosphorylceramide (MIPC) synthase catalytic subunit; forms a complex with regulatory subunit Csg2p; function in sphingolipid biosynthesis is overlapping with that of Sur1p; CSH1 has a paralog, SUR1, that arose from the whole genome duplication [Source:SGD;Acc:S000000365])

HSP 1 Score: 88.5817 bits (218), Expect = 3.682e-20
Identity = 62/197 (31.47%), Postives = 97/197 (49.24%), Query Frame = 1
Query:  253 EPPEFIYEQNVTKIIHFYWKNKEIPDLFLDFMKTWQE--DCFKDWKFMFWTDKDNYNLIKTFYPWFLKTYNEFPWNIFRADVSRYFYLFHYGGIYTDLDNECLRPFEHLLQNYSLVFGAMKGQYLGTNLKEGYVQNSFMYSRPRQTFWMELLNDILMSKGT-----GSVEVQTGPVLLSKRIALYRERLNSSDDMMI 822
             PP+ I      KIIH  +K  +IP+    ++K  Q+  D   D+ ++ WTD+ +   IK  YPWFL T+  + + I RAD  RYF L HYGGIY DLD+ C R  + LL+            +L      G V N  M S PR  F+++++  +   K        ++   TGP+ +S     Y+   N++++  +
Sbjct:   57 SPPQLI-----PKIIHQTYKTNDIPE---QWVKGRQKCIDLHPDYTYILWTDEMSDTFIKQEYPWFLDTFRSYEYPIERADAIRYFILSHYGGIYIDLDDGCERRLDPLLK---------VPAFLRKTSPTG-VSNDVMGSVPRHPFFLKVIKSLKHYKKNWYIPYMTIMGSTGPLFISVVWKQYKRWSNTAENGAV 235          
BLAST of inositol phosphoceramide mannosyltransferase 2-like vs. Ensembl Yeast
Match: OCH1 (Mannosyltransferase of the cis-Golgi apparatus; initiates the polymannose outer chain elongation of N-linked oligosaccharides of glycoproteins [Source:SGD;Acc:S000003006])

HSP 1 Score: 54.6842 bits (130), Expect = 1.035e-8
Identity = 27/88 (30.68%), Postives = 43/88 (48.86%), Query Frame = 1
Query:  313 NKEIPDLFLDFMKTWQEDCFKDWKFMFWTDKDNYNLIKTFY---PWFLKTYNEFPWNIFRADVSRYFYLFHYGGIYTDLDNECLRPFE 567
            +K  P  F  + KTW      D+++   +D      ++  Y   P  ++ +   P NI +AD  RY  LF  GGIY+D+D   L+P +
Sbjct:  110 DKNFPSSFRTYQKTWSGSYSPDYQYSLISDDSIIPFLENLYAPVPIVIQAFKLMPGNILKADFLRYLLLFARGGIYSDMDTMLLKPID 197          
BLAST of inositol phosphoceramide mannosyltransferase 2-like vs. Planmine SMEST
Match: SMESG000045292.1 (SMESG000045292.1)

