Potassium channel subfamily K member 18

Overview
NamePotassium channel subfamily K member 18
Smed IDSMED30008887
Length (bp)1446
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Potassium channel subfamily K member 18 (SMED30008887) t-SNE clustered cells

Violin plots show distribution of expression levels for Potassium channel subfamily K member 18 (SMED30008887) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Potassium channel subfamily K member 18 (SMED30008887) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Potassium channel subfamily K member 18 (SMED30008887) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30008887

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30008887SMESG000019203.1 dd_Smed_v4_15824_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30008887SMESG000019203.1 dd_Smed_v4_15824_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
anterior sideSMED30008887SMESG000019203.1 dd_Smed_v4_15824_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30008887SMESG000019203.1 dd_Smed_v4_15824_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Human
Match: KCNK18 (potassium two pore domain channel subfamily K member 18 [Source:HGNC Symbol;Acc:HGNC:19439])

HSP 1 Score: 110.538 bits (275), Expect = 6.825e-26
Identity = 101/400 (25.25%), Postives = 171/400 (42.75%), Query Frame = 3
Query:  183 LFSHIGLSGLVVAYTILGGFLFYNIEISGEINVKNQMKIVRNETENKLEQILSSEMKADFNSSE-ILTNIRAILNEHERIFKENIFENGWNGRYEITENNWSYEGSILYSVTVITTIGYGHVTPKTKLGRIFTIFYAIFGIPLTILYLNNIGDYLAEIFRLVYSQLCHPLCMKLFTKKKRLTNQLVGHHIRVSDESSIQIKSDFNENLLDTNTDFESISSRKMSHSFTEPLQSIE-NAKIHCWGDLENLQTKLEKSTETEIQIPENLENEIE-AVQSNIDKLPVELIHFDNQNTSYFYTEVSETVPLTLTLCIMVVYIIMGAFLFTFWGSDNDYLKWSYFCFITLSTIGFGDIVPGISVSDLNPKEKLIVSVLYVAIGLPVFAMCFKLMEDEIVNKVKSL 1373
            LF  +     +V Y ++G  +F  IE  G++ V         E E  LE     E+    N SE ++ + +  L  H +  K       W  R      +WS+  S+ +  TV +T+GYG++ P T+LG+   + YA+FGIPL  L L + GD LA I    Y++         F K    T  L+      S           +E +       E +   K+    + P  S+E   + H       LQ    ++ E     PE +   +  ++ SN+D++  ++   D              +PL +   I+  YI   A +  FW +  D+    YFCF+TL+TIGFGD V       L      +   +Y+ +G+ +  + FKL+++ +++  K++
Sbjct:   20 LFPGLCFLCFLVTYALVGAVVFSAIE-DGQVLVAAD----DGEFEKFLE-----ELCRILNCSETVVEDRKQDLQGHLQKVKPQ-----WFNR----TTHWSFLSSLFFCCTVFSTVGYGYIYPVTRLGKYLCMLYALFGIPLMFLVLTDTGDILATILSTSYNR---------FRKFPFFTRPLLSKWCPKSLFKKKPDPKPADEAVPQIIISAEELPGPKLGTCPSRPSCSMELFERSHALEKQNTLQLP-PQAMERSNSCPELVLGRLSYSIISNLDEVGQQVERLD--------------IPLPIIALIVFAYISCAAAILPFWETQLDFENAFYFCFVTLTTIGFGDTV-------LEHPNFFLFFSIYIIVGMEIVFIAFKLVQNRLIDIYKNV 369          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Human
Match: KCNK5 (potassium two pore domain channel subfamily K member 5 [Source:HGNC Symbol;Acc:HGNC:6280])

HSP 1 Score: 73.559 bits (179), Expect = 2.648e-13
Identity = 27/60 (45.00%), Postives = 45/60 (75.00%), Query Frame = 3
Query:  468 TENNWSYEGSILYSVTVITTIGYGHVTPKTKLGRIFTIFYAIFGIPLTILYLNNIGDYLA 647
            T NNW++  +++++ TVITTIGYG+V PKT  GR+F +FY +FG+PL + +++ +G +  
Sbjct:   79 TFNNWNWPNAMIFAATVITTIGYGNVAPKTPAGRLFCVFYGLFGVPLCLTWISALGKFFG 138          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Human
Match: KCNK3 (potassium two pore domain channel subfamily K member 3 [Source:HGNC Symbol;Acc:HGNC:6278])

HSP 1 Score: 72.0182 bits (175), Expect = 6.357e-13
Identity = 29/74 (39.19%), Postives = 47/74 (63.51%), Query Frame = 3
Query:  477 NWSYEGSILYSVTVITTIGYGHVTPKTKLGRIFTIFYAIFGIPLTILYLNNIGDYLAEIFRLVYSQLCHPLCMK 698
             W + GS  +++TVITTIGYGH  P T  G++F +FYA+ GIPLT++   ++G+ +  + R +  +    L M+
Sbjct:   77 QWRFAGSFYFAITVITTIGYGHAAPSTDGGKVFCMFYALLGIPLTLVMFQSLGERINTLVRYLLHRAKKGLGMR 150          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Human
Match: KCNK9 (potassium two pore domain channel subfamily K member 9 [Source:HGNC Symbol;Acc:HGNC:6283])

HSP 1 Score: 71.2478 bits (173), Expect = 1.006e-12
Identity = 27/67 (40.30%), Postives = 43/67 (64.18%), Query Frame = 3
Query:  477 NWSYEGSILYSVTVITTIGYGHVTPKTKLGRIFTIFYAIFGIPLTILYLNNIGDYLAEIFRLVYSQL 677
             W + GS  +++TVITTIGYGH  P T  G+ F +FYA+ GIPLT++   ++G+ +    R +  ++
Sbjct:   77 QWKFAGSFYFAITVITTIGYGHAAPGTDAGKAFCMFYAVLGIPLTLVMFQSLGERMNTFVRYLLKRI 143          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Human
Match: KCNK9 (potassium two pore domain channel subfamily K member 9 [Source:HGNC Symbol;Acc:HGNC:6283])

HSP 1 Score: 71.2478 bits (173), Expect = 1.006e-12
Identity = 27/67 (40.30%), Postives = 43/67 (64.18%), Query Frame = 3
Query:  477 NWSYEGSILYSVTVITTIGYGHVTPKTKLGRIFTIFYAIFGIPLTILYLNNIGDYLAEIFRLVYSQL 677
             W + GS  +++TVITTIGYGH  P T  G+ F +FYA+ GIPLT++   ++G+ +    R +  ++
Sbjct:   77 QWKFAGSFYFAITVITTIGYGHAAPGTDAGKAFCMFYAVLGIPLTLVMFQSLGERMNTFVRYLLKRI 143          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Celegans
Match: twk-48 (TWiK family of potassium channels [Source:UniProtKB/TrEMBL;Acc:Q7YWY7])

HSP 1 Score: 178.718 bits (452), Expect = 2.933e-51
Identity = 121/425 (28.47%), Postives = 209/425 (49.18%), Query Frame = 3
Query:  114 MQEEDSRCDREKCVNYSKNFCSCLFSHIGLSGLVVAYTILGGFLFYNIEISGEINVKNQMKIVRNETENKLEQILSSEMKADFNSSEILTNIRAILNEHERIFKENIF---ENGWNGRYEITENNWSYEGSILYSVTVITTIGYGHVTPKTKLGRIFTIFYAIFGIPLTILYLNNIGDYLAEIFRLVYSQLCHPLCMKLFTKKKRLTNQLVGHHIRVSDESSIQIKSDFNENLLDTNTDFESISSRKMSHSFTEPLQSIENAKIHCWGDLENLQTKLEKSTETEIQIPENLENEIEAVQSNIDKLPVELIHFDNQNTSYFYTEVSETVPLTLTLCIMVVYIIMGAFLFTFWGSDNDYLKWSYFCFITLSTIGFGDIVPGISVSDLN-PKEKLIVSVLYVAIGLPVFAMCFKLMEDEIVNKVKSLA 1376
            M     R    + VN  K   +  FSHIGL  LVV Y +LG  +F  +E   E  ++   ++V++  E  ++ + ++  + +   S+     + +L+E +R FK         G++G+    +  W++ G+ LYS+TVITTIGYG+   KT +G+  T+ YAI GIPL +L+L NIGD +A+IFR +Y+Q              RL  +L+  H       + +I+               S+ SR       +   S+++  +    D+E+L T   +  + E++         E   + ++ + V                     P++L +  M+ Y+ +G  +F  W     +L+  YFCFI+L+TIGFGD  P  SVS+ +  +EKL+++ +Y+  G+ + AMCF L ++E+ NK + +A
Sbjct:    1 MGRRHRRSKVTRVVNLVKKIIAFFFSHIGLCALVVGYALLGAVIFKAVEGPHEAEIQ---ELVKSAREKAVDVVWNATFRVNRLDSKQWK--KTVLDEVKR-FKTVCMLSIRKGYDGKEYGKQAQWTFTGAFLYSLTVITTIGYGNTAAKTYIGKTLTMLYAIIGIPLMLLFLTNIGDVMAKIFRFLYAQSI------------RLKFRLILWH---KKRKAAKIRRA------------NSLVSRLTRGHRVKADSSVDSFGLGAGADVEDLLTARVEMEQLEVR---------ETAAAQLESMTV---------------------PISLVVFTMLGYLGVGTTIFKVW-EGWTFLESFYFCFISLTTIGFGDKFPSTSVSNTDEAQEKLVITSIYLLFGMALLAMCFNLAQEEVQNKTRWIA 361          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Celegans
Match: twk-39 (TWiK family of potassium channels [Source:UniProtKB/TrEMBL;Acc:A1EHR5])

HSP 1 Score: 104.375 bits (259), Expect = 1.664e-23
Identity = 56/169 (33.14%), Postives = 93/169 (55.03%), Query Frame = 3
Query:  189 SHIGLSGLVVAYTILGGFLFYNIEISGEINVKNQMKIVRNETENKLEQILSSEMKADFNSSEILTNIRAILNEHERIFKENIFENGWNGRYEITEN-NWSYEGSILYSVTVITTIGYGHVTPKTKLGRIFTIFYAIFGIPLTILYLNNIGDYLAEIFRLVYSQLCHPLC 692
            +H+GL  LV  Y + G F+F  +E   E+ ++ ++K    +  + + + ++   K     + +    +  L E E +    +   G++   E      W++ G++LYS+TV TTIGYGH+ PKT  GR+ TI Y+I GIPL +L L NI + LA++F  +Y +LC   C
Sbjct:   25 THVGLCFLVALYAVAGAFMFQAVEYPYELGLQGKVKNASLKVVDDIYRFINR--KNVIEETAVKNESQWALKEFEMLLVHAMNFEGYDEHDEERPTFQWTFSGALLYSITVFTTIGYGHICPKTDTGRLLTILYSILGIPLMLLCLANIAETLAQVFTYIYFKLCCAYC 191          

HSP 2 Score: 104.375 bits (259), Expect = 1.710e-23
Identity = 47/99 (47.47%), Postives = 72/99 (72.73%), Query Frame = 3
Query: 1080 ETVPLTLTLCIMVVYIIMGAFLFTFWGSDNDYLKWSYFCFITLSTIGFGDIVPGISVSDLNPKEKLIVSVLYVAIGLPVFAMCFKLMEDEIVNKVKSLA 1376
            E +P+++ +CI+  +I  GA+LF++W + N +   +Y+CFITLSTIGFGDIVPG ++ D   +EKL+V  LY+  G+ + AMCFKLM+D++V K + L 
Sbjct:  490 EKMPVSVGICIVFAFISGGAWLFSWWENWNGF-DGAYYCFITLSTIGFGDIVPGQAL-DEGSQEKLVVCALYLLFGMALIAMCFKLMQDDVVQKARWLG 586          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Celegans
Match: twk-39 (TWiK family of potassium channels [Source:UniProtKB/TrEMBL;Acc:A1EHR5])

HSP 1 Score: 104.375 bits (259), Expect = 1.672e-23
Identity = 56/169 (33.14%), Postives = 93/169 (55.03%), Query Frame = 3
Query:  189 SHIGLSGLVVAYTILGGFLFYNIEISGEINVKNQMKIVRNETENKLEQILSSEMKADFNSSEILTNIRAILNEHERIFKENIFENGWNGRYEITEN-NWSYEGSILYSVTVITTIGYGHVTPKTKLGRIFTIFYAIFGIPLTILYLNNIGDYLAEIFRLVYSQLCHPLC 692
            +H+GL  LV  Y + G F+F  +E   E+ ++ ++K    +  + + + ++   K     + +    +  L E E +    +   G++   E      W++ G++LYS+TV TTIGYGH+ PKT  GR+ TI Y+I GIPL +L L NI + LA++F  +Y +LC   C
Sbjct:   25 THVGLCFLVALYAVAGAFMFQAVEYPYELGLQGKVKNASLKVVDDIYRFINR--KNVIEETAVKNESQWALKEFEMLLVHAMNFEGYDEHDEERPTFQWTFSGALLYSITVFTTIGYGHICPKTDTGRLLTILYSILGIPLMLLCLANIAETLAQVFTYIYFKLCCAYC 191          

HSP 2 Score: 103.99 bits (258), Expect = 1.864e-23
Identity = 47/99 (47.47%), Postives = 72/99 (72.73%), Query Frame = 3
Query: 1080 ETVPLTLTLCIMVVYIIMGAFLFTFWGSDNDYLKWSYFCFITLSTIGFGDIVPGISVSDLNPKEKLIVSVLYVAIGLPVFAMCFKLMEDEIVNKVKSLA 1376
            E +P+++ +CI+  +I  GA+LF++W + N +   +Y+CFITLSTIGFGDIVPG ++ D   +EKL+V  LY+  G+ + AMCFKLM+D++V K + L 
Sbjct:  490 EKMPVSVGICIVFAFISGGAWLFSWWENWNGF-DGAYYCFITLSTIGFGDIVPGQAL-DEGSQEKLVVCALYLLFGMALIAMCFKLMQDDVVQKARWLG 586          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Celegans
Match: twk-9 (TWiK family of potassium channels protein 9 [Source:UniProtKB/Swiss-Prot;Acc:Q23435])

HSP 1 Score: 98.9821 bits (245), Expect = 6.589e-22
Identity = 79/297 (26.60%), Postives = 135/297 (45.45%), Query Frame = 3
Query:  462 EITENNWSYEGSILYSVTVITTIGYGHVTPKTKLGRIFTIFYAIFGIPLTILYLNNIGDYLAEIFR--LVYSQLCHPLCMKLFTKKKRLTNQLVGHHIRVSDESSIQIKSDFNENLLDTNTDFESISSRKMSHSFTEPLQSIENAKIHCWGDLENLQTKLEKSTETEIQIPENLENEIEAVQSNIDKLPVELIHFDNQNTSYFYTEVSETVPLTLTLCIMVVYIIMGAFLFTFWGSDNDYLKWSYFCFITLSTIGFGDIVPGISVSDLNPKEKLIVSVLYVAIGLPVFAMCFKLMED 1346
            E     WS   S++++ TVITTIGYGHV P+T  GR+F IFY + G+P T+L + ++G +L    +  L  ++      +KL+ K K+  N+        S ++S  +       + +T  + + +S R               A+    GD                        EIE +++  D+   E    + +N     TE S  + +T T C    Y++ GA + + +  + D+ K  YF F+TL+TIG GD VP          + L+++++Y+ IGL +  M  ++  D
Sbjct:  155 ETPAEKWSIGNSVIFAFTVITTIGYGHVAPETFEGRLFLIFYGVIGVPFTLLTIADLGMFLTRFLKNLLTMARRFAHYLVKLYQKAKKQRNK--------SQKTSPVMPDSERSEVWNTGKEMKEMSMR--------------TAREPGEGD------------------------EIEVIENGNDENGKEEDEEEPENNEPRKTEESIALGITFT-C----YLVAGAKILSVYEPEMDFFKALYFNFVTLTTIGLGDFVP-------KSFDYLLITLIYIGIGLALTTMAIEIAAD 393          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Celegans
Match: twk-9 (TWiK family of potassium channels protein 9 [Source:UniProtKB/Swiss-Prot;Acc:Q23435])

HSP 1 Score: 98.5969 bits (244), Expect = 8.965e-22
Identity = 79/297 (26.60%), Postives = 135/297 (45.45%), Query Frame = 3
Query:  462 EITENNWSYEGSILYSVTVITTIGYGHVTPKTKLGRIFTIFYAIFGIPLTILYLNNIGDYLAEIFR--LVYSQLCHPLCMKLFTKKKRLTNQLVGHHIRVSDESSIQIKSDFNENLLDTNTDFESISSRKMSHSFTEPLQSIENAKIHCWGDLENLQTKLEKSTETEIQIPENLENEIEAVQSNIDKLPVELIHFDNQNTSYFYTEVSETVPLTLTLCIMVVYIIMGAFLFTFWGSDNDYLKWSYFCFITLSTIGFGDIVPGISVSDLNPKEKLIVSVLYVAIGLPVFAMCFKLMED 1346
            E     WS   S++++ TVITTIGYGHV P+T  GR+F IFY + G+P T+L + ++G +L    +  L  ++      +KL+ K K+  N+        S ++S  +       + +T  + + +S R               A+    GD                        EIE +++  D+   E    + +N     TE S  + +T T C    Y++ GA + + +  + D+ K  YF F+TL+TIG GD VP          + L+++++Y+ IGL +  M  ++  D
Sbjct:  155 ETPAEKWSIGNSVIFAFTVITTIGYGHVAPETFEGRLFLIFYGVIGVPFTLLTIADLGMFLTRFLKNLLTMARRFAHYLVKLYQKAKKQRNK--------SQKTSPVMPDSERSEVWNTGKEMKEMSMR--------------TAREPGEGD------------------------EIEVIENGNDENGKEEDEEEPENNEPRKTEESIALGITFT-C----YLVAGAKILSVYEPEMDFFKALYFNFVTLTTIGLGDFVP-------KSFDYLLITLIYIGIGLALTTMAIEIAAD 393          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Fly
Match: CG9194 (gene:FBgn0035192 transcript:FBtr0072651)

HSP 1 Score: 135.191 bits (339), Expect = 1.316e-33
Identity = 82/254 (32.28%), Postives = 140/254 (55.12%), Query Frame = 3
Query:  123 EDSRCDREKCVN---YSKNFCSCLFSHIGLSGLVVAYTILGGFLFYNIEISGEINVKNQMKIVR-NETENKLEQILSSEMKADFNSSEILTNIRAILNEHERIFKENIFENGWNGRYEITENNWSYEGSILYSVTVITTIGYGHVTPKTKLGRIFTIFYAIFGIPLTILYLNNIGDYLAEIFRLVYSQLCHPLCMKLFTKKKRLTNQLVGHHIRVSDESSIQIKSDFNENL-LDTNTDFESISSRKMSHSFTEP 869
            E ++  R +CV    +S    +C+ SH+ L  LVV+Y + G +LF ++E   E+ VK  ++ +R N TEN     L S+       S+ + N+   L   E+     I  +GW+G  ++ ++ W++ GS+ YS+ VITTIGYGH++P+T  G++ TIFYAI GIPL ++ L+NIGD +A  FR +Y ++C  +C +  T K+    +     +R    +  Q    F  ++ +   +  +S     M H++++P
Sbjct:   15 EPAKPQRGRCVAAICFSWKVLTCIVSHVLLVLLVVSYCVGGAYLFQHLERPHELEVKRDIQNLRVNLTENIW---LLSDDAVVLRESDWMANVSKHLANFEKQILTAIKADGWDGDEDLRKSQWTFAGSLFYSIIVITTIGYGHISPRTDWGKVTTIFYAIVGIPLMLICLSNIGDVMATSFRFLYWRICCYVCTR--TAKRPRNARSRQRSMRSQRHARSQPPPSFRRSMKMTQRSGNDSGLGPSMGHAYSDP 263          

HSP 2 Score: 80.4925 bits (197), Expect = 1.094e-15
Identity = 40/99 (40.40%), Postives = 62/99 (62.63%), Query Frame = 3
Query: 1080 ETVPLTLTLCIMVVYIIMGAFLFTFWGSDNDYLKWSYFCFITLSTIGFGDIVPGISVSDLNPKEKLIVSVLYVAIGLPVFAMCFKLMEDEIVNKVKSLA 1376
              VP+ L + ++V YI+ GA LF +W  +  +L  +YFCFITL+TIGFGD VP   V D + ++ +    LY+  G+ + AM F L+++E +  VK +A
Sbjct:  617 RPVPIWLCVFLVVSYILGGAVLFAYW-ENWSFLDSAYFCFITLTTIGFGDFVPAKGVKDES-EQSIAYCSLYLLFGIALLAMSFNLVQEEFIANVKEVA 713          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Fly
Match: sand (gene:FBgn0033257 transcript:FBtr0088780)

HSP 1 Score: 112.079 bits (279), Expect = 8.926e-27
Identity = 65/184 (35.33%), Postives = 110/184 (59.78%), Query Frame = 3
Query:  144 EKCVNYSKNFCSCLFSHIGLSGLVVAYTILGGFLFYNIEISGEINVKNQMK---IVRNETENKLEQI--LSSEMKADFNSSEILTNIRAILNEHERIFKENIFENGWNGRYEITENNWSYEGSILYSVTVITTIGYGHVTPKTKLGRIFTIFYAIFGIPLTILYLNNIGDYLAEIFRLVYSQLC 680
            E+  ++ ++F + +FS++G+  LV  Y I G F+F +IEI     +K++     I RN +   L +I  L++E  + F+       +  +L +++R   +   +             WS+ G+ LYS+TVITTIGYG++TP ++ G++ TI YAI G+PL +LYL+NIGD LA+ F+ +YS++C
Sbjct:   17 ERFKDHCRHFTAFMFSNVGIILLVTFYIIGGAFIFQSIEIFEYERLKSEKPHRFIARNFSGECLSRIWELTAENISFFDHHAYRRRVNDVLLDYQRAIVKKQLKGP-------DVEQWSFSGAFLYSLTVITTIGYGNITPHSECGKLVTILYAIIGMPLFLLYLSNIGDVLAKSFKWIYSKVC 193          

HSP 2 Score: 90.5077 bits (223), Expect = 2.119e-19
Identity = 45/100 (45.00%), Postives = 70/100 (70.00%), Query Frame = 3
Query: 1083 TVPLTLTLCIMVVYIIMGAFLFTFWGSDNDYLKWSYFCFITLSTIGFGDIVPGISV--SDLNPKE-KLIVSVLYVAIGLPVFAMCFKLMEDEIVNKVKSL 1373
            TVP+T+ + +MV YI+ GA LF  W  D +YL  SYFC I+LS+IGFGD+VPG  V  +D +  E   I+  +Y+ +G+ V AMCF LM++++V+ ++++
Sbjct:  284 TVPVTVCVFVMVGYILWGALLFGRW-EDWNYLDGSYFCLISLSSIGFGDLVPGDRVITADRDKVEVSFILCAIYLLLGMAVIAMCFNLMQEQVVHNIRAI 382          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Fly
Match: CG34396 (gene:FBgn0085425 transcript:FBtr0112644)

HSP 1 Score: 99.7525 bits (247), Expect = 5.592e-22
Identity = 104/415 (25.06%), Postives = 183/415 (44.10%), Query Frame = 3
Query:  186 FSHIGLSGLVVAYTILGGFLFYNIEISGEINVKNQMKIVRNETE----NKLEQI---LSSEMKADFNSSEILTNIRAILNEHERIFKENIFENGWNGRYEITENNWSYEGSILYSVTVITTIGYGHVTPKTKLGRIFTIFYAIFGIPLTILYLNNIGDYLAE--------IFRLVYSQLCHPLCMKLFTKKKRLTNQLVGHHIRVSDESSIQIKSDFNENLLDTNTDFESISSRKMSHSFTEPLQSIENAKIHCWGDLENLQTKLEKSTETEIQIPENLEN---EIEAVQSNIDKLPVELIHFDNQNTSYFYT-EVSE--TVPLTLTLCIMVVYIIMGAFLFTFWGSDNDYLKWSYFCFITLSTIGFGDIVPGISVSDLNPKEKLIVSVLYVAIGLPVFAMCFKLMEDEIVNKVK 1367
            F+HI L  ++  Y I G  +F  IE+       NQ K+V  + +    N++ Q+   LS   K +F   ++L  +       + + +  + +N          + WS+  +++YS T+ TTIGYGH+TPKT +GR  TI YAI GIP+ ++ L ++G             + R+ Y++ C           +R+  Q              QI+S     +   NT ++ ++ R+ S  F+                                  PEN E    + EA +S      V   H +   + Y  T EV +   +P+++   +++ YI++G+F F         L   Y+ FI++STIGFGD+VP       NP   ++VS++Y+  GL + +M   +++ ++ +  K
Sbjct:  112 FTHIFLILILALYNIGGAVVFRTIEV----RHANQEKLVVQDQQKSFFNEMRQVSGDLSGLSKLEFEG-QVLRIMNTYPTVVQSLLRSGMVDN---------TDPWSFWDAMVYSATIYTTIGYGHITPKTGMGRSLTIVYAIIGIPMFLIVLADLGKLFTRCVKFLWVYVRRMYYTRSC-----------RRIRKQQ-------------QIRS----AMTGFNTMYD-MAIRRPSMFFSN-------------------------------SAPENDEESQADAEAARS------VGTSHPETPTSPYPETFEVDDEFNLPVSVASLLLITYILLGSFGFLMMEPSWTPLDAFYYVFISMSTIGFGDLVPS------NPF-YVMVSMIYLMFGLALTSMFINVVQIKLSDHFK 439          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Fly
Match: CG10864 (gene:FBgn0038621 transcript:FBtr0083654)

HSP 1 Score: 97.8265 bits (242), Expect = 6.915e-22
Identity = 56/179 (31.28%), Postives = 91/179 (50.84%), Query Frame = 3
Query:  141 REKCVNYSKNFCSCLFSHIGLSGLVVAYTILGGFLFYNIEISGEINVKNQMKIVRNETENKLEQILSSEMKADFNSSEILTNIRAILNEHERIFKENIFENGWNGRYEITENNWSYEGSILYSVTVITTIGYGHVTPKTKLGRIFTIFYAIFGIPLTILYLNNIGDYLAEIFRLVYSQL 677
            R++     +NF + + + +G+  L+V Y I G F F +IE          +  +R     +L  I       D       TN   +L E++      + ++G+ GR    E  WS+  ++++ ++VIT IGYG++ P+T  G+ FT+ YA FGIPL ILY  N+G  LA  F+ +Y  L
Sbjct:   33 RKRVKRCCRNFVTFMCTQVGVGALIVIYAICGAFAFMHIERQFVDETAGHVMELRQNCSQQLWSITEQHNIIDRRRWTEATN--DVLREYQSQIA-GVVKHGYVGRSP--EQIWSFPAALMFCLSVITMIGYGNMVPRTPWGKGFTVIYATFGIPLYILYFLNMGRVLARSFKFLYRSL 206          

HSP 2 Score: 57.3806 bits (137), Expect = 1.396e-8
Identity = 39/130 (30.00%), Postives = 59/130 (45.38%), Query Frame = 3
Query: 1086 VPLTLTLCIMVVYIIMGAFLFTFWGSDNDYLKWS-----YFCFITLSTIGFGDIVPGISV---SDLN-------------PKE-------------KLIVSVLYVAIGLPVFAMCFKLMEDEIVNKVKSL 1373
            VP T  L ++  Y++ G  +F  W       KWS     YFC  +L  IGFGD VPG S+   +D+N             P E             KL ++ +Y+ +G+ + AMC  LM +E+  K + +
Sbjct:  235 VPSTACLWVIFFYVLTGTVMFANWE------KWSLLNSFYFCMTSLCKIGFGDFVPGASLTTSADVNAATQKLQEDISADPAELAQLQSVAADQHSKLAINFVYMLLGMGLVAMCRNLMREEVRLKAREM 358          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Fly
Match: CG1688 (gene:FBgn0027589 transcript:FBtr0088495)

HSP 1 Score: 92.0485 bits (227), Expect = 2.612e-19
Identity = 60/186 (32.26%), Postives = 95/186 (51.08%), Query Frame = 3
Query:  183 LFSHIGLSGLVVAYTILGGFLFYNIEISGEINVKNQMKIVRNETENKL----EQI----------LSSEMKADFNSSEILTNIRAILNEHERIFKENIFENGWNGR-----YEITEN-NWSYEGSILYSVTVITTIGYGHVTPKTKLGRIFTIFYAIFGIPLTILYLNNIGDYLAEIFRLVYSQLC 680
            LFS  GL  LV+ Y++LGG LF  +E   +I+    +   R +   +L    E++          L  E    F  S I+   R             +F  G         Y+  ++ +WS+  ++LYSVTVITTIG+G +TP+T  G++ TIFYA+ G+PL ++ L+++G  LA+  +  Y +LC
Sbjct:   73 LFSTPGLVLLVIGYSVLGGLLFPLLEAPQDISKSAAIAKSREDCLRELWIITEKLNVLYERNWTMLVHEQLRRFEGS-IVAATRQGSAGSSGGGGAGLFHEGSASALGHFGYDAGDSQSWSFSEALLYSVTVITTIGHGSLTPRTAAGKLATIFYALVGVPLMLMCLSSLGALLADGLQCTYVRLC 257          

HSP 2 Score: 72.7886 bits (177), Expect = 2.947e-13
Identity = 37/97 (38.14%), Postives = 59/97 (60.82%), Query Frame = 3
Query: 1086 VPLTLTLCIMVVYIIMGAFLFTFWGSDNDYLKWSYFCFITLSTIGFGDIVPGISVSDLNPKEKLIVSVLYVAIGLPVFAMCFKLMEDEIVNKVKSLA 1376
            VP++L L I+  YI +G  +F  W  +   +  +YFCF+TLSTIG+GD VP  S +   P+ +L     Y+ +GL + AM F ++E +++ K K +A
Sbjct:  815 VPISLVLLILASYICVGTVIFALW-ENWSLVDGAYFCFVTLSTIGYGDFVPARSFN--GPELQLYACCAYLLLGLVLVAMSFSILETQLMWKCKRIA 908          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Zebrafish
Match: kcnk18 (potassium channel, subfamily K, member 18 [Source:ZFIN;Acc:ZDB-GENE-100405-2])

HSP 1 Score: 115.161 bits (287), Expect = 8.983e-28
Identity = 106/415 (25.54%), Postives = 184/415 (44.34%), Query Frame = 3
Query:  183 LFSHIGLSGLVVAYTILGGFLFYNIEISGEIN--------VKNQMKIVRNETENKLEQILSSEMKADFNSSEILTNIRAILNEHERIFKENIFENGWNGRYEITENNWSYEGSILYSVTVITTIGYGHVTPKTKLGRIFTIFYAIFGIPLTILYLNNIGDYLAEIFRLVYSQLCHPLCMKLFTKKKRLTNQLVGH-------HIRVSDESSIQIKSD----FNEN--LLDTNTDFESISSRKMSHSFTEPLQSIENAKIHCWGDLENLQTKLEKSTETEIQIPENLENEIEAVQSNIDKLPV---ELIHFDNQNTSYFYTEVSETVPLTLTLCIMVVYIIMGAFLFTFWGSDNDYLKWSYFCFITLSTIGFGDIVPGISVSDLNPKEKLIVSVLYVAIGLPVFAMCFKLMEDEIV 1355
            LF H+ L   +V Y +LG  +F  IE +   N        V+  M+IV+N T+       +SE K              ++N+ + I  +  +E          ++ W++  S+ +  TV TT+GYG + P T  G++  + YA+ GIPL +L ++++GD LA +    Y++L       LF ++       +GH       H + S    +Q  +D    FN++  +L+T  + + I +R           SI         + E     + + +    +I   L          +D++P    EL +   Q            VPL + L ++  Y+++ + +   W    D+    YF FITL+TIGFGDIVP       +PK   +V+ L++  G+ + +M FKL + +IV
Sbjct:   20 LFPHVFLILSLVLYAVLGALVFRAIEYTNPRNESEEILSIVQKVMEIVQNHTD-------ASEQKH-------------LINKAKYILDDYCYEKE-------RDHGWTFFASLFFCCTVFTTVGYGRIYPLTSKGKVACVLYAMVGIPLMLLVISDVGDLLAVLLSKAYTRL------NLFFRR------WIGHQSWRLQSHEKTSALPQVQADTDGTYKFNQDVVVLETTNNQQVIQTRS----------SIRRGSFQLRNNKEIFDRIIVRES---FRIKGTLSKSCSC--PELDRVPTPKDELFNDIGQEMEQL------DVPLLVILLMVFAYMVICSQILKCWEKQMDHSDAFYFTFITLTTIGFGDIVPE------HPKF-FMVTFLFIITGMAIMSMAFKLGQSQIV 367          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Zebrafish
Match: kcnk18 (potassium channel, subfamily K, member 18 [Source:ZFIN;Acc:ZDB-GENE-100405-2])

HSP 1 Score: 115.161 bits (287), Expect = 9.702e-28
Identity = 106/415 (25.54%), Postives = 184/415 (44.34%), Query Frame = 3
Query:  183 LFSHIGLSGLVVAYTILGGFLFYNIEISGEIN--------VKNQMKIVRNETENKLEQILSSEMKADFNSSEILTNIRAILNEHERIFKENIFENGWNGRYEITENNWSYEGSILYSVTVITTIGYGHVTPKTKLGRIFTIFYAIFGIPLTILYLNNIGDYLAEIFRLVYSQLCHPLCMKLFTKKKRLTNQLVGH-------HIRVSDESSIQIKSD----FNEN--LLDTNTDFESISSRKMSHSFTEPLQSIENAKIHCWGDLENLQTKLEKSTETEIQIPENLENEIEAVQSNIDKLPV---ELIHFDNQNTSYFYTEVSETVPLTLTLCIMVVYIIMGAFLFTFWGSDNDYLKWSYFCFITLSTIGFGDIVPGISVSDLNPKEKLIVSVLYVAIGLPVFAMCFKLMEDEIV 1355
            LF H+ L   +V Y +LG  +F  IE +   N        V+  M+IV+N T+       +SE K              ++N+ + I  +  +E          ++ W++  S+ +  TV TT+GYG + P T  G++  + YA+ GIPL +L ++++GD LA +    Y++L       LF ++       +GH       H + S    +Q  +D    FN++  +L+T  + + I +R           SI         + E     + + +    +I   L          +D++P    EL +   Q            VPL + L ++  Y+++ + +   W    D+    YF FITL+TIGFGDIVP       +PK   +V+ L++  G+ + +M FKL + +IV
Sbjct:   20 LFPHVFLILSLVLYAVLGALVFRAIEYTNPRNESEEILSIVQKVMEIVQNHTD-------ASEQKH-------------LINKAKYILDDYCYEKE-------RDHGWTFFASLFFCCTVFTTVGYGRIYPLTSKGKVACVLYAMVGIPLMLLVISDVGDLLAVLLSKAYTRL------NLFFRR------WIGHQSWRLQSHEKTSALPQVQADTDGTYKFNQDVVVLETTNNQQVIQTRS----------SIRRGSFQLRNNKEIFDRIIVRES---FRIKGTLSKSCSC--PELDRVPTPKDELFNDIGQEMEQL------DVPLLVILLMVFAYMVICSQILKCWEKQMDHSDAFYFTFITLTTIGFGDIVPE------HPKF-FMVTFLFIITGMAIMSMAFKLGQSQIV 367          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Zebrafish
Match: kcnk18 (potassium channel, subfamily K, member 18 [Source:ZFIN;Acc:ZDB-GENE-100405-2])

HSP 1 Score: 114.39 bits (285), Expect = 1.823e-27
Identity = 106/415 (25.54%), Postives = 183/415 (44.10%), Query Frame = 3
Query:  183 LFSHIGLSGLVVAYTILGGFLFYNIEISGEIN--------VKNQMKIVRNETENKLEQILSSEMKADFNSSEILTNIRAILNEHERIFKENIFENGWNGRYEITENNWSYEGSILYSVTVITTIGYGHVTPKTKLGRIFTIFYAIFGIPLTILYLNNIGDYLAEIFRLVYSQLCHPLCMKLFTKKKRLTNQLVGH-------HIRVSDESSIQIKSD----FNEN--LLDTNTDFESISSRKMSHSFTEPLQSIENAKIHCWGDLENLQTKLEKSTETEIQIPENLENEIEAVQSNIDKLPV---ELIHFDNQNTSYFYTEVSETVPLTLTLCIMVVYIIMGAFLFTFWGSDNDYLKWSYFCFITLSTIGFGDIVPGISVSDLNPKEKLIVSVLYVAIGLPVFAMCFKLMEDEIV 1355
            LF H+ L   +V Y +LG  +F  IE     N        V+  M+IV+N T+       +SE K              ++N+ + I  +  +E          ++ W++  S+ +  TV TT+GYG + P T  G++  + YA+ GIPL +L ++++GD LA +    Y++L       LF ++       +GH       H + S    +Q  +D    FN++  +L+T  + + I +R           SI         + E     + + +    +I   L          +D++P    EL +   Q            VPL + L ++  Y+++ + +   W    D+    YF FITL+TIGFGDIVP       +PK   +V+ L++  G+ + +M FKL + +IV
Sbjct:   20 LFPHVFLILSLVLYAVLGALVFRAIEYKNPRNESEEILSIVQKVMEIVQNHTD-------TSEQKH-------------LINKAKDILDDYCYEKE-------RDHGWTFFASLFFCCTVFTTVGYGRIYPLTSKGKVACVLYAMVGIPLMLLVISDVGDLLAVLLSKAYTRL------NLFFRR------WIGHQSWRLQSHEKTSALPQVQADTDGTYKFNQDVVVLETTNNQQVIQTRS----------SIRRGSFQLRNNKEIFDRIIVRES---FRIKGTLSKSCSC--PELDRVPTPKDELFNDIGQEMEQL------DVPLLVILLMVFAYMVICSQILKCWEKQMDHSDAFYFTFITLTTIGFGDIVPE------HPKF-FMVTFLFIITGMAIMSMAFKLGQSQIV 367          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Zebrafish
Match: kcnk5b (potassium channel, subfamily K, member 5b [Source:ZFIN;Acc:ZDB-GENE-040426-1297])

HSP 1 Score: 75.8702 bits (185), Expect = 2.732e-14
Identity = 48/163 (29.45%), Postives = 85/163 (52.15%), Query Frame = 3
Query:  201 LSGLVVAYTILGGFLFYNIEISGEINVKNQMKIVRNETENKLEQ--ILSSEMKADFNSSEILTNIRAILNEHERIFKENIFENGWNGRYEITENNWSYEGSILYSVTVITTIGYGHVTPKTKLGRIFTIFYAIFGIPLTILYLNNIGDYLAEIFRLVYSQLCH 683
            L+ +++ Y  +G  +F  +E   E N+ + +   +N+T N L++   LS E+       EI+  +     +   + KE  F            NNW++E +++++ TVITTIGYG+V PKT  GR+F I Y + GIPL + +++ +G +     + +   L H
Sbjct:    8 LTSVIIFYLSIGAAIFQILE---EPNLNSAVDDYKNKTNNLLKKYPCLSKEVLG-----EIIEVVAEATGQGVTVTKEAQF------------NNWNWENAVIFAATVITTIGYGNVAPKTTGGRLFCILYGLCGIPLCLTWISELGTFFGSRTKRLSQLLLH 150          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Zebrafish
Match: kcnk5a (potassium channel, subfamily K, member 5a [Source:ZFIN;Acc:ZDB-GENE-051113-112])

HSP 1 Score: 73.559 bits (179), Expect = 1.484e-13
Identity = 45/149 (30.20%), Postives = 77/149 (51.68%), Query Frame = 3
Query:  201 LSGLVVAYTILGGFLFYNIEISGEINVKNQMKIVRNETENKLEQILSSEMKADFNSSEILTNIRAILNEHERIFKENIFENGWNGRYEITENNWSYEGSILYSVTVITTIGYGHVTPKTKLGRIFTIFYAIFGIPLTILYLNNIGDYLA 647
            L+  ++ Y  +G  +F  IE   E N +  ++  R + E+ L+Q      KAD +   IL  +     +   I  +  F            NNW++  +++++ TVITTIGYG++ PKT  GR+F IFY +FG+PL   +++ +G +  
Sbjct:    8 LTSAIIFYLSIGAAIFQVIE---EPNWEIAVRKYRADKESILKQ-YPCLTKADLDY--ILEVVSDAAGQGITITGDKTF------------NNWNWPNAVIFAATVITTIGYGNIAPKTPSGRVFCIFYGLFGVPLCFTWISELGKFFG 138          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Xenopus
Match: KCNK18 (potassium two pore domain channel subfamily K member 18 [Source:HGNC Symbol;Acc:HGNC:19439])

HSP 1 Score: 108.997 bits (271), Expect = 1.567e-25
Identity = 90/305 (29.51%), Postives = 148/305 (48.52%), Query Frame = 3
Query:  471 ENNWSYEGSILYSVTVITTIGYGHVTPKTKLGRIFTIFYAIFGIPLTILYLNNIGDYLAEIFRLVYSQ---LCHPLCMKLFTKKKRLTNQLVGHHIRVS----DESSIQIKSDFN-ENLLDTNTDFESISSRKMSHSFTEPLQSIENAKIHCWGDLENLQTKLEKSTETEIQIPE-NLENEIEAVQSNIDKLPVELIHFDNQNTSYFYTEVSETVPLTLTLCIMVVYIIMGAFLFTFWGSDNDYLKWSYFCFITLSTIGFGDIVPGISVSDLNPKEKLIVSVLYVAIGLPVFAMCFKLMEDEIVN 1358
            E  WS++ S+ +  TV TT+GYGH+ P T  G++  + YA  GIPL +L L ++GD LA +    Y +    C+ LC K   K  +L++    H  + S     +S + +K   N   ++ T    +    +  +    E +   EN K+        L++ L++ +      P+ +L    ++   N DK+  EL H D              VP+ L + +MV YI+ GA +   W  D   +   YFCF+TL+TIGFGDI+P       +P   L++S  Y  +G+ +  M FKL ++ +V+
Sbjct:   63 EEQWSFKSSLFFCCTVFTTVGYGHICPVTMYGKLACMVYATLGIPLMLLLLADLGDILARLLSRTYKRAVLACNKLCHK--PKPIKLSSLHKEHSGKSSLLKTMDSRVSMKEPLNITEVIKTQASVKRKYLQMRNIDIFELIIVKENQKV------LPLKSSLQQKS---FSCPDLDLWPPSDSAMQNFDKIGEELDHLD--------------VPIVLIVLVMVAYIMCGACILPLWEDDWTTIDAFYFCFVTLTTIGFGDIIPK------HPNYFLLLSA-YTVVGMVIVCMAFKLGQNRLVS 335          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Xenopus
Match: stk26 (serine/threonine kinase 26 [Source:Xenbase;Acc:XB-GENE-982067])

HSP 1 Score: 73.559 bits (179), Expect = 5.941e-14
Identity = 47/142 (33.10%), Postives = 73/142 (51.41%), Query Frame = 3
Query:  222 YTILGGFLFYNIEISGEINVKNQMKIVRNETENKLEQILSSEMKADFNSSEILTNIRAILNEHERIFKENIFENGWNGRYEIT-ENNWSYEGSILYSVTVITTIGYGHVTPKTKLGRIFTIFYAIFGIPLTILYLNNIGDYL 644
            Y  LG  +F  +E   E N ++Q ++ +        + L +    D N+          L +  +I  E  +E G N +   T  +NW +  S  ++ TVITTIGYG++ P T  G++F +FYA+FGIPL + +LN IG  L
Sbjct:   23 YLFLGAMMFQILEKQAESNTRDQFQVAK-------LRFLQNYTCLDVNA----------LEQFVQIIMEA-WEKGLNPKGNATNPSNWDFSNSFFFAGTVITTIGYGNLYPSTVAGQVFCVFYALFGIPLNLAFLNLIGKSL 146          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Xenopus
Match: pold2 (polymerase (DNA directed), delta 2, accessory subunit [Source:Xenbase;Acc:XB-GENE-999387])

HSP 1 Score: 75.0998 bits (183), Expect = 7.412e-14
Identity = 43/149 (28.86%), Postives = 76/149 (51.01%), Query Frame = 3
Query:  201 LSGLVVAYTILGGFLFYNIEISGEINVKNQMKIVRNETENKLEQILSSEMKADFNSSEILTNIRAILNEHERIFKENIFENGWNGRYEITENNWSYEGSILYSVTVITTIGYGHVTPKTKLGRIFTIFYAIFGIPLTILYLNNIGDYLA 647
            L+  V+ Y  +G  +F  +E   E N K   ++ +   ENK++ +         +  EIL  + +   +   I     F            NNW++  +++++ TVITTIGYG++ PKT  GR+F IFY +FG+PL + +++ +G +  
Sbjct:    8 LTSAVIFYLSIGAAIFQVLE---EPNWKAATQLYK---ENKVKILAKHSCLTPRDLEEILETVSSAAGQGVTITGNTTF------------NNWNWPNAVIFAATVITTIGYGNIAPKTSAGRLFCIFYGLFGVPLCLTWISALGKFFG 138          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Xenopus
Match: stk26 (serine/threonine kinase 26 [Source:Xenbase;Acc:XB-GENE-982067])

HSP 1 Score: 73.559 bits (179), Expect = 7.886e-14
Identity = 47/142 (33.10%), Postives = 73/142 (51.41%), Query Frame = 3
Query:  222 YTILGGFLFYNIEISGEINVKNQMKIVRNETENKLEQILSSEMKADFNSSEILTNIRAILNEHERIFKENIFENGWNGRYEIT-ENNWSYEGSILYSVTVITTIGYGHVTPKTKLGRIFTIFYAIFGIPLTILYLNNIGDYL 644
            Y  LG  +F  +E   E N ++Q ++ +        + L +    D N+          L +  +I  E  +E G N +   T  +NW +  S  ++ TVITTIGYG++ P T  G++F +FYA+FGIPL + +LN IG  L
Sbjct:   24 YLFLGAMMFQILEKQAESNTRDQFQVAK-------LRFLQNYTCLDVNA----------LEQFVQIIMEA-WEKGLNPKGNATNPSNWDFSNSFFFAGTVITTIGYGNLYPSTVAGQVFCVFYALFGIPLNLAFLNLIGKSL 147          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Xenopus
Match: pole4 (polymerase (DNA-directed), epsilon 4, accessory subunit [Source:Xenbase;Acc:XB-GENE-5722002])

HSP 1 Score: 74.3294 bits (181), Expect = 8.832e-14
Identity = 34/90 (37.78%), Postives = 53/90 (58.89%), Query Frame = 3
Query:  474 NNWSYEGSILYSVTVITTIGYGHVTPKTKLGRIFTIFYAIFGIPLTILYLNNIGDYLAEIFRLVYSQLCHPLCMKLFTKKKRLTNQ-LVG 740
              W + GS  +++TVITTIGYGH  P T  G++F +FYA+ GIPLT++   ++G+ +    R +  +L    C +L   +  + N  LVG
Sbjct:   88 KQWKFAGSFYFAITVITTIGYGHAAPGTDAGKVFCMFYAVLGIPLTLVMFQSLGERMNTFVRFLLKKL--KRCFRLRKTEVSMENMVLVG 175          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Mouse
Match: Kcnk18 (potassium channel, subfamily K, member 18 [Source:MGI Symbol;Acc:MGI:2685627])

HSP 1 Score: 117.087 bits (292), Expect = 2.776e-28
Identity = 105/428 (24.53%), Postives = 185/428 (43.22%), Query Frame = 3
Query:  114 MQEEDSRCDREKCVNYSKNFCSCLFSHIG--LSGL-----VVAYTILGGFLFYNIEISGEINVKNQMKIVRNETENKLEQILSSEMKADFNSSEILTNIRAILNEHERIFKENIFENGWNGRYEITENNWSYEGSILYSVTVITTIGYGHVTPKTKLGRIFTIFYAIFGIPLTILYLNNIGDYLAEIFRLVYSQLCHPLCMKLFTKKKRLTNQLVGHHIRVSDESSIQIKSDFNENLLDTNTDFESISSRKMSHSFTEPLQSIENAKIHCWGDLENLQTKLEKSTETEIQIPENLENEIE-AVQSNIDKLPVELIHFDNQNTSYFYTEVSETVPLTLTLCIMVVYIIMGAFLFTFWGSDNDYLKWSYFCFITLSTIGFGDIVPGISVSDLNPKEKLIVSVLYVAIGLPVFAMCFKLMEDEIVNKVKSL 1373
            M+ E+    R  C         C    +G  L GL     +V Y ++G  LF  +E  G  + + +     N    K    L + +K +     ++   R  L EH +  K    +            +WS+  ++ +  TV +T+GYGH+ P T+LG+   + YA+FGIPL  L L +IGD LA I    YS+    LC+     K R         +      S  ++    + ++D   D   + + + S     P  ++E  +     + +N      +  E     PE +   +  ++ SN+D++  ++   D              +PL +   ++  YI   A +  FW ++  +    YFCF+TL+TIGFGDIV       ++P   L  S+ Y+ +G+ +  + FKLM++ +++  K+L
Sbjct:    1 MEAEEPPEARRCCPEALGKARGCCPEALGKLLPGLCFLCCLVTYALVGAALFSAVE--GRPDPEAE----ENPELKKFLDDLCNILKCNLT---VVEGSRKNLCEHLQHLKPQWLK---------APQDWSFLSALFFCCTVFSTVGYGHMYPVTRLGKFLCMLYALFGIPLMFLVLTDIGDILATILSRAYSRFQALLCLPHDIFKWR------SLPLCRKQPDSKPVEEAIPQIVIDAGVD--ELLNPQPSKDPPSPSCNVELFERLVAREKKNKLQPPTRPVERSNSCPELVLGRLSCSILSNLDEVGQQVERLD--------------IPLPVIALVVFAYISCAAAILPFWETELGFEDAFYFCFVTLTTIGFGDIV------LVHPHFFLFFSI-YIIVGMEILFIAFKLMQNRLLHTYKTL 381          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Mouse
Match: Kcnk15 (potassium channel, subfamily K, member 15 [Source:MGI Symbol;Acc:MGI:2675209])

HSP 1 Score: 72.7886 bits (177), Expect = 1.232e-13
Identity = 47/158 (29.75%), Postives = 78/158 (49.37%), Query Frame = 3
Query:  213 VVAYTILGGFLFYNIEISGEINVKNQMKIVRNETENKLEQILSSEMKADFNSSEILTNIRAILNEHERIFKENIFENGWNGRYEITENNWSYEGSILYSVTVITTIGYGHVTPKTKLGRIFTIFYAIFGIPLTILYLNNIGDYLAEIFR--LVYSQLC 680
            +++Y ++G  +F  +E   E     Q  + R   E + +   S++   D+   E L    A+  E  R            GR       W + GS  +++TVITTIGYGH  P T  G++F +FYA+ GIPLT++   ++G+ L  + R  L+ ++ C
Sbjct:   15 ILSYLLVGAAVFDALE--SEAERSRQRLLARKRGEFRRKYRFSAD---DYRELERL----ALQAEPHR-----------AGR------QWRFAGSFYFAITVITTIGYGHAAPGTDSGKVFCMFYALLGIPLTLVTFQSLGERLNTLVRCLLLTAKRC 146          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Mouse
Match: Kcnk15 (potassium channel, subfamily K, member 15 [Source:MGI Symbol;Acc:MGI:2675209])

HSP 1 Score: 72.7886 bits (177), Expect = 1.333e-13
Identity = 45/158 (28.48%), Postives = 78/158 (49.37%), Query Frame = 3
Query:  213 VVAYTILGGFLFYNIEISGEINVKNQMKIVRNETENKLEQILSSEMKADFNSSEILTNIRAILNEHERIFKENIFENGWNGRYEITENNWSYEGSILYSVTVITTIGYGHVTPKTKLGRIFTIFYAIFGIPLTILYLNNIGDYLAEIFR--LVYSQLC 680
            +++Y ++G  +F  +E   E     Q  + R   E + +   S++   D+   E L    A+  E  R  ++                 W + GS  +++TVITTIGYGH  P T  G++F +FYA+ GIPLT++   ++G+ L  + R  L+ ++ C
Sbjct:   34 ILSYLLVGAAVFDALE--SEAERSRQRLLARKRGEFRRKYRFSAD---DYRELERL----ALQAEPHRAGRQ-----------------WRFAGSFYFAITVITTIGYGHAAPGTDSGKVFCMFYALLGIPLTLVTFQSLGERLNTLVRCLLLTAKRC 165          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Mouse
Match: Kcnk5 (potassium channel, subfamily K, member 5 [Source:MGI Symbol;Acc:MGI:1336175])

HSP 1 Score: 73.1738 bits (178), Expect = 2.148e-13
Identity = 27/60 (45.00%), Postives = 45/60 (75.00%), Query Frame = 3
Query:  468 TENNWSYEGSILYSVTVITTIGYGHVTPKTKLGRIFTIFYAIFGIPLTILYLNNIGDYLA 647
            T NNW++  +++++ TVITTIGYG+V PKT  GR+F +FY +FG+PL + +++ +G +  
Sbjct:   79 TFNNWNWPNAMIFAATVITTIGYGNVAPKTPAGRLFCVFYGLFGVPLCLTWISALGKFFG 138          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Mouse
Match: Kcnk10 (potassium channel, subfamily K, member 10 [Source:MGI Symbol;Acc:MGI:1919508])

HSP 1 Score: 69.3218 bits (168), Expect = 7.607e-13
Identity = 45/153 (29.41%), Postives = 68/153 (44.44%), Query Frame = 3
Query:  222 YTILGGFLFYNIEISGEINVKNQMKIVRNE--------TENKLEQILSSEMKADFNSSEILTNIRAILNEHERIFKENIFENGWNGRYEITENNWSYEGSILYSVTVITTIGYGHVTPKTKLGRIFTIFYAIFGIPLTILYLNNIGDYLAEIF 656
            Y + GG +F  +E   E + KN + + + E        +  +LE ++   + AD      +                        G    + ++W    +  ++ TVITTIGYG++ P T+ G+IF I YAIFGIPL    L  IGD L  IF
Sbjct:   82 YLVTGGLVFRALEQPFESSQKNTIALEKAEFLRDHICVSPQELETLIQHALDADNAGVSPV------------------------GNSSNSSSHWDLGSAFFFAGTVITTIGYGNIAPSTEGGKIFCILYAIFGIPLFGFLLAGIGDQLGTIF 210          
BLAST of Potassium channel subfamily K member 18 vs. UniProt/SwissProt
Match: sp|Q6Q1P3|KCNKI_RAT (Potassium channel subfamily K member 18 OS=Rattus norvegicus OX=10116 GN=Kcnk18 PE=2 SV=1)

HSP 1 Score: 128.642 bits (322), Expect = 1.470e-31
Identity = 103/402 (25.62%), Postives = 179/402 (44.53%), Query Frame = 3
Query:  213 VVAYTILGGFLFYNIEISGEINVKNQMKIVRNETENKLEQILSSEMKADFNSSEILTNIRAILNEHERIFKENIFENGWNGRYEITENNWSYEGSILYSVTVITTIGYGHVTPKTKLGRIFTIFYAIFGIPLTILYLNNIGDYLAEIFRLVYSQLCHPLCM-KLFTKKKRLTNQLVGHHIRVSDESSIQIKSDFNEN-LLDTNTD------------FESISSRKMSHSFTEPLQSIENAKIHCWGDLENLQTKLEKSTETEIQIPENLENEIE-AVQSNIDKLPVELIHFDNQNTSYFYTEVSETVPLTLTLCIMVVYIIMGAFLFTFWGSDNDYLKWSYFCFITLSTIGFGDIVPGISVSDLNPKEKLIVSVLYVAIGLPVFAMCFKLMEDEIVNKVKSL 1373
            +V Y ++G  LF  +E  G  + + +      +  +KL  IL   +        ++   R  L EH +  K   F+            +WS+  ++ +  TV +T+GYGH+ P T+LG+   + YA+FGIPL  L L +IGD LA I    YS+    LC+ +  +K + L         + +DE+  QI  D   + LLD                FE + +R+  +    P++ +E +                         PE +   +  ++ SN+D++  ++   D              +PL +   ++  YI   A +  FW +D  +    YFCF+TL+TIGFGDIV       ++P   L  S+ Y+ +G+ +  + FKLM++ +++  K+L
Sbjct:   52 LVTYALVGAALFSAVE--GRPDPEAEENPELKKFLDKLCNILKCNLT-------VVEGSRKDLCEHLQQLKPQWFK---------APEDWSFLSALFFCCTVFSTVGYGHMYPVTRLGKFLCMLYALFGIPLMFLVLTDIGDILAAILSRAYSRFQALLCLPRDISKWRPLLLCRKQTDSKPADEAIPQIVIDAGADELLDPQPSREPASPSCNVELFERLVAREKQNELQPPMRPVERSN----------------------SCPELVLGRLSCSILSNLDEVGQQVERLD--------------IPLPVIALVIFAYISCAAAILPFWETDLGFEDAFYFCFVTLTTIGFGDIV------LVHPHFFLFFSI-YIIVGMEILFIAFKLMQNRLLHTYKTL 392          
BLAST of Potassium channel subfamily K member 18 vs. UniProt/SwissProt
Match: sp|Q6VV64|KCNKI_MOUSE (Potassium channel subfamily K member 18 OS=Mus musculus OX=10090 GN=Kcnk18 PE=1 SV=1)

HSP 1 Score: 117.087 bits (292), Expect = 1.942e-27
Identity = 105/428 (24.53%), Postives = 185/428 (43.22%), Query Frame = 3
Query:  114 MQEEDSRCDREKCVNYSKNFCSCLFSHIG--LSGL-----VVAYTILGGFLFYNIEISGEINVKNQMKIVRNETENKLEQILSSEMKADFNSSEILTNIRAILNEHERIFKENIFENGWNGRYEITENNWSYEGSILYSVTVITTIGYGHVTPKTKLGRIFTIFYAIFGIPLTILYLNNIGDYLAEIFRLVYSQLCHPLCMKLFTKKKRLTNQLVGHHIRVSDESSIQIKSDFNENLLDTNTDFESISSRKMSHSFTEPLQSIENAKIHCWGDLENLQTKLEKSTETEIQIPENLENEIE-AVQSNIDKLPVELIHFDNQNTSYFYTEVSETVPLTLTLCIMVVYIIMGAFLFTFWGSDNDYLKWSYFCFITLSTIGFGDIVPGISVSDLNPKEKLIVSVLYVAIGLPVFAMCFKLMEDEIVNKVKSL 1373
            M+ E+    R  C         C    +G  L GL     +V Y ++G  LF  +E  G  + + +     N    K    L + +K +     ++   R  L EH +  K    +            +WS+  ++ +  TV +T+GYGH+ P T+LG+   + YA+FGIPL  L L +IGD LA I    YS+    LC+     K R         +      S  ++    + ++D   D   + + + S     P  ++E  +     + +N      +  E     PE +   +  ++ SN+D++  ++   D              +PL +   ++  YI   A +  FW ++  +    YFCF+TL+TIGFGDIV       ++P   L  S+ Y+ +G+ +  + FKLM++ +++  K+L
Sbjct:    1 MEAEEPPEARRCCPEALGKARGCCPEALGKLLPGLCFLCCLVTYALVGAALFSAVE--GRPDPEAE----ENPELKKFLDDLCNILKCNLT---VVEGSRKNLCEHLQHLKPQWLK---------APQDWSFLSALFFCCTVFSTVGYGHMYPVTRLGKFLCMLYALFGIPLMFLVLTDIGDILATILSRAYSRFQALLCLPHDIFKWR------SLPLCRKQPDSKPVEEAIPQIVIDAGVD--ELLNPQPSKDPPSPSCNVELFERLVAREKKNKLQPPTRPVERSNSCPELVLGRLSCSILSNLDEVGQQVERLD--------------IPLPVIALVVFAYISCAAAILPFWETELGFEDAFYFCFVTLTTIGFGDIV------LVHPHFFLFFSI-YIIVGMEILFIAFKLMQNRLLHTYKTL 381          
BLAST of Potassium channel subfamily K member 18 vs. UniProt/SwissProt
Match: sp|Q7Z418|KCNKI_HUMAN (Potassium channel subfamily K member 18 OS=Homo sapiens OX=9606 GN=KCNK18 PE=1 SV=1)

HSP 1 Score: 110.538 bits (275), Expect = 3.278e-25
Identity = 101/400 (25.25%), Postives = 171/400 (42.75%), Query Frame = 3
Query:  183 LFSHIGLSGLVVAYTILGGFLFYNIEISGEINVKNQMKIVRNETENKLEQILSSEMKADFNSSE-ILTNIRAILNEHERIFKENIFENGWNGRYEITENNWSYEGSILYSVTVITTIGYGHVTPKTKLGRIFTIFYAIFGIPLTILYLNNIGDYLAEIFRLVYSQLCHPLCMKLFTKKKRLTNQLVGHHIRVSDESSIQIKSDFNENLLDTNTDFESISSRKMSHSFTEPLQSIE-NAKIHCWGDLENLQTKLEKSTETEIQIPENLENEIE-AVQSNIDKLPVELIHFDNQNTSYFYTEVSETVPLTLTLCIMVVYIIMGAFLFTFWGSDNDYLKWSYFCFITLSTIGFGDIVPGISVSDLNPKEKLIVSVLYVAIGLPVFAMCFKLMEDEIVNKVKSL 1373
            LF  +     +V Y ++G  +F  IE  G++ V         E E  LE     E+    N SE ++ + +  L  H +  K       W  R      +WS+  S+ +  TV +T+GYG++ P T+LG+   + YA+FGIPL  L L + GD LA I    Y++         F K    T  L+      S           +E +       E +   K+    + P  S+E   + H       LQ    ++ E     PE +   +  ++ SN+D++  ++   D              +PL +   I+  YI   A +  FW +  D+    YFCF+TL+TIGFGD V       L      +   +Y+ +G+ +  + FKL+++ +++  K++
Sbjct:   20 LFPGLCFLCFLVTYALVGAVVFSAIE-DGQVLVAAD----DGEFEKFLE-----ELCRILNCSETVVEDRKQDLQGHLQKVKPQ-----WFNR----TTHWSFLSSLFFCCTVFSTVGYGYIYPVTRLGKYLCMLYALFGIPLMFLVLTDTGDILATILSTSYNR---------FRKFPFFTRPLLSKWCPKSLFKKKPDPKPADEAVPQIIISAEELPGPKLGTCPSRPSCSMELFERSHALEKQNTLQLP-PQAMERSNSCPELVLGRLSYSIISNLDEVGQQVERLD--------------IPLPIIALIVFAYISCAAAILPFWETQLDFENAFYFCFVTLTTIGFGDTV-------LEHPNFFLFFSIYIIVGMEIVFIAFKLVQNRLIDIYKNV 369          
BLAST of Potassium channel subfamily K member 18 vs. UniProt/SwissProt
Match: sp|Q23435|TWK9_CAEEL (TWiK family of potassium channels protein 9 OS=Caenorhabditis elegans OX=6239 GN=twk-9 PE=2 SV=2)

HSP 1 Score: 98.5969 bits (244), Expect = 1.140e-20
Identity = 79/297 (26.60%), Postives = 135/297 (45.45%), Query Frame = 3
Query:  462 EITENNWSYEGSILYSVTVITTIGYGHVTPKTKLGRIFTIFYAIFGIPLTILYLNNIGDYLAEIFR--LVYSQLCHPLCMKLFTKKKRLTNQLVGHHIRVSDESSIQIKSDFNENLLDTNTDFESISSRKMSHSFTEPLQSIENAKIHCWGDLENLQTKLEKSTETEIQIPENLENEIEAVQSNIDKLPVELIHFDNQNTSYFYTEVSETVPLTLTLCIMVVYIIMGAFLFTFWGSDNDYLKWSYFCFITLSTIGFGDIVPGISVSDLNPKEKLIVSVLYVAIGLPVFAMCFKLMED 1346
            E     WS   S++++ TVITTIGYGHV P+T  GR+F IFY + G+P T+L + ++G +L    +  L  ++      +KL+ K K+  N+        S ++S  +       + +T  + + +S R               A+    GD                        EIE +++  D+   E    + +N     TE S  + +T T C    Y++ GA + + +  + D+ K  YF F+TL+TIG GD VP          + L+++++Y+ IGL +  M  ++  D
Sbjct:  155 ETPAEKWSIGNSVIFAFTVITTIGYGHVAPETFEGRLFLIFYGVIGVPFTLLTIADLGMFLTRFLKNLLTMARRFAHYLVKLYQKAKKQRNK--------SQKTSPVMPDSERSEVWNTGKEMKEMSMR--------------TAREPGEGD------------------------EIEVIENGNDENGKEEDEEEPENNEPRKTEESIALGITFT-C----YLVAGAKILSVYEPEMDFFKALYFNFVTLTTIGLGDFVP-------KSFDYLLITLIYIGIGLALTTMAIEIAAD 393          
BLAST of Potassium channel subfamily K member 18 vs. UniProt/SwissProt
Match: sp|P34410|TWK7_CAEEL (TWiK family of potassium channels protein 7 OS=Caenorhabditis elegans OX=6239 GN=twk-7 PE=3 SV=3)

HSP 1 Score: 84.3445 bits (207), Expect = 5.400e-16
Identity = 50/170 (29.41%), Postives = 94/170 (55.29%), Query Frame = 3
Query:  165 KNFCSCLFSHIGLSGLVVAYTILGGFLFYNIEISGEINVK-NQMKIV---RNETENKLEQILSSEMKADFNSSEILTNIRAILNEHERIFKENIFENGWNGRYEITEN----NWSYEGSILYSVTVITTIGYGHVTPKTKLGRIFTIFYAIFGIPLTILYLNNIGDYLAE 650
            + F   +  H+ L  L   YT++G  +FY++E   E  +K  Q+K++   +NE  + L ++ +      +    +    R + N  +++F    FE  +    E+ +N     W++  SI ++VTV+TTIGYG+  P T +GRI+ I +++ GIPLT++ + ++G +L+E
Sbjct:  156 RKFAKLVLPHVALVLLTCTYTVIGALIFYSVEQPHEQMMKEQQLKLIYTRQNEFVDDLIRLAAGNETKRYEWESLAE--RHMHNMSDQLFVA--FEKYFLTSNEVKKNAATETWTFSSSIFFAVTVVTTIGYGNPVPVTNIGRIWCILFSLLGIPLTLVTIADLGKFLSE 321          
BLAST of Potassium channel subfamily K member 18 vs. TrEMBL
Match: R7U1G0 (Uncharacterized protein (Fragment) OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_62385 PE=3 SV=1)

HSP 1 Score: 244.973 bits (624), Expect = 4.488e-73
Identity = 142/408 (34.80%), Postives = 219/408 (53.68%), Query Frame = 3
Query:  165 KNFCSCLFSHIGLSGLVVAYTILGGFLFYNIEISGEINVKNQMKIVRNETENKLEQILSSEMKADFNSSEILTNIRAILNEHERIFKENIFENGWNGRYEITENN--WSYEGSILYSVTVITTIGYGHVTPKTKLGRIFTIFYAIFGIPLTILYLNNIGDYLAEIFRLVYSQLCHPL--CMKLFTKKKRLTNQLVGHHIRVSDESSIQIKSDFNENLLDTNTDFESISSRKMSHSFTEPLQSIENAKIHCWGDLENLQTKLEKSTETEIQIPENLENEIEAVQSNIDKLPVELIHFDNQNTSYFYTEVSETVPLTLTLCIMVVYIIMGAFLFTFWGSDNDYLKWSYFCFITLSTIGFGDIVPGISVSDLNPKEKLIVSVLYVAIGLPVFAMCFKLMEDEIVNKVKSLA 1376
            K F + LFSHIGL+ LVV Y+ILGGFLF  IE   E   K +++ VR +   +L+   +   +   N++     +R +L  +++     + E GW+G  +++E++  WS+ G++LY+VTVITTIGYGHV PKT  GRI TI YA+ GIPLT LYL+NIG++LA+ FRL Y ++C  +  C K   K+KR   + +    R+    ++   +  ++  +D +  ++ +   +                           T L+ +    +  P + E+E E  +  +                          P+++ L ++  YI  G+ LFT W  D DYL  SYFCFITLSTIGFGDIVPG  + +    EKL++ VL++A GL + AMCF LM++E+  K+K + 
Sbjct:   16 KKFVTFLFSHIGLAALVVGYSILGGFLFRWIEAPSEWQEKYRIREVREDIVEQLQSTATHLKEGQINATSFENKVRGVLFHYQKELILAVKEKGWDGNDDMSESSVQWSFAGALLYAVTVITTIGYGHVAPKTSAGRIVTIVYALIGIPLTFLYLSNIGNFLADAFRLFYKKVCCDVFCCKKCERKRKR---ERLKMRRRIVKNHTMGNSTALHDMAIDMDCAYDQLELGEY--------------------------TDLKGNALNFVDDPFDYEDEDEDAKVTV--------------------------PVSICLILIAGYIFAGSVLFTLW-EDWDYLTGSYFCFITLSTIGFGDIVPGTDMKEWASHEKLVLCVLWLAFGLSLLAMCFNLMQEEVKEKIKRIG 367          
BLAST of Potassium channel subfamily K member 18 vs. TrEMBL
Match: T1EGS2 (Uncharacterized protein OS=Helobdella robusta OX=6412 GN=20195772 PE=3 SV=1)

HSP 1 Score: 214.157 bits (544), Expect = 1.992e-61
Identity = 140/412 (33.98%), Postives = 214/412 (51.94%), Query Frame = 3
Query:  144 EKCVNYSKNFCSCLFSHIGLSGLVVAYTILGGFLFYNIEISGEINVKNQMKIVRNETENKLEQILSSEMKADFNSSEILTN--IRAILNEHERIFKENIFENGWNGRYEITENN--WSYEGSILYSVTVITTIGYGHVTPKTKLGRIFTIFYAIFGIPLTILYLNNIGDYLAEIFRLVYSQLCHPLCMKLFTKKKRLTNQLVGHHIRVSDESSIQIKSDFNENLLDTNTDFESISSRKMSHSFTEPLQSIENAKIHCWGDLENLQTKLEKSTETEIQIPENLENEIEAVQSNIDKLPVELIHFDNQNTSYFYTEVSETVPLTLTLCIMVVYIIMGAFLFTFWGSDNDYLKWSYFCFITLSTIGFGDIVPGISVSDLNPKEKLIVSVLYVAIGLPVFAMCFKLMEDEIVNKVK 1367
            +K  N  +   + LFSH+GLS ++VAYT+LG F F  IE   E   K  +  ++++    + +IL+   KA  + ++ L N  +R I  + +    + + + GWNG  E+ E +  WS  GSILY++TVITTIGYGHV PKT +GRI TI YA+ GIPLT LYL+NIG++LA+ FR+ Y  +C  +      +++R   +L+   +R   E  I+ K      + +       IS  K  +     L+S+    +       +L T L  S + E                                        + TVP+ + L ++  Y+ +G+ LF+FW   N  +  SYFCF+TLSTIGFGDIVPG    D + + KL++  +++A GL + AMCF LM++E+  K K
Sbjct:    1 QKIANCCRETTAFLFSHVGLSAMIVAYTVLGAFTFRQIESESERMEKFHIIKLKDDL---VGEILNLTEKARIHPNKKLLNETLRKIFLDFQTELYKAVKDKGWNGLDEVDETSLQWSLAGSILYAITVITTIGYGHVVPKTDIGRIVTILYALVGIPLTFLYLSNIGNFLADCFRIFYKNICCDVFCCKKCERQRKKERLI---LRKKREKLIRKKL-----VAEAAKQTVLISCNKKKNRNYAKLRSVVGVTLG-----RDLSTDLSSSGKEET-----------------------------------CEHATVTVPIYICLILIGSYLFIGSALFSFWEGWNT-ITGSYFCFVTLSTIGFGDIVPGTEAKDWSSQPKLVLCAIWLAFGLSLLAMCFNLMQEEVKEKFK 360          
BLAST of Potassium channel subfamily K member 18 vs. TrEMBL
Match: A0A4D5S293 (Putative potassium channel subfamily protein k member (Fragment) OS=Ixodes scapularis OX=6945 PE=3 SV=1)

HSP 1 Score: 214.927 bits (546), Expect = 2.231e-61
Identity = 135/409 (33.01%), Postives = 206/409 (50.37%), Query Frame = 3
Query:  147 KCVNYSKNFCSCLFSHIGLSGLVVAYTILGGFLFYNIEISGEINVKNQMKIVRNETENKLEQILSSEMKADFNSSEILTNIRAILNEHERIFKENIFENGWNGRYEITENNWSYEGSILYSVTVITTIGYGHVTPKTKLGRIFTIFYAIFGIPLTILYLNNIGDYLAEIFRLVYSQLCHPLCMKLFTKKKRLTNQLVGHHIRVSDESSIQIKSDFNENLLDTNTDFESISSRKMSHSFTEPLQSIENAKIHCWGDLENLQTKLEKSTETEIQIPENLENEIEAVQSNIDKLPVELIHFDNQNTSYFYTEVSETVPLTLTLCIMVVYIIMGAFLFTFWGSDNDYLKWSYFCFITLSTIGFGDIVPGIS-VSDLNPKEKLIVSVLYVAIGLPVFAMCFKLMEDEIVNKVKS 1370
            KC    + F + LFSH+GL  LVV Y+ILG F F  +E   E+   +Q+ ++R +T  +L +I +      +  +        IL+   R+      ++G++G+   T   WS+ G+ LYS+TVITTIGYG++ P+T  G++ TI YAI GIPL +LYL NIGD LA+ FR VY +LC   C      ++R    L  H                  N L  N                    ++EN ++H                     I  +  N ++     +   PV +    + +      +   +VP+TL   IM+ YI  GA +F+ W    ++L  SYFCF+TLSTIGFGD+VPG + VSD   +EKL++  LY+ +G+ + AMCF LM++E++ KV++
Sbjct:   19 KCKTCCRRFTAFLFSHVGLCALVVGYSILGAFAFRALEAPYEVEKASQVILMREQTVRRLWEI-TDRFNVLYRENWTAAVSSEILDFQGRLIAA--VKDGYDGKEIGTGQQWSFSGAFLYSLTVITTIGYGNIAPRTNWGKMVTILYAIVGIPLMLLYLTNIGDILAKAFRYVYGKLC--TCRPAQHPQRRRRQPLPLH------------------NHLQRNA-------------------AVENYRVH--------------------HIVGH--NSVDLQDGKLRDDPVRVESLADDDVYEGGAKPRVSVPITLCFVIMIGYISGGAVIFSLW-EGWEFLDGSYFCFVTLSTIGFGDLVPGDTVVSDSGSQEKLVICSLYLLVGMALIAMCFNLMQEEVIYKVRN 362          
BLAST of Potassium channel subfamily K member 18 vs. TrEMBL
Match: A0A210QFK5 (Potassium channel subfamily K member 18 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT15582 PE=3 SV=1)

HSP 1 Score: 214.542 bits (545), Expect = 7.992e-61
Identity = 140/428 (32.71%), Postives = 226/428 (52.80%), Query Frame = 3
Query:  141 REKCVNYSKNFCSCLFSHIGLSGLVVAYTILGGFLFYNIEISGEINV----KNQMKIVRNETENKLEQILSSEMKADFNSSEILTNIRAILNEHERIFKENIFENGWNG-------RYEITENNWSYEGSILYSVTVITTIGYGHVTPKTKLGRIFTIFYAIFGIPLTILYLNNIGDYLAEIFRLVYSQLCHPLCMKLFTKKKRLTNQLVGHHIRVSDESSIQIKSDFNENLLDTNTDFESISSRKMSHSFTE-PLQSIENAKIHCWGDLENLQTKL-------EKSTETEIQIPENLENEIEAVQSNIDKLPVELIHFDNQNTSYFYTEVSETVPLTLTLCIMVVYIIMGAFLFTFWGSDNDYLKWSYFCFITLSTIGFGDIVPGISVSDLNPKEKLIVSVLYVAIGLPVFAMCFKLMEDEIVNKVK 1367
            RE C   +  F   LFSH+GL G+VV Y + GGF+F ++E + E  +    K + + + N+T   +  +++ E   + + S +   +R +L      F++N    G++G       + +     WS+ G++ +SVTVI+TIGYGH+ PKT  GR+  I YA+ GIPL +L L NIGD LA+IFR +Y+++C   C +   K K +  +       V+ E     +SD   N++          +  M H F++ P ++ E+ K    G  ++++             T+ E   P  L N+           PV     D+++  +   ++  TVPLT+T+ ++  YI  GA LF  W S  D+L+ +YFCFITLSTIGFGD+VPG    +   + +L++  +YV  G+ + +MCF LM+DEI+ K K
Sbjct:    6 REGCCKNAMKF---LFSHVGLCGMVVLYCVAGGFIFEHLEKNNEQQICYDSKEEYEPMENKTLTNMLNVIT-ENDGNPDKSVMTIQLRVLL----ETFRDNSIAIGYDGSVCADYGKADGPTYKWSWPGALFFSVTVISTIGYGHIAPKTFWGRLVCIAYAVLGIPLMLLCLANIGDVLADIFRFIYAKICCCGCCRRKDKTKVVQIK------PVAQEPEGAWRSDKTGNMVIPK-------APPMKHEFSKIPPKTPESMKGMTNGRPDDVKPVRIIPMDVKSYKTQHEPHRPMPLRND-----------PVLDDDSDDEDDDFDDKKI--TVPLTVTMIVIAGYIFGGAVLFGLWES-WDWLQSAYFCFITLSTIGFGDVVPGTDFDNPQAQAQLVLGAIYVLFGMAILSMCFSLMQDEIIAKCK 398          
BLAST of Potassium channel subfamily K member 18 vs. TrEMBL
Match: A0A0L8G4G9 (Uncharacterized protein OS=Octopus bimaculoides OX=37653 GN=OCBIM_22000601mg PE=3 SV=1)

HSP 1 Score: 212.231 bits (539), Expect = 3.744e-59
Identity = 146/426 (34.27%), Postives = 217/426 (50.94%), Query Frame = 3
Query:  183 LFSHIGLSGLVVAYTILGGFLFYNIEISGEINVKNQMKIVRNETENKLEQILSSEMKAD----FNSSEILTNIRAILNEHERIFKENIFENGWNGRYEITENNWSYEGSILYSVTVITTIGYGHVTPKTKLGRIFTIFYAIFGIPLTILYLNNIGDYLAEIFRLVYSQLCHPLC-----MKLFTKKKRLTNQLVGHHIRVSDESSIQIKSDFNENLLDTNTDFESISSRKMSHSFTEPLQSIE----NAKIHCWGDLENLQTKLEKSTETEIQIPENLE-NEIEAVQSNIDKLPVELIHFDNQNTSY------FYTEVSE----------------TVPLTLTLCIMVVYIIMGAFLFTFWGSDNDYLKWSYFCFITLSTIGFGDIVPGISVSDLNPKEKLIVSVLYVAIGLPVFAMCFKLMEDEI 1352
             FSH+GL+G VVAY I GG++F  +E   E +++ ++  +R++    L  + S++  A+     NS  I  NI     E  R     I    WNG  E  E  WSY G++LYSVTV+TTIGYGH+ PKT  GRI TI YAIFGIPLT+L L  IG ++A IF+ +Y  +C+ L      ++++  K +    L     ++  E  I+ KS+      D +   +S S   + +S  + L   E      +I  W   +N++ KL  S +  +Q   N E N+ +  Q   +      +   +  T++       + E  E                 VP+ +TL ++  YI +GA LF+ W  + DYL  SYFCF+TLSTIGFGD VPG  V   +  EK  +  +Y+  GL + AM F LM+ E+
Sbjct:   40 FFSHVGLTGSVVAYNIFGGWIFMELEAPHERDLRQEVSSIRSKYRAILANV-STQQGANNDSLSNSGYIYDNIVKFEEELVRF----IATTEWNGLDEEFELQWSYTGALLYSVTVVTTIGYGHIAPKTMWGRIVTIIYAIFGIPLTLLCLRTIGSFMAGIFKFIYENICYQLYKQWQRLRIYILKTKRKQTLRFLQAKMVLEELIE-KSNELLKSTDDSDSSQSSSEDDLKNSINKELHQREIKKGRQRILKWKSRKNIRKKLRLSKQVSVQQQPNQETNDCDTTQRIAEDSCKITMSPQSSKTAFVEENDILFQEKPEGHDGIKLRPRGSHHEIRVPVYITLLVIAGYIFIGAVLFSLWEKNWDYLIGSYFCFVTLSTIGFGDFVPGSDVDSWSSAEKQAICTIYLLFGLAMIAMSFNLMQQEV 459          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Cavefish
Match: ENSAMXT00000047723.1 (pep primary_assembly:Astyanax_mexicanus-2.0:9:15897283:15919205:1 gene:ENSAMXG00000033807.1 transcript:ENSAMXT00000047723.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 120.553 bits (301), Expect = 4.184e-29
Identity = 107/399 (26.82%), Postives = 178/399 (44.61%), Query Frame = 3
Query:  183 LFSHIGLSGLVVAYTILGGFLFYNIEIS----GEINVKNQMKI----VRNETENKLEQILSSEMKADFNSSEILTNIRAILNEHERIFKENIFENGWNGRYEITENNWSYEGSILYSVTVITTIGYGHVTPKTKLGRIFTIFYAIFGIPLTILYLNNIGDYLAEIFRLVYSQLCHPLCMKLFTKKKRLTNQLVGHHIRVSDESSIQIKS-DFNENLLDTNTDFESISSRKMSHSFTE--PLQSIENAKI--HCWGDLENLQTKLEKSTETEIQIPENLENEIEAVQSNIDKLPVELIHFDNQNTSYFYTEVSE-TVPLTLTLCIMVVYIIMGAFLFTFWGSDNDYLKWSYFCFITLSTIGFGDIVPGISVSDLNPKEKLIVSVLYVAIGLPVFAMCFKL 1337
            L  H  L   ++ Y +LG  LF+ IE +    G + +    +     V NE  NK      SE        E+L  +       E+I +E  F+  W      + + W + GS+ +  TV TT+GYG + P TK GR+  I YA  GIPL +L + ++GD LA +F   Y +L H  C       +RL  ++   H +  D  +I+  +  FN +++      +      +  S  E  P   ++N  I  H    +   + + ++        PE            ++++P   + F  ++      E+    VP  + L ++  YI++ A +   W  D       YFCFITL+TIGFGDIVP       +PK   +++ L++ +G+ + +M FKL
Sbjct:  136 LLPHAALILSLIVYALLGAALFHAIEGTQSNDGTLEIHEGFRKFVHEVVNEARNKSTSANVSE--------EVLEAV------GEKILRE--FKAVWMQ----SSDRWHFYGSLFFCCTVFTTVGYGEIYPVTKAGRVACILYATVGIPLMLLVITDVGDILAVLFSNSYRRL-HSSC-------RRLLYRVWNPHQKPRDPVTIRDGTYIFNRDVVVQEVSVDHRIGTAIDSSVIEQKPDHLLKNKNIFNHI---IAKEKFRRKRPLTRSCSCPE------------LNQMPPPPVGFKIKDFLSIGHEMERFNVPFLVILLVVFAYILIWALILPIWEDDLGKFDAFYFCFITLTTIGFGDIVPK------HPKF-FMLTFLFIIMGMAIMSMAFKL 484          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Cavefish
Match: ENSAMXT00000032793.1 (pep primary_assembly:Astyanax_mexicanus-2.0:22:28595722:28598505:1 gene:ENSAMXG00000030049.1 transcript:ENSAMXT00000032793.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 74.3294 bits (181), Expect = 2.075e-14
Identity = 30/64 (46.88%), Postives = 45/64 (70.31%), Query Frame = 3
Query:  474 NNWSYEGSILYSVTVITTIGYGHVTPKTKLGRIFTIFYAIFGIPLTILYLNNIGDYLAEIFRLV 665
              WS+ GS  +S+TVITTIGYGH  P+T+ G++F + YA+ GIPLT++   + G+ +  +FR V
Sbjct:   66 RQWSFPGSFYFSLTVITTIGYGHSYPRTEAGKVFCMLYALLGIPLTLVMFQSTGERMNMLFRSV 129          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Cavefish
Match: kcnk15 (potassium channel subfamily K member 15-like [Source:NCBI gene;Acc:103042097])

HSP 1 Score: 73.9442 bits (180), Expect = 7.845e-14
Identity = 43/123 (34.96%), Postives = 67/123 (54.47%), Query Frame = 3
Query:  306 NETENKLEQIL---SSEMKADFNSSEILTNIRAILNEHERIFKENIFENGWNGRYEITENNWSYEGSILYSVTVITTIGYGHVTPKTKLGRIFTIFYAIFGIPLTILYLNNIGDYLAEIFRLV 665
            +ETE++  ++L     EMK  +  SE   + R I    ER+  +   E    GR       W + GS  +++TVITTIGYGH  P T  G++F +FYA+ GIPLT++   ++G+ +    R +
Sbjct:   31 SETESERRRVLEQKRGEMKRQYRFSE--EDYREI----ERMVLQA--EPHRAGR------QWKFAGSFYFAITVITTIGYGHAAPGTDAGKVFCMFYAVLGIPLTLVMFQSLGERMNTFVRFL 139          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Cavefish
Match: kcnk5a (potassium two pore domain channel subfamily K member 5 [Source:NCBI gene;Acc:103027816])

HSP 1 Score: 73.9442 bits (180), Expect = 1.208e-13
Identity = 27/60 (45.00%), Postives = 45/60 (75.00%), Query Frame = 3
Query:  468 TENNWSYEGSILYSVTVITTIGYGHVTPKTKLGRIFTIFYAIFGIPLTILYLNNIGDYLA 647
            T NNW++  +++++ TVITTIGYG++ PKT  GR+F IFY +FG+PL + +++ +G +  
Sbjct:   79 TFNNWNWPNAVIFAATVITTIGYGNIAPKTPSGRVFCIFYGLFGVPLCLTWISELGKFFG 138          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Cavefish
Match: KCNK4 (potassium channel subfamily K member 4-like [Source:NCBI gene;Acc:103026898])

HSP 1 Score: 71.633 bits (174), Expect = 6.203e-13
Identity = 49/158 (31.01%), Postives = 78/158 (49.37%), Query Frame = 3
Query:  213 VVAYTILGGFLFYNIEISGEINVKNQM-KIVRNETENKLEQ--ILSSEMKADFNSSEILTNIRAILNEHERIFKENIFENGWNGRYEITENNWSYEGSILYSVTVITTIGYGHVTPKTKLGRIFTIFYAIFGIPLTILYLNNIGDYLAEIFRLVYSQL 677
            V+ Y ++G  +F  +E   E    N++   +RN     LE    +SSE     N  E+L NI   +            E G N +     ++W    +  +S T+ITTIGYG+++P+TK G++F I YA+ GIPL    L  +GD+L    R   +++
Sbjct:   76 VLLYLVMGALVFNALEAPAEEKQYNELYDNLRNTCSIFLESYSCISSE-----NLHELLENITEAI------------EAGVNAKNNTFSSSWDLASAFFFSGTIITTIGYGNISPQTKWGKLFCICYALVGIPLFGFLLAGVGDHLGTGLRKAIAKI 216          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003416.1 (pep scaffold:Pmarinus_7.0:GL476517:78247:80718:1 gene:ENSPMAG00000003129.1 transcript:ENSPMAT00000003416.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 72.0182 bits (175), Expect = 1.202e-14
Identity = 30/71 (42.25%), Postives = 44/71 (61.97%), Query Frame = 3
Query:  477 NWSYEGSILYSVTVITTIGYGHVTPKTKLGRIFTIFYAIFGIPLTILYLNNIGDYLAEIFRLVYSQLCHPL 689
             W++ GS+ +  T+ TTIGYGH+ P T  G+I  + YA FGIP+ +L L ++GD LA     +Y+   H L
Sbjct:    1 KWNFLGSLFFCCTIFTTIGYGHIAPSTDGGKIMCMVYATFGIPIMLLVLADVGDLLARTLTTIYTSFRHRL 71          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Sea Lamprey
Match: kcnk7 (potassium channel, subfamily K, member 7 [Source:ZFIN;Acc:ZDB-GENE-110304-2])

HSP 1 Score: 60.8474 bits (146), Expect = 1.420e-10
Identity = 37/151 (24.50%), Postives = 64/151 (42.38%), Query Frame = 3
Query:  222 YTILGGFLFYNIEISGEINVKNQMKIVRNE--------TENKLEQILSSEMKADFNSSEILTNIRAILNEHERIFKENIFENGWNGRYEITENNWSYEGSILYSVTVITTIGYGHVTPKTKLGRIFTIFYAIFGIPLTILYLNNIGDYLAE 650
            Y +LG  +F  +E   E  ++  ++ +R+         ++  LE  L   ++A  +    L N  A                           +W +  ++ ++ TV+TT+GYGH  P +  G+   I YA+ GIP T+L L +I   L E
Sbjct:   19 YLVLGAIVFSTLERPYEERLRMDVRRLRDAFVRQHACLSDEALEGFLRDALEARTHGVSALRNATA-------------------------GPHWDFVSALFFASTVLTTVGYGHTVPLSDAGKALCILYAVLGIPFTLLLLTSIVQRLME 144          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Sea Lamprey
Match: KCNK10 (potassium two pore domain channel subfamily K member 10 [Source:HGNC Symbol;Acc:HGNC:6273])

HSP 1 Score: 59.3066 bits (142), Expect = 4.664e-10
Identity = 27/59 (45.76%), Postives = 36/59 (61.02%), Query Frame = 3
Query:  480 WSYEGSILYSVTVITTIGYGHVTPKTKLGRIFTIFYAIFGIPLTILYLNNIGDYLAEIF 656
            W    +  ++ TV+TTIGYG+V+P T  GRIF   YA+ GIP+    L  +GD L  IF
Sbjct:  102 WDLGSAFFFAGTVLTTIGYGNVSPSTDWGRIFCTAYALVGIPIFGFLLAGVGDQLGTIF 160          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Sea Lamprey
Match: KCNK16 (potassium two pore domain channel subfamily K member 16 [Source:HGNC Symbol;Acc:HGNC:14464])

HSP 1 Score: 57.7658 bits (138), Expect = 9.408e-10
Identity = 36/146 (24.66%), Postives = 65/146 (44.52%), Query Frame = 3
Query:  216 VAYTILGGFLFYNIEISGEINVKNQM-----KIVRNET---ENKLEQILSSEMKADFNSSEILTNIRAILNEHERIFKENIFENGWNGRYEITENNWSYEGSILYSVTVITTIGYGHVTPKTKLGRIFTIFYAIFGIPLTILYLNN 629
            VAY + G  +F  +E+  E N++ ++       ++N +   +  L+  L   + A  +       +R    +                    + +NW +  ++L++VTV+TTIGYG   P +  GR    FYA+ GIPL +  L+ 
Sbjct:   23 VAYLLAGAAVFQVLELPAEQNIRQRLTDSWAAFIQNHSCVDDGTLDLFLQEVLDARSH------GVRVAAGQAS------------------SPSNWDFSSALLFTVTVVTTIGYGSTAPGSTWGRASCAFYALLGIPLNLQLLSR 144          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Sea Lamprey
Match: KCNK16 (potassium two pore domain channel subfamily K member 16 [Source:HGNC Symbol;Acc:HGNC:14464])

HSP 1 Score: 58.151 bits (139), Expect = 1.124e-9
Identity = 34/143 (23.78%), Postives = 67/143 (46.85%), Query Frame = 3
Query:  201 LSGLVVAYTILGGFLFYNIEISGEINVKNQMKIVRNETENKLEQILSSEMKADFNSSEILTNIRAILNEHERIFKENIFENGWNGRYEITENNWSYEGSILYSVTVITTIGYGHVTPKTKLGRIFTIFYAIFGIPLTILYLNN 629
            L+   VAY + G  +F  +E+  E N++ ++        +     + +    D  + ++   ++ +L+      +    +         + +NW +  ++L++VTV+TTIGYG   P +  GR    FYA+ GIPL +  L+ 
Sbjct:    8 LATAYVAYLLAGAAVFQVLELPAEQNIRQRLT-------DSWAAFIQNHSCVDDGTLDLF--LQEVLDARSHGVRVAAGQAS-------SPSNWDFSSALLFTVTVVTTIGYGSTAPGSTWGRASCAFYALLGIPLNLQLLSR 134          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Yeast
Match: TOK1 (Outward-rectifier potassium channel of the plasma membrane; has two pore domains in tandem, each of which forms a functional channel permeable to potassium; carboxy tail functions to prevent inner gate closures; target of K1 toxin [Source:SGD;Acc:S000003629])

HSP 1 Score: 51.2174 bits (121), Expect = 2.236e-7
Identity = 23/59 (38.98%), Postives = 33/59 (55.93%), Query Frame = 3
Query:  477 NWSYEGSILYSVTVITTIGYGHVTPKTKLGRIFTIFYAIFGIPLTILYLNNIGDYLAEI 653
            NWSY   I +    + TIGYG   P+T  GR F + +A+  +PL    L+ +GD L +I
Sbjct:  405 NWSYFNCIYFCFLCLLTIGYGDYAPRTGAGRAFFVIWALGAVPLMGAILSTVGDLLFDI 463          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Nematostella
Match: EDO35923 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SK42])

HSP 1 Score: 80.4925 bits (197), Expect = 2.386e-17
Identity = 49/143 (34.27%), Postives = 77/143 (53.85%), Query Frame = 3
Query:  222 YTILGGFLFYNIEISGEINVKNQMKIVRNETENKLEQILSSEMKADFNSSEILTNIRAILNEHERIFKENIFENGWNGRYEITENNWSYEGSILYSVTVITTIGYGHVTPKTKLGRIFTIFYAIFGIPLTILYLNNIGDYLAE 650
            Y + G  +F  IE   E   ++  + VR   +N +E+         +N SE   ++R +  E  +   E        G +++  + WS+ GS+ ++ TV+TTIGYG + P T  GR+F IFYAIFGIP+T L L +IG+ + E
Sbjct:    3 YLLFGAAVFQTIESGEERRERHHFEFVR---QNLIEK---------YNISE--KDMRNLFKEISKAIDE--------GYFDVNYDRWSFAGSLFFTGTVVTTIGYGQMAPATVWGRVFCIFYAIFGIPITGLMLKSIGERITE 123          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Nematostella
Match: EDO47667 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RLC4])

HSP 1 Score: 76.2554 bits (186), Expect = 3.814e-16
Identity = 48/144 (33.33%), Postives = 71/144 (49.31%), Query Frame = 3
Query:  207 GLVVAYTILGGFLFYNIEISGEINVKNQMKIVRNETENKLEQILSSEMKADFNSSEILTNIRAILNEHERIFKENIFENGWNGRYEITENNWSYEGSILYSVTVITTIGYGHVTPKTKLGRIFTIFYAIFGIPLTILYLNNIGD 638
             L ++Y  LG  +F  +E   E+  +  M   R + + +            +N S+   +++  L   E I     F   W+ R       WS  GS+ ++ TV+TTIGYGHVTP T  GR+F IFYA+ GIPLT L L+ +  
Sbjct:    2 ALFLSYIFLGAVIFQALEAKNEMAERRAMSFARLKFQQR------------YNISD--EDMKVFLERIEEIVDHG-FSREWSRR-------WSLLGSLFFAGTVVTTIGYGHVTPCTISGRVFCIFYALVGIPLTWLLLSTLAQ 123          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Nematostella
Match: EDO47668 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RLC5])

HSP 1 Score: 77.0258 bits (188), Expect = 9.336e-16
Identity = 33/58 (56.90%), Postives = 44/58 (75.86%), Query Frame = 3
Query:  477 NWSYEGSILYSVTVITTIGYGHVTPKTKLGRIFTIFYAIFGIPLTILYLNNIGDYLAE 650
             WSY GS+ +S TVITTIGYGH++P+T  GRIF + YA+FGIP+T L L ++G  + E
Sbjct:   85 KWSYTGSLFFSGTVITTIGYGHLSPETFFGRIFCMLYALFGIPITWLMLTSLGKKIVE 142          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Nematostella
Match: EDO46328 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQB1])

HSP 1 Score: 71.633 bits (174), Expect = 3.482e-14
Identity = 29/65 (44.62%), Postives = 46/65 (70.77%), Query Frame = 3
Query:  474 NNWSYEGSILYSVTVITTIGYGHVTPKTKLGRIFTIFYAIFGIPLTILYLNNIGDYLAEIFRLVY 668
            + WSY  S+ ++ +V+TTIGYGH+ P T  GRIF + +A+FGIPL ++ L N+GD + ++   V+
Sbjct:  100 SRWSYYASLYFTWSVVTTIGYGHLAPSTLGGRIFCMIFALFGIPLNLMILKNLGDRIKDVIHYVH 164          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Nematostella
Match: EDO33193 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SSX6])

HSP 1 Score: 70.4774 bits (171), Expect = 9.130e-14
Identity = 31/74 (41.89%), Postives = 44/74 (59.46%), Query Frame = 3
Query:  477 NWSYEGSILYSVTVITTIGYGHVTPKTKLGRIFTIFYAIFGIPLTILYLNNIGDYLAEIFRLVYSQLCHPLCMK 698
             WS+ GS+ ++ TVITTIGYGH  P+T  G+IF + YA  GIPL +    +IG+        ++ +L   L MK
Sbjct:   78 QWSFAGSVYFATTVITTIGYGHTVPRTPRGKIFCMIYAAVGIPLALTMFQSIGERFNTFLACMFRRLKRKLGMK 151          

HSP 2 Score: 49.6766 bits (117), Expect = 9.007e-7
Identity = 33/86 (38.37%), Postives = 48/86 (55.81%), Query Frame = 3
Query: 1068 TEVSETVPLTLT--LCIMVVYIIMGAFLFTFWGSDNDYLKWSYFCFITLSTIGFGDIVPGISVSDLNPKEKLI-VSVLYVAIGLPV 1316
            T+VS T  L +   L  MV+ +  GAF+FT +    DY    Y+CFIT++TIGFGD V      D     K + +S+L++  GL +
Sbjct:  153 TDVSSTTNLVVVCGLLAMVITVSSGAFIFTHY-EKWDYFHSLYYCFITVTTIGFGDYVALQDSKDERYSNKYVGISLLFIFFGLTI 237          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Medaka
Match: kcnk18 (potassium two pore domain channel subfamily K member 18 [Source:NCBI gene;Acc:101159039])

HSP 1 Score: 125.176 bits (313), Expect = 2.817e-31
Identity = 99/397 (24.94%), Postives = 178/397 (44.84%), Query Frame = 3
Query:  183 LFSHIGLSGLVVAYTILGGFLFYNIEISGEINVKNQMKIVRNETENKLEQILSSEMKADFNSSEILTNIRAILNEHERIFKENIFENGWNGRYEITENNWSYEGSILYSVTVITTIGYGHVTPKTKLGRIFTIFYAIFGIPLTILYLNNIGDYLAEIFRLVYSQLCHPLCMKLFTKKKRLTNQLVGHHIRVSDESSIQIKSDFNENLLDTNTDFESISSRKMSHSFTEPLQSIENAKIHCWGDLENLQTKLEKSTETEIQIPENLENEIEAVQS----NIDKLPVELIHFDNQNTSYFYTEVSE-TVPLTLTLCIMVVYIIMGAFLFTFWGSDNDYLKWSYFCFITLSTIGFGDIVPGISVSDLNPKEKLIVSVLYVAIGLPVFAMCFKLMEDEIVN 1358
            +F H+ L G +VAY +LG  +F  IE        N+   ++ +    L +I+        N+S   + +   + +  + F    F+N          +NW++ GS+ +  TV TT+GYG + P T  G++  + YA+ GIPL +L + ++GD+LA +    Y Q         F K  R      G   +  D +S   +   ++     + D  ++          EPL   +  +       +++Q +  K    +I   +NL+ +   +++     +++LP     F   + +     + +  VP  L L  +  YI +G  +   W  D       YFCFITL+TIGFGDI+P       +P   +++S L++ +G+ + +M FKL +  IV 
Sbjct:   17 VFPHLALCGTLVAYAVLGALIFQRIEGG------NKPSKIQEDYREFLGEIVDIVRNHSQNTSCSQSCMVDQVEKKMKTFNSIWFQN---------PDNWTFFGSMFFCCTVFTTVGYGEIYPVTLSGKVVCVLYAMVGIPLMLLVILDVGDFLALLMTKAYVQ------AHAFFKDLRSQTWSPG---KAQDRASDSRRQGLDDGTFVFSRDVVAL----------EPLDIRQVLRSQADVRHKSIQLQNNKEIFEKILARDNLQRKGPLLRTFSCPELNQLPTPPKGFIVWDFTGLGDGMDQLDVPFVLILFAVFAYICLGGLILPLWEKDFTDFDPYYFCFITLTTIGFGDIIPK------HPNYFMLIS-LFIIVGMAIMSMAFKLSQTRIVT 372          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Medaka
Match: KCNK4 (potassium channel subfamily K member 4 [Source:NCBI gene;Acc:101166075])

HSP 1 Score: 76.2554 bits (186), Expect = 1.415e-14
Identity = 42/155 (27.10%), Postives = 77/155 (49.68%), Query Frame = 3
Query:  213 VVAYTILGGFLFYNIEISGEINVKNQMKIVRNETENKLEQILSSEMKADFNSSEILTNIRAILNEHERIFKENIFENGWNGRYEITENNWSYEGSILYSVTVITTIGYGHVTPKTKLGRIFTIFYAIFGIPLTILYLNNIGDYLAEIFRLVYSQL 677
            V+ Y +LG  +F  +EI  E       + ++ E+E +L ++              L N   +  E    F + + E   +   E +   W    +  +S T+ITTIG+G+++P+T  G++F IFYA+ GIP+  + L  +GD+L  + R   +++
Sbjct:   13 VLLYLVLGAVVFRTLEIPNE-------RKIQEESEKQLSRV----------REHFLGNFSCVEPESLLDFLQEVIEGLGSSSNETSFTKWDLASAFFFSGTIITTIGFGNISPQTDGGKLFCIFYALVGIPMFGILLAGVGDHLGTVLRKAIAKI 150          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Medaka
Match: KCNK4 (potassium channel subfamily K member 4 [Source:NCBI gene;Acc:101166075])

HSP 1 Score: 74.3294 bits (181), Expect = 8.136e-14
Identity = 46/169 (27.22%), Postives = 88/169 (52.07%), Query Frame = 3
Query:  174 CSCLFS-HIGLSGLVVAYTILGGFLFYNIEISGEINVKNQMKIVRNETENKLEQILSSEMKADFNSSEILTNIRAILNEHERIFKENIFENGWNGRYEITENNWSYEGSILYSVTVITTIGYGHVTPKTKLGRIFTIFYAIFGIPLTILYLNNIGDYLAEIFRLVYSQL 677
            CS L +  +G    V+ Y +LG  +F  +EI  E       + ++ E+E +L     S ++  F  +       ++L+  +++  E + E   +   E +   W    +  +S T+ITTIG+G+++P+T  G++F IFYA+ GIP+  + L  +GD+L  + R   +++
Sbjct:    3 CSTLLAIFVG----VLLYLVLGAVVFRTLEIPNE-------RKIQEESEKQL-----SRVREHFLGNFSCVEPESLLDFLQKV--EEVIEGLGSSSNETSFTKWDLASAFFFSGTIITTIGFGNISPQTDGGKLFCIFYALVGIPMFGILLAGVGDHLGTVLRKAIAKI 153          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Medaka
Match: kcnk5a (potassium two pore domain channel subfamily K member 5 [Source:NCBI gene;Acc:101161107])

HSP 1 Score: 73.9442 bits (180), Expect = 1.063e-13
Identity = 27/60 (45.00%), Postives = 45/60 (75.00%), Query Frame = 3
Query:  468 TENNWSYEGSILYSVTVITTIGYGHVTPKTKLGRIFTIFYAIFGIPLTILYLNNIGDYLA 647
            T NNW++  +++++ TVITTIGYG++ PKT  GR+F IFY +FG+PL + +++ +G +  
Sbjct:   79 TFNNWNWPNAVIFAATVITTIGYGNIAPKTSSGRVFCIFYGLFGVPLCLTWISELGKFFG 138          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Medaka
Match: kcnk15 (potassium channel subfamily K member 15 [Source:NCBI gene;Acc:101160319])

HSP 1 Score: 73.559 bits (179), Expect = 1.141e-13
Identity = 42/116 (36.21%), Postives = 65/116 (56.03%), Query Frame = 3
Query:  306 NETENKLEQIL---SSEMKADFNSSEILTNIRAILNEHERIFKENIFENGWNGRYEITENNWSYEGSILYSVTVITTIGYGHVTPKTKLGRIFTIFYAIFGIPLTILYLNNIGDYL 644
            +ETE+   +IL    +EM+  +  SE   + R I    ER+  +   E    GR       W + GS  +++TVITTIGYGH  P T  G++F +FYA+ GIPLT++   ++G+ +
Sbjct:   36 SETESARRRILEQKRNEMRKKYRFSE--DDYREI----ERVVLQA--EPHRAGR------QWKFAGSFYFAITVITTIGYGHAAPGTDAGKVFCMFYAVLGIPLTLVMFQSLGERM 137          
BLAST of Potassium channel subfamily K member 18 vs. Planmine SMEST
Match: SMESG000019203.1 (SMESG000019203.1)

HSP 1 Score: 862.833 bits (2228), Expect = 0.000e+0
Identity = 421/421 (100.00%), Postives = 421/421 (100.00%), Query Frame = 3
Query:  114 MQEEDSRCDREKCVNYSKNFCSCLFSHIGLSGLVVAYTILGGFLFYNIEISGEINVKNQMKIVRNETENKLEQILSSEMKADFNSSEILTNIRAILNEHERIFKENIFENGWNGRYEITENNWSYEGSILYSVTVITTIGYGHVTPKTKLGRIFTIFYAIFGIPLTILYLNNIGDYLAEIFRLVYSQLCHPLCMKLFTKKKRLTNQLVGHHIRVSDESSIQIKSDFNENLLDTNTDFESISSRKMSHSFTEPLQSIENAKIHCWGDLENLQTKLEKSTETEIQIPENLENEIEAVQSNIDKLPVELIHFDNQNTSYFYTEVSETVPLTLTLCIMVVYIIMGAFLFTFWGSDNDYLKWSYFCFITLSTIGFGDIVPGISVSDLNPKEKLIVSVLYVAIGLPVFAMCFKLMEDEIVNKVKSLA 1376
            MQEEDSRCDREKCVNYSKNFCSCLFSHIGLSGLVVAYTILGGFLFYNIEISGEINVKNQMKIVRNETENKLEQILSSEMKADFNSSEILTNIRAILNEHERIFKENIFENGWNGRYEITENNWSYEGSILYSVTVITTIGYGHVTPKTKLGRIFTIFYAIFGIPLTILYLNNIGDYLAEIFRLVYSQLCHPLCMKLFTKKKRLTNQLVGHHIRVSDESSIQIKSDFNENLLDTNTDFESISSRKMSHSFTEPLQSIENAKIHCWGDLENLQTKLEKSTETEIQIPENLENEIEAVQSNIDKLPVELIHFDNQNTSYFYTEVSETVPLTLTLCIMVVYIIMGAFLFTFWGSDNDYLKWSYFCFITLSTIGFGDIVPGISVSDLNPKEKLIVSVLYVAIGLPVFAMCFKLMEDEIVNKVKSLA
Sbjct:    1 MQEEDSRCDREKCVNYSKNFCSCLFSHIGLSGLVVAYTILGGFLFYNIEISGEINVKNQMKIVRNETENKLEQILSSEMKADFNSSEILTNIRAILNEHERIFKENIFENGWNGRYEITENNWSYEGSILYSVTVITTIGYGHVTPKTKLGRIFTIFYAIFGIPLTILYLNNIGDYLAEIFRLVYSQLCHPLCMKLFTKKKRLTNQLVGHHIRVSDESSIQIKSDFNENLLDTNTDFESISSRKMSHSFTEPLQSIENAKIHCWGDLENLQTKLEKSTETEIQIPENLENEIEAVQSNIDKLPVELIHFDNQNTSYFYTEVSETVPLTLTLCIMVVYIIMGAFLFTFWGSDNDYLKWSYFCFITLSTIGFGDIVPGISVSDLNPKEKLIVSVLYVAIGLPVFAMCFKLMEDEIVNKVKSLA 421          
BLAST of Potassium channel subfamily K member 18 vs. Planmine SMEST
Match: SMESG000019992.1 (SMESG000019992.1)

HSP 1 Score: 213.001 bits (541), Expect = 3.603e-64
Identity = 152/402 (37.81%), Postives = 209/402 (51.99%), Query Frame = 3
Query:  210 LVVAYTILGGFLFYNIEISGEINVKNQMKIVRNETENKLEQILSSEMKADFNSSEILTNIRAILNEHERIFKENIFENGWNGRYEITENNWSYEGSILYSVTVITTIGYGHVTPKTKLGRIFTIFYAIFGIPLTILYLNNIGDYLAEIFRLVYSQLCHPLCMKLFTKKKRLTNQLVGHHIRVSDESSIQIKSDFNENLLDTNTDFESISSRKMSHSFTEP-LQSIENAKIHCWGDLENLQTKLEKSTETEIQIPENLENEIEAVQSNIDKLPVELIHFDNQNTSYFYTEVSETV------------PLTLTLCIMVVYIIMGAFLFTFWGSDNDYLKWSYFCFITLSTIGFGDIVPGISVSDLNPKEKLIVSVLYVAIGLPVFAMCFKLMEDEIVNKVKSLA 1376
            ++V YT++GGF+F  IE   E  +K +MK        KL   + + +K   N S   +N+   L ++     + +   GWNG +   E +W+ EGSIL+S+TVITTIGYG  TPKT+ G+  TI YAI GIP T L L+NIG + ++ F   Y          LF +K +   +   +  R+     I IK    +          S    K  H   E  L +  N       DL     + ++S+ ++  IPE  E+  E +  N   + V  + +D +       E SETV            P+ +T  IM+ YI++GA  FT W  DNDYLKW+YFCFITLSTIGFGDIVPG  +   NPKEKLI  V YV +GL VF+MCFKLME+EI  K K+  
Sbjct:    1 MIVVYTLMGGFMFKLIENQQERRIKLKMKKTSQRIVEKLSNYILNSLKE--NISLDPSNLNNFLLKYTEELSK-LKNEGWNGTFGENEYSWTLEGSILFSLTVITTIGYGVATPKTRWGKFLTIVYAIIGIPFTFLSLSNIGQHFSKAFCGFY----------LFLRKSKFLKKQKENFTRL-----IHIKRSLPKQQEKKLKKVSSKLRYKRKHPKGERNLVNWNNID----SDLFIYSIESDESSSSDDAIPEIEEDFNEWLIKN-QSVNVSYLTYDRE-----IPEQSETVEQVNLSYSQIRIPIAITFAIMICYILIGALFFTIW-EDNDYLKWAYFCFITLSTIGFGDIVPGTKIDSDNPKEKLIFVVFYVVVGLSVFSMCFKLMEEEIRYKWKTFV 373          
BLAST of Potassium channel subfamily K member 18 vs. Planmine SMEST
Match: SMESG000019992.1 (SMESG000019992.1)

HSP 1 Score: 204.142 bits (518), Expect = 5.517e-61
Identity = 149/395 (37.72%), Postives = 203/395 (51.39%), Query Frame = 3
Query:  231 LGGFLFYNIEISGEINVKNQMKIVRNETENKLEQILSSEMKADFNSSEILTNIRAILNEHERIFKENIFENGWNGRYEITENNWSYEGSILYSVTVITTIGYGHVTPKTKLGRIFTIFYAIFGIPLTILYLNNIGDYLAEIFRLVYSQLCHPLCMKLFTKKKRLTNQLVGHHIRVSDESSIQIKSDFNENLLDTNTDFESISSRKMSHSFTEP-LQSIENAKIHCWGDLENLQTKLEKSTETEIQIPENLENEIEAVQSNIDKLPVELIHFDNQNTSYFYTEVSETV------------PLTLTLCIMVVYIIMGAFLFTFWGSDNDYLKWSYFCFITLSTIGFGDIVPGISVSDLNPKEKLIVSVLYVAIGLPVFAMCFKLMEDEIVNKVKSLA 1376
            +GGF+F  IE   E  +K +MK        KL   + + +K   N S   +N+   L ++     + +   GWNG +   E +W+ EGSIL+S+TVITTIGYG  TPKT+ G+  TI YAI GIP T L L+NIG + ++ F   Y          LF +K +   +   +  R+     I IK    +          S    K  H   E  L +  N       DL     + ++S+ ++  IPE  E+  E +  N   + V  + +D +       E SETV            P+ +T  IM+ YI++GA  FT W  DNDYLKW+YFCFITLSTIGFGDIVPG  +   NPKEKLI  V YV +GL VF+MCFKLME+EI  K K+  
Sbjct:    1 MGGFMFKLIENQQERRIKLKMKKTSQRIVEKLSNYILNSLKE--NISLDPSNLNNFLLKYTEELSK-LKNEGWNGTFGENEYSWTLEGSILFSLTVITTIGYGVATPKTRWGKFLTIVYAIIGIPFTFLSLSNIGQHFSKAFCGFY----------LFLRKSKFLKKQKENFTRL-----IHIKRSLPKQQEKKLKKVSSKLRYKRKHPKGERNLVNWNNID----SDLFIYSIESDESSSSDDAIPEIEEDFNEWLIKN-QSVNVSYLTYDRE-----IPEQSETVEQVNLSYSQIRIPIAITFAIMICYILIGALFFTIW-EDNDYLKWAYFCFITLSTIGFGDIVPGTKIDSDNPKEKLIFVVFYVVVGLSVFSMCFKLMEEEIRYKWKTFV 366          
BLAST of Potassium channel subfamily K member 18 vs. Planmine SMEST
Match: SMESG000019992.1 (SMESG000019992.1)

HSP 1 Score: 197.593 bits (501), Expect = 1.275e-58
Identity = 132/324 (40.74%), Postives = 173/324 (53.40%), Query Frame = 3
Query:  444 GWNGRYEITENNWSYEGSILYSVTVITTIGYGHVTPKTKLGRIFTIFYAIFGIPLTILYLNNIGDYLAEIFRLVYSQLCHPLCMKLFTKKKRLTNQLVGHHIRVSDESSIQIKSDFNENLLDTNTDFESISSRKMSHSFTEP-LQSIENAKIHCWGDLENLQTKLEKSTETEIQIPENLENEIEAVQSNIDKLPVELIHFDNQNTSYFYTEVSETV------------PLTLTLCIMVVYIIMGAFLFTFWGSDNDYLKWSYFCFITLSTIGFGDIVPGISVSDLNPKEKLIVSVLYVAIGLPVFAMCFKLMEDEIVNKVKSLA 1376
            GWNG +   E +W+ EGSIL+S+TVITTIGYG  TPKT+ G+  TI YAI GIP T L L+NIG + ++ F   Y          LF +K +   +   +  R+     I IK    +          S    K  H   E  L +  N       DL     + ++S+ ++  IPE  E+  E +  N   + V  + +D +       E SETV            P+ +T  IM+ YI++GA  FT W  DNDYLKW+YFCFITLSTIGFGDIVPG  +   NPKEKLI  V YV +GL VF+MCFKLME+EI  K K+  
Sbjct:   49 GWNGTFGENEYSWTLEGSILFSLTVITTIGYGVATPKTRWGKFLTIVYAIIGIPFTFLSLSNIGQHFSKAFCGFY----------LFLRKSKFLKKQKENFTRL-----IHIKRSLPKQQEKKLKKVSSKLRYKRKHPKGERNLVNWNNID----SDLFIYSIESDESSSSDDAIPEIEEDFNEWLIKN-QSVNVSYLTYDRE-----IPEQSETVEQVNLSYSQIRIPIAITFAIMICYILIGALFFTIW-EDNDYLKWAYFCFITLSTIGFGDIVPGTKIDSDNPKEKLIFVVFYVVVGLSVFSMCFKLMEEEIRYKWKTFV 346          
BLAST of Potassium channel subfamily K member 18 vs. Planmine SMEST
Match: SMESG000068804.1 (SMESG000068804.1)

HSP 1 Score: 173.326 bits (438), Expect = 3.767e-47
Identity = 98/248 (39.52%), Postives = 148/248 (59.68%), Query Frame = 3
Query:  144 EKCVNYSKNFCSCLFSHIGLSGLVVAYTILGGFLFYNIEISGEINVKNQMKIVRNE-TENKLEQILSSEMKADFNSSEILTNI--------RAILNEHERI----FKENIF----ENGWNGRYEITENNWSYEGSILYSVTVITTIGYGHVTPKTKLGRIFTIFYAIFGIPLTILYLNNIGDYLAEIFRLVYSQLCHPLCMKLFTKKKRLTNQLVGHHIRVSDESSIQ---IKSDFNENLLDTNTDFE 827
            EK     K F + LFSHIGLS ++V Y I+GGF+F ++EIS EIN K ++K  RN+  +  ++ ++S  +   +N+++I+ N         + +LN +  +    +  N+     E GWNG  ++T  NWSYEG++LY +TVITTIGYGHV PKTKLG+  T+ YA+ GIPLT LYL+NIGDYLA+ FR +Y ++C   C     K ++  + L    I+ +    +    IK D  + ++  N  F+
Sbjct:   61 EKTKQCCKRFFTFLFSHIGLSAILVGYVIIGGFMFQSLEISNEINTKKRVKDHRNDFIKATIKNLIS--LNLTWNNTDIMNNSSDINKPGNQTLLNNYLTMVIINYTNNVIFFMQEEGWNGNDDVTALNWSYEGALLYVLTVITTIGYGHVAPKTKLGKFITMLYALLGIPLTFLYLSNIGDYLADWFRFIYHKVCRKYCKMCCQKSRKHHSGLRSKLIKANAFPGMSKKVIKRDRPKQMIKPNNFFD 306          

HSP 2 Score: 125.561 bits (314), Expect = 1.483e-30
Identity = 65/98 (66.33%), Postives = 79/98 (80.61%), Query Frame = 3
Query: 1083 TVPLTLTLCIMVVYIIMGAFLFTFWGSDNDYLKWSYFCFITLSTIGFGDIVPGISVSDLNPKEKLIVSVLYVAIGLPVFAMCFKLMEDEIVNKVKSLA 1376
            TVP++L+L ++ +YII+GA +FT WG D D+LKWSYFCFITLSTIGFGDIVPG  V   NPKEKLI+  +YV IGL VFAMCFKLM++E+V K K L 
Sbjct:  527 TVPISLSLTVIWIYIIIGAIIFTVWG-DLDFLKWSYFCFITLSTIGFGDIVPGTKVDSKNPKEKLIIVSIYVIIGLSVFAMCFKLMQEEVVAKFKRLG 623          
The following BLAST results are available for this feature:
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
KCNK186.825e-2625.25potassium two pore domain channel subfamily K memb... [more]
KCNK52.648e-1345.00potassium two pore domain channel subfamily K memb... [more]
KCNK36.357e-1339.19potassium two pore domain channel subfamily K memb... [more]
KCNK91.006e-1240.30potassium two pore domain channel subfamily K memb... [more]
KCNK91.006e-1240.30potassium two pore domain channel subfamily K memb... [more]
back to top
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
twk-482.933e-5128.47TWiK family of potassium channels [Source:UniProt... [more]
twk-391.664e-2333.14TWiK family of potassium channels [Source:UniProt... [more]
twk-391.672e-2333.14TWiK family of potassium channels [Source:UniProt... [more]
twk-96.589e-2226.60TWiK family of potassium channels protein 9 [Sour... [more]
twk-98.965e-2226.60TWiK family of potassium channels protein 9 [Sour... [more]
back to top
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG91941.316e-3332.28gene:FBgn0035192 transcript:FBtr0072651[more]
sand8.926e-2735.33gene:FBgn0033257 transcript:FBtr0088780[more]
CG343965.592e-2225.06gene:FBgn0085425 transcript:FBtr0112644[more]
CG108646.915e-2231.28gene:FBgn0038621 transcript:FBtr0083654[more]
CG16882.612e-1932.26gene:FBgn0027589 transcript:FBtr0088495[more]
back to top
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kcnk188.983e-2825.54potassium channel, subfamily K, member 18 [Source:... [more]
kcnk189.702e-2825.54potassium channel, subfamily K, member 18 [Source:... [more]
kcnk181.823e-2725.54potassium channel, subfamily K, member 18 [Source:... [more]
kcnk5b2.732e-1429.45potassium channel, subfamily K, member 5b [Source:... [more]
kcnk5a1.484e-1330.20potassium channel, subfamily K, member 5a [Source:... [more]
back to top
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
KCNK181.567e-2529.51potassium two pore domain channel subfamily K memb... [more]
stk265.941e-1433.10serine/threonine kinase 26 [Source:Xenbase;Acc:XB-... [more]
pold27.412e-1428.86polymerase (DNA directed), delta 2, accessory subu... [more]
stk267.886e-1433.10serine/threonine kinase 26 [Source:Xenbase;Acc:XB-... [more]
pole48.832e-1437.78polymerase (DNA-directed), epsilon 4, accessory su... [more]
back to top
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Kcnk182.776e-2824.53potassium channel, subfamily K, member 18 [Source:... [more]
Kcnk151.232e-1329.75potassium channel, subfamily K, member 15 [Source:... [more]
Kcnk151.333e-1328.48potassium channel, subfamily K, member 15 [Source:... [more]
Kcnk52.148e-1345.00potassium channel, subfamily K, member 5 [Source:M... [more]
Kcnk107.607e-1329.41potassium channel, subfamily K, member 10 [Source:... [more]
back to top
BLAST of Potassium channel subfamily K member 18 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6Q1P3|KCNKI_RAT1.470e-3125.62Potassium channel subfamily K member 18 OS=Rattus ... [more]
sp|Q6VV64|KCNKI_MOUSE1.942e-2724.53Potassium channel subfamily K member 18 OS=Mus mus... [more]
sp|Q7Z418|KCNKI_HUMAN3.278e-2525.25Potassium channel subfamily K member 18 OS=Homo sa... [more]
sp|Q23435|TWK9_CAEEL1.140e-2026.60TWiK family of potassium channels protein 9 OS=Cae... [more]
sp|P34410|TWK7_CAEEL5.400e-1629.41TWiK family of potassium channels protein 7 OS=Cae... [more]
back to top
BLAST of Potassium channel subfamily K member 18 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
R7U1G04.488e-7334.80Uncharacterized protein (Fragment) OS=Capitella te... [more]
T1EGS21.992e-6133.98Uncharacterized protein OS=Helobdella robusta OX=6... [more]
A0A4D5S2932.231e-6133.01Putative potassium channel subfamily protein k mem... [more]
A0A210QFK57.992e-6132.71Potassium channel subfamily K member 18 OS=Mizuhop... [more]
A0A0L8G4G93.744e-5934.27Uncharacterized protein OS=Octopus bimaculoides OX... [more]
back to top
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000047723.14.184e-2926.82pep primary_assembly:Astyanax_mexicanus-2.0:9:1589... [more]
ENSAMXT00000032793.12.075e-1446.88pep primary_assembly:Astyanax_mexicanus-2.0:22:285... [more]
kcnk157.845e-1434.96potassium channel subfamily K member 15-like [Sour... [more]
kcnk5a1.208e-1345.00potassium two pore domain channel subfamily K memb... [more]
KCNK46.203e-1331.01potassium channel subfamily K member 4-like [Sourc... [more]
back to top
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000003416.11.202e-1442.25pep scaffold:Pmarinus_7.0:GL476517:78247:80718:1 g... [more]
kcnk71.420e-1024.50potassium channel, subfamily K, member 7 [Source:Z... [more]
KCNK104.664e-1045.76potassium two pore domain channel subfamily K memb... [more]
KCNK169.408e-1024.66potassium two pore domain channel subfamily K memb... [more]
KCNK161.124e-923.78potassium two pore domain channel subfamily K memb... [more]
back to top
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
TOK12.236e-738.98Outward-rectifier potassium channel of the plasma ... [more]
back to top
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO359232.386e-1734.27Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO476673.814e-1633.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO476689.336e-1656.90Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO463283.482e-1444.62Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO331939.130e-1441.89Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kcnk182.817e-3124.94potassium two pore domain channel subfamily K memb... [more]
KCNK41.415e-1427.10potassium channel subfamily K member 4 [Source:NCB... [more]
KCNK48.136e-1427.22potassium channel subfamily K member 4 [Source:NCB... [more]
kcnk5a1.063e-1345.00potassium two pore domain channel subfamily K memb... [more]
kcnk151.141e-1336.21potassium channel subfamily K member 15 [Source:NC... [more]
back to top
BLAST of Potassium channel subfamily K member 18 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000019203.10.000e+0100.00SMESG000019203.1[more]
SMESG000019992.13.603e-6437.81SMESG000019992.1[more]
SMESG000019992.15.517e-6137.72SMESG000019992.1[more]
SMESG000019992.11.275e-5840.74SMESG000019992.1[more]
SMESG000068804.13.767e-4739.52SMESG000068804.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30008887 ID=SMED30008887|Name=Potassium channel subfamily K member 18|organism=Schmidtea mediterranea sexual|type=transcript|length=1446bp
GAGAGTGATGCATGCAGCACAAGCATAAATTGGTGTCGATGGAGATCCAC
TGTATTCGATGCTAATAGCGCAATATTATTTTCCCTATCAATTGATCAAT
ATCCATTCCAGAAATGCAAGAAGAAGATAGTAGATGTGACAGAGAAAAAT
GTGTGAATTATTCCAAAAACTTTTGTTCCTGTCTTTTCTCTCACATTGGC
TTATCGGGCTTAGTTGTCGCATACACGATTCTTGGAGGATTCTTATTCTA
TAACATTGAAATAAGTGGAGAAATAAATGTGAAAAACCAGATGAAAATAG
TGCGGAATGAAACGGAAAATAAATTAGAGCAAATTCTTTCTTCAGAAATG
AAAGCAGATTTTAATTCCAGTGAAATTTTGACAAATATTCGCGCAATTTT
AAATGAGCATGAACGGATTTTTAAAGAAAATATTTTTGAAAACGGATGGA
ATGGTCGGTATGAAATTACTGAAAATAATTGGTCATATGAAGGTTCAATT
TTATATTCAGTTACAGTGATTACCACTATAGGATATGGACATGTTACTCC
TAAAACCAAATTAGGGAGAATTTTTACAATATTTTACGCCATATTCGGTA
TTCCATTGACAATATTATATTTAAACAATATTGGTGATTATCTTGCTGAA
ATATTCAGATTGGTATATTCGCAATTATGTCATCCTCTCTGCATGAAACT
TTTCACAAAGAAAAAACGGCTAACAAACCAACTTGTCGGTCATCATATCC
GAGTCTCTGACGAATCTTCAATACAAATTAAATCTGATTTTAATGAAAAT
TTACTTGACACAAACACAGACTTTGAATCTATTTCGTCTCGAAAAATGAG
CCACTCTTTCACCGAGCCTTTACAATCAATCGAAAATGCTAAAATTCATT
GTTGGGGGGATCTGGAAAATTTGCAAACAAAATTAGAAAAATCTACAGAA
ACTGAAATACAAATCCCAGAAAATTTAGAGAATGAAATTGAAGCTGTACA
ATCCAACATTGATAAGCTACCCGTTGAGCTCATTCATTTCGATAATCAAA
ATACCTCCTATTTTTATACAGAGGTAAGTGAAACTGTGCCATTAACGTTA
ACACTTTGTATCATGGTCGTATATATTATCATGGGCGCCTTTCTTTTCAC
ATTTTGGGGAAGCGATAATGATTATCTCAAATGGTCGTACTTTTGTTTTA
TAACCCTATCAACAATTGGTTTTGGTGACATCGTTCCAGGTATTTCTGTA
AGTGATCTCAATCCGAAAGAAAAACTCATTGTATCCGTGCTATATGTCGC
TATCGGACTTCCGGTATTTGCTATGTGTTTCAAATTAATGGAGGATGAGA
TTGTTAACAAGGTCAAATCACTTGCCAAAAAAATAGGAATTATCAAAACG
TGAAAAAATACGGATATTTAATACGGTTTTATTTAATAAATTCTCA
back to top

protein sequence of SMED30008887-orf-1

>SMED30008887-orf-1 ID=SMED30008887-orf-1|Name=SMED30008887-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=430bp
MQEEDSRCDREKCVNYSKNFCSCLFSHIGLSGLVVAYTILGGFLFYNIEI
SGEINVKNQMKIVRNETENKLEQILSSEMKADFNSSEILTNIRAILNEHE
RIFKENIFENGWNGRYEITENNWSYEGSILYSVTVITTIGYGHVTPKTKL
GRIFTIFYAIFGIPLTILYLNNIGDYLAEIFRLVYSQLCHPLCMKLFTKK
KRLTNQLVGHHIRVSDESSIQIKSDFNENLLDTNTDFESISSRKMSHSFT
EPLQSIENAKIHCWGDLENLQTKLEKSTETEIQIPENLENEIEAVQSNID
KLPVELIHFDNQNTSYFYTEVSETVPLTLTLCIMVVYIIMGAFLFTFWGS
DNDYLKWSYFCFITLSTIGFGDIVPGISVSDLNPKEKLIVSVLYVAIGLP
VFAMCFKLMEDEIVNKVKSLAKKIGIIKT*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000101muscle cell
PLANA:0000140anterior region of the whole animal
Vocabulary: INTERPRO
TermDefinition
IPR009572DUF1187
IPR011528NERD
IPR0032802pore_dom_K_chnl
IPR013099K_chnl_dom
Vocabulary: biological process
TermDefinition
GO:0071805potassium ion transmembrane transport
GO:0006810transport
GO:0006811ion transport
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: molecular function
TermDefinition
GO:0005267potassium channel activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR003280Two pore domain potassium channelPRINTSPR013332POREKCHANELcoord: 366..375
score: 75.16
coord: 134..162
score: 56.71
IPR013099Potassium channel domainPFAMPF07885Ion_trans_2coord: 120..178
e-value: 4.3E-19
score: 68.3
coord: 333..411
e-value: 2.0E-14
score: 53.3
NoneNo IPR availablePANTHERPTHR11003POTASSIUM CHANNEL, SUBFAMILY Kcoord: 19..420
NoneNo IPR availablePANTHERPTHR11003:SF276TWIK FAMILY OF POTASSIUM CHANNELScoord: 19..420
NoneNo IPR availableSUPERFAMILYSSF81324Voltage-gated potassium channelscoord: 16..190
NoneNo IPR availableSUPERFAMILYSSF81324Voltage-gated potassium channelscoord: 322..420
NoneNo IPR availableTMHMMTMhelixcoord: 357..379
NoneNo IPR availableTMHMMTMhelixcoord: 325..347
NoneNo IPR availableTMHMMTMhelixcoord: 150..172
NoneNo IPR availableTMHMMTMhelixcoord: 388..410
NoneNo IPR availableTMHMMTMhelixcoord: 24..46
NoneNo IPR availableTMHMMTMhelixcoord: 123..145