Dynamin-type G domain-containing protein

Overview
NameDynamin-type G domain-containing protein
Smed IDSMED30008898
Length (bp)1951
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Dynamin-type G domain-containing protein (SMED30008898) t-SNE clustered cells

Violin plots show distribution of expression levels for Dynamin-type G domain-containing protein (SMED30008898) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Dynamin-type G domain-containing protein (SMED30008898) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Dynamin-type G domain-containing protein (SMED30008898) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30008898

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30008898SMESG000014759.1 SmedASXL_006125SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30008898SMESG000014759.1 SmedASXL_015543SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30008898 SmedASXL_029782SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
epidermal cellSMED30008898SMESG000014759.1 dd_Smed_v4_7448_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30008898SMESG000014759.1 dd_Smed_v4_7448_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30008898SMESG000014759.1 dd_Smed_v4_7448_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Human
Match: MFN2 (mitofusin 2 [Source:HGNC Symbol;Acc:HGNC:16877])

HSP 1 Score: 121.324 bits (303), Expect = 5.634e-28
Identity = 79/259 (30.50%), Postives = 133/259 (51.35%), Query Frame = 1
Query:    4 VKKDSIKISFFGKVSAGKSRVLNTILGGNIFVSAVADTTSCFVSVTKSDRRCHYLRVDGSEDNFGSLENLKDKVKELTTYLSKNINRRLDTAKTVQV-FLNIKNEILKNKTEIVDCPGSNNKGEVTECIKKQSLDSDIFIFVMTC--TLTDEEKDFFEYQSKLSSKPDIFVLVNKWDNSDKDRQENTNKSRDKIKKEIINLLTKNGNFSSKEASERIFFVSALEMFKSRVENADVFVNKKN--QEAIAMRNYEFTSFEK 765
            + +  +K++FFG+ S GKS V+N +L   +  S +  TT+CF+ V  +D    +L  +GSE+   +       V +L   L ++  ++L     V V + N K  +LK+   ++D PG +   E+   I K  LD+D+F+ V     TL   EK FF   S+  S+P+IF+L N+WD S  + +      R  +++    L+ + G     +A +RIFFVSA E+  +R++ A           E   +R +EF +FE+
Sbjct:   92 LARRHMKVAFFGRTSNGKSTVINAMLWDKVLPSGIGHTTNCFLRVEGTDGHEAFLLTEGSEEKRSA-----KTVNQLAHALHQD--KQLHAGSLVSVMWPNSKCPLLKDDLVLMDSPGIDVTTELDSWIDKFCLDADVFVLVANSESTLMQTEKHFFHKVSERLSRPNIFILNNRWDASASEPEYMEEVRRQHMERCTSFLVDELGVVDRSQAGDRIFFVSAKEVLNARIQKAQGMPEGGGALAEGFQVRMFEFQNFER 343          
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Human
Match: MFN2 (mitofusin 2 [Source:HGNC Symbol;Acc:HGNC:16877])

HSP 1 Score: 121.324 bits (303), Expect = 5.634e-28
Identity = 79/259 (30.50%), Postives = 133/259 (51.35%), Query Frame = 1
Query:    4 VKKDSIKISFFGKVSAGKSRVLNTILGGNIFVSAVADTTSCFVSVTKSDRRCHYLRVDGSEDNFGSLENLKDKVKELTTYLSKNINRRLDTAKTVQV-FLNIKNEILKNKTEIVDCPGSNNKGEVTECIKKQSLDSDIFIFVMTC--TLTDEEKDFFEYQSKLSSKPDIFVLVNKWDNSDKDRQENTNKSRDKIKKEIINLLTKNGNFSSKEASERIFFVSALEMFKSRVENADVFVNKKN--QEAIAMRNYEFTSFEK 765
            + +  +K++FFG+ S GKS V+N +L   +  S +  TT+CF+ V  +D    +L  +GSE+   +       V +L   L ++  ++L     V V + N K  +LK+   ++D PG +   E+   I K  LD+D+F+ V     TL   EK FF   S+  S+P+IF+L N+WD S  + +      R  +++    L+ + G     +A +RIFFVSA E+  +R++ A           E   +R +EF +FE+
Sbjct:   92 LARRHMKVAFFGRTSNGKSTVINAMLWDKVLPSGIGHTTNCFLRVEGTDGHEAFLLTEGSEEKRSA-----KTVNQLAHALHQD--KQLHAGSLVSVMWPNSKCPLLKDDLVLMDSPGIDVTTELDSWIDKFCLDADVFVLVANSESTLMQTEKHFFHKVSERLSRPNIFILNNRWDASASEPEYMEEVRRQHMERCTSFLVDELGVVDRSQAGDRIFFVSAKEVLNARIQKAQGMPEGGGALAEGFQVRMFEFQNFER 343          
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Human
Match: MFN1 (mitofusin 1 [Source:HGNC Symbol;Acc:HGNC:18262])

HSP 1 Score: 114.005 bits (284), Expect = 1.037e-26
Identity = 80/254 (31.50%), Postives = 136/254 (53.54%), Query Frame = 1
Query:   19 IKISFFGKVSAGKSRVLNTILGGNIFVSAVADTTSCFVSVTKSDRRCHYLRVDGSEDNFGSLENLKDKVKELTTYLSKNINRRLDTAKTVQVFLN-IKNEILKNKTEIVDCPGSNNKGEVTECIKKQSLDSDIFIFVMTC--TLTDEEKDFFEYQSKLSSKPDIFVLVNKWDNSDKDRQENTNKSRDKIKKEIINLLTKNGNFSSKEASERIFFVSALEMFKSRVENADVFVNK--KNQEAIAMRNYEFTSFEK 765
            +K++FFG+ S+GKS V+N +L   +  S +   T+CF+SV  +D    YL  +GS++     +++K  V +L   L  ++++ L     V+VF    K  +L++   +VD PG++   E+   I K  LD+D+F+ V     TL + EK FF   ++  SKP+IF+L N+WD S  + +   +  R  +++ +  L+ +    ++ EA  RIFFVSA E+  +R + A           E    R  EF +FE+
Sbjct:   76 MKVAFFGRTSSGKSSVINAMLWDKVLPSGIGHITNCFLSVEGTDGDKAYLMTEGSDEK----KSVK-TVNQLAHAL--HMDKDLKAGCLVRVFWPKAKCALLRDDLVLVDSPGTDVTTELDSWIDKFCLDADVFVLVANSESTLMNTEKHFFHKVNERLSKPNIFILNNRWDASASEPEYMEDVRRQHMERCLHFLVEELKVVNALEAQNRIFFVSAKEVLSARKQKAQGMPESGVALAEGFHARLQEFQNFEQ 322          
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Human
Match: MFN1 (mitofusin 1 [Source:HGNC Symbol;Acc:HGNC:18262])

HSP 1 Score: 113.62 bits (283), Expect = 1.654e-25
Identity = 80/254 (31.50%), Postives = 136/254 (53.54%), Query Frame = 1
Query:   19 IKISFFGKVSAGKSRVLNTILGGNIFVSAVADTTSCFVSVTKSDRRCHYLRVDGSEDNFGSLENLKDKVKELTTYLSKNINRRLDTAKTVQVFLN-IKNEILKNKTEIVDCPGSNNKGEVTECIKKQSLDSDIFIFVMTC--TLTDEEKDFFEYQSKLSSKPDIFVLVNKWDNSDKDRQENTNKSRDKIKKEIINLLTKNGNFSSKEASERIFFVSALEMFKSRVENADVFVNK--KNQEAIAMRNYEFTSFEK 765
            +K++FFG+ S+GKS V+N +L   +  S +   T+CF+SV  +D    YL  +GS++     +++K  V +L   L  ++++ L     V+VF    K  +L++   +VD PG++   E+   I K  LD+D+F+ V     TL + EK FF   ++  SKP+IF+L N+WD S  + +   +  R  +++ +  L+ +    ++ EA  RIFFVSA E+  +R + A           E    R  EF +FE+
Sbjct:   76 MKVAFFGRTSSGKSSVINAMLWDKVLPSGIGHITNCFLSVEGTDGDKAYLMTEGSDEK----KSVK-TVNQLAHAL--HMDKDLKAGCLVRVFWPKAKCALLRDDLVLVDSPGTDVTTELDSWIDKFCLDADVFVLVANSESTLMNTEKHFFHKVNERLSKPNIFILNNRWDASASEPEYMEDVRRQHMERCLHFLVEELKVVNALEAQNRIFFVSAKEVLSARKQKAQGMPESGVALAEGFHARLQEFQNFEQ 322          
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Human
Match: MFN1 (mitofusin 1 [Source:HGNC Symbol;Acc:HGNC:18262])

HSP 1 Score: 113.62 bits (283), Expect = 1.654e-25
Identity = 80/254 (31.50%), Postives = 136/254 (53.54%), Query Frame = 1
Query:   19 IKISFFGKVSAGKSRVLNTILGGNIFVSAVADTTSCFVSVTKSDRRCHYLRVDGSEDNFGSLENLKDKVKELTTYLSKNINRRLDTAKTVQVFLN-IKNEILKNKTEIVDCPGSNNKGEVTECIKKQSLDSDIFIFVMTC--TLTDEEKDFFEYQSKLSSKPDIFVLVNKWDNSDKDRQENTNKSRDKIKKEIINLLTKNGNFSSKEASERIFFVSALEMFKSRVENADVFVNK--KNQEAIAMRNYEFTSFEK 765
            +K++FFG+ S+GKS V+N +L   +  S +   T+CF+SV  +D    YL  +GS++     +++K  V +L   L  ++++ L     V+VF    K  +L++   +VD PG++   E+   I K  LD+D+F+ V     TL + EK FF   ++  SKP+IF+L N+WD S  + +   +  R  +++ +  L+ +    ++ EA  RIFFVSA E+  +R + A           E    R  EF +FE+
Sbjct:   76 MKVAFFGRTSSGKSSVINAMLWDKVLPSGIGHITNCFLSVEGTDGDKAYLMTEGSDEK----KSVK-TVNQLAHAL--HMDKDLKAGCLVRVFWPKAKCALLRDDLVLVDSPGTDVTTELDSWIDKFCLDADVFVLVANSESTLMNTEKHFFHKVNERLSKPNIFILNNRWDASASEPEYMEDVRRQHMERCLHFLVEELKVVNALEAQNRIFFVSAKEVLSARKQKAQGMPESGVALAEGFHARLQEFQNFEQ 322          
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Celegans
Match: fzo-1 (Transmembrane GTPase fzo-1 [Source:UniProtKB/Swiss-Prot;Acc:Q23424])

HSP 1 Score: 110.923 bits (276), Expect = 4.811e-25
Identity = 79/270 (29.26%), Postives = 132/270 (48.89%), Query Frame = 1
Query:    7 KKDSIKISFFGKVSAGKSRVLNTILGGNIFVSAVADTTSCFVSVTKSDRRCHYLRVDGSEDNFGSLENLKDKVKELTTYLSKNINRRLDTAKT----------VQVFLNIKNE-----ILKNKTEIVDCPGSNNKGEVTECIKKQSLDSDIFIFVMTC--TLTDEEKDFFEYQSKLSSKPDIFVLVNKWDNSDKDRQENTNKSRDKIKKEIINLLTKNGNFSSKEASERIFFVSALEMFKSRVENADVFVNKKNQEAIAMRNYEFTSFEK 765
            ++D++K+ FFG+ S GKS  +N +L   +    +  TT CF            L+V+GSE   G L+ L D  +++   +   I   L    +          ++VF   K+E     +L+N   I+D PG +   E    I K  LD+D+F+ V     TLT  EK+FF   +K  SKP++F+L N+WD S  + +   +  +  + +    L+ +    S +E ++RIFFVS+ E+ +SR++   +       E    R  EF +FE+
Sbjct:   97 QRDNMKVVFFGRTSNGKSTTINAMLHEKVLPQGMGHTTCCF------------LQVEGSEGEVGHLQ-LDDNPQKIDMKMLGKIGHALSDENSDLPAMGQDSLLKVFHPKKSESGECRLLQNDVVILDSPGVDLSPEFDSWIDKHCLDADVFVLVSNAESTLTQAEKNFFLRVAKKLSKPNVFILNNRWDASAAETENIEDVKKQHLTRFRQFLVDELEVCSEREVNDRIFFVSSREVLESRLKARGLVQKAYQAEGHGTRALEFQNFER 353          
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Fly
Match: Marf (gene:FBgn0029870 transcript:FBtr0343373)

HSP 1 Score: 130.568 bits (327), Expect = 3.300e-31
Identity = 87/265 (32.83%), Postives = 143/265 (53.96%), Query Frame = 1
Query:    4 VKKDSIKISFFGKVSAGKSRVLNTILGGNIFVSAVADTTSCFVSVTKSDRRCHYLRVDGSEDNFGSLENLKDKVKELTTYLSKNINRRLDTAKTVQVFLNIKN-EILKNKTEIVDCPGSNNKGEVTECIKKQSLDSDIFIFVMTC--TLTDEEKDFFEYQSKLSSKPDIFVLVNKWD---NSDKDRQENTNKSRDKIKKEIINLLTKNGNFSS-KEASERIFFVSALEMFKSRVENADVFVNKKNQEAIA----MRNYEFTSFEK 765
            +++D +K++FFG+ S GKS V+N +L   I  S +  TT+CF  V  S+    YL  +GSE+    +      +K+L   L +    +L  +  V++F   +   +L++    VD PG +    + + I    L++D+F+ V+    T+T  EK FF   S+  SKP+IF+L N+WD   N  + ++    K + +  +  I+ LTK    S+ KEA+ER+FFVSA E  ++R+E A    N  +  AIA    +R +EF  FE+
Sbjct:  133 LQRDHMKVAFFGRTSNGKSSVINAMLREKILPSGIGHTTNCFCQVEGSNGGEAYLMTEGSEEKLNVV-----NIKQLANALCQ---EKLCESSLVRIFWPRERCSLLRDDVVFVDSPGVDVSANLDDWIDNHCLNADVFVLVLNAESTMTRAEKQFFHTVSQKLSKPNIFILNNRWDASANEPECQESELAKVKSQHTERCIDFLTKELKVSNEKEAAERVFFVSARETLQARIEEAK--GNPPHMGAIAEGFQIRYFEFQDFER 387          
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Fly
Match: Marf (gene:FBgn0029870 transcript:FBtr0070910)