HSP 1 Score: 467.233 bits (1201), Expect = 6.731e-167
Identity = 219/238 (92.02%), Postives = 228/238 (95.80%), Query Frame = 1
Query:  274 EQNVTKIIHFYWKNKEIPDLFLDFMKTWQEDCFKDWKFMFWTDKDNYNLIKTFYPWFLKTYNEFPWNIFRADVSRYFYLFHYGGIYTDLDNECLRPFEHLLQNYSLVFGAMKGQYLGTNLKEGYVQNSFMYSRPRQTFWMELLNDILMSKGTGSVEVQTGPVLLSKRIALYRERLNSSDDMMIYSPNYFNPFSWIDNSKVDPNCKSHNKMTLENLNKCRSSMISKGSYVVQYHAHSWG 987
            ++ VTKIIH  WK  +IP +F  ++K+W + C+KDWKFMFWTDKDNYNLIKTFYPWFLKTYNEFPWNIFRADVSRYFYLFHYGGIYTDLDNECLRPFEHLLQNYSLVFGAMKGQYLGTNLKEGYVQNSFMYSRPRQTFWMELLNDILMSKGTGSVEVQTGPVLLSKRIALYRERLNSSDDMMIYSPNYFNPFSWIDNSKVDPNCKSHNKMTLENLNKCRSSMISKGSYVVQYHAHSWG
Sbjct:   47 KEKVTKIIHVSWKTNDIPVVFQKYLKSWTDFCYKDWKFMFWTDKDNYNLIKTFYPWFLKTYNEFPWNIFRADVSRYFYLFHYGGIYTDLDNECLRPFEHLLQNYSLVFGAMKGQYLGTNLKEGYVQNSFMYSRPRQTFWMELLNDILMSKGTGSVEVQTGPVLLSKRIALYRERLNSSDDMMIYSPNYFNPFSWIDNSKVDPNCKSHNKMTLENLNKCRSSMISKGSYVVQYHAHSWG 284          
BLAST of inositol phosphoceramide mannosyltransferase 2-like vs. Planmine SMEST
Match: SMESG000045480.1 (SMESG000045480.1)

HSP 1 Score: 446.047 bits (1146), Expect = 1.235e-158
Identity = 210/238 (88.24%), Postives = 223/238 (93.70%), Query Frame = 1
Query:  274 EQNVTKIIHFYWKNKEIPDLFLDFMKTWQEDCFKDWKFMFWTDKDNYNLIKTFYPWFLKTYNEFPWNIFRADVSRYFYLFHYGGIYTDLDNECLRPFEHLLQNYSLVFGAMKGQYLGTNLKEGYVQNSFMYSRPRQTFWMELLNDILMSKGTGSVEVQTGPVLLSKRIALYRERLNSSDDMMIYSPNYFNPFSWIDNSKVDPNCKSHNKMTLENLNKCRSSMISKGSYVVQYHAHSWG 987
            ++ VTKIIH  WK  +IP +F  ++K+W + C+KDWKFMFWTDKDNYNLIKTFYPWFLKTYNEFP NI+RADVSRYFYLFHYGGIYTDLDNECLRPFEHLLQNYS+VFGAMKGQYLGTNLKEGYVQNSFMYSRPRQTFWMELLNDILM KGT SVEVQTGPVLLSKRIALYRERLNSSDDMMIYSPNYFNPFSWIDNSKVDPNCKS N+MT ENLNKCRSSM+SKGSYVVQYHAHSWG
Sbjct:   47 KEKVTKIIHVSWKTNDIPVVFQKYLKSWTDFCYKDWKFMFWTDKDNYNLIKTFYPWFLKTYNEFPRNIYRADVSRYFYLFHYGGIYTDLDNECLRPFEHLLQNYSIVFGAMKGQYLGTNLKEGYVQNSFMYSRPRQTFWMELLNDILMFKGTDSVEVQTGPVLLSKRIALYRERLNSSDDMMIYSPNYFNPFSWIDNSKVDPNCKSPNQMTRENLNKCRSSMLSKGSYVVQYHAHSWG 284          
BLAST of inositol phosphoceramide mannosyltransferase 2-like vs. Planmine SMEST
Match: SMESG000045267.1 (SMESG000045267.1)

HSP 1 Score: 443.351 bits (1139), Expect = 1.805e-157
Identity = 209/238 (87.82%), Postives = 222/238 (93.28%), Query Frame = 1
Query:  274 EQNVTKIIHFYWKNKEIPDLFLDFMKTWQEDCFKDWKFMFWTDKDNYNLIKTFYPWFLKTYNEFPWNIFRADVSRYFYLFHYGGIYTDLDNECLRPFEHLLQNYSLVFGAMKGQYLGTNLKEGYVQNSFMYSRPRQTFWMELLNDILMSKGTGSVEVQTGPVLLSKRIALYRERLNSSDDMMIYSPNYFNPFSWIDNSKVDPNCKSHNKMTLENLNKCRSSMISKGSYVVQYHAHSWG 987
            ++ VTKIIH  WK  +IP +F  ++K+W + C+KDW FMFWTDKDNYNLIKTFYPWFLKTYN+FP NI+RADVSRYFYLFHYGGIYTDLDNECLRPFEHLLQNYS+VFGAMKGQYLGTNLKEGYVQNSFMYSRPRQTFWMELLNDILM KGT SVEVQTGPVLLSKRIALYRERLNSSDDMMIYSPNYFNPFSWIDNSKVD NCKSHN+MT ENLNKCRSSMISKGSYVVQYHAHSWG
Sbjct:   47 KEKVTKIIHVSWKTNDIPVVFQKYLKSWTDFCYKDWNFMFWTDKDNYNLIKTFYPWFLKTYNKFPRNIYRADVSRYFYLFHYGGIYTDLDNECLRPFEHLLQNYSIVFGAMKGQYLGTNLKEGYVQNSFMYSRPRQTFWMELLNDILMFKGTDSVEVQTGPVLLSKRIALYRERLNSSDDMMIYSPNYFNPFSWIDNSKVDLNCKSHNQMTRENLNKCRSSMISKGSYVVQYHAHSWG 284          
BLAST of inositol phosphoceramide mannosyltransferase 2-like vs. Planmine SMEST
Match: SMESG000037990.1 (SMESG000037990.1)

HSP 1 Score: 422.935 bits (1086), Expect = 2.018e-149
Identity = 202/239 (84.52%), Postives = 214/239 (89.54%), Query Frame = 1
Query:  277 QNVTKIIHFYWKNKEIPDLFLDFMKTWQEDCFKDWKFMFWTDKDNYNLIKTFYPWFLKTYNEFPWNIFRADVSRYFYLFHYGGIYTDLDNECLRPFEHLLQNYSLVFGAMKGQYLGTNLKEGYVQNSFMYSRPRQTFWMELLNDILMSKGTGSVEVQTGPVLLSKR--IALYRERLNSSDDMMIYSPNYFNPFSWIDNSKVDPNCKSHNKMTLENLNKCRSSMISKGSYVVQYHAHSWG 987
            + VTKIIH  WK  +IP  F  ++K+W + C+KDWKFMFWTDKDNYNLIKTFYPWFLKTYN+FP NI+R DVSRYFYLFHYGGIYTDLDNECLRPFEHLLQNYS+VFGAMKGQYLGTNLKEGYVQNSFMYSRPRQTFWMELLNDILM  GT SVEVQTGPVLLSK   IALYRERLNSSDDMMIYSPNYFNP SWI  SKVDPNCK HN+MTLENL KC+SSMIS GSYVVQYHAHSWG
Sbjct:   48 EKVTKIIHVSWKTNDIPVEFQKYLKSWTDFCYKDWKFMFWTDKDNYNLIKTFYPWFLKTYNKFPRNIYRVDVSRYFYLFHYGGIYTDLDNECLRPFEHLLQNYSIVFGAMKGQYLGTNLKEGYVQNSFMYSRPRQTFWMELLNDILMFNGTDSVEVQTGPVLLSKSFIIALYRERLNSSDDMMIYSPNYFNPLSWIIKSKVDPNCKFHNQMTLENLKKCKSSMISTGSYVVQYHAHSWG 286          
BLAST of inositol phosphoceramide mannosyltransferase 2-like vs. Planmine SMEST
Match: SMESG000059812.1 (SMESG000059812.1)