HSP 1 Score: 130.568 bits (327), Expect = 3.880e-31
Identity = 87/262 (33.21%), Postives = 141/262 (53.82%), Query Frame = 1
Query:    4 VKKDSIKISFFGKVSAGKSRVLNTILGGNIFVSAVADTTSCFVSVTKSDRRCHYLRVDGSEDNFGSLENLKDKVKELTTYLSKNINRRLDTAKTVQVFLNIKN-EILKNKTEIVDCPGSNNKGEVTECIKKQSLDSDIFIFVMTC--TLTDEEKDFFEYQSKLSSKPDIFVLVNKWDNSDKDRQENTNKSRDKIKKEIINLLTKNGNFSS-KEASERIFFVSALEMFKSRVENADVFVNKKNQEAIA----MRNYEFTSFEK 765
            +++D +K++FFG+ S GKS V+N +L   I  S +  TT+CF  V  S+    YL  +GSE+    +      +K+L   L +    +L  +  V++F   +   +L++    VD PG +    + + I    L++D+F+ V+    T+T  EK FF   S+  SKP+IF+L N+WD S  +  E     + +  +  I+ LTK    S+ KEA+ER+FFVSA E  ++R+E A    N  +  AIA    +R +EF  FE+
Sbjct:  133 LQRDHMKVAFFGRTSNGKSSVINAMLREKILPSGIGHTTNCFCQVEGSNGGEAYLMTEGSEEKLNVV-----NIKQLANALCQ---EKLCESSLVRIFWPRERCSLLRDDVVFVDSPGVDVSANLDDWIDNHCLNADVFVLVLNAESTMTRAEKQFFHTVSQKLSKPNIFILNNRWDAS-ANEPECQESVKSQHTERCIDFLTKELKVSNEKEAAERVFFVSARETLQARIEEAK--GNPPHMGAIAEGFQIRYFEFQDFER 383          
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Fly
Match: Marf (gene:FBgn0029870 transcript:FBtr0070909)

HSP 1 Score: 130.568 bits (327), Expect = 3.880e-31
Identity = 87/262 (33.21%), Postives = 141/262 (53.82%), Query Frame = 1
Query:    4 VKKDSIKISFFGKVSAGKSRVLNTILGGNIFVSAVADTTSCFVSVTKSDRRCHYLRVDGSEDNFGSLENLKDKVKELTTYLSKNINRRLDTAKTVQVFLNIKN-EILKNKTEIVDCPGSNNKGEVTECIKKQSLDSDIFIFVMTC--TLTDEEKDFFEYQSKLSSKPDIFVLVNKWDNSDKDRQENTNKSRDKIKKEIINLLTKNGNFSS-KEASERIFFVSALEMFKSRVENADVFVNKKNQEAIA----MRNYEFTSFEK 765
            +++D +K++FFG+ S GKS V+N +L   I  S +  TT+CF  V  S+    YL  +GSE+    +      +K+L   L +    +L  +  V++F   +   +L++    VD PG +    + + I    L++D+F+ V+    T+T  EK FF   S+  SKP+IF+L N+WD S  +  E     + +  +  I+ LTK    S+ KEA+ER+FFVSA E  ++R+E A    N  +  AIA    +R +EF  FE+
Sbjct:  133 LQRDHMKVAFFGRTSNGKSSVINAMLREKILPSGIGHTTNCFCQVEGSNGGEAYLMTEGSEEKLNVV-----NIKQLANALCQ---EKLCESSLVRIFWPRERCSLLRDDVVFVDSPGVDVSANLDDWIDNHCLNADVFVLVLNAESTMTRAEKQFFHTVSQKLSKPNIFILNNRWDAS-ANEPECQESVKSQHTERCIDFLTKELKVSNEKEAAERVFFVSARETLQARIEEAK--GNPPHMGAIAEGFQIRYFEFQDFER 383          
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Fly
Match: fzo (gene:FBgn0011596 transcript:FBtr0084399)

HSP 1 Score: 109.383 bits (272), Expect = 1.938e-24
Identity = 79/264 (29.92%), Postives = 133/264 (50.38%), Query Frame = 1
Query:    4 VKKDSIKISFFGKVSAGKSRVLNTILGGNIFVSAVADTTSCFVSV-TKSDRRCHYLRVDGSEDNFGSLENLKDKVKELTTYLSKNINRRLDTAKTVQVFLNIKNE--ILKNKTEIVDCPGSNNKGEVTECIKKQSLDSDIFIFVMTC--TLTDEEKDFFEYQSKLSSKPDIFVLVNKWDNSDKDRQENTNKSRDKIKKEIINLLTKN-GNFS-SKEASERIFFVSALEMFKSRVENADVFVNKKNQEAIAMRNYEFTSFEKSLS 774
            + +D +K++FFG+ S GKS V+N +L   I  SA+  TTSCF  V         +++V+  +++         ++  L+   S +    L  +  +QV +  KN   IL     ++D PG +   ++ +C+    +D+D+FI V+    T++  E+ FF+  +   S+P++F+L N+WD +     E   K +D+  +  +NLL    G +S ++EA ERI+ VSALE    R  N  +  N   Q     R  EF  FE   S
Sbjct:   82 LSRDRMKVAFFGRTSNGKSAVINALLHEKILPSAMGHTTSCFCQVQANGSNETEHVKVEQEDEHM--------ELSALSQLASAHSPGALKPSTLLQVNM-AKNRCSILDYDVVLMDTPGVDVTAQLDDCLDSYCMDADVFILVLNAESTVSRVERQFFKDVASKLSRPNLFILNNRWDKASSLEPEMEQKVKDQHMERCVNLLVDELGVYSTAQEAWERIYHVSALEALHIR--NGQI-TNPSGQ--TQQRYQEFLRFENDFS 331          
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Zebrafish
Match: mfn1b (mitofusin 1b [Source:ZFIN;Acc:ZDB-GENE-040426-1553])

HSP 1 Score: 118.242 bits (295), Expect = 1.097e-28
Identity = 85/254 (33.46%), Postives = 132/254 (51.97%), Query Frame = 1
Query:   19 IKISFFGKVSAGKSRVLNTILGGNIFVSAVADTTSCFVSVTKSDRRCHYLRVDGSEDNFGSLENLKDKVKELTTYLSKNINRRLDTAKTVQVFLN-IKNEILKNKTEIVDCPGSNNKGEVTECIKKQSLDSDIFIFVMT--CTLTDEEKDFFEYQSKLSSKPDIFVLVNKWDNSDKDRQENTNKSRDKIKKEIINLLTKNGNFSSK-EASERIFFVSALEMFKSRVENADVFVNKKNQEAIAMRNYEFTSFEKS 768
            +K++FFG+ S GKS V+N +L   +  S +  TT+CF+SV  +D    +L+ +GSE+     E     V +L   L  +++  LD    V+VF    K  +L++   +VD PG++   E+   I K  LD+D+F+ V     TL + EK FF   ++  SKP+IF+L N+WD S  +  E     R +     +N L +      + +A  RIFFVSA E+  SR++ A         E    R  EF +FE+S
Sbjct:   77 MKVAFFGRTSNGKSTVINAMLRDRVLPSGIGHTTNCFLSVEGTDEDKAFLKTEGSEE-----EKSIKTVNQLAHAL--HMDESLDAGCLVKVFWPKTKCALLRDDLVLVDSPGTDVTTELDSWIDKFCLDADVFVLVANSESTLMNTEKHFFHKVNEKLSKPNIFILNNRWDASAAE-PEYMEDVRKQHTDRCVNFLVEELKVVDRAQAPNRIFFVSAKEVLNSRMQRAQ---GGALAEGFQDRLKEFQNFERS 319          
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Zebrafish
Match: mfn1b (mitofusin 1b [Source:ZFIN;Acc:ZDB-GENE-040426-1553])

HSP 1 Score: 118.242 bits (295), Expect = 1.523e-28
Identity = 85/256 (33.20%), Postives = 132/256 (51.56%), Query Frame = 1
Query:   19 IKISFFGKVSAGKSRVLNTILGGNIFVSAVADTTSCFVSVTKSDRRCHYLRVDGSEDNFGSLENLKDKVKELTTYLSKNINRRLDTAKTVQVFLN-IKNEILKNKTEIVDCPGSNNKGEVTECIKKQSLDSDIFIFVMT--CTLTDEEKDFFEYQSKLSSKPDIFVLVNKWDNSDKDRQENTNKSRDKIKKEIINLLTKNGNFSSK-EASERIFFVSALEMFKSRVENADVFVNKKN--QEAIAMRNYEFTSFEKS 768
            +K++FFG+ S GKS V+N +L   +  S +  TT+CF+SV  +D    +L+ +GSE+     E     V +L   L  +++  LD    V+VF    K  +L++   +VD PG++   E+   I K  LD+D+F+ V     TL + EK FF   ++  SKP+IF+L N+WD S  +  E     R +     +N L +      + +A  RIFFVSA E+  SR++ A           E    R  EF +FE+S
Sbjct:   77 MKVAFFGRTSNGKSTVINAMLRDRVLPSGIGHTTNCFLSVEGTDEDKAFLKTEGSEE-----EKSIKTVNQLAHAL--HMDESLDAGCLVKVFWPKTKCALLRDDLVLVDSPGTDVTTELDSWIDKFCLDADVFVLVANSESTLMNTEKHFFHKVNEKLSKPNIFILNNRWDASAAE-PEYMEDVRKQHTDRCVNFLVEELKVVDRAQAPNRIFFVSAKEVLNSRMQRAQGMPETGGALAEGFQDRLKEFQNFERS 324          
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Zebrafish
Match: mfn1b (mitofusin 1b [Source:ZFIN;Acc:ZDB-GENE-040426-1553])

HSP 1 Score: 118.242 bits (295), Expect = 4.096e-27
Identity = 85/259 (32.82%), Postives = 134/259 (51.74%), Query Frame = 1
Query:    4 VKKDSIKISFFGKVSAGKSRVLNTILGGNIFVSAVADTTSCFVSVTKSDRRCHYLRVDGSEDNFGSLENLKDKVKELTTYLSKNINRRLDTAKTVQVFLN-IKNEILKNKTEIVDCPGSNNKGEVTECIKKQSLDSDIFIFVMT--CTLTDEEKDFFEYQSKLSSKPDIFVLVNKWDNSDKDRQENTNKSRDKIKKEIINLLTKNGNFSSK-EASERIFFVSALEMFKSRVENADVFVNKKNQEAIAMRNYEFTSFEKS 768
            + +  +K++FFG+ S GKS V+N +L   +  S +  TT+CF+SV  +D    +L+ +GSE+     E     V +L   L  +++  LD    V+VF    K  +L++   +VD PG++   E+   I K  LD+D+F+ V     TL + EK FF   ++  SKP+IF+L N+WD S  +  E     R +     +N L +      + +A  RIFFVSA E+  SR++ A         E    R  EF +FE+S
Sbjct:   72 LARRHMKVAFFGRTSNGKSTVINAMLRDRVLPSGIGHTTNCFLSVEGTDEDKAFLKTEGSEE-----EKSIKTVNQLAHAL--HMDESLDAGCLVKVFWPKTKCALLRDDLVLVDSPGTDVTTELDSWIDKFCLDADVFVLVANSESTLMNTEKHFFHKVNEKLSKPNIFILNNRWDASAAE-PEYMEDVRKQHTDRCVNFLVEELKVVDRAQAPNRIFFVSAKEVLNSRMQRAQ---GGALAEGFQDRLKEFQNFERS 319          
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Zebrafish
Match: mfn1b (mitofusin 1b [Source:ZFIN;Acc:ZDB-GENE-040426-1553])

HSP 1 Score: 117.857 bits (294), Expect = 5.496e-27
Identity = 85/261 (32.57%), Postives = 134/261 (51.34%), Query Frame = 1
Query:    4 VKKDSIKISFFGKVSAGKSRVLNTILGGNIFVSAVADTTSCFVSVTKSDRRCHYLRVDGSEDNFGSLENLKDKVKELTTYLSKNINRRLDTAKTVQVFLN-IKNEILKNKTEIVDCPGSNNKGEVTECIKKQSLDSDIFIFVMT--CTLTDEEKDFFEYQSKLSSKPDIFVLVNKWDNSDKDRQENTNKSRDKIKKEIINLLTKNGNFSSK-EASERIFFVSALEMFKSRVENADVFVNKKN--QEAIAMRNYEFTSFEKS 768
            + +  +K++FFG+ S GKS V+N +L   +  S +  TT+CF+SV  +D    +L+ +GSE+     E     V +L   L  +++  LD    V+VF    K  +L++   +VD PG++   E+   I K  LD+D+F+ V     TL + EK FF   ++  SKP+IF+L N+WD S  +  E     R +     +N L +      + +A  RIFFVSA E+  SR++ A           E    R  EF +FE+S
Sbjct:   72 LARRHMKVAFFGRTSNGKSTVINAMLRDRVLPSGIGHTTNCFLSVEGTDEDKAFLKTEGSEE-----EKSIKTVNQLAHAL--HMDESLDAGCLVKVFWPKTKCALLRDDLVLVDSPGTDVTTELDSWIDKFCLDADVFVLVANSESTLMNTEKHFFHKVNEKLSKPNIFILNNRWDASAAE-PEYMEDVRKQHTDRCVNFLVEELKVVDRAQAPNRIFFVSAKEVLNSRMQRAQGMPETGGALAEGFQDRLKEFQNFERS 324          
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Zebrafish
Match: mfn1b (mitofusin 1b [Source:ZFIN;Acc:ZDB-GENE-040426-1553])

HSP 1 Score: 117.857 bits (294), Expect = 5.496e-27
Identity = 85/261 (32.57%), Postives = 134/261 (51.34%), Query Frame = 1
Query:    4 VKKDSIKISFFGKVSAGKSRVLNTILGGNIFVSAVADTTSCFVSVTKSDRRCHYLRVDGSEDNFGSLENLKDKVKELTTYLSKNINRRLDTAKTVQVFLN-IKNEILKNKTEIVDCPGSNNKGEVTECIKKQSLDSDIFIFVMT--CTLTDEEKDFFEYQSKLSSKPDIFVLVNKWDNSDKDRQENTNKSRDKIKKEIINLLTKNGNFSSK-EASERIFFVSALEMFKSRVENADVFVNKKN--QEAIAMRNYEFTSFEKS 768
            + +  +K++FFG+ S GKS V+N +L   +  S +  TT+CF+SV  +D    +L+ +GSE+     E     V +L   L  +++  LD    V+VF    K  +L++   +VD PG++   E+   I K  LD+D+F+ V     TL + EK FF   ++  SKP+IF+L N+WD S  +  E     R +     +N L +      + +A  RIFFVSA E+  SR++ A           E    R  EF +FE+S
Sbjct:   72 LARRHMKVAFFGRTSNGKSTVINAMLRDRVLPSGIGHTTNCFLSVEGTDEDKAFLKTEGSEE-----EKSIKTVNQLAHAL--HMDESLDAGCLVKVFWPKTKCALLRDDLVLVDSPGTDVTTELDSWIDKFCLDADVFVLVANSESTLMNTEKHFFHKVNEKLSKPNIFILNNRWDASAAE-PEYMEDVRKQHTDRCVNFLVEELKVVDRAQAPNRIFFVSAKEVLNSRMQRAQGMPETGGALAEGFQDRLKEFQNFERS 324          
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Xenopus
Match: mfn1 (mitofusin 1 [Source:NCBI gene;Acc:548943])

HSP 1 Score: 115.161 bits (287), Expect = 5.413e-26
Identity = 82/259 (31.66%), Postives = 138/259 (53.28%), Query Frame = 1
Query:    4 VKKDSIKISFFGKVSAGKSRVLNTILGGNIFVSAVADTTSCFVSVTKSDRRCHYLRVDGSEDNFGSLENLKDKVKELTTYLSKNINRRLDTAKTVQVFLN-IKNEILKNKTEIVDCPGSNNKGEVTECIKKQSLDSDIFIFVMT--CTLTDEEKDFFEYQSKLSSKPDIFVLVNKWDNSDKDRQENTNKSRDKIKKEIINLLTKNGNFSSKEASERIFFVSALEMFKSRVENADVF--VNKKNQEAIAMRNYEFTSFEK 765
            + + ++K++FFG+ S+GKS V+N++L   +  S +  TT+CF+SV  ++    YL  +GSE+     +++K  V +L   L  ++++ L     V VF    K  +L++   +VD PG++   E+   I K  LD+D+F+ V     TL + EK FF   ++  SKP+IF+L N+WD S  + +   +  +  +++    L+ +     S EA +RIFFVSA E+  +R+  A           E    R  EF  FEK
Sbjct:   82 LARRNMKVAFFGRTSSGKSTVINSMLWDKVLPSGIGHTTNCFLSVEGTEGDKAYLMTEGSEEK----KSVK-TVNQLAHAL--HMDKDLGAGCLVHVFWPKAKCALLRDDLVLVDSPGTDVTTELDSWIDKFCLDADVFVLVANSESTLMNTEKHFFYKVNEKLSKPNIFILNNRWDASASEPEYMEDVRKQHMERCQSFLVDELKVVDSLEAQKRIFFVSAKEVLNARMHKAQGMPEAGAALAEGFHTRFLEFQKFEK 333          
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Xenopus
Match: mfn1 (mitofusin 1 [Source:NCBI gene;Acc:548943])

HSP 1 Score: 115.161 bits (287), Expect = 5.429e-26
Identity = 82/259 (31.66%), Postives = 138/259 (53.28%), Query Frame = 1
Query:    4 VKKDSIKISFFGKVSAGKSRVLNTILGGNIFVSAVADTTSCFVSVTKSDRRCHYLRVDGSEDNFGSLENLKDKVKELTTYLSKNINRRLDTAKTVQVFLN-IKNEILKNKTEIVDCPGSNNKGEVTECIKKQSLDSDIFIFVMT--CTLTDEEKDFFEYQSKLSSKPDIFVLVNKWDNSDKDRQENTNKSRDKIKKEIINLLTKNGNFSSKEASERIFFVSALEMFKSRVENADVF--VNKKNQEAIAMRNYEFTSFEK 765
            + + ++K++FFG+ S+GKS V+N++L   +  S +  TT+CF+SV  ++    YL  +GSE+     +++K  V +L   L  ++++ L     V VF    K  +L++   +VD PG++   E+   I K  LD+D+F+ V     TL + EK FF   ++  SKP+IF+L N+WD S  + +   +  +  +++    L+ +     S EA +RIFFVSA E+  +R+  A           E    R  EF  FEK
Sbjct:   82 LARRNMKVAFFGRTSSGKSTVINSMLWDKVLPSGIGHTTNCFLSVEGTEGDKAYLMTEGSEEK----KSVK-TVNQLAHAL--HMDKDLGAGCLVHVFWPKAKCALLRDDLVLVDSPGTDVTTELDSWIDKFCLDADVFVLVANSESTLMNTEKHFFYKVNEKLSKPNIFILNNRWDASASEPEYMEDVRKQHMERCQSFLVDELKVVDSLEAQKRIFFVSAKEVLNARMHKAQGMPEAGAALAEGFHTRFLEFQKFEK 333          
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Xenopus
Match: mfn1 (mitofusin 1 [Source:NCBI gene;Acc:548943])

HSP 1 Score: 114.775 bits (286), Expect = 6.024e-26
Identity = 82/259 (31.66%), Postives = 138/259 (53.28%), Query Frame = 1
Query:    4 VKKDSIKISFFGKVSAGKSRVLNTILGGNIFVSAVADTTSCFVSVTKSDRRCHYLRVDGSEDNFGSLENLKDKVKELTTYLSKNINRRLDTAKTVQVFLN-IKNEILKNKTEIVDCPGSNNKGEVTECIKKQSLDSDIFIFVMT--CTLTDEEKDFFEYQSKLSSKPDIFVLVNKWDNSDKDRQENTNKSRDKIKKEIINLLTKNGNFSSKEASERIFFVSALEMFKSRVENADVF--VNKKNQEAIAMRNYEFTSFEK 765
            + + ++K++FFG+ S+GKS V+N++L   +  S +  TT+CF+SV  ++    YL  +GSE+     +++K  V +L   L  ++++ L     V VF    K  +L++   +VD PG++   E+   I K  LD+D+F+ V     TL + EK FF   ++  SKP+IF+L N+WD S  + +   +  +  +++    L+ +     S EA +RIFFVSA E+  +R+  A           E    R  EF  FEK
Sbjct:   87 LARRNMKVAFFGRTSSGKSTVINSMLWDKVLPSGIGHTTNCFLSVEGTEGDKAYLMTEGSEEK----KSVK-TVNQLAHAL--HMDKDLGAGCLVHVFWPKAKCALLRDDLVLVDSPGTDVTTELDSWIDKFCLDADVFVLVANSESTLMNTEKHFFYKVNEKLSKPNIFILNNRWDASASEPEYMEDVRKQHMERCQSFLVDELKVVDSLEAQKRIFFVSAKEVLNARMHKAQGMPEAGAALAEGFHTRFLEFQKFEK 338          
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Xenopus
Match: mfn1 (mitofusin 1 [Source:NCBI gene;Acc:548943])

HSP 1 Score: 114.775 bits (286), Expect = 6.059e-26
Identity = 82/254 (32.28%), Postives = 135/254 (53.15%), Query Frame = 1
Query:   19 IKISFFGKVSAGKSRVLNTILGGNIFVSAVADTTSCFVSVTKSDRRCHYLRVDGSEDNFGSLENLKDKVKELTTYLSKNINRRLDTAKTVQVFLN-IKNEILKNKTEIVDCPGSNNKGEVTECIKKQSLDSDIFIFVMT--CTLTDEEKDFFEYQSKLSSKPDIFVLVNKWDNSDKDRQENTNKSRDKIKKEIINLLTKNGNFSSKEASERIFFVSALEMFKSRVENADVF--VNKKNQEAIAMRNYEFTSFEK 765
            +K++FFG+ S+GKS V+N++L   +  S +  TT+CF+SV  ++    YL  +GSE+     +++K  V +L   L  ++++ L     V VF    K  +L++   +VD PG++   E+   I K  LD+D+F+ V     TL + EK FF   ++  SKP+IF+L N+WD S  + +   +  +  +++    L+ +     S EA +RIFFVSA E+  +R+  A           E    R  EF  FEK
Sbjct:   95 MKVAFFGRTSSGKSTVINSMLWDKVLPSGIGHTTNCFLSVEGTEGDKAYLMTEGSEEK----KSVK-TVNQLAHAL--HMDKDLGAGCLVHVFWPKAKCALLRDDLVLVDSPGTDVTTELDSWIDKFCLDADVFVLVANSESTLMNTEKHFFYKVNEKLSKPNIFILNNRWDASASEPEYMEDVRKQHMERCQSFLVDELKVVDSLEAQKRIFFVSAKEVLNARMHKAQGMPEAGAALAEGFHTRFLEFQKFEK 341          
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Xenopus
Match: mfn1 (mitofusin 1 [Source:NCBI gene;Acc:548943])

HSP 1 Score: 114.775 bits (286), Expect = 6.164e-26
Identity = 82/259 (31.66%), Postives = 138/259 (53.28%), Query Frame = 1
Query:    4 VKKDSIKISFFGKVSAGKSRVLNTILGGNIFVSAVADTTSCFVSVTKSDRRCHYLRVDGSEDNFGSLENLKDKVKELTTYLSKNINRRLDTAKTVQVFLN-IKNEILKNKTEIVDCPGSNNKGEVTECIKKQSLDSDIFIFVMT--CTLTDEEKDFFEYQSKLSSKPDIFVLVNKWDNSDKDRQENTNKSRDKIKKEIINLLTKNGNFSSKEASERIFFVSALEMFKSRVENADVF--VNKKNQEAIAMRNYEFTSFEK 765
            + + ++K++FFG+ S+GKS V+N++L   +  S +  TT+CF+SV  ++    YL  +GSE+     +++K  V +L   L  ++++ L     V VF    K  +L++   +VD PG++   E+   I K  LD+D+F+ V     TL + EK FF   ++  SKP+IF+L N+WD S  + +   +  +  +++    L+ +     S EA +RIFFVSA E+  +R+  A           E    R  EF  FEK
Sbjct:   72 LARRNMKVAFFGRTSSGKSTVINSMLWDKVLPSGIGHTTNCFLSVEGTEGDKAYLMTEGSEEK----KSVK-TVNQLAHAL--HMDKDLGAGCLVHVFWPKAKCALLRDDLVLVDSPGTDVTTELDSWIDKFCLDADVFVLVANSESTLMNTEKHFFYKVNEKLSKPNIFILNNRWDASASEPEYMEDVRKQHMERCQSFLVDELKVVDSLEAQKRIFFVSAKEVLNARMHKAQGMPEAGAALAEGFHTRFLEFQKFEK 323          
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Mouse
Match: Mfn2 (mitofusin 2 [Source:MGI Symbol;Acc:MGI:2442230])

HSP 1 Score: 120.939 bits (302), Expect = 3.678e-28
Identity = 81/259 (31.27%), Postives = 135/259 (52.12%), Query Frame = 1
Query:    4 VKKDSIKISFFGKVSAGKSRVLNTILGGNIFVSAVADTTSCFVSVTKSDRRCHYLRVDGSEDNFGSLENLKDKVKELTTYLSKNINRRLDTAKTVQV-FLNIKNEILKNKTEIVDCPGSNNKGEVTECIKKQSLDSDIFIFVMTC--TLTDEEKDFFEYQSKLSSKPDIFVLVNKWDNSDKDRQENTNKSRDKIKKEIINLLTKNGNFSSKEASERIFFVSALEMFKSRVENADVFVNKKN--QEAIAMRNYEFTSFEK 765
            + +  +K++FFG+ S GKS V+N +L   +  S +  TT+CF+ V  +D    +L  +GSE+     +++K  V +L   L ++   +L     V V + N K  +LK+   ++D PG +   E+   I K  LD+D+F+ V     TL   EK FF   S+  S+P+IF+L N+WD S  + +      R  +++    L+ + G     +A +RIFFVSA E+  +RV+ A           E   +R +EF +FE+
Sbjct:   92 LARRHMKVAFFGRTSNGKSTVINAMLWDKVLPSGIGHTTNCFLRVGGTDGHEAFLLTEGSEEK----KSVK-TVNQLAHALHQD--EQLHAGSMVSVMWPNSKCPLLKDDLVLMDSPGIDVTTELDSWIDKFCLDADVFVLVANSESTLMQTEKQFFHKVSERLSRPNIFILNNRWDASASEPEYMEEVRRQHMERCTSFLVDELGVVDRAQAGDRIFFVSAKEVLSARVQKAQGMPEGGGALAEGFQVRMFEFQNFER 343          
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Mouse
Match: Mfn2 (mitofusin 2 [Source:MGI Symbol;Acc:MGI:2442230])

HSP 1 Score: 120.939 bits (302), Expect = 5.515e-28
Identity = 81/259 (31.27%), Postives = 135/259 (52.12%), Query Frame = 1
Query:    4 VKKDSIKISFFGKVSAGKSRVLNTILGGNIFVSAVADTTSCFVSVTKSDRRCHYLRVDGSEDNFGSLENLKDKVKELTTYLSKNINRRLDTAKTVQV-FLNIKNEILKNKTEIVDCPGSNNKGEVTECIKKQSLDSDIFIFVMTC--TLTDEEKDFFEYQSKLSSKPDIFVLVNKWDNSDKDRQENTNKSRDKIKKEIINLLTKNGNFSSKEASERIFFVSALEMFKSRVENADVFVNKKN--QEAIAMRNYEFTSFEK 765
            + +  +K++FFG+ S GKS V+N +L   +  S +  TT+CF+ V  +D    +L  +GSE+     +++K  V +L   L ++   +L     V V + N K  +LK+   ++D PG +   E+   I K  LD+D+F+ V     TL   EK FF   S+  S+P+IF+L N+WD S  + +      R  +++    L+ + G     +A +RIFFVSA E+  +RV+ A           E   +R +EF +FE+
Sbjct:   92 LARRHMKVAFFGRTSNGKSTVINAMLWDKVLPSGIGHTTNCFLRVGGTDGHEAFLLTEGSEEK----KSVK-TVNQLAHALHQD--EQLHAGSMVSVMWPNSKCPLLKDDLVLMDSPGIDVTTELDSWIDKFCLDADVFVLVANSESTLMQTEKQFFHKVSERLSRPNIFILNNRWDASASEPEYMEEVRRQHMERCTSFLVDELGVVDRAQAGDRIFFVSAKEVLSARVQKAQGMPEGGGALAEGFQVRMFEFQNFER 343          
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Mouse
Match: Mfn2 (mitofusin 2 [Source:MGI Symbol;Acc:MGI:2442230])

HSP 1 Score: 120.939 bits (302), Expect = 5.515e-28
Identity = 81/259 (31.27%), Postives = 135/259 (52.12%), Query Frame = 1
Query:    4 VKKDSIKISFFGKVSAGKSRVLNTILGGNIFVSAVADTTSCFVSVTKSDRRCHYLRVDGSEDNFGSLENLKDKVKELTTYLSKNINRRLDTAKTVQV-FLNIKNEILKNKTEIVDCPGSNNKGEVTECIKKQSLDSDIFIFVMTC--TLTDEEKDFFEYQSKLSSKPDIFVLVNKWDNSDKDRQENTNKSRDKIKKEIINLLTKNGNFSSKEASERIFFVSALEMFKSRVENADVFVNKKN--QEAIAMRNYEFTSFEK 765
            + +  +K++FFG+ S GKS V+N +L   +  S +  TT+CF+ V  +D    +L  +GSE+     +++K  V +L   L ++   +L     V V + N K  +LK+   ++D PG +   E+   I K  LD+D+F+ V     TL   EK FF   S+  S+P+IF+L N+WD S  + +      R  +++    L+ + G     +A +RIFFVSA E+  +RV+ A           E   +R +EF +FE+
Sbjct:   92 LARRHMKVAFFGRTSNGKSTVINAMLWDKVLPSGIGHTTNCFLRVGGTDGHEAFLLTEGSEEK----KSVK-TVNQLAHALHQD--EQLHAGSMVSVMWPNSKCPLLKDDLVLMDSPGIDVTTELDSWIDKFCLDADVFVLVANSESTLMQTEKQFFHKVSERLSRPNIFILNNRWDASASEPEYMEEVRRQHMERCTSFLVDELGVVDRAQAGDRIFFVSAKEVLSARVQKAQGMPEGGGALAEGFQVRMFEFQNFER 343          
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Mouse
Match: Mfn2 (mitofusin 2 [Source:MGI Symbol;Acc:MGI:2442230])

HSP 1 Score: 120.939 bits (302), Expect = 5.515e-28
Identity = 81/259 (31.27%), Postives = 135/259 (52.12%), Query Frame = 1
Query:    4 VKKDSIKISFFGKVSAGKSRVLNTILGGNIFVSAVADTTSCFVSVTKSDRRCHYLRVDGSEDNFGSLENLKDKVKELTTYLSKNINRRLDTAKTVQV-FLNIKNEILKNKTEIVDCPGSNNKGEVTECIKKQSLDSDIFIFVMTC--TLTDEEKDFFEYQSKLSSKPDIFVLVNKWDNSDKDRQENTNKSRDKIKKEIINLLTKNGNFSSKEASERIFFVSALEMFKSRVENADVFVNKKN--QEAIAMRNYEFTSFEK 765
            + +  +K++FFG+ S GKS V+N +L   +  S +  TT+CF+ V  +D    +L  +GSE+     +++K  V +L   L ++   +L     V V + N K  +LK+   ++D PG +   E+   I K  LD+D+F+ V     TL   EK FF   S+  S+P+IF+L N+WD S  + +      R  +++    L+ + G     +A +RIFFVSA E+  +RV+ A           E   +R +EF +FE+
Sbjct:   92 LARRHMKVAFFGRTSNGKSTVINAMLWDKVLPSGIGHTTNCFLRVGGTDGHEAFLLTEGSEEK----KSVK-TVNQLAHALHQD--EQLHAGSMVSVMWPNSKCPLLKDDLVLMDSPGIDVTTELDSWIDKFCLDADVFVLVANSESTLMQTEKQFFHKVSERLSRPNIFILNNRWDASASEPEYMEEVRRQHMERCTSFLVDELGVVDRAQAGDRIFFVSAKEVLSARVQKAQGMPEGGGALAEGFQVRMFEFQNFER 343          
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Mouse
Match: Mfn1 (mitofusin 1 [Source:MGI Symbol;Acc:MGI:1914664])

HSP 1 Score: 117.857 bits (294), Expect = 5.829e-27
Identity = 83/260 (31.92%), Postives = 137/260 (52.69%), Query Frame = 1
Query:    4 VKKDSIKISFFGKVSAGKSRVLNTILGGNIFVSAVADTTSCFVSVTKSDRRCHYLRVDGSEDNFGSLENLKDKVKELTTYLSKNINRRLDTAKTVQVFLN-IKNEILKNKTEIVDCPGSNNKGEVTECIKKQSLDSDIFIFVMTC--TLTDEEKDFFEYQSKLSSKPDIFVLVNKWDNSDKDRQENTNKSRDKIKKEIINLLTKNGNFSSKEASERIFFVSALEMFKSRVENADVFVNKKN--QEAIAMRNYEFTSFEKS 768
            + +  +K++FFG+ S+GKS V+N +L   +  S +  TT+CF+SV  +D    YL  +GS++     +++K  V +L   L  ++++ L     V VF    K  +L++   +VD PG++   E+   I K  LD+D+F+ V     TL + EK FF   ++  SKP+IF+L N+WD S  + +   +  R  +++ +  L+ +    S  EA  RIFFVSA E+  SR   A           E    R  EF +FE++
Sbjct:   71 LSRRHMKVAFFGRTSSGKSSVINAMLWDKVLPSGIGHTTNCFLSVEGTDGDKAYLMTEGSDEK----KSVK-TVNQLAHAL--HMDKDLKAGCLVHVFWPKAKCALLRDDLVLVDSPGTDVTTELDIWIDKFCLDADVFVLVANSESTLMNTEKHFFHKVNERLSKPNIFILNNRWDASASEPEYMEDVRRQHMERCLHFLVEELKVVSPSEARNRIFFVSAKEVLNSRKHKAQGMPEGGGALAEGFQARLQEFQNFEQT 323          
BLAST of Dynamin-type G domain-containing protein vs. UniProt/SwissProt
Match: sp|Q7YU24|MARF_DROME (Transmembrane GTPase Marf OS=Drosophila melanogaster OX=7227 GN=Marf PE=1 SV=1)

HSP 1 Score: 130.568 bits (327), Expect = 3.889e-30
Identity = 87/262 (33.21%), Postives = 141/262 (53.82%), Query Frame = 1
Query:    4 VKKDSIKISFFGKVSAGKSRVLNTILGGNIFVSAVADTTSCFVSVTKSDRRCHYLRVDGSEDNFGSLENLKDKVKELTTYLSKNINRRLDTAKTVQVFLNIKN-EILKNKTEIVDCPGSNNKGEVTECIKKQSLDSDIFIFVMTC--TLTDEEKDFFEYQSKLSSKPDIFVLVNKWDNSDKDRQENTNKSRDKIKKEIINLLTKNGNFSS-KEASERIFFVSALEMFKSRVENADVFVNKKNQEAIA----MRNYEFTSFEK 765
            +++D +K++FFG+ S GKS V+N +L   I  S +  TT+CF  V  S+    YL  +GSE+    +      +K+L   L +    +L  +  V++F   +   +L++    VD PG +    + + I    L++D+F+ V+    T+T  EK FF   S+  SKP+IF+L N+WD S  +  E     + +  +  I+ LTK    S+ KEA+ER+FFVSA E  ++R+E A    N  +  AIA    +R +EF  FE+
Sbjct:  133 LQRDHMKVAFFGRTSNGKSSVINAMLREKILPSGIGHTTNCFCQVEGSNGGEAYLMTEGSEEKLNVV-----NIKQLANALCQ---EKLCESSLVRIFWPRERCSLLRDDVVFVDSPGVDVSANLDDWIDNHCLNADVFVLVLNAESTMTRAEKQFFHTVSQKLSKPNIFILNNRWDAS-ANEPECQESVKSQHTERCIDFLTKELKVSNEKEAAERVFFVSARETLQARIEEAK--GNPPHMGAIAEGFQIRYFEFQDFER 383          
BLAST of Dynamin-type G domain-containing protein vs. UniProt/SwissProt
Match: sp|O95140|MFN2_HUMAN (Mitofusin-2 OS=Homo sapiens OX=9606 GN=MFN2 PE=1 SV=3)

HSP 1 Score: 121.324 bits (303), Expect = 2.706e-27
Identity = 79/259 (30.50%), Postives = 133/259 (51.35%), Query Frame = 1
Query:    4 VKKDSIKISFFGKVSAGKSRVLNTILGGNIFVSAVADTTSCFVSVTKSDRRCHYLRVDGSEDNFGSLENLKDKVKELTTYLSKNINRRLDTAKTVQV-FLNIKNEILKNKTEIVDCPGSNNKGEVTECIKKQSLDSDIFIFVMTC--TLTDEEKDFFEYQSKLSSKPDIFVLVNKWDNSDKDRQENTNKSRDKIKKEIINLLTKNGNFSSKEASERIFFVSALEMFKSRVENADVFVNKKN--QEAIAMRNYEFTSFEK 765
            + +  +K++FFG+ S GKS V+N +L   +  S +  TT+CF+ V  +D    +L  +GSE+   +       V +L   L ++  ++L     V V + N K  +LK+   ++D PG +   E+   I K  LD+D+F+ V     TL   EK FF   S+  S+P+IF+L N+WD S  + +      R  +++    L+ + G     +A +RIFFVSA E+  +R++ A           E   +R +EF +FE+
Sbjct:   92 LARRHMKVAFFGRTSNGKSTVINAMLWDKVLPSGIGHTTNCFLRVEGTDGHEAFLLTEGSEEKRSA-----KTVNQLAHALHQD--KQLHAGSLVSVMWPNSKCPLLKDDLVLMDSPGIDVTTELDSWIDKFCLDADVFVLVANSESTLMQTEKHFFHKVSERLSRPNIFILNNRWDASASEPEYMEEVRRQHMERCTSFLVDELGVVDRSQAGDRIFFVSAKEVLNARIQKAQGMPEGGGALAEGFQVRMFEFQNFER 343          
BLAST of Dynamin-type G domain-containing protein vs. UniProt/SwissProt
Match: sp|Q8R500|MFN2_RAT (Mitofusin-2 OS=Rattus norvegicus OX=10116 GN=Mfn2 PE=1 SV=1)

HSP 1 Score: 121.324 bits (303), Expect = 3.348e-27
Identity = 81/259 (31.27%), Postives = 135/259 (52.12%), Query Frame = 1
Query:    4 VKKDSIKISFFGKVSAGKSRVLNTILGGNIFVSAVADTTSCFVSVTKSDRRCHYLRVDGSEDNFGSLENLKDKVKELTTYLSKNINRRLDTAKTVQV-FLNIKNEILKNKTEIVDCPGSNNKGEVTECIKKQSLDSDIFIFVMTC--TLTDEEKDFFEYQSKLSSKPDIFVLVNKWDNSDKDRQENTNKSRDKIKKEIINLLTKNGNFSSKEASERIFFVSALEMFKSRVENADVFVNKKN--QEAIAMRNYEFTSFEK 765
            + +  +K++FFG+ S GKS V+N +L   +  S +  TT+CF+ V  +D    +L  +GSE+     +++K  V +L   L ++   +L     V V + N K  +LK+   ++D PG +   E+   I K  LD+D+F+ V     TL   EK FF   S+  S+P+IF+L N+WD S  + +      R  +++    L+ + G     +A +RIFFVSA E+  +RV+ A           E   +R +EF +FE+
Sbjct:   92 LARRHMKVAFFGRTSNGKSTVINAMLWDKVLPSGIGHTTNCFLRVGGTDGHEAFLLTEGSEEK----KSVK-TVNQLAHALHQD--EQLHAGSLVSVMWPNSKCPLLKDGLVLMDSPGIDVTTELDSWIDKFCLDADVFVLVANSESTLMQTEKQFFHKVSERLSRPNIFILNNRWDASASEPEYMEEVRRQHMERCTSFLVDELGVVDRAQAGDRIFFVSAKEVLSARVQKAQGMPEGGGALAEGFQVRMFEFQNFER 343          
BLAST of Dynamin-type G domain-containing protein vs. UniProt/SwissProt
Match: sp|Q80U63|MFN2_MOUSE (Mitofusin-2 OS=Mus musculus OX=10090 GN=Mfn2 PE=1 SV=3)

HSP 1 Score: 120.939 bits (302), Expect = 3.858e-27
Identity = 81/259 (31.27%), Postives = 135/259 (52.12%), Query Frame = 1
Query:    4 VKKDSIKISFFGKVSAGKSRVLNTILGGNIFVSAVADTTSCFVSVTKSDRRCHYLRVDGSEDNFGSLENLKDKVKELTTYLSKNINRRLDTAKTVQV-FLNIKNEILKNKTEIVDCPGSNNKGEVTECIKKQSLDSDIFIFVMTC--TLTDEEKDFFEYQSKLSSKPDIFVLVNKWDNSDKDRQENTNKSRDKIKKEIINLLTKNGNFSSKEASERIFFVSALEMFKSRVENADVFVNKKN--QEAIAMRNYEFTSFEK 765
            + +  +K++FFG+ S GKS V+N +L   +  S +  TT+CF+ V  +D    +L  +GSE+     +++K  V +L   L ++   +L     V V + N K  +LK+   ++D PG +   E+   I K  LD+D+F+ V     TL   EK FF   S+  S+P+IF+L N+WD S  + +      R  +++    L+ + G     +A +RIFFVSA E+  +RV+ A           E   +R +EF +FE+
Sbjct:   92 LARRHMKVAFFGRTSNGKSTVINAMLWDKVLPSGIGHTTNCFLRVGGTDGHEAFLLTEGSEEK----KSVK-TVNQLAHALHQD--EQLHAGSMVSVMWPNSKCPLLKDDLVLMDSPGIDVTTELDSWIDKFCLDADVFVLVANSESTLMQTEKQFFHKVSERLSRPNIFILNNRWDASASEPEYMEEVRRQHMERCTSFLVDELGVVDRAQAGDRIFFVSAKEVLSARVQKAQGMPEGGGALAEGFQVRMFEFQNFER 343          
BLAST of Dynamin-type G domain-containing protein vs. UniProt/SwissProt
Match: sp|Q8R4Z9|MFN1_RAT (Mitofusin-1 OS=Rattus norvegicus OX=10116 GN=Mfn1 PE=1 SV=1)

HSP 1 Score: 117.857 bits (294), Expect = 3.210e-26
Identity = 83/260 (31.92%), Postives = 138/260 (53.08%), Query Frame = 1
Query:    4 VKKDSIKISFFGKVSAGKSRVLNTILGGNIFVSAVADTTSCFVSVTKSDRRCHYLRVDGSEDNFGSLENLKDKVKELTTYLSKNINRRLDTAKTVQVFLN-IKNEILKNKTEIVDCPGSNNKGEVTECIKKQSLDSDIFIFVMTC--TLTDEEKDFFEYQSKLSSKPDIFVLVNKWDNSDKDRQENTNKSRDKIKKEIINLLTKNGNFSSKEASERIFFVSALEMFKSRVENADVFVNKKN--QEAIAMRNYEFTSFEKS 768
            + +  +K++FFG+ S+GKS V+N +L   +  S +  TT+CF+SV  +D    YL  +GS++     +++K  V +L   L  ++++ L     V VF    K  +L++   +VD PG++   E+   I K  LD+D+F+ V     TL + EK FF   ++  SKP+IF+L N+WD S  + +   +  R  +++ +  L+ +    S  EA  RIFFVSA E+  SR+  A           E    R  EF +FE++
Sbjct:   71 LSRRHMKVAFFGRTSSGKSSVINAMLWDKVLPSGIGHTTNCFLSVEGTDGDKAYLMTEGSDEK----KSVK-TVNQLAHAL--HMDKDLKAGCLVHVFWPKAKCALLRDDLVLVDSPGTDVTTELDIWIDKFCLDADVFVLVANSESTLMNTEKHFFHKVNERLSKPNIFILNNRWDASASEPEYMEDVRRQHMERCLHFLVEELKVVSPLEARNRIFFVSAKEVLNSRMNKAQGMPEGGGALAEGFQARLQEFQNFEQT 323          
BLAST of Dynamin-type G domain-containing protein vs. TrEMBL
Match: A0A1I8P414 (Dynamin-type G domain-containing protein OS=Stomoxys calcitrans OX=35570 GN=106083566 PE=3 SV=1)

HSP 1 Score: 137.502 bits (345), Expect = 6.475e-30
Identity = 91/264 (34.47%), Postives = 144/264 (54.55%), Query Frame = 1
Query:    4 VKKDSIKISFFGKVSAGKSRVLNTILGGNIFVSAVADTTSCFVSVTKSDRRCHYLRVDGSEDNFGSLENLKDKVKELTTYLSKNINRRLDTAKTVQVFLNIKN-EILKNKTEIVDCPGSNNKGEVTECIKKQSLDSDIFIFVMTC--TLTDEEKDFFEYQSKLSSKPDIFVLVNKWDNS--DKDRQENTNKSRDKIKKEIINLLTKNGNFSS-KEASERIFFVSALEMFKSRVENADVFVNKKNQEAIAM----RNYEFTSFEK 765
            + +D +K++FFG+ S GKS V+N +L   I  S +  TT+CF  V  SD    YL  +GS++    +      +K+L   L +    +L  +  V++F   +   +L++    VD PG +    + + I    L++D+F+ V+    T+T  EK FF   S+  SKP+IF+L N+WD S  + + QE+  K + +  +  I+ LTK    SS KEA+ER+FFVSA E  ++R+E A    N  +Q AIA     R +EF  FE+
Sbjct:  123 LARDHMKVAFFGRTSNGKSSVINAMLREKILPSGIGHTTNCFCQVEGSDSSEAYLVKEGSDEKLNVV-----NIKQLANALCQ---EKLSESSLVRIFWPRERCMLLRDDVVFVDSPGVDVSANLDDWIDNHCLNADVFVLVLNAESTMTRAEKQFFHTVSQKLSKPNIFILNNRWDASANEPESQESLEKVKSQHTERCIDFLTKELKVSSEKEAAERVFFVSAREALQARIEEAK--GNSPSQGAIAEGFHNRYFEFQDFER 376          
BLAST of Dynamin-type G domain-containing protein vs. TrEMBL
Match: B4R5L5 (GD16797 OS=Drosophila simulans OX=7240 GN=Dsim\GD16797 PE=3 SV=1)

HSP 1 Score: 129.798 bits (325), Expect = 3.173e-29
Identity = 87/262 (33.21%), Postives = 141/262 (53.82%), Query Frame = 1
Query:    4 VKKDSIKISFFGKVSAGKSRVLNTILGGNIFVSAVADTTSCFVSVTKSDRRCHYLRVDGSEDNFGSLENLKDKVKELTTYLSKNINRRLDTAKTVQVFLNIKN-EILKNKTEIVDCPGSNNKGEVTECIKKQSLDSDIFIFVMTC--TLTDEEKDFFEYQSKLSSKPDIFVLVNKWDNSDKDRQENTNKSRDKIKKEIINLLTKNGNFSS-KEASERIFFVSALEMFKSRVENADVFVNKKNQEAIA----MRNYEFTSFEK 765
            +++D +K++FFG+ S GKS V+N +L   I  S +  TT+CF  V  S+    YL  +GSE+    +      +K+L   L +    +L  +  V++F   +   +L++    VD PG +    + + I    L++D+F+ V+    T+T  EK FF   S+  SKP+IF+L N+WD S  +  E     + +  +  I+ LTK    S+ KEA+ER+FFVSA E  ++R+E A    N  +  AIA    +R +EF  FE+
Sbjct:   89 LQRDHMKVAFFGRTSNGKSSVINAMLREKILPSGIGHTTNCFCQVEGSNGGEAYLMTEGSEEKLNVV-----NIKQLANALCQ---EKLCESSLVRIFWPRERCSLLRDDVVFVDSPGVDVSANLDDWIDNHCLNADVFVLVLNAESTMTRAEKQFFHTVSQKLSKPNIFILNNRWDAS-ANEPECQESVKSQHTERCIDFLTKELKVSNEKEAAERVFFVSARETLQARIEEAK--GNPPHMGAIAEGFQIRYFEFQDFER 339          
BLAST of Dynamin-type G domain-containing protein vs. TrEMBL
Match: T1P9C3 (Dynamin-type G domain-containing protein OS=Musca domestica OX=7370 GN=101901601 PE=2 SV=1)

HSP 1 Score: 134.806 bits (338), Expect = 4.289e-29
Identity = 96/299 (32.11%), Postives = 154/299 (51.51%), Query Frame = 1
Query:    4 VKKDSIKISFFGKVSAGKSRVLNTILGGNIFVSAVADTTSCFVSVTKSDRRCHYLRVDGSEDNFGSLENLKDKVKELTTYLSKNINRRLDTAKTVQVFLNIKN-EILKNKTEIVDCPGSNNKGEVTECIKKQSLDSDIFIFVMTC--TLTDEEKDFFEYQSKLSSKPDIFVLVNKWDNSDKDRQENTNKSRDKIKKEIINLLTKNGNFSS-KEASERIFFVSALEMFKSRVENADVFVNKKNQEAIA----MRNYEFTSFEKSLSRGFRAIKASIQGKM--------SFYGLLRSLYKN 852
            + +D +K++FFG+ S GKS V+N +L   I  S +  TT+CF  V  SD    YL  +GSE+    +      +K+L   L +    +L  +  V++F   +   +L++    VD PG +    + + I    L++D+F+ V+    T+T  EK FF   S+  SKP+IF+L N+WD S  +  E+    R +  +  I+ LTK    ++ KEA+ER+FFVSA E  ++R+E A    N  +Q AIA     R +EF  FE+         K+++Q K         +  G +RS+  N
Sbjct:  122 LARDHMKVAFFGRTSNGKSSVINAMLREKILPSGIGHTTNCFCQVEGSDSSEAYLMKEGSEEKLNVV-----NIKQLANALCQ---EKLSESSLVRIFWPRERCNLLRDDVVFVDSPGVDVSANLDDWIDNHCLNADVFVLVLNAESTMTRAEKQFFHTVSQKLSKPNIFILNNRWDAS-ANEPESQESVRSQHTERCIDFLTKELKVTNEKEAAERVFFVSAREALQARIEEAK--GNSPSQGAIAEGFHARYFEFQDFERKFEECIS--KSAVQTKFEKHSSRGKTLSGDMRSMLDN 407          
BLAST of Dynamin-type G domain-containing protein vs. TrEMBL
Match: A0A1L2F5M3 (Mitochondrial assembly regulatory factor OS=Drosophila bipectinata OX=42026 GN=Marf PE=3 SV=1)

HSP 1 Score: 133.65 bits (335), Expect = 9.918e-29
Identity = 98/298 (32.89%), Postives = 155/298 (52.01%), Query Frame = 1
Query:    4 VKKDSIKISFFGKVSAGKSRVLNTILGGNIFVSAVADTTSCFVSVTKSDRRCHYLRVDGSEDNFGSLENLKDKVKELTTYLSKNINRRLDTAKTVQVFLNIKN-EILKNKTEIVDCPGSNNKGEVTECIKKQSLDSDIFIFVMTC--TLTDEEKDFFEYQSKLSSKPDIFVLVNKWDNSDKDRQENTNKSRDKIKKEIINLLTKNGNFSS-KEASERIFFVSALEMFKSRVENADVFVNKKNQEAIA----MRNYEFTSFEKSLSRGF--RAIKASIQ-----GKMSFYGLLRSLYKN 852
            +++D +K++FFG+ S GKS V+N +L   I  S +  TT+CF  V  S+    YL  +GS+++   +      +K+L   L +    +L  +  V++F   K   +L++    VD PG +    + + I    L++D+F+ V+    T+T  EK FF   S+  SKP+IF+L N+WD S  +  E     + +  +  I+ LTK    S+ KEA+ER+FFVSA E  ++R+E A    N  +  AIA    MR +EF  FE+         A+K   Q     GK S  G +RS+  N
Sbjct:  129 LQRDHMKVAFFGRTSNGKSSVINAMLREKILPSGIGHTTNCFCQVEGSNGDEAYLMTEGSDEHINVV-----NIKQLANALCQ---EKLCESSLVRIFWPRKRCSLLRDDVVFVDSPGVDVSANLDDWIDNHCLNADVFVLVLNAESTMTRAEKQFFHTVSQKLSKPNIFILNNRWDAS-ANEPECQESVKSQHTERCIDFLTKELKVSNEKEAAERVFFVSARETLQARIEEAK--GNPPHMGAIAEGFQMRYFEFQDFERKFEECISQSAVKTKFQQHSSRGK-SVAGDMRSMLDN 414          
BLAST of Dynamin-type G domain-containing protein vs. TrEMBL
Match: A0A1I8P415 (Dynamin-type G domain-containing protein OS=Stomoxys calcitrans OX=35570 GN=106083566 PE=3 SV=1)

HSP 1 Score: 133.265 bits (334), Expect = 1.355e-28
Identity = 89/265 (33.58%), Postives = 142/265 (53.58%), Query Frame = 1
Query:    4 VKKDSIKISFFGKVSAGKSRVLNTILGGNIFVSAVADTTSCFVSVTKSDRRCHYLRVDGSEDNFGSLENLKDKVKELTTYLSKNINRRLDTAKTVQVFLNIKN-EILKNKTEIVDCPGSNNKGEVTECIKKQSLDSDIFIFVMTC--TLTDEEKDFFEYQSKLSSKPDIFVLVNKWD---NSDKDRQENTNKSRDKIKKEIINLLTKNGNFSS-KEASERIFFVSALEMFKSRVENADVFVNKKNQEAIAM----RNYEFTSFEK 765
            + +D +K++FFG+ S GKS V+N +L   I  S +  TT+CF  V  SD    YL  +GS++    +      +K+L   L +    +L  +  V++F   +   +L++    VD PG +    + + I    L++D+F+ V+    T+T  EK FF   S+  SKP+IF+L N+WD   N  + ++    K + +  +  I+ LTK    SS KEA+ER+FFVSA E  ++R+E A    N  +Q AIA     R +EF  FE+
Sbjct:  123 LARDHMKVAFFGRTSNGKSSVINAMLREKILPSGIGHTTNCFCQVEGSDSSEAYLVKEGSDEKLNVV-----NIKQLANALCQ---EKLSESSLVRIFWPRERCMLLRDDVVFVDSPGVDVSANLDDWIDNHCLNADVFVLVLNAESTMTRAEKQFFHTVSQKLSKPNIFILNNRWDASANEPESQESELEKVKSQHTERCIDFLTKELKVSSEKEAAERVFFVSAREALQARIEEAK--GNSPSQGAIAEGFHNRYFEFQDFER 377          
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Cavefish
Match: mfn1b (mitofusin-1 [Source:NCBI gene;Acc:103030239])

HSP 1 Score: 119.783 bits (299), Expect = 9.229e-28
Identity = 85/261 (32.57%), Postives = 134/261 (51.34%), Query Frame = 1
Query:    4 VKKDSIKISFFGKVSAGKSRVLNTILGGNIFVSAVADTTSCFVSVTKSDRRCHYLRVDGSEDNFGSLENLKDKVKELTTYLSKNINRRLDTAKTVQVFLN-IKNEILKNKTEIVDCPGSNNKGEVTECIKKQSLDSDIFIFVMT--CTLTDEEKDFFEYQSKLSSKPDIFVLVNKWDNSDKDRQENTNKSRDKIKKEIINLLTKNGNFSSK-EASERIFFVSALEMFKSRVENADVFVNKKN--QEAIAMRNYEFTSFEKS 768
            + +  +K++FFG+ S GKS V+N +L   +  S +  TT+CF+SV  +D    YL+ +GSE+     E     V +L   L  +++  LD    V+VF    K  +L++   +VD PG++   ++   I K  LD+D+F+ V     TL + EK FF   ++  SKP+IF+L N+WD S  +  E  +  R +     +N L +      + EA   IFFVSA E+  SR++ A           E    R  EF SFE++
Sbjct:   72 LARRHMKVAFFGRTSNGKSTVINAMLRDRVLPSGIGHTTNCFLSVEGTDEDKAYLKTEGSEE-----EKSIKTVNQLAHAL--HMDESLDAGCLVKVFWPKTKCALLRDDLVLVDSPGTDVTTQLDSWIDKFCLDADVFVLVANSESTLMNTEKHFFHKVNERLSKPNIFILNNRWDASASE-PEYMDDVRKQHTDRCVNFLVEELKVVDREEAPNHIFFVSAKEVLNSRMQRAQGMPETGGALAEGFQDRLKEFQSFERT 324          
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Cavefish
Match: mfn1b (mitofusin-1 [Source:NCBI gene;Acc:103030239])

HSP 1 Score: 119.783 bits (299), Expect = 1.045e-27
Identity = 85/261 (32.57%), Postives = 134/261 (51.34%), Query Frame = 1
Query:    4 VKKDSIKISFFGKVSAGKSRVLNTILGGNIFVSAVADTTSCFVSVTKSDRRCHYLRVDGSEDNFGSLENLKDKVKELTTYLSKNINRRLDTAKTVQVFLN-IKNEILKNKTEIVDCPGSNNKGEVTECIKKQSLDSDIFIFVMT--CTLTDEEKDFFEYQSKLSSKPDIFVLVNKWDNSDKDRQENTNKSRDKIKKEIINLLTKNGNFSSK-EASERIFFVSALEMFKSRVENADVFVNKKN--QEAIAMRNYEFTSFEKS 768
            + +  +K++FFG+ S GKS V+N +L   +  S +  TT+CF+SV  +D    YL+ +GSE+     E     V +L   L  +++  LD    V+VF    K  +L++   +VD PG++   ++   I K  LD+D+F+ V     TL + EK FF   ++  SKP+IF+L N+WD S  +  E  +  R +     +N L +      + EA   IFFVSA E+  SR++ A           E    R  EF SFE++
Sbjct:   72 LARRHMKVAFFGRTSNGKSTVINAMLRDRVLPSGIGHTTNCFLSVEGTDEDKAYLKTEGSEE-----EKSIKTVNQLAHAL--HMDESLDAGCLVKVFWPKTKCALLRDDLVLVDSPGTDVTTQLDSWIDKFCLDADVFVLVANSESTLMNTEKHFFHKVNERLSKPNIFILNNRWDASASE-PEYMDDVRKQHTDRCVNFLVEELKVVDREEAPNHIFFVSAKEVLNSRMQRAQGMPETGGALAEGFQDRLKEFQSFERT 324          
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000043809.1 (mitofusin-1-like [Source:NCBI gene;Acc:103034819])

HSP 1 Score: 118.242 bits (295), Expect = 2.919e-27
Identity = 82/260 (31.54%), Postives = 137/260 (52.69%), Query Frame = 1
Query:    4 VKKDSIKISFFGKVSAGKSRVLNTILGGNIFVSAVADTTSCFVSVTKSDRRCHYLRVDGSEDNFGSLENLKDKVKELTTYLSKNINRRLDTAKTVQVFLN-IKNEILKNKTEIVDCPGSNNKGEVTECIKKQSLDSDIFIFVMT--CTLTDEEKDFFEYQSKLSSKPDIFVLVNKWDNSDKDRQENTNKSRDKIKKEIINLLTKNGNFSSKEASERIFFVSALEMFKSRVENADVFVNKKNQEAIAM--RNYEFTSFEKS 768
            + +  +K++FFG+ S GKS V+N +L   +  S +  TT+CF+SV  +D    +L  + SE+     +++K  V +L   L  +++R LD+   V+VF    K  +L++   ++D PG++   E+   I K  LD+D+F+ V     TL + EK FF   S+  SKP+IF+L N+WD S+ + +      +  + + +  L+ +    S  +A  RIFFVSA E   +R+  A          A     R  EF SFE++
Sbjct:   72 LARRQMKVAFFGRTSNGKSTVINAMLRERVLPSGIGHTTNCFISVEGTDGDQAFLTTENSEER----KSIK-TVNQLAHAL--HMDRNLDSGCLVRVFWPKTKCALLRDDLVLMDSPGTDVTSELDSWIDKFCLDADVFVLVANSESTLMNTEKHFFHKVSERISKPNIFILNNRWDASETEPEYLDGVRKQHMDRCVSFLVDELKVVSPDQAPNRIFFVSAKEALSARIHRAQGMPETGAALADGFQDRLQEFQSFERT 324          
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Cavefish
Match: mfn2 (mitofusin 2 [Source:ZFIN;Acc:ZDB-GENE-081105-44])

HSP 1 Score: 116.701 bits (291), Expect = 9.719e-27
Identity = 82/259 (31.66%), Postives = 133/259 (51.35%), Query Frame = 1
Query:    4 VKKDSIKISFFGKVSAGKSRVLNTILGGNIFVSAVADTTSCFVSVTKSDRRCHYLRVDGSEDNFGSLENLKDKVKELTTYLSKNINRRLDTAKTVQV-FLNIKNEILKNKTEIVDCPGSNNKGEVTECIKKQSLDSDIFIFVMTC--TLTDEEKDFFEYQSKLSSKPDIFVLVNKWDNSDKDRQENTNKSRDKIKKEIINLLTKNGNFSSKEASERIFFVSALEMFKSRVENADVFVNKKN--QEAIAMRNYEFTSFEK 765
            + +  +K+ FFG+ S GKS V+N +L   +  S +  TT+CF+ V  +D    +L  +GSE+     +N+K  V +L   L ++ +  LD    V V +   K  +L++   +VD PG +   E+   I K  LD+D+F+ V     TL   EK FF   ++  S P+IF+L N+WD S  + +      R  + +    L+ + G     +AS+RIFFVSA E+ ++RV+ A           E    R +EF +FE+
Sbjct:   92 LSRRHMKVVFFGRTSNGKSSVINAMLWDKVLPSGIGHTTNCFLRVEGTDGNEAFLLTEGSEER----KNVK-TVNQLAHALHQDED--LDAGSLVCVMWPKAKCALLRDDLVLVDSPGIDVTTELDSWIDKFCLDADVFVLVANSESTLMQTEKSFFHKVNERLSSPNIFILNNRWDASASEPEYMEEVRRQHMDRCSSFLVDELGVVDRAQASDRIFFVSAKEVLQARVQKAQGMPEAGGALAEGFQARMFEFQNFER 343          
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Nematostella
Match: EDO42379 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S1L1])

HSP 1 Score: 111.309 bits (277), Expect = 1.699e-25
Identity = 89/289 (30.80%), Postives = 142/289 (49.13%), Query Frame = 1
Query:    4 VKKDSIKISFFGKVSAGKSRVLNTILGGNIFVSAVADTTSCFVSVTKSDRRCHYLRVDGSEDNFGSLENLKDKVKELTTYLSKNINRRLDTAKTVQVFLN-IKNEILKNKTEIVDCPGSNNKGEVTECIKKQSLDSDIFIFVMTC--TLTDEEKDFFEYQSKLSSKPDIFVLVNKWDNSDKDRQENTNKSRDKIKKEIINLLTKNGNFSSKE--------ASERIFFVSALEMFKSRV--------ENADVFVNKKNQEAIAMRNYEFTSFEKSLSRGFRAIKASIQGK 813
            + +D +K++FFG+ S GKS V+N +L   I    +  TT+CF+SV  SD    Y+ +  S++        +  VK L          +LD +  VQV+    + ++L     +VD PG +   ++   I K  LD+D+F+ V     TL   EK+FF   ++  SKP+IF+L N+WD S     E   +  + +KK+    L +N +F SKE        A +R+FFVSA E   SR+        E   + V+  +   +   N+E   FE+ +S      K++IQ K
Sbjct:   91 IARDQMKVAFFGRTSNGKSTVVNAMLQDRILPMGIGHTTNCFLSVNGSDSADPYILIPESDE--------RRNVKTLGQIAHALFEEKLDHSSLVQVYWPKSRCKMLSEDVVLVDSPGIDVSPDLDLWIDKHCLDADVFVLVCNAESTLMVTEKNFFHKVNQKLSKPNIFILNNRWDASAG---EPDVEMMELVKKQ---HLQRNVDFLSKELKCVDKKQAEDRVFFVSAKETLMSRMQKHQGMPEEGGAIHVDGFHGRKLEFENFEH-KFEECIS------KSAIQTK 358          
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000009003.2 (pep primary_assembly:ASM223467v1:17:11595384:11602171:-1 gene:ENSORLG00000007178.2 transcript:ENSORLT00000009003.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 114.775 bits (286), Expect = 1.531e-27
Identity = 81/255 (31.76%), Postives = 129/255 (50.59%), Query Frame = 1
Query:   19 IKISFFGKVSAGKSRVLNTILGGNIFVSAVADTTSCFVSVTKSDRRCHYLRVDGSEDNFGSLENLKDKVKELTTYLSKNINRRLDTAKTVQVFLN-IKNEILKNKTEIVDCPGSNNKGEVTECIKKQSLDSDIFIFV--MTCTLTDEEKDFFEYQSKLSSKPDIFVLVNKWDNSDKDRQENTNKSRDKIKKEIINLLTKNGNFSSKEASERIFFVSALEMFKSRVENADVFVNKKN--QEAIAMRNYEFTSFEKS 768
            +K++FFG+ S GKS V+N +L   +  S +  TT+CF+SV  +D    YL  + SE+           V +L   L  +++  LD++  V+VF    +  +L+N   ++D PG++   E+   I K  LD+D+F+ V     TL + EK FF   S+  SKP+IF+L N+WD S  +        +  + + +  L  + G     EA  RIFF+SA E+  SR++ A           E    R  EF  FE++
Sbjct:   75 MKVAFFGRTSNGKSTVINAMLRDRVLPSGIGHTTNCFLSVEGTDGDEAYLTSEASEER-----RSISTVNQLAHAL--HMDPTLDSSCLVKVFWPKSRCALLRNDLVLMDSPGTDVTLELDSWIDKFCLDADVFVLVGNAESTLMNTEKLFFHKVSERISKPNIFILHNRWDASVTEPDYIQEVRKQHLDRCVGFLAEELGVVGPNEAPGRIFFISAKEVLSSRMQRAQGMPETGGALAEGFHERLTEFQRFERT 322          
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Medaka
Match: mfn1b (mitofusin 1 [Source:NCBI gene;Acc:101158009])

HSP 1 Score: 117.857 bits (294), Expect = 3.800e-27
Identity = 83/260 (31.92%), Postives = 133/260 (51.15%), Query Frame = 1
Query:    4 VKKDSIKISFFGKVSAGKSRVLNTILGGNIFVSAVADTTSCFVSVTKSDRRCHYLRVDGSEDNFGSLENLKDKVKELTTYLSKNINRRLDTAKTVQVFLN-IKNEILKNKTEIVDCPGSNNKGEVTECIKKQSLDSDIFIFVMT--CTLTDEEKDFFEYQSKLSSKPDIFVLVNKWDNSDKDRQENTNKSRDKIKKEIINLLTKNGNFSSKE-ASERIFFVSALEMFKSRVENADVFVNKKN--QEAIAMRNYEFTSFEK 765
            + +  +K++FFG+ S GKS V+N +L   +  S +  TT+CF+SV  +D    YL+ +GS++     E     V ++   L  +++  LD    V+VF    K  +L++   +VD PG++   ++   I K  LD+D+F+ V     TL + EK FF   ++  SKP+IF+L N+WD S  +  E     R +     +N L +      +E A  RIFF+SA E+  SR++ A           E    R  EF SFE+
Sbjct:   83 LARRHMKVAFFGRTSNGKSTVINAMLRDRVLPSGIGHTTNCFLSVEGTDDDRSYLKTEGSDE-----EKSIKTVNQMAHAL--HMDESLDAGCLVRVFWPKTKCALLRDDLVLVDSPGTDVTTQLDSWIDKFCLDADVFVLVANSESTLMNTEKHFFHKVNERLSKPNIFILNNRWDAS-ANEPEYMEDVRKQHTDRCVNFLVEELKVVDREQAPNRIFFISAKEVLNSRMQRAQGMPETGGALAEGFQERLKEFQSFER 334          
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Medaka
Match: mfn1b (mitofusin 1 [Source:NCBI gene;Acc:101158009])

HSP 1 Score: 117.472 bits (293), Expect = 5.208e-27
Identity = 83/255 (32.55%), Postives = 130/255 (50.98%), Query Frame = 1
Query:   19 IKISFFGKVSAGKSRVLNTILGGNIFVSAVADTTSCFVSVTKSDRRCHYLRVDGSEDNFGSLENLKDKVKELTTYLSKNINRRLDTAKTVQVFLN-IKNEILKNKTEIVDCPGSNNKGEVTECIKKQSLDSDIFIFVMT--CTLTDEEKDFFEYQSKLSSKPDIFVLVNKWDNSDKDRQENTNKSRDKIKKEIINLLTKNGNFSSKE-ASERIFFVSALEMFKSRVENADVFVNKKN--QEAIAMRNYEFTSFEK 765
            +K++FFG+ S GKS V+N +L   +  S +  TT+CF+SV  +D    YL+ +GS D   S++ +      L      +++  LD    V+VF    K  +L++   +VD PG++   ++   I K  LD+D+F+ V     TL + EK FF   ++  SKP+IF+L N+WD S  +  E     R +     +N L +      +E A  RIFF+SA E+  SR++ A           E    R  EF SFE+
Sbjct:   88 MKVAFFGRTSNGKSTVINAMLRDRVLPSGIGHTTNCFLSVEGTDDDRSYLKTEGS-DEEKSIKTVNQMAHAL------HMDESLDAGCLVRVFWPKTKCALLRDDLVLVDSPGTDVTTQLDSWIDKFCLDADVFVLVANSESTLMNTEKHFFHKVNERLSKPNIFILNNRWDAS-ANEPEYMEDVRKQHTDRCVNFLVEELKVVDREQAPNRIFFISAKEVLNSRMQRAQGMPETGGALAEGFQERLKEFQSFER 334          
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Medaka
Match: mfn2 (mitofusin 2 [Source:NCBI gene;Acc:101170481])

HSP 1 Score: 112.849 bits (281), Expect = 1.524e-25
Identity = 79/259 (30.50%), Postives = 133/259 (51.35%), Query Frame = 1
Query:    4 VKKDSIKISFFGKVSAGKSRVLNTILGGNIFVSAVADTTSCFVSVTKSDRRCHYLRVDGSEDNFGSLENLKDKVKELTTYLSKNINRRLDTAKTVQV-FLNIKNEILKNKTEIVDCPGSNNKGEVTECIKKQSLDSDIFIFVMTC--TLTDEEKDFFEYQSKLSSKPDIFVLVNKWDNSDKDRQENTNKSRDKIKKEIINLLTKNGNFSSKEASERIFFVSALEMFKSRVENADVFVNKKN--QEAIAMRNYEFTSFEK 765
            + +  +K+ FFG+ S GKS V+N +L   +  S +  TT+CF+ V  +D    +L  +GSE+     +++K  V +L   L ++  + LD    V V +  +K  +L++   +VD PG +   E+   I K  LD+D+F+ V     TL   EK FF   ++  S P+IF+L N+WD S  + +      R  + +    L+ + G     +AS+RIFFVSA E+ ++R++             E    R +EF +FE+
Sbjct:   92 LARRHMKVVFFGRTSNGKSTVINAMLCDKVLPSGIGHTTNCFLRVEGTDGSEGFLLTEGSEEK----KSIK-TVNQLAHALHQD--QDLDAGSLVCVMWPKVKCALLRDDLVLVDSPGIDVTTELDSWIDKFCLDADVFVLVANSESTLMQTEKSFFHKVNERLSSPNIFILNNRWDASASEPEYMDEVRRQHMDRCSNFLVEELGVVDRAQASDRIFFVSAKEVLQARMQRVQGMPEAGGALAEGFQARMFEFQNFER 343          
BLAST of Dynamin-type G domain-containing protein vs. Planmine SMEST
Match: SMESG000014759.1 (SMESG000014759.1)

HSP 1 Score: 519.62 bits (1337), Expect = 1.962e-178
Identity = 263/281 (93.59%), Postives = 266/281 (94.66%), Query Frame = 1
Query:    1 KVKKDSIKISFFGKVSAGKSRVLNTILGGNIFVSAVADTTSCFVSVTKSDRRCHYLRVDGSEDNFGSLENLKDKVKELTTYLSKNINRRLDTAKTVQVFLNIKNEILKNKTEIVDCPGSNNKGEVTECIKKQSLDSDIFIFVMTCTLTDEEKDFFEYQSKLSSKPDIFVLVNKWDNSDKDRQENTNKSRDKIKKEIINLLTKNGNFSSKEASERIFFVSALEMFKSRVENADVFVNKKNQEAIAMRNYEFTSFEKSLS------------RGFRAIKASIQ 807
            KVKKDSIKISFFGKVSAGKSRVLNTILGGNIFVSAVADTTSCFVSVTKSDRRCHYLRVDGSEDNFGSLENLKDKVKELTTYLSKNINRRLDTAKTVQVFLNIKNEILKNKTEIVDCPGSNNKGEVTECIKKQSLDSDIFIFVMTCTLTDEEKDFFEYQSKLSSKPDIFVLVNKWDNSDKDRQENTNKSRDKIKKEIINLLTKNGNFSSKEASERIFFVSALEMFKSRVENADVFVNKKNQEAIAMRNYEFTSFEKSLS            R FR + A+I+
Sbjct:   68 KVKKDSIKISFFGKVSAGKSRVLNTILGGNIFVSAVADTTSCFVSVTKSDRRCHYLRVDGSEDNFGSLENLKDKVKELTTYLSKNINRRLDTAKTVQVFLNIKNEILKNKTEIVDCPGSNNKGEVTECIKKQSLDSDIFIFVMTCTLTDEEKDFFEYQSKLSSKPDIFVLVNKWDNSDKDRQENTNKSRDKIKKEIINLLTKNGNFSSKEASERIFFVSALEMFKSRVENADVFVNKKNQEAIAMRNYEFTSFEKSLSNYIDNPEKKKTKRHFREVTAAIK 348          

HSP 2 Score: 445.662 bits (1145), Expect = 1.186e-149
Identity = 250/250 (100.00%), Postives = 250/250 (100.00%), Query Frame = 3
Query:  936 NYIDNPEKKKTKRHFREVTAAIKEIENVRKDFKEELLGTNKLEEFNKNPMKHLLDSLKRIKSDLISHINKNCSYISDQIQYEVEDLKXXXXXXXXXXXXTKLNSLPTKVSTDLLNLQSDSNEIIEXXXXXXXXXXXXXXXXNKEEKPTLKRALAKNIALQVIPEKSTLGRAWGWAKSFVTDSDEQEVQRTLEKNKQEISMVASEICDYVREFQRNVVNYVCSEYDKRFGIVADRINYIDQYWEFVINVME 1685
            NYIDNPEKKKTKRHFREVTAAIKEIENVRKDFKEELLGTNKLEEFNKNPMKHLLDSLKRIKSDLISHINKNCSYISDQIQYEVEDLKRNINRNNVRDINTKLNSLPTKVSTDLLNLQSDSNEIIEKMKKKFKRVMGKHKFKNKEEKPTLKRALAKNIALQVIPEKSTLGRAWGWAKSFVTDSDEQEVQRTLEKNKQEISMVASEICDYVREFQRNVVNYVCSEYDKRFGIVADRINYIDQYWEFVINVME
Sbjct:  326 NYIDNPEKKKTKRHFREVTAAIKEIENVRKDFKEELLGTNKLEEFNKNPMKHLLDSLKRIKSDLISHINKNCSYISDQIQYEVEDLKRNINRNNVRDINTKLNSLPTKVSTDLLNLQSDSNEIIEKMKKKFKRVMGKHKFKNKEEKPTLKRALAKNIALQVIPEKSTLGRAWGWAKSFVTDSDEQEVQRTLEKNKQEISMVASEICDYVREFQRNVVNYVCSEYDKRFGIVADRINYIDQYWEFVINVME 575          
BLAST of Dynamin-type G domain-containing protein vs. Planmine SMEST
Match: SMESG000014755.1 (SMESG000014755.1)

HSP 1 Score: 398.667 bits (1023), Expect = 1.210e-132
Identity = 200/259 (77.22%), Postives = 227/259 (87.64%), Query Frame = 1
Query:    1 KVKKDSIKISFFGKVSAGKSRVLNTILGGNIFVSAVADTTSCFVSVTKSDRRCHYLRVDGSEDNFGSLENLKDKVKELTTYLSKNINRRLDTAKTVQVFLNIKNEILKNKTEIVDCPGSNNKGEVTECIKKQSLDSDIFIFVMTCTLTDEEKDFFEYQSKLSSKPDIFVLVNKWDNSDKDRQENTNKSRDKIKKEIINLLTKNGNFSSKEASERIFFVSALEMFKSRVENADVFVNKKNQEAIAMRNYEFTSFEKSLSR 777
            KVKKDSIKISFFG VSAGKS+VLNTI+G N+F+SAVADTTSCFV+V KSDR  HYLRV+GSE NF SL NLK+KVKELTT+LS+N   RLDT KTVQVFLNI+NEI+KN TEI DCPGSNNK EVTECI +QSLDSDIFIFVMTCTLT+EEKDFFEYQSKLSSKPDIFVLVNKWD SD+D+   T KSR KIK+EI+NLLTK+GNFSS+EAS+RIFFVSALEMFK R+E  ++F N++ + AI MR  EF SFE+SLSR
Sbjct:   68 KVKKDSIKISFFGTVSAGKSKVLNTIIGENLFLSAVADTTSCFVAVRKSDRGRHYLRVEGSETNFDSLTNLKNKVKELTTHLSENTTGRLDTTKTVQVFLNIENEIMKNNTEIFDCPGSNNKREVTECIMQQSLDSDIFIFVMTCTLTNEEKDFFEYQSKLSSKPDIFVLVNKWDKSDQDKTAVTEKSRIKIKREIVNLLTKDGNFSSEEASKRIFFVSALEMFKCRIERKEIFGNQRTRRAIEMRYEEFLSFEESLSR 326          

HSP 2 Score: 67.0106 bits (162), Expect = 2.244e-11
Identity = 62/150 (41.33%), Postives = 88/150 (58.67%), Query Frame = 3
Query:  939 YIDNPEKKKTKRHFREVTAAIKEIENVRKDFKEELLGTNKLEEFNKNPMKHLLDSLKRIKSDLISHINKNCSYISDQIQYEVEDLKXXXXXXXXXXXXTKLNSLPTKVSTDLLNLQSDSNEIIEXXXXXXXXXXXXXXXXNKEEKPTLKR 1388
            YIDNPE  K +RH REV    + +E++ + FK EL     L E     MK L   L +    ++  + +    I   +     DL+  + RNN++   + LN++ T+VS DL+N+QS+ N+ ++ MKK FKRVMGKHKF  KEEKPTLKR
Sbjct:  327 YIDNPEINKLERHDREVRETTRNLESIIESFKTELFKHKDLRELKTYDMKDLSGRLDKAYECILKDLLRETKEIHMNLSTNCHDLRTFLTRNNIQGTCSMLNTVTTRVSNDLMNIQSNLNKKLQTMKKDFKRVMGKHKFIKKEEKPTLKR 476          
BLAST of Dynamin-type G domain-containing protein vs. Planmine SMEST
Match: SMESG000014762.1 (SMESG000014762.1)

HSP 1 Score: 191.43 bits (485), Expect = 1.799e-52
Identity = 112/265 (42.26%), Postives = 167/265 (63.02%), Query Frame = 1
Query:    1 KVKKDSIKISFFGKVSAGKSRVLNTILGGNIFVSAVADTTSCFVSVTKSDRRCHYLRVDGSEDNFGSLENLKDKVKELTTYLSKNINRRLDTA-KTVQVFLNIKNE-ILKNKTEIVDCPGSNNKGEVTECIKKQSLDSDIFIFVMTCTLTDEEKDFFEYQSKLSSKPDIFVLVNKWDNSDKDRQENTNKSRDKIKKEIINLLTKNGNFSSKEASERIFFVSALEMFKSRVENADVFVNKKNQEAIAMRNYEFTSFEKSLSRGFRA 789
            KV +D +KI  FGKVS GKS +LNT+LG N F S  A TTS FV V KS+   + ++   ++  F    + K+ +KE+   +S +I     TA + ++V + + +E +LK   EIVDCPGS NK ++T+CIKK S ++DIFIFV+   LTD+++ FF+YQ   S+KPD+F+++N+WD SD D +E+T  S++KI +E    L        +E SERI+F+S+ EMF+ R+EN D  +  K+ +    R  EFT FE +L +   A
Sbjct:   74 KVNRDIVKIFLFGKVSVGKSTLLNTMLGDNYFASGTAHTTSSFVHVKKSEDDSYRIKTKDTDRTFT---DKKEFIKEIEI-MSGDIKGNKATANENIEVSIRMDDESLLKKGIEIVDCPGSGNKSQITDCIKKNSQEADIFIFVLNYALTDDDRVFFKYQEDSSTKPDVFIVINQWDESDNDDEESTQMSKEKINEECSKFLQDLDLMKKEEISERIYFLSSSEMFQFRIENDDSLI--KSSKTAKKRFDEFTRFEYNLKKYISA 332          
BLAST of Dynamin-type G domain-containing protein vs. Planmine SMEST
Match: SMESG000014753.1 (SMESG000014753.1)

HSP 1 Score: 182.956 bits (463), Expect = 1.459e-49
Identity = 109/261 (41.76%), Postives = 159/261 (60.92%), Query Frame = 1
Query:    1 KVKKDSIKISFFGKVSAGKSRVLNTILGGNIFVSAVADTTSCFVSVTKSDRRCHYLRVDGSEDNFGSLENLKDKVKELTTYLSKNINRRLDTA-KTVQVFLNIKNE-ILKNKTEIVDCPGSNNKGEVTECIKKQSLDSDIFIFVMTCTLTDEEKDFFEYQSKLSSKPDIFVLVNKWDNSDKDRQENTNKSRDKIKKEIINLLTKNGNFSSKEASERIFFVSALEMFKSRVENADVFVNKKNQEAIAMRNYEFTSFEKSLSR 777
            KV +D +KI  FGKVS GKS++LN +LG N F S  A TTS FV V KS+   + ++   ++  F      K K  E    +S +I     TA +T++V + + +E +LK   EIVDCPGS NK ++T+CIKK S ++DIFIFV+   LTD+++ FF+YQ   S+KPD+F+++N+WD SD D +E+T  S+ KIK+E    L K       E  +RI+F SA EM + R+EN D  V+  +   +  R  +F  FE +L +
Sbjct:   74 KVNRDVVKIFLFGKVSVGKSKLLNAMLGDNYFASGTAHTTSSFVHVKKSEDDSYRIKTKDTDRTFTD----KTKFIEEIERISGDIKGNKATANETIEVSICMDDETLLKKGIEIVDCPGSGNKSQITDCIKKNSQEADIFIFVLNYALTDDDRVFFKYQEDSSTKPDVFIVINQWDESDNDDEESTQMSKTKIKEECSKFLRKLEITKEDEIYDRIYFFSAREMSQIRIENNDSLVD--SDPNVKKRFEDFMRFEYNLKK 328          
BLAST of Dynamin-type G domain-containing protein vs. Planmine SMEST
Match: SMESG000014747.1 (SMESG000014747.1)

HSP 1 Score: 155.606 bits (392), Expect = 3.124e-40
Identity = 93/254 (36.61%), Postives = 155/254 (61.02%), Query Frame = 1
Query:   22 KISFFGKVSAGKSRVLNTILGGNIFVSAVADTTSCFVSVTKSDRRCHYLRVDGSEDNFGSLENLKDKVKELTTYLSKNINRRLDTAKTVQVFLNI--KNEILKNKTEIVDCPGSNNKGEVTECIKKQSLDSDIFIFVMTCTLTDEEKDFFEYQSKLSSKPDIFVLVNKWDNSDKD-RQENTNKSRDKIKKEIINLLTKNGNFSSKEASERIFFVSALEMFKSRVENADVFVNKKNQEAIAMRNYEFTSFEKSLS 774
            KI FFG++S+GKS+++N ILG ++F+SAV  TT+CFV + KSD   + +R  G    + + +   DKV+ ++T    N   +    + V++F+ +   N+ILK   E+VD PGS  +GE++ECI+  + D++IF++V++  +T+E++ FFE+Q K  +KPDIF+L NKWD  D+D   +  +K+   +K    NL+       +K+  +RI+FVSA E+   R+   D+  +K+ +     R  EF  FE  +S
Sbjct:   69 KIYFFGRMSSGKSKLINGILGEDLFLSAVKHTTNCFVHIRKSDNEKYRIRHGGDTFIYDNKKEAMDKVETISTV---NEWSKFTENEFVELFIPLGKDNKILKGNVELVDSPGSGIRGEISECIRNYATDANIFVYVLSDDITEEDERFFEFQ-KTVTKPDIFILFNKWDQLDQDCESKGIDKTYKALKGRCQNLIKTFMGKQTKDIDKRIYFVSAKELLDIRINKKDLNGSKEKE-----RYEEFLHFENYIS 313          
The following BLAST results are available for this feature:
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MFN25.634e-2830.50mitofusin 2 [Source:HGNC Symbol;Acc:HGNC:16877][more]
MFN25.634e-2830.50mitofusin 2 [Source:HGNC Symbol;Acc:HGNC:16877][more]
MFN11.037e-2631.50mitofusin 1 [Source:HGNC Symbol;Acc:HGNC:18262][more]
MFN11.654e-2531.50mitofusin 1 [Source:HGNC Symbol;Acc:HGNC:18262][more]
MFN11.654e-2531.50mitofusin 1 [Source:HGNC Symbol;Acc:HGNC:18262][more]
back to top
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
fzo-14.811e-2529.26Transmembrane GTPase fzo-1 [Source:UniProtKB/Swis... [more]
back to top
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Marf3.300e-3132.83gene:FBgn0029870 transcript:FBtr0343373[more]
Marf3.880e-3133.21gene:FBgn0029870 transcript:FBtr0070910[more]
Marf3.880e-3133.21gene:FBgn0029870 transcript:FBtr0070909[more]
fzo1.938e-2429.92gene:FBgn0011596 transcript:FBtr0084399[more]
back to top
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mfn1b1.097e-2833.46mitofusin 1b [Source:ZFIN;Acc:ZDB-GENE-040426-1553... [more]
mfn1b1.523e-2833.20mitofusin 1b [Source:ZFIN;Acc:ZDB-GENE-040426-1553... [more]
mfn1b4.096e-2732.82mitofusin 1b [Source:ZFIN;Acc:ZDB-GENE-040426-1553... [more]
mfn1b5.496e-2732.57mitofusin 1b [Source:ZFIN;Acc:ZDB-GENE-040426-1553... [more]
mfn1b5.496e-2732.57mitofusin 1b [Source:ZFIN;Acc:ZDB-GENE-040426-1553... [more]
back to top
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mfn15.413e-2631.66mitofusin 1 [Source:NCBI gene;Acc:548943][more]
mfn15.429e-2631.66mitofusin 1 [Source:NCBI gene;Acc:548943][more]
mfn16.024e-2631.66mitofusin 1 [Source:NCBI gene;Acc:548943][more]
mfn16.059e-2632.28mitofusin 1 [Source:NCBI gene;Acc:548943][more]
mfn16.164e-2631.66mitofusin 1 [Source:NCBI gene;Acc:548943][more]
back to top
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Mfn23.678e-2831.27mitofusin 2 [Source:MGI Symbol;Acc:MGI:2442230][more]
Mfn25.515e-2831.27mitofusin 2 [Source:MGI Symbol;Acc:MGI:2442230][more]
Mfn25.515e-2831.27mitofusin 2 [Source:MGI Symbol;Acc:MGI:2442230][more]
Mfn25.515e-2831.27mitofusin 2 [Source:MGI Symbol;Acc:MGI:2442230][more]
Mfn15.829e-2731.92mitofusin 1 [Source:MGI Symbol;Acc:MGI:1914664][more]
back to top
BLAST of Dynamin-type G domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q7YU24|MARF_DROME3.889e-3033.21Transmembrane GTPase Marf OS=Drosophila melanogast... [more]
sp|O95140|MFN2_HUMAN2.706e-2730.50Mitofusin-2 OS=Homo sapiens OX=9606 GN=MFN2 PE=1 S... [more]
sp|Q8R500|MFN2_RAT3.348e-2731.27Mitofusin-2 OS=Rattus norvegicus OX=10116 GN=Mfn2 ... [more]
sp|Q80U63|MFN2_MOUSE3.858e-2731.27Mitofusin-2 OS=Mus musculus OX=10090 GN=Mfn2 PE=1 ... [more]
sp|Q8R4Z9|MFN1_RAT3.210e-2631.92Mitofusin-1 OS=Rattus norvegicus OX=10116 GN=Mfn1 ... [more]
back to top
BLAST of Dynamin-type G domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1I8P4146.475e-3034.47Dynamin-type G domain-containing protein OS=Stomox... [more]
B4R5L53.173e-2933.21GD16797 OS=Drosophila simulans OX=7240 GN=Dsim\GD1... [more]
T1P9C34.289e-2932.11Dynamin-type G domain-containing protein OS=Musca ... [more]
A0A1L2F5M39.918e-2932.89Mitochondrial assembly regulatory factor OS=Drosop... [more]
A0A1I8P4151.355e-2833.58Dynamin-type G domain-containing protein OS=Stomox... [more]
back to top
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
mfn1b9.229e-2832.57mitofusin-1 [Source:NCBI gene;Acc:103030239][more]
mfn1b1.045e-2732.57mitofusin-1 [Source:NCBI gene;Acc:103030239][more]
ENSAMXT00000043809.12.919e-2731.54mitofusin-1-like [Source:NCBI gene;Acc:103034819][more]
mfn29.719e-2731.66mitofusin 2 [Source:ZFIN;Acc:ZDB-GENE-081105-44][more]
back to top
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO423791.699e-2530.80Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ENSORLT00000009003.21.531e-2731.76pep primary_assembly:ASM223467v1:17:11595384:11602... [more]
mfn1b3.800e-2731.92mitofusin 1 [Source:NCBI gene;Acc:101158009][more]
mfn1b5.208e-2732.55mitofusin 1 [Source:NCBI gene;Acc:101158009][more]
mfn21.524e-2530.50mitofusin 2 [Source:NCBI gene;Acc:101170481][more]
back to top
BLAST of Dynamin-type G domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000014759.11.962e-17893.59SMESG000014759.1[more]
SMESG000014755.11.210e-13277.22SMESG000014755.1[more]
SMESG000014762.11.799e-5242.26SMESG000014762.1[more]
SMESG000014753.11.459e-4941.76SMESG000014753.1[more]
SMESG000014747.13.124e-4036.61SMESG000014747.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30008898 ID=SMED30008898|Name=Dynamin-type G domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1951bp
AAAGTGAAAAAGGATTCGATTAAAATCTCCTTTTTTGGAAAGGTCTCCGC
TGGTAAAAGCCGCGTTTTAAATACGATTCTTGGAGGAAATATATTTGTAT
CAGCAGTAGCAGATACGACTTCGTGTTTCGTAAGTGTTACTAAATCCGAT
AGGCGCTGCCATTACTTACGGGTGGATGGCTCGGAGGATAATTTTGGTTC
CTTGGAAAATTTGAAGGATAAGGTTAAAGAATTGACAACTTACCTGAGTA
AGAACATTAATAGACGATTGGATACTGCGAAGACCGTCCAAGTATTCCTC
AACATCAAAAACGAGATATTGAAGAACAAAACCGAAATCGTCGACTGTCC
AGGCAGCAATAACAAAGGAGAAGTGACAGAATGTATCAAGAAACAATCTC
TAGATTCAGATATCTTCATTTTTGTTATGACATGCACTCTTACAGATGAA
GAAAAAGATTTCTTTGAATACCAATCAAAGTTATCGTCAAAGCCAGACAT
TTTCGTGTTGGTTAATAAATGGGATAATTCAGATAAAGATCGACAAGAAA
ATACAAATAAAAGTCGCGATAAAATTAAAAAAGAAATAATTAATCTTCTC
ACTAAGAATGGCAATTTTAGTTCGAAAGAAGCTTCAGAAAGAATATTTTT
TGTGTCGGCGCTGGAAATGTTTAAAAGTCGAGTTGAAAATGCAGATGTAT
TTGTTAATAAAAAGAATCAAGAAGCAATTGCGATGCGAAATTACGAATTT
ACCTCATTTGAAAAGTCACTGTCGAGAGGATTTAGAGCTATCAAAGCATC
TATTCAAGGAAAAATGTCTTTTTATGGCTTGCTACGTTCGCTATATAAGA
ACAGATCATTCAAAAGGCTTTTCTCAAAATTATTGTTTTTGCTCAATACT
GAATTTTTTCACAATTTGAATTCTTCGACTTCTAGAATTATATTGACAAT
CCAGAAAAGAAAAAAACCAAACGGCACTTCAGGGAGGTGACTGCCGCAAT
CAAAGAAATTGAAAACGTGAGAAAGGATTTTAAAGAGGAATTATTAGGAA
CAAATAAATTAGAAGAGTTTAATAAGAATCCAATGAAACATTTGTTGGAC
TCTCTTAAAAGGATAAAAAGTGATTTAATAAGTCACATAAATAAAAACTG
TTCTTATATATCTGACCAAATACAATACGAAGTTGAGGATCTGAAAAGGA
ACATTAACAGGAACAATGTCAGGGATATAAACACAAAATTAAACTCTCTG
CCAACAAAGGTGAGCACAGACCTACTAAATCTCCAAAGTGATTCAAATGA
GATAATTGAAAAAATGAAGAAAAAATTTAAAAGAGTAATGGGGAAACATA
AATTTAAAAATAAGGAAGAAAAGCCAACACTGAAAAGAGCTTTAGCAAAG
AATATTGCTTTACAAGTAATTCCTGAGAAGTCAACATTGGGTCGTGCTTG
GGGATGGGCTAAATCATTTGTTACTGACAGTGATGAGCAAGAGGTCCAAA
GGACTTTAGAAAAAAACAAACAAGAAATCTCTATGGTTGCAAGTGAAATA
TGTGATTATGTGAGAGAATTTCAAAGAAACGTAGTAAATTATGTCTGTAG
CGAATATGATAAAAGGTTTGGAATAGTGGCAGATAGGATCAACTACATTG
ATCAGTACTGGGAATTTGTGATCAATGTCATGGAATAATTAGGCTTTGAA
TGCCACTATTATCATTGAAACATTTAGTTTTACGTATACATTAGAATTTT
TAATATTATAATATTCACATTTTGTCTTTGATGCAATAATAGCCGCAAAA
TCTCATTTAAGGTTTCTTTTCAAGTGACAAGGAAATCCTTTTGAACGATT
CGCAGTCCAGTTTTCTCGAAACCTAACTGAATATCTGACCTCAAAGAGGC
TTCAAAACTAACGTGACATTAAAATATAATCTTAAAGTCACACACACACA
C
back to top

protein sequence of SMED30008898-orf-1

>SMED30008898-orf-1 ID=SMED30008898-orf-1|Name=SMED30008898-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=330bp
KVKKDSIKISFFGKVSAGKSRVLNTILGGNIFVSAVADTTSCFVSVTKSD
RRCHYLRVDGSEDNFGSLENLKDKVKELTTYLSKNINRRLDTAKTVQVFL
NIKNEILKNKTEIVDCPGSNNKGEVTECIKKQSLDSDIFIFVMTCTLTDE
EKDFFEYQSKLSSKPDIFVLVNKWDNSDKDRQENTNKSRDKIKKEIINLL
TKNGNFSSKEASERIFFVSALEMFKSRVENADVFVNKKNQEAIAMRNYEF
TSFEKSLSRGFRAIKASIQGKMSFYGLLRSLYKNRSFKRLFSKLLFLLNT
EFFHNLNSSTSRIILTIQKRKKPNGTSGR*
back to top

protein sequence of SMED30008898-orf-2

>SMED30008898-orf-2 ID=SMED30008898-orf-2|Name=SMED30008898-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=202bp
MKHLLDSLKRIKSDLISHINKNCSYISDQIQYEVEDLKRNINRNNVRDIN
TKLNSLPTKVSTDLLNLQSDSNEIIEKMKKKFKRVMGKHKFKNKEEKPTL
KRALAKNIALQVIPEKSTLGRAWGWAKSFVTDSDEQEVQRTLEKNKQEIS
MVASEICDYVREFQRNVVNYVCSEYDKRFGIVADRINYIDQYWEFVINVM
E*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR027094Mitofusin_fam
IPR022812Dynamin_SF
IPR027417P-loop_NTPase
Vocabulary: molecular function
TermDefinition
GO:0000166nucleotide binding
GO:0003924GTPase activity
GO:0005515protein binding
GO:0005525GTP binding
GO:0016787hydrolase activity
GO:0031625ubiquitin protein ligase binding
Vocabulary: biological process
TermDefinition
GO:0001825blastocyst formation
GO:0006626protein targeting to mitochondrion
GO:0006914autophagy
GO:0006915apoptotic process
GO:0006986response to unfolded protein
GO:0007006mitochondrial membrane organization
GO:0007596blood coagulation
GO:0008053mitochondrial fusion
GO:0016236macroautophagy
GO:0034497protein localization to pre-autophagosomal structure
GO:0046580negative regulation of Ras protein signal transduction
GO:0048593camera-type eye morphogenesis
GO:0048662negative regulation of smooth muscle cell proliferation
GO:0051646mitochondrion localization
GO:0061734parkin-mediated stimulation of mitophagy in response to mitochondrial depolarization
Vocabulary: cellular component
TermDefinition
GO:0005739mitochondrion
GO:0005741mitochondrial outer membrane
GO:0005829cytosol
GO:0015630microtubule cytoskeleton
GO:0016020membrane
GO:0016021integral component of membrane
GO:0031306intrinsic component of mitochondrial outer membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 9..257
e-value: 4.1E-21
score: 77.6
IPR022812Dynamin superfamilyPFAMPF00350Dynamin_Ncoord: 9..170
e-value: 6.7E-16
score: 58.8
IPR027094Mitofusin familyPANTHERPTHR10465TRANSMEMBRANE GTPASE FZO1coord: 2..259
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 4..221