HSP 1 Score: 393.275 bits (1009), Expect = 4.878e-139
Identity = 187/200 (93.50%), Postives = 192/200 (96.00%), Query Frame = 1
Query:  388 MFWTDKDNYNLIKTFYPWFLKTYNEFPWNIFRADVSRYFYLFHYGGIYTDLDNECLRPFEHLLQNYSLVFGAMKGQYLGTNLKEGYVQNSFMYSRPRQTFWMELLNDILMSKGTGSVEVQTGPVLLSKRIALYRERLNSSDDMMIYSPNYFNPFSWIDNSKVDPNCKSHNKMTLENLNKCRSSMISKGSYVVQYHAHSWG 987
            MFWTD+DNYNLIKTFYPWFLK YNEFP NI+RADVSRYFYLFHYGGIYTDLDNECLRPFEHLLQNYS+VFGAMKGQYLGTNLKEGYVQNSFMYSRPRQTFWMELLNDILM KGT SVEVQTGPVLLSKRI L+RERLNSSD MMIYSPNYFNPFSWID SKVDPNCKSHN+MT ENLNKCRSSMISKGSYVVQYHAHSWG
Sbjct:    1 MFWTDEDNYNLIKTFYPWFLKKYNEFPRNIYRADVSRYFYLFHYGGIYTDLDNECLRPFEHLLQNYSIVFGAMKGQYLGTNLKEGYVQNSFMYSRPRQTFWMELLNDILMFKGTNSVEVQTGPVLLSKRIVLFRERLNSSDYMMIYSPNYFNPFSWIDKSKVDPNCKSHNQMTRENLNKCRSSMISKGSYVVQYHAHSWG 200          
The following BLAST results are available for this feature:
BLAST of inositol phosphoceramide mannosyltransferase 2-like vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of inositol phosphoceramide mannosyltransferase 2-like vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of inositol phosphoceramide mannosyltransferase 2-like vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of inositol phosphoceramide mannosyltransferase 2-like vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of inositol phosphoceramide mannosyltransferase 2-like vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of inositol phosphoceramide mannosyltransferase 2-like vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of inositol phosphoceramide mannosyltransferase 2-like vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P33300|SUR1_YEAST9.379e-2131.17Mannosyl phosphorylinositol ceramide synthase SUR1... [more]
sp|Q10323|IMT3_SCHPO3.195e-1946.46Inositol phosphoceramide mannosyltransferase 3 OS=... [more]
sp|P38287|CSH1_YEAST2.556e-1831.47Mannosyl phosphorylinositol ceramide synthase CSH1... [more]
sp|Q9UT67|IMT2_SCHPO2.586e-1842.31Inositol phosphoceramide mannosyltransferase 2 OS=... [more]
sp|O14084|IMT1_SCHPO3.146e-1627.37Inositol phosphoceramide mannosyltransferase 1 OS=... [more]
back to top
BLAST of inositol phosphoceramide mannosyltransferase 2-like vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267DNA28.961e-5437.05Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267H9I31.582e-5337.05Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8H5Y82.226e-5338.82Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267F5L22.671e-5338.82Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267DTA43.796e-5343.98Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of inositol phosphoceramide mannosyltransferase 2-like vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of inositol phosphoceramide mannosyltransferase 2-like vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of inositol phosphoceramide mannosyltransferase 2-like vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 3
Match NameE-valueIdentityDescription
SUR11.351e-2231.17Mannosylinositol phosphorylceramide (MIPC) synthas... [more]
CSH13.682e-2031.47Mannosylinositol phosphorylceramide (MIPC) synthas... [more]
OCH11.035e-830.68Mannosyltransferase of the cis-Golgi apparatus; in... [more]
back to top
BLAST of inositol phosphoceramide mannosyltransferase 2-like vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of inositol phosphoceramide mannosyltransferase 2-like vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of inositol phosphoceramide mannosyltransferase 2-like vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000045292.16.731e-16792.02SMESG000045292.1[more]
SMESG000045480.11.235e-15888.24SMESG000045480.1[more]
SMESG000045267.11.805e-15787.82SMESG000045267.1[more]
SMESG000037990.12.018e-14984.52SMESG000037990.1[more]
SMESG000059812.14.878e-13993.50SMESG000059812.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30008902 ID=SMED30008902|Name=inositol phosphoceramide mannosyltransferase 2-like|organism=Schmidtea mediterranea sexual|type=transcript|length=1059bp
CACTCAACCGTGACACGGACCAAATTTTGGTAGAATTATTTATATAAATT
GTTATAATGATTGCTGTTGAGATTCTGTATTATAATTCTGTGTATTATGC
TGTGAAATAATAATTCACATAAAATATATATTGGAATACTCACAAATGCC
ATTGCAATGATGAATTTAAACAAATTATTTACTATATGTTTGGTCATAGC
AATAATATTTTTATTGTTCAATTCATATAATGTCAAATACGTGATAAATT
TCGAGCCACCAGAGTTCATTTATGAGCAGAATGTAACAAAAATAATACAT
TTCTATTGGAAGAATAAAGAAATACCAGATCTTTTCCTAGATTTCATGAA
AACTTGGCAAGAAGACTGCTTTAAAGATTGGAAATTCATGTTCTGGACAG
ATAAGGACAATTATAACTTGATCAAAACCTTTTATCCATGGTTTCTTAAA
ACGTACAACGAATTTCCTTGGAATATTTTTCGAGCCGACGTCAGTAGGTA
TTTCTATTTGTTTCATTATGGAGGAATTTACACAGATCTCGACAATGAAT
GTTTGCGTCCATTTGAGCATTTGTTGCAAAACTATTCTCTCGTTTTCGGG
GCGATGAAAGGTCAATATTTAGGGACCAATTTAAAAGAAGGATACGTTCA
AAATTCTTTCATGTATTCAAGACCGAGACAGACATTTTGGATGGAGTTGT
TGAATGATATTCTCATGTCTAAGGGCACAGGTTCTGTGGAAGTTCAAACC
GGACCAGTTTTATTATCAAAACGAATCGCCTTATATCGAGAACGGTTAAA
TTCCTCAGATGACATGATGATTTATTCTCCAAATTATTTCAACCCATTCA
GTTGGATAGATAATTCAAAAGTGGACCCGAATTGTAAATCTCATAACAAA
ATGACTCTGGAGAATTTAAACAAATGTAGAAGCTCAATGATTTCAAAGGG
ATCATATGTCGTTCAGTATCATGCCCACAGTTGGGGATAAGTTCTTAGAA
CTATAATAACTATTTAGATTAGGTTTTGTATTTGTATATTTCATTAATTT
TAACTCTAA
back to top

protein sequence of SMED30008902-orf-1

>SMED30008902-orf-1 ID=SMED30008902-orf-1|Name=SMED30008902-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=278bp
MMNLNKLFTICLVIAIIFLLFNSYNVKYVINFEPPEFIYEQNVTKIIHFY
WKNKEIPDLFLDFMKTWQEDCFKDWKFMFWTDKDNYNLIKTFYPWFLKTY
NEFPWNIFRADVSRYFYLFHYGGIYTDLDNECLRPFEHLLQNYSLVFGAM
KGQYLGTNLKEGYVQNSFMYSRPRQTFWMELLNDILMSKGTGSVEVQTGP
VLLSKRIALYRERLNSSDDMMIYSPNYFNPFSWIDNSKVDPNCKSHNKMT
LENLNKCRSSMISKGSYVVQYHAHSWG*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000018Category 4 cell
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR007577GlycoTrfase_DXD_sugar-bd_CS
IPR029044Nucleotide-diphossugar_trans
Vocabulary: molecular function
TermDefinition
GO:0000030mannosyltransferase activity
GO:0016740transferase activity
GO:0016757transferase activity, transferring glycosyl groups
Vocabulary: cellular component
TermDefinition
GO:0005783endoplasmic reticulum
GO:0005789endoplasmic reticulum membrane
GO:0005794Golgi apparatus
GO:0016020membrane
GO:0016021integral component of membrane
GO:0032588trans-Golgi network membrane
GO:0033106cis-Golgi network membrane
Vocabulary: biological process
TermDefinition
GO:0051999mannosyl-inositol phosphorylceramide biosynthetic process
GO:0097502mannosylation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableTMHMMTMhelixcoord: 7..26