wntP-1

Overview
NamewntP-1 (ABY85207.1)
Smed IDSMED30008884
Length (bp)1530
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of wntP-1 (SMED30008884) t-SNE clustered cells

Violin plots show distribution of expression levels for wntP-1 (SMED30008884) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30008884

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 35

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
posterior poleSMED30008884SMESG000024191.1 EU296630.1smed_ncbi_20200123PMID:23318641
Chen et al., 2013
whole organism asexual adult fluorescence in situ hybridization evidence
posterior poleSMED30008884SMESG000024191.1 EU296630.1smed_ncbi_20200123PMID:23318641
Chen et al., 2013
whole organism asexual adult colorimetric in situ hybridization evidence
dorsal midlineSMED30008884SMESG000024191.1 EU296630.1smed_ncbi_20200123PMID:20707997
Gurley et al., 2010
whole organism asexual adult colorimetric in situ hybridization evidence
posterior poleSMED30008884SMESG000024191.1 EU296630.1smed_ncbi_20200123PMID:20707997
Gurley et al., 2010
whole organism asexual adult colorimetric in situ hybridization evidence
dorsal midlineSMED30008884SMESG000024191.1 SMED30008884smed_20140614PMID:20707997
Gurley et al., 2010
whole organism asexual adult fluorescence in situ hybridization evidence
dorsal midlineSMED30008884SMESG000024191.1 SMED30008884smed_20140614PMID:20707997
Gurley et al., 2010
whole organism asexual adult colorimetric in situ hybridization evidence
posterior region of the whole animalSMED30008884SMESG000024191.1 SMED30008884smed_20140614PMID:20707997
Gurley et al., 2010
whole organism asexual adult colorimetric in situ hybridization evidence
dorsal midlineSMED30008884SMESG000024191.1 ABY85207.1smed_ncbi_20200123PMID:20707997
Gurley et al., 2010
whole organism asexual adult colorimetric in situ hybridization evidence
posterior poleSMED30008884SMESG000024191.1 ABY85207.1smed_ncbi_20200123PMID:20707997
Gurley et al., 2010
whole organism asexual adult colorimetric in situ hybridization evidence
posterior poleSMED30008884SMESG000024191.1 dd_Smed_v4_28398_0_1dd_Smed_v4PMID:27063937
Scimone et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
posterior poleSMED30008884SMESG000024191.1 EU296630.1smed_ncbi_20200123PMID:24992682
Vásquez-Doorman et al., 2014
whole organism asexual adult colorimetric in situ hybridization evidence
head regionSMED30008884SMESG000024191.1 SmedASXL_006093SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
posterior poleSMED30008884SMESG000024191.1 EU296630.1smed_ncbi_20200123PMID:25725068
Owen et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
dorsal midlineSMED30008884SMESG000024191.1 EU296630.1smed_ncbi_20200123PMID:19805089
Petersen et al., 2009
whole organism asexual adult colorimetric in situ hybridization evidence
posterior poleSMED30008884SMESG000024191.1 EU296630.1smed_ncbi_20200123PMID:19805089
Petersen et al., 2009
whole organism asexual adult colorimetric in situ hybridization evidence
dorsal midlineSMED30008884SMESG000024191.1 wntP-1smed_ncbi_20200123PMID:19805089
Petersen et al., 2009
whole organism asexual adult colorimetric in situ hybridization evidence
posterior poleSMED30008884SMESG000024191.1 wntP-1smed_ncbi_20200123PMID:19805089
Petersen et al., 2009
whole organism asexual adult colorimetric in situ hybridization evidence
dorsal midlineSMED30008884SMESG000024191.1 ABY85207.1smed_ncbi_20200123PMID:19805089
Petersen et al., 2009
whole organism asexual adult colorimetric in situ hybridization evidence
posterior poleSMED30008884SMESG000024191.1 ABY85207.1smed_ncbi_20200123PMID:19805089
Petersen et al., 2009
whole organism asexual adult colorimetric in situ hybridization evidence
posterior poleSMED30008884SMESG000024191.1 EU296630smed_ncbi_20200123PMID:18063755
Petersen et al., 2008
whole organism asexual adult colorimetric in situ hybridization evidence
posterior poleSMED30008884SMESG000024191.1 Smed-wntP-1smed_ncbi_20200123PMID:18063755
Petersen et al., 2008
whole organism asexual adult colorimetric in situ hybridization evidence
tail regionSMED30008884SMESG000024191.1 Contig40256newmark_estsPMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
tail regionSMED30008884SMESG000024191.1 Contig40256uc_Smed_v2PMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
posterior poleSMED30008884SMESG000024191.1 EU296630.1smed_ncbi_20200123PMID:18063757
Gurley et al., 2008
whole organism asexual adult colorimetric in situ hybridization evidence
posterior poleSMED30008884SMESG000024191.1 EU296630smed_ncbi_20200123PMID:18063757
Gurley et al., 2008
whole organism asexual adult colorimetric in situ hybridization evidence
posterior poleSMED30008884SMESG000024191.1 EU296630smed_ncbi_20200123PMID:30485821
Tewari et al., 2018
whole organism asexual adult fluorescence in situ hybridization evidence
posterior poleSMED30008884SMESG000024191.1 EU296630.1smed_ncbi_20200123PMID:24523458
Lin et al., 2014
whole organism asexual adult colorimetric in situ hybridization evidence
posterior poleSMED30008884SMESG000024191.1 EU296630.1smed_ncbi_20200123PMID:19211673
Adell et al., 2009
whole organism asexual adult colorimetric in situ hybridization evidence
posterior poleSMED30008884SMESG000024191.1 ABY85207.1smed_ncbi_20200123PMID:19211673
Adell et al., 2009
whole organism asexual adult colorimetric in situ hybridization evidence
posterior poleSMED30008884SMESG000024191.1 EU296630.1smed_ncbi_20200123PMID:24415944
Scimone et al., 2014
whole organism asexual adult fluorescence in situ hybridization evidence
posterior poleSMED30008884SMESG000024191.1 ABY85207.1smed_ncbi_20200123PMID:27074666
Lander et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
posterior poleSMED30008884SMESG000024191.1 EU296630.1smed_ncbi_20200123PMID:21566195
Petersen et al., 2011
whole organism asexual adult colorimetric in situ hybridization evidence
posterior poleSMED30008884SMESG000024191.1 ABY85207.1smed_ncbi_20200123PMID:21566195
Petersen et al., 2011
whole organism asexual adult colorimetric in situ hybridization evidence
tail regionSMED30008884SMESG000024191.1 EU296630.1smed_ncbi_20200123PMID:26556349
Sureda-Gómez et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
posterior poleSMED30008884SMESG000024191.1 EU296630.1smed_ncbi_20200123PMID:26556349
Sureda-Gómez et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of wntP-1 vs. Ensembl Human
Match: WNT1 (Wnt family member 1 [Source:HGNC Symbol;Acc:HGNC:12774])

HSP 1 Score: 196.052 bits (497), Expect = 3.903e-57
Identity = 104/318 (32.70%), Postives = 156/318 (49.06%), Query Frame = 1
Query:  382 NSDLIQVAIEGIRKGIYTCQKLFANHRWNCPTPNLNNPSALLFGDIMLKGFPETAFIYAMLSASVAQTVAEACS-FKLSHCPCNNKGR-ISQTNWIWQGCDDNVQFGRRFARKMFDPDIPDWNKKTLMNLHNTGTGRRVAVKSMNVKCVCQGTSGSCTTKICHRKVASIDEIGNILKEKYENAVKVVKEDSEVNLLANSQKRKTTNKNQQYRKALIIARKHIFIRTEKQYPYARDLVYLEDVPKNFYCDSKPEWHILGTTGRVCNSLSNSTDSCNNLCCNRPFLTRSKTIMENCNCKFIWCCKVECQQCQKRIFIETC 1329
            N  ++     G++  +  C+  F N RWNCPT     P   LFG I+ +G  ETAFI+A+ SA V  +VA +CS   +  C C+ + R     +W W GC DN+ FGR F R+  D      + + LMNLHN   GR      M  +C C G SGSCT + C  ++ ++  +G++L+++++ A +V+  +   N  + ++  +   ++  ++                  P   DLVY E  P   +C         GT GR CNS S + D C  LCC R   TR++ + E CNC F WCC V C+ C     +  C
Sbjct:   75 NPGILHSVSGGLQSAVRECKWQFRNRRWNCPTA----PGPHLFGKIVNRGCRETAFIFAITSAGVTHSVARSCSEGSIESCTCDYRRRGPGGPDWHWGGCSDNIDFGRLFGREFVDSGEKGRDLRFLMNLHNNEAGRTTVFSEMRQECKCHGMSGSCTVRTCWMRLPTLRAVGDVLRDRFDGASRVLYGNRGSNRASRAELLRLEPEDPAHKP-----------------PSPHDLVYFEKSPN--FCTYSGRLGTAGTAGRACNSSSPALDGCELLCCGRGHRTRTQRVTERCNCTFHWCCHVSCRNCTHTRVLHEC 369          
BLAST of wntP-1 vs. Ensembl Human
Match: WNT16 (Wnt family member 16 [Source:HGNC Symbol;Acc:HGNC:16267])

HSP 1 Score: 194.512 bits (493), Expect = 8.438e-57
Identity = 116/328 (35.37%), Postives = 164/328 (50.00%), Query Frame = 1
Query:  391 LIQVAIEGIRKGIYTCQKLFANHRWNCPTPNLNNPSAL----LFGDIMLKGFPETAFIYAMLSASVAQTVAEACSFK-LSHCPCN----NKGRISQTNWIWQGCDDNVQFGRRFARKMFDPDIPDWNKKT-----LMNLHNTGTGRRVAVKSMNVKCVCQGTSGSCTTKICHRKVASIDEIGNILKEKYENAVKVVKEDSEVNLLANSQKRKTTNKNQQYRKALIIARKHIFIRTEKQYPYARDLVYLEDVPKNFYCDSKPEWHILGTTGRVCNSLSNSTDSCNNLCCNRPFLTRSKTIMENCNCKFIWCCKVECQQCQKRIFIETCQ 1332
            L+    EG R GI  C   F + RWNC        + +    LFG  +  G  ETAFIYA+++A +  +V  +CS   ++ C C+    N G  S+  W W GC D+VQ+G  F+RK  D  I +   K       MNLHN   GR+   K M+V C C G SGSC  K C + ++S ++IG++LK+KYEN++++          ++  KRK   + +  RK  I               +  DL+Y+   P   YC    +  I GT GR CN  S   D CN LCC R + T     +E C CKFIWCC V C++C+    + TC+
Sbjct:   56 LLPSIREGARLGIQECGSQFRHERWNCMITAAATTAPMGASPLFGYELSSGTKETAFIYAVMAAGLVHSVTRSCSAGNMTECSCDTTLQNGGSASE-GWHWGGCSDDVQYGMWFSRKFLDFPIGNTTGKENKVLLAMNLHNNEAGRQAVAKLMSVDCRCHGVSGSCAVKTCWKTMSSFEKIGHLLKDKYENSIQI----------SDKTKRKMRRREKDQRKIPI---------------HKDDLLYVNKSPN--YCVEDKKLGIPGTQGRECNRTSEGADGCNLLCCGRGYNTHVVRHVERCECKFIWCCYVRCRRCESMTDVHTCK 355          
BLAST of wntP-1 vs. Ensembl Human
Match: WNT16 (Wnt family member 16 [Source:HGNC Symbol;Acc:HGNC:16267])

HSP 1 Score: 194.512 bits (493), Expect = 1.245e-56
Identity = 113/321 (35.20%), Postives = 160/321 (49.84%), Query Frame = 1
Query:  409 EGIRKGIYTCQKLFANHRWNCPTPNLNNPSAL----LFGDIMLKGFPETAFIYAMLSASVAQTVAEACSFK-LSHCPCNNK---GRISQTNWIWQGCDDNVQFGRRFARKMFDPDIPDWNKKT-----LMNLHNTGTGRRVAVKSMNVKCVCQGTSGSCTTKICHRKVASIDEIGNILKEKYENAVKVVKEDSEVNLLANSQKRKTTNKNQQYRKALIIARKHIFIRTEKQYPYARDLVYLEDVPKNFYCDSKPEWHILGTTGRVCNSLSNSTDSCNNLCCNRPFLTRSKTIMENCNCKFIWCCKVECQQCQKRIFIETCQ 1332
            EG R GI  C   F + RWNC        + +    LFG  +  G  ETAFIYA+++A +  +V  +CS   ++ C C+     G  +   W W GC D+VQ+G  F+RK  D  I +   K       MNLHN   GR+   K M+V C C G SGSC  K C + ++S ++IG++LK+KYEN++++          ++  KRK   + +  RK  I               +  DL+Y+   P   YC    +  I GT GR CN  S   D CN LCC R + T     +E C CKFIWCC V C++C+    + TC+
Sbjct:   72 EGARLGIQECGSQFRHERWNCMITAAATTAPMGASPLFGYELSSGTKETAFIYAVMAAGLVHSVTRSCSAGNMTECSCDTTLQNGGSASEGWHWGGCSDDVQYGMWFSRKFLDFPIGNTTGKENKVLLAMNLHNNEAGRQAVAKLMSVDCRCHGVSGSCAVKTCWKTMSSFEKIGHLLKDKYENSIQI----------SDKTKRKMRRREKDQRKIPI---------------HKDDLLYVNKSPN--YCVEDKKLGIPGTQGRECNRTSEGADGCNLLCCGRGYNTHVVRHVERCECKFIWCCYVRCRRCESMTDVHTCK 365          
BLAST of wntP-1 vs. Ensembl Human
Match: WNT2B (Wnt family member 2B [Source:HGNC Symbol;Acc:HGNC:12781])

HSP 1 Score: 191.43 bits (485), Expect = 2.849e-56
Identity = 111/314 (35.35%), Postives = 159/314 (50.64%), Query Frame = 1
Query:  409 EGIRKGIYTCQKLFANHRWNCPTPNLNNPSALLFGDIMLKGFPETAFIYAMLSASVAQTVAEACS-FKLSHCPCN--NKGR--ISQTNWIWQGCDDNVQFGRRFARKMFDPDIPDW-NKKTLMNLHNTGTGRRVAVKSMNVKCVCQGTSGSCTTKICHRKVASIDEIGNILKEKYENAVKVVKEDSEVNLLANSQKRKTTNKNQQYRKALIIARKHIFIRTEKQYPYARDLVYLEDVPKNFYCDSKPEWHILGTTGRVCNSLSNSTDSCNNLCCNRPFLTRSKTIMENCNCKFIWCCKVECQQCQKRIFIETCQ 1332
            EG R+ I  CQ  F +HRWNC T + ++    +FG +ML+   E AF+YA+ SA V   +  ACS  +LS C C+   +GR    + ++ W GC DN+ +G RFA+   D       + + LMNLHN   GR    + + ++C C G SGSCT + C R ++     G+ L+ +Y+ AV+V+      N  A           Q YR+A          RT        DLVY ++ P   YC        LGT GRVC+  S  TD C  +CC R + T   T +  C CKF WCC V C++C+  + + TC+
Sbjct:    6 EGAREWIRECQHQFRHHRWNCTTLDRDHT---VFGRVMLRSSREAAFVYAISSAGVVHAITRACSQGELSVCSCDPYTRGRHHDQRGDFDWGGCSDNIHYGVRFAKAFVDAKEKRLKDARALMNLHNNRCGRTAVRRFLKLECKCHGVSGSCTLRTCWRALSDFRRTGDYLRRRYDGAVQVMATQDGANFTA---------ARQGYRRA---------TRT--------DLVYFDNSPD--YCVLDKAAGSLGTAGRVCSKTSKGTDGCEIMCCGRGYDTTRVTRVTQCECKFHWCCAVRCKECRNTVDVHTCK 288          
BLAST of wntP-1 vs. Ensembl Human
Match: WNT2B (Wnt family member 2B [Source:HGNC Symbol;Acc:HGNC:12781])

HSP 1 Score: 194.126 bits (492), Expect = 3.350e-56
Identity = 112/321 (34.89%), Postives = 163/321 (50.78%), Query Frame = 1
Query:  388 DLIQVAIEGIRKGIYTCQKLFANHRWNCPTPNLNNPSALLFGDIMLKGFPETAFIYAMLSASVAQTVAEACS-FKLSHCPCN--NKGR--ISQTNWIWQGCDDNVQFGRRFARKMFDPDIPDW-NKKTLMNLHNTGTGRRVAVKSMNVKCVCQGTSGSCTTKICHRKVASIDEIGNILKEKYENAVKVVKEDSEVNLLANSQKRKTTNKNQQYRKALIIARKHIFIRTEKQYPYARDLVYLEDVPKNFYCDSKPEWHILGTTGRVCNSLSNSTDSCNNLCCNRPFLTRSKTIMENCNCKFIWCCKVECQQCQKRIFIETCQ 1332
            D+++   EG R+ I  CQ  F +HRWNC T + ++    +FG +ML+   E AF+YA+ SA V   +  ACS  +LS C C+   +GR    + ++ W GC DN+ +G RFA+   D       + + LMNLHN   GR    + + ++C C G SGSCT + C R ++     G+ L+ +Y+ AV+V+      N          T   Q YR+A          RT        DLVY ++ P   YC        LGT GRVC+  S  TD C  +CC R + T   T +  C CKF WCC V C++C+  + + TC+
Sbjct:   91 DIMRSVGEGAREWIRECQHQFRHHRWNCTTLDRDHT---VFGRVMLRSSREAAFVYAISSAGVVHAITRACSQGELSVCSCDPYTRGRHHDQRGDFDWGGCSDNIHYGVRFAKAFVDAKEKRLKDARALMNLHNNRCGRTAVRRFLKLECKCHGVSGSCTLRTCWRALSDFRRTGDYLRRRYDGAVQVMATQDGANF---------TAARQGYRRA---------TRT--------DLVYFDNSPD--YCVLDKAAGSLGTAGRVCSKTSKGTDGCEIMCCGRGYDTTRVTRVTQCECKFHWCCAVRCKECRNTVDVHTCK 380          
BLAST of wntP-1 vs. Ensembl Celegans
Match: cwn-2 (pep chromosome:WBcel235:IV:10067824:10070251:1 gene:WBGene00000858.1 transcript:W01B6.1.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:cwn-2)

HSP 1 Score: 179.489 bits (454), Expect = 1.487e-51
Identity = 106/318 (33.33%), Postives = 157/318 (49.37%), Query Frame = 1
Query:  412 GIRKGIYTCQKLFANHRWNCPTPNLNNPSALLFGDIMLKGFPETAFIYAMLSASVAQTVAEACSFKL-SHCPCNN--KGRISQTNWIWQGCDDNVQFGRRFAR-------KMFDPDIPDWNKKTLMNLHNTGTGRRVAVKSMNVKCVCQGTSGSCTTKICHRKVASIDEIGNILKEKYENAVKV-VKEDSEVNLLANSQKRKTTNKNQQYRKALIIARKHIFIRTEKQYPYARDLVYLEDVPKNFYCDSKPEWHILGTTGRVCNSLSNSTDSCNNLCCNRPFLTRSKTIMENCNCKFIWCCKVECQQCQKRIFIETCQ 1332
            G +  I  CQ+ F  HRWNC T    + S  + G I      E AF YA+LSA V   +   C   L + C C++  K +   T+W W GC DNV++G +F+R       K  DP     N ++LMN  N   GR++  +    KC C G SG+C  K C  ++ S++++G IL+ KY+ A++V + +   + LLA+   ++                     R  +  P   DLV+++D P   YC        LGT GRVC   S   + C++LCC R + T ++ +   CNCKF WCCKV CQ C     ++ C+
Sbjct:   72 GAQNAIQECQRQFTGHRWNCST----HYSTGMLGPIHKMATREAAFTYAILSAGVTHEIGRRCKQGLLTSCGCSDETKPKNVPTDWSWGGCGDNVEYGYKFSRDFIDIREKEHDPKRNHDNGRSLMNRRNNEAGRKILKRHRKPKCKCHGVSGACNMKTCWMQLPSMEQVGKILRNKYDKAIRVQINDRGNLQLLADEATKE---------------------RKTRALPT--DLVFMDDSPD--YCRFDRHSGTLGTEGRVCKRGSGGAEGCDSLCCGRGYNTYTQEVKSKCNCKFEWCCKVVCQTCNNVTQVDICK 360          
BLAST of wntP-1 vs. Ensembl Celegans
Match: cwn-1 (pep chromosome:WBcel235:II:130983:133598:-1 gene:WBGene00000857.1 transcript:K10B4.6a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:cwn-1)

HSP 1 Score: 160.999 bits (406), Expect = 1.692e-44
Identity = 112/339 (33.04%), Postives = 163/339 (48.08%), Query Frame = 1
Query:  382 NSDLIQVAIEGIRKGIYTCQKLFANHRWNC----PTPNLNNPSALLFGDIMLKGFPETAFIYAMLSASVAQTVAEACSFKLSH-CPCN--NKGRISQTNWIWQGCDDNVQFGRRFARKMFDPD------IPDWNKKTLM-------------NLHNTGTGRRVAVKSMNVKCVCQGTSGSCTTKICHRKVASIDEIGNILKEKYENA--VKVVKEDSEVNLLANSQKRKTTNKNQQYRKALIIARKHIFIRTEKQYPYARDLVYLEDVPKNFYCDSKPEWHILGTTGRVCNSLSNSTDSCNNLCCNRPFLTRSKTIMENCNCKFIWCCKVECQQCQKRI 1314
            N DL++    G       CQ  F   RWNC    P  +   P   L+ +       E+AF++A+ SA+VA  V   C+  +S  C C+        ++ + +QGC DNV+FG   +++  D        + D N  +L+             NLHN   GR+V  KS+  +C C G SGSC  + C   + +   IG  +K+K++ A  VKVVKED         +K +   KN Q+                K++  A DLVY+   P   +C+S P   ILGT GR C    N+ D C+ LCC R +  + + + E CNCKFI+CC+V C+ CQKRI
Sbjct:   59 NIDLMESVRSGSLAAHAECQFQFHKRRWNCTLIDPVTHEVIPDVFLYENTR-----ESAFVHAISSAAVAYKVTRDCARGISERCGCDYSKNDHSGKSQFQYQGCSDNVKFGIGVSKEFVDSAQRRVLMMKDDNGTSLLGPSQLSADGMHMINLHNNQAGRQVLEKSLRRECKCHGMSGSCEMRTCWDSLPNFRHIGMAIKDKFDGAAEVKVVKED-------GIEKPRIVMKNSQF----------------KRHTNA-DLVYMTPSPD--FCESDPLRGILGTKGRQCTLAPNAIDDCSLLCCGRGYEKKVQIVEEKCNCKFIYCCEVRCEPCQKRI 366          
BLAST of wntP-1 vs. Ensembl Celegans
Match: egl-20 (Wnt homolog [Source:UniProtKB/TrEMBL;Acc:G5EG05])

HSP 1 Score: 153.68 bits (387), Expect = 1.306e-41
Identity = 102/341 (29.91%), Postives = 164/341 (48.09%), Query Frame = 1
Query:  394 IQVAIEGIRKGIYTCQKLFANHRWNCPTPN-LNNPSALLFGDIMLKGF----PETAFIYAMLSASVAQTVAEAC-SFKLSHCPCNNKG-----------RISQTNWIWQGCDDNVQFGRRFARKMFDPDIPDW---------NKKTLMNLHNTGTGRRVAVKSMNVKCVCQGTSGSCTTKICHRKVASIDEIGNILKEKYEN-AVKVVKEDSEVNLLANSQKRKTTNKNQQYRKALIIARKHIFIRTEKQYPY-ARDLVYLEDVPKNFYCDSKPEWHILGTTGRVCNSLSNSTDSCNNLCCNRPFLTRSKTIMENCNCKFIWCCKVECQQCQKRIFIETCQ 1332
            I     G+R+ I  C+  F   RWNC + + +       F DI+ K       E AF+ A+++AS+  ++ + C +  L+ C C++K             +S+  + W GC DNV  G R+A+K  D    DW         N   L+  HN   GR    +++  +C C G SGSC  K C  ++    ++ ++LK++Y++ AV+V               RK T +         + RK    RTE++ P    ++ Y+   P   YC+      ILGT+GR C   S S++SC+ LCC R + TR +     C CKF+WCC+V+C+ C + + + TC+
Sbjct:   85 IPFVARGVREAIRECENKFKFERWNCSSRDEVTETRHGKFQDILGKTLRSANKEAAFLNAIMAASIVHSITKGCNTGNLTECGCDSKPGMQRYQAESDPSMSRDQFSWGGCSDNVPHGIRYAKKFLD----DWETAQFDKTKNVAHLVRRHNNFVGREAIAQNIRRQCRCHGVSGSCEFKTCWLQMQKFSQVSDLLKKRYDHFAVQVT--------------RKATKR---------LRRKE---RTERKIPLRGNEMAYVHRSPS--YCEKNLTAGILGTSGRECIHNSYSSESCDLLCCGRGYNTRLEIRQTQCECKFVWCCEVKCKTCTEEVAVHTCK 393          
BLAST of wntP-1 vs. Ensembl Celegans
Match: mom-2 (pep chromosome:WBcel235:V:8355988:8358185:1 gene:WBGene00003395.1 transcript:F38E1.7.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:mom-2)

HSP 1 Score: 151.369 bits (381), Expect = 5.177e-41
Identity = 96/327 (29.36%), Postives = 162/327 (49.54%), Query Frame = 1
Query:  382 NSDLIQVAIEGIRKGIYTCQKLFANHRWNCPTPNLNNPSALLFGDIMLK-GFPETAFIYAMLSASVAQTVAEACSFKL-SHCPCNNKGRISQT------------NWIWQGCDDNVQFGRRFARKMFD--PDIPDWNKKTLMNLHNTGTGRRVAVKSMNVKCVCQGTSGSCTTKICHRKVASIDEIGNILKEKYENAVKVVKEDSEVNLLANSQKRKTTNKNQQYRKALIIARKHIFIRTEKQYPYARDLVYLEDVPKNFYCDSKPEWHILGTTGRVCNSLSNSTDSCNNLCCNRPFLTRSKTIMENCNCKFIWCCKVECQQCQKRI 1314
            N ++I+  I G+R  ++TC+  F    WNC    L  P     G   L+    E+A++YA+ +A V+ ++A ACS  L   C C    + S +            +++W GC DNV+FG  F RK  D          ++ MNLHN   GRR+ V +MN +C C G SGSC TK C + +   DE  + L +KY+ A  V   D ++ + + S    ++ +++++ + +  + K +            +L+YL         D+ P +  +    R C       ++C N+CC R + T  + + E C+C+F+WCC+V+C+ C+K +
Sbjct:   62 NPNIIKYLISGLRSALHTCEYTFQREAWNC---TLTLPG---VGTSPLQIASRESAYVYAISAAGVSHSLARACSKGLIDDCGCGETPQGSGSVAVSQASSRSSSDFVWAGCSDNVKFGNTFGRKFVDQYDRQHATEPRSQMNLHNNRVGRRLLVNAMNKECKCHGVSGSCVTKTCWKVMPKFDEFASRLHQKYQLAKLVTNNDQKLTVRS-SPSAGSSGRSERFARNMDASSKQM----------RNELIYL---------DASPNYCAIDVKDRECG------ENCPNICCGRGWRTTREIVDEPCHCQFVWCCEVKCKTCKKLV 356          
BLAST of wntP-1 vs. Ensembl Celegans
Match: mom-2 (pep chromosome:WBcel235:V:8355953:8358185:1 gene:WBGene00003395.1 transcript:F38E1.7.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:mom-2)

HSP 1 Score: 151.369 bits (381), Expect = 5.177e-41
Identity = 96/327 (29.36%), Postives = 162/327 (49.54%), Query Frame = 1
Query:  382 NSDLIQVAIEGIRKGIYTCQKLFANHRWNCPTPNLNNPSALLFGDIMLK-GFPETAFIYAMLSASVAQTVAEACSFKL-SHCPCNNKGRISQT------------NWIWQGCDDNVQFGRRFARKMFD--PDIPDWNKKTLMNLHNTGTGRRVAVKSMNVKCVCQGTSGSCTTKICHRKVASIDEIGNILKEKYENAVKVVKEDSEVNLLANSQKRKTTNKNQQYRKALIIARKHIFIRTEKQYPYARDLVYLEDVPKNFYCDSKPEWHILGTTGRVCNSLSNSTDSCNNLCCNRPFLTRSKTIMENCNCKFIWCCKVECQQCQKRI 1314
            N ++I+  I G+R  ++TC+  F    WNC    L  P     G   L+    E+A++YA+ +A V+ ++A ACS  L   C C    + S +            +++W GC DNV+FG  F RK  D          ++ MNLHN   GRR+ V +MN +C C G SGSC TK C + +   DE  + L +KY+ A  V   D ++ + + S    ++ +++++ + +  + K +            +L+YL         D+ P +  +    R C       ++C N+CC R + T  + + E C+C+F+WCC+V+C+ C+K +
Sbjct:   62 NPNIIKYLISGLRSALHTCEYTFQREAWNC---TLTLPG---VGTSPLQIASRESAYVYAISAAGVSHSLARACSKGLIDDCGCGETPQGSGSVAVSQASSRSSSDFVWAGCSDNVKFGNTFGRKFVDQYDRQHATEPRSQMNLHNNRVGRRLLVNAMNKECKCHGVSGSCVTKTCWKVMPKFDEFASRLHQKYQLAKLVTNNDQKLTVRS-SPSAGSSGRSERFARNMDASSKQM----------RNELIYL---------DASPNYCAIDVKDRECG------ENCPNICCGRGWRTTREIVDEPCHCQFVWCCEVKCKTCKKLV 356          
BLAST of wntP-1 vs. Ensembl Fly
Match: Wnt2 (gene:FBgn0004360 transcript:FBtr0339383)

HSP 1 Score: 145.206 bits (365), Expect = 5.827e-39
Identity = 102/325 (31.38%), Postives = 151/325 (46.46%), Query Frame = 1
Query:  388 DLIQVAIEGIRKGIYTCQKLFANHRWNCPTPNLNNPSALLFGDIMLKGFPETAFIYAMLSASVAQTVAEACS-FKLSHCPCNNKGRISQTN-------WIWQGCDDNVQFGRRFARKMFDPDIPDWNKKTLMNLHNTGTGRRVAVKSMNVKCVCQGTSGSCTTKICHRKVASIDEIGNILKEKYENA--VKVVKEDSEVNLLANSQKRKTTNKNQQYRKALIIARKHIFIRTEKQYPYARDLVYLEDVPKNFYCDSKPEWHILGTTGRVCNSLSNSTDSCNNLCCNRPFLTRSKTIMENCNCKFIWCCKVECQQCQKRIFIETCQ 1332
            D +    EG + G   CQ  F  HRWNC      N    +F  ++     E A+ YA+ SA  A  V  AC+   +S C C+ + + + T        W W GC  +V FG R+AR+  D    + + +TLMNLHN   GR +  K +   C C G SGSC  K C + +     +G+ L  KY+ A  V+ VK    + L+ + +K   T + Q   K ++             +P   +L+YLE  P   YC+   +    GT+GR C    +   SC+ LCC R   T+       C C+F WCC+V+C +C +     TC+
Sbjct:   22 DALIALGEGHQLGAQECQHQFRGHRWNCSEVWQRN----VFAHVIPTASREAAYTYAIASAGAAYAVTAACARGNISTCGCDVRHKATPTGGGTPDEPWKWGGCSADVDFGMRYARRFMDARELERDSRTLMNLHNNRAGRTLVKKMLRTDCKCHGVSGSCVMKTCWKSLPPFRLVGDRLMLKYQKAKTVQAVKGKRGLRLVLSRKKHAGTARAQ---KPVL------------DWPKRMELIYLEASPN--YCERSLQTGSQGTSGRTCQRTGHGPQSCDLLCCGRGHNTQHIRRTTQCRCQFRWCCEVKCDECDESYEEFTCK 325          
BLAST of wntP-1 vs. Ensembl Fly
Match: Wnt2 (gene:FBgn0004360 transcript:FBtr0088512)

HSP 1 Score: 145.206 bits (365), Expect = 9.794e-39
Identity = 102/325 (31.38%), Postives = 151/325 (46.46%), Query Frame = 1
Query:  388 DLIQVAIEGIRKGIYTCQKLFANHRWNCPTPNLNNPSALLFGDIMLKGFPETAFIYAMLSASVAQTVAEACS-FKLSHCPCNNKGRISQTN-------WIWQGCDDNVQFGRRFARKMFDPDIPDWNKKTLMNLHNTGTGRRVAVKSMNVKCVCQGTSGSCTTKICHRKVASIDEIGNILKEKYENA--VKVVKEDSEVNLLANSQKRKTTNKNQQYRKALIIARKHIFIRTEKQYPYARDLVYLEDVPKNFYCDSKPEWHILGTTGRVCNSLSNSTDSCNNLCCNRPFLTRSKTIMENCNCKFIWCCKVECQQCQKRIFIETCQ 1332
            D +    EG + G   CQ  F  HRWNC      N    +F  ++     E A+ YA+ SA  A  V  AC+   +S C C+ + + + T        W W GC  +V FG R+AR+  D    + + +TLMNLHN   GR +  K +   C C G SGSC  K C + +     +G+ L  KY+ A  V+ VK    + L+ + +K   T + Q   K ++             +P   +L+YLE  P   YC+   +    GT+GR C    +   SC+ LCC R   T+       C C+F WCC+V+C +C +     TC+
Sbjct:   49 DALIALGEGHQLGAQECQHQFRGHRWNCSEVWQRN----VFAHVIPTASREAAYTYAIASAGAAYAVTAACARGNISTCGCDVRHKATPTGGGTPDEPWKWGGCSADVDFGMRYARRFMDARELERDSRTLMNLHNNRAGRTLVKKMLRTDCKCHGVSGSCVMKTCWKSLPPFRLVGDRLMLKYQKAKTVQAVKGKRGLRLVLSRKKHAGTARAQ---KPVL------------DWPKRMELIYLEASPN--YCERSLQTGSQGTSGRTCQRTGHGPQSCDLLCCGRGHNTQHIRRTTQCRCQFRWCCEVKCDECDESYEEFTCK 352          
BLAST of wntP-1 vs. Ensembl Fly
Match: wg (gene:FBgn0284084 transcript:FBtr0079432)

HSP 1 Score: 127.872 bits (320), Expect = 1.260e-31
Identity = 82/243 (33.74%), Postives = 117/243 (48.15%), Query Frame = 1
Query:  382 NSDLIQVAIEGIRKGIYTCQKLFANHRWNCPTPNLNNPSALLFGDIMLKGFPETAFIYAMLSASVAQTVAEACS-FKLSHCPCN--NKGRISQTN-----------WIWQGCDDNVQFGRRFARKMFDPDIPDWNKKTLMNLHNTGTGRRVAVKSMNVKCVCQGTSGSCTTKICHRKVASIDEIGNILKEKYENAVKVVKEDS--EVNLLANSQKRKTTNKNQQYRKALIIARKHIFIRTEKQ 1062
            N  ++   ++G    I  CQ  F N RWNC T N +    L FG I+ +G  ET+FIYA+ SA+V  ++A ACS   +  C C+  ++ R  Q N           W W GC DN+ FG +F+R+  D      N +  MNLHN   GR      M  +C C G SGSCT K C  ++A+   IG+ LK +++ A +V   +S    N LA          N      LII +  +    E++
Sbjct:   75 NPGVLGALVKGANLAISECQHQFRNRRWNCSTRNFSRGKNL-FGKIVDRGCRETSFIYAITSAAVTHSIARACSEGTIESCTCDYSHQSRSPQANHQAGSVAGVRDWEWGGCSDNIGFGFKFSREFVDTGERGRNLREKMNLHNNEAGRAHVQAEMRQECKCHGMSGSCTVKTCWMRLANFRVIGDNLKARFDGATRVQVTNSLRATNALAPVSP-NAAGSNSVGSNGLIIPQSGLVYGEEEE 315          

HSP 2 Score: 80.1073 bits (196), Expect = 9.096e-16
Identity = 37/92 (40.22%), Postives = 51/92 (55.43%), Query Frame = 1
Query: 1054 EKQYPYARDLVYLEDVPKNFYCDSKPEWHILGTTGRVCNSLSNSTDSCNNLCCNRPFLTRSKTIMENCNCKFIWCCKVECQQCQKRIFIETC 1329
            E + P ++DLVYLE  P   +C+      ILGT GR CN  S   D C  +CC R +      ++E C C F WCC+V+C+ C+ +  I TC
Sbjct:  378 EHKPPGSKDLVYLEPSPS--FCEKNLRQGILGTHGRQCNETSLGVDGCGLMCCGRGYRRDEVVVVERCACTFHWCCEVKCKLCRTKKVIYTC 467          
BLAST of wntP-1 vs. Ensembl Fly
Match: Wnt5 (gene:FBgn0010194 transcript:FBtr0343046)

HSP 1 Score: 129.798 bits (325), Expect = 1.759e-31
Identity = 72/195 (36.92%), Postives = 108/195 (55.38%), Query Frame = 1
Query:  748 KTLMNLHNTGTGRRVAVKSMNVKCVCQGTSGSCTTKICHRKVASIDEIGNILKEKYENAVKVVKEDSEVNLLANSQKRKTTNKNQQYRKALIIARKHIFIRTEKQYPYARDLVYLEDVPKNFYCDSKPEWHILGTTGRVCNSLSNSTDSCNNLCCNRPFLTRSKTIMENCNCKFIWCCKVECQQCQKRIFIETCQ 1332
            ++LMNLHN   GRR  +K   + C C G SGSC+   C ++++SI EIG+ L+EKYE A KV     ++N     ++ +   K+ Q++                  P A DL+YL++ P   +C +    H  GT GRVC+  S+  +SC  LCC R + T++  + E CNCKF WCC+V+C+ C K +   TC+
Sbjct:  839 RSLMNLHNNEAGRRAVIKKARITCKCHGVSGSCSLITCWQQLSSIREIGDYLREKYEGATKV-----KIN-----KRGRLQIKDLQFK-----------------VPTAHDLIYLDESPD--WCRNSYALHWPGTHGRVCHKNSSGLESCAILCCGRGYNTKNIIVNERCNCKFHWCCQVKCEVCTKVLEEHTCK 1004          

HSP 2 Score: 78.9518 bits (193), Expect = 4.650e-15
Identity = 43/117 (36.75%), Postives = 60/117 (51.28%), Query Frame = 1
Query:  412 GIRKGIYTCQKLFANHRWNCPTPNLNNPSALLFGDIMLKGFPETAFIYAMLSASVAQTVAEAC-SFKLSHCPCNNKGRISQ--TNWIWQGCDDNVQFGRRFARKMFDPDIPDWNKKT 753
            G R  I  CQ  F N RWNC T N       +FG +     PE AFI+A+ +A+V   +A AC   +L+ C C+   R  Q   +W W GC DN++F  +FA    D    + N++T
Sbjct:  575 GARAAIQECQFQFKNRRWNCSTTN----DETVFGPMTSLAAPEMAFIHALAAATVTSFIARACRDGQLASCSCSRGSRPKQLHDDWKWGGCGDNLEFAYKFATDFIDSREKETNRET 687          
BLAST of wntP-1 vs. Ensembl Fly
Match: Wnt5 (gene:FBgn0010194 transcript:FBtr0074623)

HSP 1 Score: 129.798 bits (325), Expect = 1.759e-31
Identity = 72/195 (36.92%), Postives = 108/195 (55.38%), Query Frame = 1
Query:  748 KTLMNLHNTGTGRRVAVKSMNVKCVCQGTSGSCTTKICHRKVASIDEIGNILKEKYENAVKVVKEDSEVNLLANSQKRKTTNKNQQYRKALIIARKHIFIRTEKQYPYARDLVYLEDVPKNFYCDSKPEWHILGTTGRVCNSLSNSTDSCNNLCCNRPFLTRSKTIMENCNCKFIWCCKVECQQCQKRIFIETCQ 1332
            ++LMNLHN   GRR  +K   + C C G SGSC+   C ++++SI EIG+ L+EKYE A KV     ++N     ++ +   K+ Q++                  P A DL+YL++ P   +C +    H  GT GRVC+  S+  +SC  LCC R + T++  + E CNCKF WCC+V+C+ C K +   TC+
Sbjct:  839 RSLMNLHNNEAGRRAVIKKARITCKCHGVSGSCSLITCWQQLSSIREIGDYLREKYEGATKV-----KIN-----KRGRLQIKDLQFK-----------------VPTAHDLIYLDESPD--WCRNSYALHWPGTHGRVCHKNSSGLESCAILCCGRGYNTKNIIVNERCNCKFHWCCQVKCEVCTKVLEEHTCK 1004          

HSP 2 Score: 78.9518 bits (193), Expect = 4.650e-15
Identity = 43/117 (36.75%), Postives = 60/117 (51.28%), Query Frame = 1
Query:  412 GIRKGIYTCQKLFANHRWNCPTPNLNNPSALLFGDIMLKGFPETAFIYAMLSASVAQTVAEAC-SFKLSHCPCNNKGRISQ--TNWIWQGCDDNVQFGRRFARKMFDPDIPDWNKKT 753
            G R  I  CQ  F N RWNC T N       +FG +     PE AFI+A+ +A+V   +A AC   +L+ C C+   R  Q   +W W GC DN++F  +FA    D    + N++T
Sbjct:  575 GARAAIQECQFQFKNRRWNCSTTN----DETVFGPMTSLAAPEMAFIHALAAATVTSFIARACRDGQLASCSCSRGSRPKQLHDDWKWGGCGDNLEFAYKFATDFIDSREKETNRET 687          
BLAST of wntP-1 vs. Ensembl Zebrafish
Match: wnt7bb (wingless-type MMTV integration site family, member 7Bb [Source:ZFIN;Acc:ZDB-GENE-081006-1])

HSP 1 Score: 196.052 bits (497), Expect = 1.420e-57
Identity = 120/319 (37.62%), Postives = 161/319 (50.47%), Query Frame = 1
Query:  388 DLIQVAIEGIRKGIYTCQKLFANHRWNCPTPNLNNPSALLFGDIMLKGFPETAFIYAMLSASVAQTVAEACS-FKLSHCPCN--NKGRISQT-NWIWQGCDDNVQFGRRFARKMFDPDIPDWNKKTLMNLHNTGTGRRVAVKSMNVKCVCQGTSGSCTTKICHRKVASIDEIGNILKEKYENAVKVVKEDSEVNLLANSQKRKTTNKNQQYRKALIIARKHIFIRTEKQYPYARDLVYLEDVPKNFYCDSKPEWHILGTTGRVCNSLSNSTDSCNNLCCNRPFLTRSKTIMENCNCKFIWCCKVECQQCQKRIFIETCQ 1332
            D I V  EG + GI  CQ  F   RWNC           +FG  +  G  E AF YA+ +A VA  V  ACS   +SHC C+   +G  +Q   W W GC  ++++G  F+RK  D      N + LMNLHN   GR+V  + M ++C C G SGSCTTK C   +    EIG +LK+KY  AV       +V ++  S+ R+ T    +              RT  Q P   DLVY+E  P   YC+   +   +GT GR+CN  S  TD C+ +CC R + T   T +  CNCKF WCC V+C  C +R  + TC+
Sbjct:   61 DAIIVIGEGAQLGINECQYQFRYGRWNCSALGERT----VFGQELRVGSREAAFTYAITAAGVAHAVTAACSQGNMSHCGCDREKQGYYNQEEGWKWGGCSADIKYGIEFSRKFVDAREIKKNARRLMNLHNNEAGRKVLEERMKLECKCHGVSGSCTTKTCWTTLPKFREIGYVLKDKYNKAV-------QVEVVRASRLRQPTFLKVK--------------RTRHQKPLETDLVYIERSPN--YCEEDAKTGSVGTQGRLCNRTSPHTDGCDLMCCGRGYNTHQYTKVWQCNCKFQWCCFVKCNTCSERTEVFTCK 352          
BLAST of wntP-1 vs. Ensembl Zebrafish
Match: wnt7aa (wingless-type MMTV integration site family, member 7Aa [Source:ZFIN;Acc:ZDB-GENE-051129-1])

HSP 1 Score: 195.667 bits (496), Expect = 1.518e-57
Identity = 113/323 (34.98%), Postives = 165/323 (51.08%), Query Frame = 1
Query:  388 DLIQVAIEGIRKGIYTCQKLFANHRWNCPTPNLNNPSALLFGDIMLKGFPETAFIYAMLSASVAQTVAEACS-FKLSHCPCNNKGRI---SQTNWIWQGCDDNVQFGRRFARKMFDPDIPDWNKKTLMNLHNTGTGRRVAVKSMNVKCVCQGTSGSCTTKICHRKVASIDEIGNILKEKYENAVKVVKEDSEVNLLANSQKRKTTNKNQQYRKALIIARKHIFIRTEKQYPYAR----DLVYLEDVPKNFYCDSKPEWHILGTTGRVCNSLSNSTDSCNNLCCNRPFLTRSKTIMENCNCKFIWCCKVECQQCQKRIFIETCQ 1332
            D I V  EG + GI  CQ  F N RWNC           +FG  +  G  E AF YA+++A VA  +  AC+   LS C C+ + +     +  W W GC  ++++G  F++   D      N +TLMNLHN   GR++  K+M ++C C G SGSCTTK C   +    ++G ILKE+Y +AV V               R + NK            +  F++ +K Y Y +    DLVY+E  P   YC++ P    +GT GR+CN  +  T+ C+ +CC R + T   + +  CNCKF+WCC V+C  C +R  + TC+
Sbjct:   57 DAIIVIGEGAQMGINECQFQFKNGRWNCSALG----ERTVFGKELKVGSKEAAFTYAIIAAGVAHAITAACTQGTLSGCGCDKEKQGFYNQEEGWKWGGCSADIRYGLSFSKVFLDAREIKQNARTLMNLHNNEVGRKILEKNMRLECKCHGVSGSCTTKTCWTTLPKFRQLGYILKERYNHAVHV------------EPVRASRNK------------RPAFLKVKKPYSYRKPMDTDLVYIEKSPN--YCEADPVTGSMGTQGRICNKTAQHTNGCDLMCCGRGYNTHQYSRVWQCNCKFLWCCYVKCNTCSERTEVYTCK 349          
BLAST of wntP-1 vs. Ensembl Zebrafish
Match: wnt7bb (wingless-type MMTV integration site family, member 7Bb [Source:ZFIN;Acc:ZDB-GENE-081006-1])

HSP 1 Score: 195.282 bits (495), Expect = 2.690e-57
Identity = 120/319 (37.62%), Postives = 161/319 (50.47%), Query Frame = 1
Query:  388 DLIQVAIEGIRKGIYTCQKLFANHRWNCPTPNLNNPSALLFGDIMLKGFPETAFIYAMLSASVAQTVAEACS-FKLSHCPCN--NKGRISQT-NWIWQGCDDNVQFGRRFARKMFDPDIPDWNKKTLMNLHNTGTGRRVAVKSMNVKCVCQGTSGSCTTKICHRKVASIDEIGNILKEKYENAVKVVKEDSEVNLLANSQKRKTTNKNQQYRKALIIARKHIFIRTEKQYPYARDLVYLEDVPKNFYCDSKPEWHILGTTGRVCNSLSNSTDSCNNLCCNRPFLTRSKTIMENCNCKFIWCCKVECQQCQKRIFIETCQ 1332
            D I V  EG + GI  CQ  F   RWNC           +FG  +  G  E AF YA+ +A VA  V  ACS   +SHC C+   +G  +Q   W W GC  ++++G  F+RK  D      N + LMNLHN   GR+V  + M ++C C G SGSCTTK C   +    EIG +LK+KY  AV       +V ++  S+ R+ T    +              RT  Q P   DLVY+E  P   YC+   +   +GT GR+CN  S  TD C+ +CC R + T   T +  CNCKF WCC V+C  C +R  + TC+
Sbjct:   57 DAIIVIGEGAQLGINECQYQFRYGRWNCSALG----ERTVFGQELRVGSREAAFTYAITAAGVAHAVTAACSQGNMSHCGCDREKQGYYNQEEGWKWGGCSADIKYGIEFSRKFVDAREIKKNARRLMNLHNNEAGRKVLEERMKLECKCHGVSGSCTTKTCWTTLPKFREIGYVLKDKYNKAV-------QVEVVRASRLRQPTFLKVK--------------RTRHQKPLETDLVYIERSPN--YCEEDAKTGSVGTQGRLCNRTSPHTDGCDLMCCGRGYNTHQYTKVWQCNCKFQWCCFVKCNTCSERTEVFTCK 348          
BLAST of wntP-1 vs. Ensembl Zebrafish
Match: wnt1 (wingless-type MMTV integration site family, member 1 [Source:NCBI gene;Acc:30128])

HSP 1 Score: 191.815 bits (486), Expect = 9.429e-56
Identity = 108/319 (33.86%), Postives = 156/319 (48.90%), Query Frame = 1
Query:  382 NSDLIQVAIEGIRKGIYTCQKLFANHRWNCPTPNLNNPSALLFGDIMLKGFPETAFIYAMLSASVAQTVAEACS-FKLSHCPCNNKGRI-SQTNWIWQGCDDNVQFGRRFARKMFDPDIPDWNKKTLMNLHNTGTGRRVAVKSMNVKCVCQGTSGSCTTKICHRKVASIDEIGNILKEKYENAVKVVKEDSEVNLLAN-SQKRKTTNKNQQYRKALIIARKHIFIRTEKQYPYARDLVYLEDVPKNFYCDSKPEWHILGTTGRVCNSLSNSTDSCNNLCCNRPFLTRSKTIMENCNCKFIWCCKVECQQCQKRIFIETC 1329
            N  ++     G+   I  C+  F N RWNCPT +  N    +FG I+ +G  ETAF++A+ SA V   VA +CS   +  C C+ + R     +W W GC DNV+FGR F R+  D      + + L NLHN   GR      M  +C C G SGSCT + C  ++ S   +G+ LK++++ A +VV  +   N  ++ +  R    +N  ++                  P +RDLVY E  P   +C    +    GT+GR CNS S + D C  LCC R + TR + + E C+C F WCC V C  C     +  C
Sbjct:   74 NPGILHAIAAGLHTAIKECKWQFRNRRWNCPTTHSPN----VFGKIVNRGCRETAFVFAITSAGVTHAVARSCSEGAIESCTCDYRRRGPGGPDWHWGGCSDNVEFGRMFGREFVDSSERGRDLRYLTNLHNNEAGRMTVASEMQQECKCHGMSGSCTVRTCWMRLPSFRLVGDYLKDRFDGASRVVYANKGSNRASHRADPRHLEPENPAHK-----------------LPSSRDLVYFEKSPN--FCSYNGKTGTHGTSGRTCNSSSPALDGCELLCCGRGYKTRMEQVTERCHCTFHWCCHVSCLNCTSTQTVHQC 369          
BLAST of wntP-1 vs. Ensembl Zebrafish
Match: wnt4 (wingless-type MMTV integration site family, member 4 [Source:NCBI gene;Acc:30123])

HSP 1 Score: 189.504 bits (480), Expect = 4.750e-55
Identity = 112/326 (34.36%), Postives = 167/326 (51.23%), Query Frame = 1
Query:  382 NSDLIQVAIEGIRKGIYTCQKLFANHRWNCPTPNLNNPSALLFGDIMLKGFPETAFIYAMLSASVAQTVAEACS-FKLSHCPCN-NKGRISQTNWIWQGCDDNVQFGRRFARKMFDPDIPDWNK-----KTLMNLHNTGTGRRVAVKSMNVKCVCQGTSGSCTTKICHRKVASIDEIGNILKEKYENAVKVVKEDSEVNLLANSQKRKTTNKNQQYRKALIIARKHIFIRTEKQYPYA-RDLVYLEDVPKNFYCDSKPEW-HILGTTGRVCNSLSNSTDSCNNLCCNRPFLTRSKTIMENCNCKFIWCCKVECQQCQKRIFIETCQ 1332
            N +++     G +  I  CQ  F N RWNC T      S  +FG ++ +G  E AF+YA+ +ASVA  V  ACS  +L  C C+ N   +S   + W GC DN+ +G  F++   D  I + +K     + LMNLHN   GR+  +  M V+C C G SGSC  K C + +    ++GN++KEK++ A       +EV L      +    +N Q++                  P+   DLVYL+  P   +C+  P    I+GT GR CN  S + D C  +CC R F T    +++ C+CKF WCC V+C+QC+K + + TC+
Sbjct:   60 NVEVMDAVRRGAQLAIDECQYQFRNRRWNCSTLE----SVPVFGKVVTQGTREAAFVYAISAASVAFAVTRACSSGELDKCGCDRNVHGVSPEGFQWSGCSDNIAYGVAFSQSFVD--IRERSKGQSSNRALMNLHNNEAGRKAILNHMRVECKCHGVSGSCEVKTCWKAMPPFRKVGNVIKEKFDGA-------TEVELRKVGTTKVLVPRNSQFK------------------PHTDEDLVYLDPSPD--FCEHDPRTPGIMGTAGRFCNKTSKAIDGCELMCCGRGFHTEEVEVVDRCSCKFHWCCYVKCKQCRKMVEMHTCR 352          
BLAST of wntP-1 vs. Ensembl Xenopus
Match: pdgfc (platelet derived growth factor C [Source:Xenbase;Acc:XB-GENE-985688])

HSP 1 Score: 200.675 bits (509), Expect = 1.653e-59
Identity = 117/326 (35.89%), Postives = 162/326 (49.69%), Query Frame = 1
Query:  391 LIQVAIEGIRKGIYTCQKLFANHRWNC---PTPNLNNPSALLFGDIMLKGFPETAFIYAMLSASVAQTVAEACSFK-LSHCPCNNK---GRISQTNWIWQGCDDNVQFGRRFARKMFDPDIP-----DWNKKTLMNLHNTGTGRRVAVKSMNVKCVCQGTSGSCTTKICHRKVASIDEIGNILKEKYENAVKVVKEDSEVNLLANSQKRKTTNKNQQYRKALIIARKHIFIRTEKQYPYARDLVYLEDVPKNFYCDSKPEWHILGTTGRVCNSLSNSTDSCNNLCCNRPFLTRSKTIMENCNCKFIWCCKVECQQCQKRIFIETCQ 1332
            L+    EG R GI+ C+  F + RWNC   PT +    +  +FG  +  G  ETAFI A+ +A +  +V  ACS   ++ C C+     G  +   W W GC D++Q+G  F+RK  D         D +    M+LHN   GR+   K M V C C G SGSC  K C + ++S ++IGN LK KYEN++++          A+  KRK   + +  RK  I               Y  DLVY    P   YC   P+  I GT GR CN  S  +DSCN LCC R + T     +E C CKF+WCC V C++C+    + TC+
Sbjct:   33 LLSSIREGARLGIHECRNQFKHERWNCSVSPTISSATSAHTIFGYELSSGTKETAFISAVTAAGLVHSVTRACSAGNMTECSCDTSLQNGGSASEGWHWGGCSDDLQYGMWFSRKFLDAPYKNSSGRDSDVLNAMHLHNNEAGRQAVTKLMTVDCRCHGVSGSCAVKTCWKSMSSFEKIGNFLKNKYENSIQI----------ADRLKRKVRRREKNDRKIPI---------------YKGDLVYTNKSPN--YCVEDPKLGISGTHGRECNRTSEGSDSCNLLCCGRGYNTHVVRHVERCECKFVWCCYVRCRRCESMTDVHTCK 331          
BLAST of wntP-1 vs. Ensembl Xenopus
Match: WNT2B (Wnt family member 2B [Source:NCBI gene;Acc:100491761])

HSP 1 Score: 193.741 bits (491), Expect = 1.521e-56
Identity = 112/322 (34.78%), Postives = 162/322 (50.31%), Query Frame = 1
Query:  388 DLIQVAIEGIRKGIYTCQKLFANHRWNCPTPNLNNPSALLFGDIMLKGFPETAFIYAMLSASVAQTVAEACS-FKLSHCPCNNKGRI----SQTNWIWQGCDDNVQFGRRFARKMFDPDIPDW-NKKTLMNLHNTGTGRRVAVKSMNVKCVCQGTSGSCTTKICHRKVASIDEIGNILKEKYENAVKV-VKEDSEVNLLANSQKRKTTNKNQQYRKALIIARKHIFIRTEKQYPYARDLVYLEDVPKNFYCDSKPEWHILGTTGRVCNSLSNSTDSCNNLCCNRPFLTRSKTIMENCNCKFIWCCKVECQQCQKRIFIETCQ 1332
            D++Q   EG ++ I  CQ  F +HRWNC T + ++    +FG  ML+   ETAF+YA+  A V   +  ACS  +L  C C+ K R      +  + W GC D++ FG +FA+   D       + + LMNLHN   GR    + MN++C C G SGSCT + C R ++   + G+ L+ KY  A++V + +D     +AN   RK T K                           DLVY E+ P   YC        LGT GRVC+ +S  TD C  +CC R + T   T +  C CKF WCC V C++C++ + + TC+
Sbjct:   54 DIMQAIGEGAKEWIRECQHQFRHHRWNCSTLDRDHT---VFGRAMLRSSRETAFVYAISYAGVVYALTRACSQGELKSCSCDPKKRGRSKDERGEFDWGGCSDHIDFGIKFAKDFVDAKEKRLKDARALMNLHNNRCGRMAVKRFMNLECKCHGVSGSCTLRTCWRAMSDFRKTGDFLRRKYNGAIQVTMNQDGSGFAVANQNFRKATKK---------------------------DLVYFENSPD--YCLMDKTAGSLGTAGRVCDKVSRGTDGCEVMCCGRGYDTTRVTRITKCECKFHWCCAVRCKECEETVDVHTCK 343          
BLAST of wntP-1 vs. Ensembl Xenopus
Match: WNT2B (Wnt family member 2B [Source:NCBI gene;Acc:100491761])

HSP 1 Score: 193.741 bits (491), Expect = 4.217e-56
Identity = 112/322 (34.78%), Postives = 162/322 (50.31%), Query Frame = 1
Query:  388 DLIQVAIEGIRKGIYTCQKLFANHRWNCPTPNLNNPSALLFGDIMLKGFPETAFIYAMLSASVAQTVAEACS-FKLSHCPCNNKGRI----SQTNWIWQGCDDNVQFGRRFARKMFDPDIPDW-NKKTLMNLHNTGTGRRVAVKSMNVKCVCQGTSGSCTTKICHRKVASIDEIGNILKEKYENAVKV-VKEDSEVNLLANSQKRKTTNKNQQYRKALIIARKHIFIRTEKQYPYARDLVYLEDVPKNFYCDSKPEWHILGTTGRVCNSLSNSTDSCNNLCCNRPFLTRSKTIMENCNCKFIWCCKVECQQCQKRIFIETCQ 1332
            D++Q   EG ++ I  CQ  F +HRWNC T + ++    +FG  ML+   ETAF+YA+  A V   +  ACS  +L  C C+ K R      +  + W GC D++ FG +FA+   D       + + LMNLHN   GR    + MN++C C G SGSCT + C R ++   + G+ L+ KY  A++V + +D     +AN   RK T K                           DLVY E+ P   YC        LGT GRVC+ +S  TD C  +CC R + T   T +  C CKF WCC V C++C++ + + TC+
Sbjct:   92 DIMQAIGEGAKEWIRECQHQFRHHRWNCSTLDRDHT---VFGRAMLRSSRETAFVYAISYAGVVYALTRACSQGELKSCSCDPKKRGRSKDERGEFDWGGCSDHIDFGIKFAKDFVDAKEKRLKDARALMNLHNNRCGRMAVKRFMNLECKCHGVSGSCTLRTCWRAMSDFRKTGDFLRRKYNGAIQVTMNQDGSGFAVANQNFRKATKK---------------------------DLVYFENSPD--YCLMDKTAGSLGTAGRVCDKVSRGTDGCEVMCCGRGYDTTRVTRITKCECKFHWCCAVRCKECEETVDVHTCK 381          
BLAST of wntP-1 vs. Ensembl Xenopus
Match: wnt4 (Wnt family member 4 [Source:NCBI gene;Acc:100491282])

HSP 1 Score: 191.815 bits (486), Expect = 6.366e-56
Identity = 113/323 (34.98%), Postives = 163/323 (50.46%), Query Frame = 1
Query:  382 NSDLIQVAIEGIRKGIYTCQKLFANHRWNCPTPNLNNPSALLFGDIMLKGFPETAFIYAMLSASVAQTVAEACS-FKLSHCPCNNKGR-ISQTNWIWQGCDDNVQFGRRFARKMFDP---DIPDWNKKTLMNLHNTGTGRRVAVKSMNVKCVCQGTSGSCTTKICHRKVASIDEIGNILKEKYENAVKVVKEDSEVNLLANSQKRKTTNKNQQYRKALIIARKHIFIRTEKQYPYA-RDLVYLEDVPKNFYCDSKPEWHILGTTGRVCNSLSNSTDSCNNLCCNRPFLTRSKTIMENCNCKFIWCCKVECQQCQKRIFIETCQ 1332
            N +++     G +  I  CQ  F N RWNC T +    S  +FG ++ +G  E AF+YA+ SA VA  V  ACS   L  C C+     +S   + W GC DN+ +G  F++   D         + + LMNLHN   GR+  + +M V+C C G SGSC  K C + + +  ++GN+LKEK++ A       +EV        +    KN Q++                  P+   DLVYL+  P   +CD   +  +LGTTGR CN  S + D C  +CC R F T    I+E C+CKF WCC V+C+QC K + + TC+
Sbjct:   60 NLEVMDSVRRGAQLAIEECQYQFRNRRWNCSTLD----SLPVFGKVVTQGTREAAFVYAISSAGVAFAVTRACSSGDLEKCGCDRTVHGVSPQGFQWSGCSDNIAYGVAFSQSFVDVRERSKGGSSSRALMNLHNNDAGRKAILNNMRVECKCHGVSGSCEVKTCWKAMPTFRKVGNVLKEKFDGA-------TEVEQKKIGSTKVLVPKNSQFK------------------PHTDEDLVYLDSSPD--FCDHDLKNGVLGTTGRQCNKTSKAIDGCELMCCGRGFHTEEVEIIERCSCKFHWCCFVKCKQCHKVVEMHTCR 351          
BLAST of wntP-1 vs. Ensembl Xenopus
Match: wnt4 (Wnt family member 4 [Source:NCBI gene;Acc:100491282])

HSP 1 Score: 191.815 bits (486), Expect = 8.098e-56
Identity = 113/323 (34.98%), Postives = 163/323 (50.46%), Query Frame = 1
Query:  382 NSDLIQVAIEGIRKGIYTCQKLFANHRWNCPTPNLNNPSALLFGDIMLKGFPETAFIYAMLSASVAQTVAEACS-FKLSHCPCNNKGR-ISQTNWIWQGCDDNVQFGRRFARKMFDP---DIPDWNKKTLMNLHNTGTGRRVAVKSMNVKCVCQGTSGSCTTKICHRKVASIDEIGNILKEKYENAVKVVKEDSEVNLLANSQKRKTTNKNQQYRKALIIARKHIFIRTEKQYPYA-RDLVYLEDVPKNFYCDSKPEWHILGTTGRVCNSLSNSTDSCNNLCCNRPFLTRSKTIMENCNCKFIWCCKVECQQCQKRIFIETCQ 1332
            N +++     G +  I  CQ  F N RWNC T +    S  +FG ++ +G  E AF+YA+ SA VA  V  ACS   L  C C+     +S   + W GC DN+ +G  F++   D         + + LMNLHN   GR+  + +M V+C C G SGSC  K C + + +  ++GN+LKEK++ A       +EV        +    KN Q++                  P+   DLVYL+  P   +CD   +  +LGTTGR CN  S + D C  +CC R F T    I+E C+CKF WCC V+C+QC K + + TC+
Sbjct:   58 NLEVMDSVRRGAQLAIEECQYQFRNRRWNCSTLD----SLPVFGKVVTQGTREAAFVYAISSAGVAFAVTRACSSGDLEKCGCDRTVHGVSPQGFQWSGCSDNIAYGVAFSQSFVDVRERSKGGSSSRALMNLHNNDAGRKAILNNMRVECKCHGVSGSCEVKTCWKAMPTFRKVGNVLKEKFDGA-------TEVEQKKIGSTKVLVPKNSQFK------------------PHTDEDLVYLDSSPD--FCDHDLKNGVLGTTGRQCNKTSKAIDGCELMCCGRGFHTEEVEIIERCSCKFHWCCFVKCKQCHKVVEMHTCR 349          
BLAST of wntP-1 vs. Ensembl Mouse
Match: Wnt16 (wingless-type MMTV integration site family, member 16 [Source:MGI Symbol;Acc:MGI:2136018])

HSP 1 Score: 197.593 bits (501), Expect = 4.790e-58
Identity = 123/351 (35.04%), Postives = 172/351 (49.00%), Query Frame = 1
Query:  349 PNWKNFTDLPANSD----------LIQVAIEGIRKGIYTCQKLFANHRWNC---PTPNLNNPSALLFGDIMLKGFPETAFIYAMLSASVAQTVAEACSFK-LSHCPCN----NKGRISQTNWIWQGCDDNVQFGRRFARKMFDPDIPDWNKKT-----LMNLHNTGTGRRVAVKSMNVKCVCQGTSGSCTTKICHRKVASIDEIGNILKEKYENAVKVVKEDSEVNLLANSQKRKTTNKNQQYRKALIIARKHIFIRTEKQYPYARDLVYLEDVPKNFYCDSKPEWHILGTTGRVCNSLSNSTDSCNNLCCNRPFLTRSKTIMENCNCKFIWCCKVECQQCQKRIFIETCQ 1332
            P      DLP NS           L+    EG R GI  C+  F + RWNC    T +    +A LFG  +  G  ETAFIYA+++A +  +V  +CS   ++ C C+    N G  S+  W W GC D+VQ+G  F+RK  D  I +   K       MNLHN   GR+   K M+V C C G SGSC  K C + ++S ++IG+ LK+KYEN++++          ++  KRK   + +  R+  I+                 DL+Y+   P   YC    +  I GT GR CN  S   D CN LCC R + T     +E C CKFIWCC V C++C+    + TC+
Sbjct:   42 PEKLGCADLPLNSRQKELCKRKPYLLPSIREGARLGIQECRSQFRHERWNCMVATTTSTQLATAPLFGYELSSGTKETAFIYAIMAAGLVHSVTRSCSAGNMTECSCDTTLQNGGSPSE-GWHWGGCSDDVQYGMWFSRKFLDLPIRNTTGKESRVLLAMNLHNNEAGRQAVAKLMSVDCRCHGVSGSCAVKTCWKTMSSFEKIGHFLKDKYENSIQI----------SDKTKRKMRRREKDQRQTPILKD---------------DLLYVHKSPN--YCVENKKLGIPGTQGRECNRTSGGADGCNLLCCGRGYNTHVVRHVERCECKFIWCCYVRCRRCESMTDVHTCK 364          
BLAST of wntP-1 vs. Ensembl Mouse
Match: Wnt1 (wingless-type MMTV integration site family, member 1 [Source:MGI Symbol;Acc:MGI:98953])

HSP 1 Score: 196.052 bits (497), Expect = 2.195e-57
Identity = 104/318 (32.70%), Postives = 156/318 (49.06%), Query Frame = 1
Query:  382 NSDLIQVAIEGIRKGIYTCQKLFANHRWNCPTPNLNNPSALLFGDIMLKGFPETAFIYAMLSASVAQTVAEACS-FKLSHCPCNNKGR-ISQTNWIWQGCDDNVQFGRRFARKMFDPDIPDWNKKTLMNLHNTGTGRRVAVKSMNVKCVCQGTSGSCTTKICHRKVASIDEIGNILKEKYENAVKVVKEDSEVNLLANSQKRKTTNKNQQYRKALIIARKHIFIRTEKQYPYARDLVYLEDVPKNFYCDSKPEWHILGTTGRVCNSLSNSTDSCNNLCCNRPFLTRSKTIMENCNCKFIWCCKVECQQCQKRIFIETC 1329
            N  ++     G++  +  C+  F N RWNCPT     P   LFG I+ +G  ETAFI+A+ SA V  +VA +CS   +  C C+ + R     +W W GC DN+ FGR F R+  D      + + LMNLHN   GR      M  +C C G SGSCT + C  ++ ++  +G++L+++++ A +V+  +   N  + ++  +   ++  ++                  P   DLVY E  P   +C         GT GR CNS S + D C  LCC R   TR++ + E CNC F WCC V C+ C     +  C
Sbjct:   75 NPGILHSVSGGLQSAVRECKWQFRNRRWNCPTA----PGPHLFGKIVNRGCRETAFIFAITSAGVTHSVARSCSEGSIESCTCDYRRRGPGGPDWHWGGCSDNIDFGRLFGREFVDSGEKGRDLRFLMNLHNNEAGRTTVFSEMRQECKCHGMSGSCTVRTCWMRLPTLRAVGDVLRDRFDGASRVLYGNRGSNRASRAELLRLEPEDPAHKP-----------------PSPHDLVYFEKSPN--FCTYSGRLGTAGTAGRACNSSSPALDGCELLCCGRGHRTRTQRVTERCNCTFHWCCHVSCRNCTHTRVLHEC 369          
BLAST of wntP-1 vs. Ensembl Mouse
Match: Wnt7b (wingless-type MMTV integration site family, member 7B [Source:MGI Symbol;Acc:MGI:98962])

HSP 1 Score: 191.815 bits (486), Expect = 5.470e-56
Identity = 119/323 (36.84%), Postives = 161/323 (49.85%), Query Frame = 1
Query:  388 DLIQVAIEGIRKGIYTCQKLFANHRWNCPTPNLNNPSALLFGDIMLKGFPETAFIYAMLSASVAQTVAEACS-FKLSHCPCN--NKGRISQT-NWIWQGCDDNVQFGRRFARKMFDPDIPDWNKKTLMNLHNTGTGRRVAVKSMNVKCVCQGTSGSCTTKICHRKVASIDEIGNILKEKYENAVKVVKEDSEVNLLANSQKRKTTNKNQQYRKALIIARKHIFIRTEK----QYPYARDLVYLEDVPKNFYCDSKPEWHILGTTGRVCNSLSNSTDSCNNLCCNRPFLTRSKTIMENCNCKFIWCCKVECQQCQKRIFIETCQ 1332
            D I V  EG + GI  CQ  F   RWNC           +FG  +  G  E AF YA+ +A VA  V  ACS   LS+C C+   +G  +Q   W W GC  +V++G  F+R+  D      N + LMNLHN   GR+V    M ++C C G SGSCTTK C   +    E+G++LKEKY  AV       +V ++  S+ R+ T                 F+R ++    Q P   DLVY+E  P   YC+       +GT GR+CN  S   D C+ +CC R + T   T +  CNCKF WCC V+C  C +R  + TC+
Sbjct:   61 DAIIVIGEGAQMGIDECQHQFRFGRWNCSALG----EKTVFGQELRVGSREAAFTYAITAAGVAHAVTAACSQGNLSNCGCDREKQGYYNQAEGWKWGGCSADVRYGIDFSRRFVDAREIKKNARRLMNLHNNEAGRKVLEDRMKLECKCHGVSGSCTTKTCWTTLPKFREVGHLLKEKYNAAV-------QVEVVRASRLRQPT-----------------FLRIKQLRSYQKPMETDLVYIEKSPN--YCEEDAATGSVGTQGRLCNRTSPGADGCDTMCCGRGYNTHQYTKVWQCNCKFHWCCFVKCNTCSERTEVFTCK 353          
BLAST of wntP-1 vs. Ensembl Mouse
Match: Wnt7b (wingless-type MMTV integration site family, member 7B [Source:MGI Symbol;Acc:MGI:98962])

HSP 1 Score: 191.43 bits (485), Expect = 6.601e-56
Identity = 119/323 (36.84%), Postives = 161/323 (49.85%), Query Frame = 1
Query:  388 DLIQVAIEGIRKGIYTCQKLFANHRWNCPTPNLNNPSALLFGDIMLKGFPETAFIYAMLSASVAQTVAEACS-FKLSHCPCN--NKGRISQT-NWIWQGCDDNVQFGRRFARKMFDPDIPDWNKKTLMNLHNTGTGRRVAVKSMNVKCVCQGTSGSCTTKICHRKVASIDEIGNILKEKYENAVKVVKEDSEVNLLANSQKRKTTNKNQQYRKALIIARKHIFIRTEK----QYPYARDLVYLEDVPKNFYCDSKPEWHILGTTGRVCNSLSNSTDSCNNLCCNRPFLTRSKTIMENCNCKFIWCCKVECQQCQKRIFIETCQ 1332
            D I V  EG + GI  CQ  F   RWNC           +FG  +  G  E AF YA+ +A VA  V  ACS   LS+C C+   +G  +Q   W W GC  +V++G  F+R+  D      N + LMNLHN   GR+V    M ++C C G SGSCTTK C   +    E+G++LKEKY  AV       +V ++  S+ R+ T                 F+R ++    Q P   DLVY+E  P   YC+       +GT GR+CN  S   D C+ +CC R + T   T +  CNCKF WCC V+C  C +R  + TC+
Sbjct:   57 DAIIVIGEGAQMGIDECQHQFRFGRWNCSALG----EKTVFGQELRVGSREAAFTYAITAAGVAHAVTAACSQGNLSNCGCDREKQGYYNQAEGWKWGGCSADVRYGIDFSRRFVDAREIKKNARRLMNLHNNEAGRKVLEDRMKLECKCHGVSGSCTTKTCWTTLPKFREVGHLLKEKYNAAV-------QVEVVRASRLRQPT-----------------FLRIKQLRSYQKPMETDLVYIEKSPN--YCEEDAATGSVGTQGRLCNRTSPGADGCDTMCCGRGYNTHQYTKVWQCNCKFHWCCFVKCNTCSERTEVFTCK 349          
BLAST of wntP-1 vs. Ensembl Mouse
Match: Wnt2b (wingless-type MMTV integration site family, member 2B [Source:MGI Symbol;Acc:MGI:1261834])

HSP 1 Score: 190.66 bits (483), Expect = 3.679e-55
Identity = 112/321 (34.89%), Postives = 160/321 (49.84%), Query Frame = 1
Query:  388 DLIQVAIEGIRKGIYTCQKLFANHRWNCPTPNLNNPSALLFGDIMLKGFPETAFIYAMLSASVAQTVAEACS-FKLSHCPCN--NKGR--ISQTNWIWQGCDDNVQFGRRFARKMFDPDIPDW-NKKTLMNLHNTGTGRRVAVKSMNVKCVCQGTSGSCTTKICHRKVASIDEIGNILKEKYENAVKVVKEDSEVNLLANSQKRKTTNKNQQYRKALIIARKHIFIRTEKQYPYARDLVYLEDVPKNFYCDSKPEWHILGTTGRVCNSLSNSTDSCNNLCCNRPFLTRSKTIMENCNCKFIWCCKVECQQCQKRIFIETCQ 1332
            D+++   EG R+ I  CQ  F +HRWNC T + ++    +FG  ML+   E AF+YA+ SA V   +  ACS  +LS C C+   +GR    + ++ W GC DN+ +G RFA+   D       + + LMNLHN   GR    + + ++C C G SGSCT + C R ++     G+ L+ +Y+ AV+V       N          T   Q YR A          RT        DLVY ++ P   YC        LGT GRVC+  S  TD C  +CC R + T   T +  C CKF WCC V C++C+  + + TC+
Sbjct:   89 DIMRSVGEGAREWIRECQHQFRHHRWNCTTLDRDH---TVFGRAMLRSSREAAFVYAISSAGVVHAITRACSQGELSVCSCDPYTRGRHHDQRGDFDWGGCSDNIHYGVRFAKAFVDAKEKRLKDARALMNLHNNRCGRTAVRRFLKLECKCHGVSGSCTLRTCWRALSDFRRTGDYLRRRYDGAVQVTATQDGANF---------TAARQGYRHA---------TRT--------DLVYFDNSPD--YCVLDKAAGSLGTAGRVCSKTSKGTDGCEIMCCGRGYDTTRVTRVTQCECKFHWCCAVRCKECRNTVDVHTCK 378          
BLAST of wntP-1 vs. UniProt/SwissProt
Match: sp|Q5E9U6|WNT16_BOVIN (Protein Wnt-16 OS=Bos taurus OX=9913 GN=WNT16 PE=2 SV=1)

HSP 1 Score: 198.749 bits (504), Expect = 1.076e-57
Identity = 117/318 (36.79%), Postives = 165/318 (51.89%), Query Frame = 1
Query:  409 EGIRKGIYTCQKLFANHRWNCPTPNLNNP-SALLFGDIMLKGFPETAFIYAMLSASVAQTVAEACSFK-LSHCPCNNK---GRISQTNWIWQGCDDNVQFGRRFARKMFDPDIPDWNKKT-----LMNLHNTGTGRRVAVKSMNVKCVCQGTSGSCTTKICHRKVASIDEIGNILKEKYENAVKVVKEDSEVNLLANSQKRKTTNKNQQYRKALIIARKHIFIRTEKQYPYARDLVYLEDVPKNFYCDSKPEWHILGTTGRVCNSLSNSTDSCNNLCCNRPFLTRSKTIMENCNCKFIWCCKVECQQCQKRIFIETCQ 1332
            EG R GI  C+  F + RWNC     + P ++ LFG  +  G  ETAFIYA+++A +  +V  +CS   ++ C C+     G  S   W W GC D+VQ+G  F+RK  D  I +   K       MNLHN   GR+   K M++ C C G SGSC  K C + ++S ++IG++LK+KYEN+V++          ++  KRK   + +  RK        I IR +       DL+Y+   P   YC    +  I GT GR CN  S   D CN LCC R + T     +E C CKFIWCC V C++C+    + TC+
Sbjct:   72 EGARLGIQECRSQFRHERWNCLVAAASAPGTSPLFGYELSSGTKETAFIYAVMAAGLVHSVTRSCSAGNMTECSCDTTLQNGGSSSEGWHWGGCSDDVQYGMWFSRKFLDFPIKNTTAKESKVLLAMNLHNNEAGRQAVAKLMSLDCRCHGVSGSCAVKTCWKTMSSFEKIGHLLKDKYENSVQI----------SDKIKRKMHRREKDQRK--------IPIRKD-------DLLYVNKSPN--YCVEDKKLGIPGTQGRECNRTSEGADGCNLLCCGRGYNTHVVRHVERCECKFIWCCYVRCRRCESMTDVHTCK 362          
BLAST of wntP-1 vs. UniProt/SwissProt
Match: sp|Q9QYS1|WNT16_MOUSE (Protein Wnt-16 OS=Mus musculus OX=10090 GN=Wnt16 PE=2 SV=2)

HSP 1 Score: 197.593 bits (501), Expect = 3.351e-57
Identity = 123/351 (35.04%), Postives = 172/351 (49.00%), Query Frame = 1
Query:  349 PNWKNFTDLPANSD----------LIQVAIEGIRKGIYTCQKLFANHRWNC---PTPNLNNPSALLFGDIMLKGFPETAFIYAMLSASVAQTVAEACSFK-LSHCPCN----NKGRISQTNWIWQGCDDNVQFGRRFARKMFDPDIPDWNKKT-----LMNLHNTGTGRRVAVKSMNVKCVCQGTSGSCTTKICHRKVASIDEIGNILKEKYENAVKVVKEDSEVNLLANSQKRKTTNKNQQYRKALIIARKHIFIRTEKQYPYARDLVYLEDVPKNFYCDSKPEWHILGTTGRVCNSLSNSTDSCNNLCCNRPFLTRSKTIMENCNCKFIWCCKVECQQCQKRIFIETCQ 1332
            P      DLP NS           L+    EG R GI  C+  F + RWNC    T +    +A LFG  +  G  ETAFIYA+++A +  +V  +CS   ++ C C+    N G  S+  W W GC D+VQ+G  F+RK  D  I +   K       MNLHN   GR+   K M+V C C G SGSC  K C + ++S ++IG+ LK+KYEN++++          ++  KRK   + +  R+  I+                 DL+Y+   P   YC    +  I GT GR CN  S   D CN LCC R + T     +E C CKFIWCC V C++C+    + TC+
Sbjct:   42 PEKLGCADLPLNSRQKELCKRKPYLLPSIREGARLGIQECRSQFRHERWNCMVATTTSTQLATAPLFGYELSSGTKETAFIYAIMAAGLVHSVTRSCSAGNMTECSCDTTLQNGGSPSE-GWHWGGCSDDVQYGMWFSRKFLDLPIRNTTGKESRVLLAMNLHNNEAGRQAVAKLMSVDCRCHGVSGSCAVKTCWKTMSSFEKIGHFLKDKYENSIQI----------SDKTKRKMRRREKDQRQTPILKD---------------DLLYVHKSPN--YCVENKKLGIPGTQGRECNRTSGGADGCNLLCCGRGYNTHVVRHVERCECKFIWCCYVRCRRCESMTDVHTCK 364          
BLAST of wntP-1 vs. UniProt/SwissProt
Match: sp|Q91029|WNT1_CHICK (Protein Wnt-1 OS=Gallus gallus OX=9031 GN=WNT1 PE=1 SV=3)

HSP 1 Score: 197.593 bits (501), Expect = 4.049e-57
Identity = 107/318 (33.65%), Postives = 153/318 (48.11%), Query Frame = 1
Query:  382 NSDLIQVAIEGIRKGIYTCQKLFANHRWNCPTPNLNNPSALLFGDIMLKGFPETAFIYAMLSASVAQTVAEACS-FKLSHCPCNNKGRI-SQTNWIWQGCDDNVQFGRRFARKMFDPDIPDWNKKTLMNLHNTGTGRRVAVKSMNVKCVCQGTSGSCTTKICHRKVASIDEIGNILKEKYENAVKVVKEDSEVNLLANSQKRKTTNKNQQYRKALIIARKHIFIRTEKQYPYARDLVYLEDVPKNFYCDSKPEWHILGTTGRVCNSLSNSTDSCNNLCCNRPFLTRSKTIMENCNCKFIWCCKVECQQCQKRIFIETC 1329
            N  ++     G++  +  CQ  F N RWNCPT    N    +FG I+ +G  ETAFI+A+ SA V  +VA +CS   +  C C+ + R     +W W GC DN+ FGR F R+  D      + + LMNLHN   GR      M  +C C G SGSCT + C  ++ +   +G++LK++++ A +V+  +   N  +  +      +N  ++                  P   DLVY E  P   +C    +    GT GR CNS S   D C  LCC R F TR++ + E CNC F WCC V C  C     +  C
Sbjct:   73 NPGILHSVSAGLQSAVRECQWQFRNRRWNCPTSQGPN----IFGKIVNRGCRETAFIFAITSAGVTHSVARSCSEGSIESCTCDYRRRGPGGPDWHWGGCSDNIDFGRLFGREFVDSSEKGRDLRFLMNLHNNEAGRMTVFSEMRQECKCHGMSGSCTVRTCWMRLPTFRAVGDVLKDRFDGASRVIYGNKGSNRASRVELHHLEPENPAHKP-----------------PSPHDLVYFEKSPN--FCTYSGKMGTAGTAGRACNSSSPGLDGCELLCCGRGFRTRTQRVTERCNCTFHWCCHVSCLNCTNTQVLHEC 367          
BLAST of wntP-1 vs. UniProt/SwissProt
Match: sp|P04426|WNT1_MOUSE (Proto-oncogene Wnt-1 OS=Mus musculus OX=10090 GN=Wnt1 PE=1 SV=1)

HSP 1 Score: 196.052 bits (497), Expect = 1.536e-56
Identity = 104/318 (32.70%), Postives = 156/318 (49.06%), Query Frame = 1
Query:  382 NSDLIQVAIEGIRKGIYTCQKLFANHRWNCPTPNLNNPSALLFGDIMLKGFPETAFIYAMLSASVAQTVAEACS-FKLSHCPCNNKGR-ISQTNWIWQGCDDNVQFGRRFARKMFDPDIPDWNKKTLMNLHNTGTGRRVAVKSMNVKCVCQGTSGSCTTKICHRKVASIDEIGNILKEKYENAVKVVKEDSEVNLLANSQKRKTTNKNQQYRKALIIARKHIFIRTEKQYPYARDLVYLEDVPKNFYCDSKPEWHILGTTGRVCNSLSNSTDSCNNLCCNRPFLTRSKTIMENCNCKFIWCCKVECQQCQKRIFIETC 1329
            N  ++     G++  +  C+  F N RWNCPT     P   LFG I+ +G  ETAFI+A+ SA V  +VA +CS   +  C C+ + R     +W W GC DN+ FGR F R+  D      + + LMNLHN   GR      M  +C C G SGSCT + C  ++ ++  +G++L+++++ A +V+  +   N  + ++  +   ++  ++                  P   DLVY E  P   +C         GT GR CNS S + D C  LCC R   TR++ + E CNC F WCC V C+ C     +  C
Sbjct:   75 NPGILHSVSGGLQSAVRECKWQFRNRRWNCPTA----PGPHLFGKIVNRGCRETAFIFAITSAGVTHSVARSCSEGSIESCTCDYRRRGPGGPDWHWGGCSDNIDFGRLFGREFVDSGEKGRDLRFLMNLHNNEAGRTTVFSEMRQECKCHGMSGSCTVRTCWMRLPTLRAVGDVLRDRFDGASRVLYGNRGSNRASRAELLRLEPEDPAHKP-----------------PSPHDLVYFEKSPN--FCTYSGRLGTAGTAGRACNSSSPALDGCELLCCGRGHRTRTQRVTERCNCTFHWCCHVSCRNCTHTRVLHEC 369          
BLAST of wntP-1 vs. UniProt/SwissProt
Match: sp|P04628|WNT1_HUMAN (Proto-oncogene Wnt-1 OS=Homo sapiens OX=9606 GN=WNT1 PE=1 SV=1)

HSP 1 Score: 196.052 bits (497), Expect = 1.874e-56
Identity = 104/318 (32.70%), Postives = 156/318 (49.06%), Query Frame = 1
Query:  382 NSDLIQVAIEGIRKGIYTCQKLFANHRWNCPTPNLNNPSALLFGDIMLKGFPETAFIYAMLSASVAQTVAEACS-FKLSHCPCNNKGR-ISQTNWIWQGCDDNVQFGRRFARKMFDPDIPDWNKKTLMNLHNTGTGRRVAVKSMNVKCVCQGTSGSCTTKICHRKVASIDEIGNILKEKYENAVKVVKEDSEVNLLANSQKRKTTNKNQQYRKALIIARKHIFIRTEKQYPYARDLVYLEDVPKNFYCDSKPEWHILGTTGRVCNSLSNSTDSCNNLCCNRPFLTRSKTIMENCNCKFIWCCKVECQQCQKRIFIETC 1329
            N  ++     G++  +  C+  F N RWNCPT     P   LFG I+ +G  ETAFI+A+ SA V  +VA +CS   +  C C+ + R     +W W GC DN+ FGR F R+  D      + + LMNLHN   GR      M  +C C G SGSCT + C  ++ ++  +G++L+++++ A +V+  +   N  + ++  +   ++  ++                  P   DLVY E  P   +C         GT GR CNS S + D C  LCC R   TR++ + E CNC F WCC V C+ C     +  C
Sbjct:   75 NPGILHSVSGGLQSAVRECKWQFRNRRWNCPTA----PGPHLFGKIVNRGCRETAFIFAITSAGVTHSVARSCSEGSIESCTCDYRRRGPGGPDWHWGGCSDNIDFGRLFGREFVDSGEKGRDLRFLMNLHNNEAGRTTVFSEMRQECKCHGMSGSCTVRTCWMRLPTLRAVGDVLRDRFDGASRVLYGNRGSNRASRAELLRLEPEDPAHKP-----------------PSPHDLVYFEKSPN--FCTYSGRLGTAGTAGRACNSSSPALDGCELLCCGRGHRTRTQRVTERCNCTFHWCCHVSCRNCTHTRVLHEC 369          
BLAST of wntP-1 vs. TrEMBL
Match: B0LMF6 (Protein Wnt OS=Schmidtea mediterranea OX=79327 GN=wntP-1 PE=2 SV=1)

HSP 1 Score: 778.859 bits (2010), Expect = 0.000e+0
Identity = 372/372 (100.00%), Postives = 372/372 (100.00%), Query Frame = 1
Query:  217 HLYKMKSDPNIATNSLQYAFTRHQWNQFYSFDPIRRKLYSQEYRPNWKNFTDLPANSDLIQVAIEGIRKGIYTCQKLFANHRWNCPTPNLNNPSALLFGDIMLKGFPETAFIYAMLSASVAQTVAEACSFKLSHCPCNNKGRISQTNWIWQGCDDNVQFGRRFARKMFDPDIPDWNKKTLMNLHNTGTGRRVAVKSMNVKCVCQGTSGSCTTKICHRKVASIDEIGNILKEKYENAVKVVKEDSEVNLLANSQKRKTTNKNQQYRKALIIARKHIFIRTEKQYPYARDLVYLEDVPKNFYCDSKPEWHILGTTGRVCNSLSNSTDSCNNLCCNRPFLTRSKTIMENCNCKFIWCCKVECQQCQKRIFIETCQ 1332
            HLYKMKSDPNIATNSLQYAFTRHQWNQFYSFDPIRRKLYSQEYRPNWKNFTDLPANSDLIQVAIEGIRKGIYTCQKLFANHRWNCPTPNLNNPSALLFGDIMLKGFPETAFIYAMLSASVAQTVAEACSFKLSHCPCNNKGRISQTNWIWQGCDDNVQFGRRFARKMFDPDIPDWNKKTLMNLHNTGTGRRVAVKSMNVKCVCQGTSGSCTTKICHRKVASIDEIGNILKEKYENAVKVVKEDSEVNLLANSQKRKTTNKNQQYRKALIIARKHIFIRTEKQYPYARDLVYLEDVPKNFYCDSKPEWHILGTTGRVCNSLSNSTDSCNNLCCNRPFLTRSKTIMENCNCKFIWCCKVECQQCQKRIFIETCQ
Sbjct:   49 HLYKMKSDPNIATNSLQYAFTRHQWNQFYSFDPIRRKLYSQEYRPNWKNFTDLPANSDLIQVAIEGIRKGIYTCQKLFANHRWNCPTPNLNNPSALLFGDIMLKGFPETAFIYAMLSASVAQTVAEACSFKLSHCPCNNKGRISQTNWIWQGCDDNVQFGRRFARKMFDPDIPDWNKKTLMNLHNTGTGRRVAVKSMNVKCVCQGTSGSCTTKICHRKVASIDEIGNILKEKYENAVKVVKEDSEVNLLANSQKRKTTNKNQQYRKALIIARKHIFIRTEKQYPYARDLVYLEDVPKNFYCDSKPEWHILGTTGRVCNSLSNSTDSCNNLCCNRPFLTRSKTIMENCNCKFIWCCKVECQQCQKRIFIETCQ 420          
BLAST of wntP-1 vs. TrEMBL
Match: F5C3T8 (Protein Wnt OS=Dugesia japonica OX=6161 GN=wnt-1 PE=2 SV=1)

HSP 1 Score: 672.929 bits (1735), Expect = 0.000e+0
Identity = 316/372 (84.95%), Postives = 344/372 (92.47%), Query Frame = 1
Query:  217 HLYKMKSDPNIATNSLQYAFTRHQWNQFYSFDPIRRKLYSQEYRPNWKNFTDLPANSDLIQVAIEGIRKGIYTCQKLFANHRWNCPTPNLNNPSALLFGDIMLKGFPETAFIYAMLSASVAQTVAEACSFKLSHCPCNNKGRISQTNWIWQGCDDNVQFGRRFARKMFDPDIPDWNKKTLMNLHNTGTGRRVAVKSMNVKCVCQGTSGSCTTKICHRKVASIDEIGNILKEKYENAVKVVKEDSEVNLLANSQKRKTTNKNQQYRKALIIARKHIFIRTEKQYPYARDLVYLEDVPKNFYCDSKPEWHILGTTGRVCNSLSNSTDSCNNLCCNRPFLTRSKTIMENCNCKFIWCCKVECQQCQKRIFIETCQ 1332
            HLYKMK+DPNIATNSLQYAFT+HQW+QFYSFDPIRRKLYSQE R NW+NFTDLPANSDLIQVAIEGIRKGIYTC+KLF NHRWNCPTPN NNPSALLFGDIMLKGFPETAFIYAMLSASV QTVAEACSF+LSHCPCNNKGRISQ+NWIWQGCDDNVQFGRRFARKMFDP+  DW+KK+LMNLHNTG GRR AVKSM VKCVCQGTSGSCTTKICHRKV+SI EIGN LK KYE AVKVV+ +++++ L +SQK K +NKN +YR  L++A+KHIFI TEK+YP   D+VYLEDVPKNFYCDSKPEWHILGTTGR+CNSLSNSTDSC+NLCCNRPFLTRSKTIME C+CKFIWCC VECQQCQKRIFIETCQ
Sbjct:   50 HLYKMKNDPNIATNSLQYAFTKHQWHQFYSFDPIRRKLYSQEQRHNWRNFTDLPANSDLIQVAIEGIRKGIYTCKKLFINHRWNCPTPNYNNPSALLFGDIMLKGFPETAFIYAMLSASVVQTVAEACSFRLSHCPCNNKGRISQSNWIWQGCDDNVQFGRRFARKMFDPEHADWHKKSLMNLHNTGAGRREAVKSMKVKCVCQGTSGSCTTKICHRKVSSISEIGNSLKIKYETAVKVVR-NNDIHSLLDSQKNKASNKNLKYRTGLVVAKKHIFIPTEKKYPDTSDIVYLEDVPKNFYCDSKPEWHILGTTGRICNSLSNSTDSCDNLCCNRPFLTRSKTIMEQCHCKFIWCCVVECQQCQKRIFIETCQ 420          
BLAST of wntP-1 vs. TrEMBL
Match: G8DNQ3 (Protein Wnt (Fragment) OS=Dugesia japonica OX=6161 PE=2 SV=1)

HSP 1 Score: 648.277 bits (1671), Expect = 0.000e+0
Identity = 305/360 (84.72%), Postives = 331/360 (91.94%), Query Frame = 1
Query:  253 TNSLQYAFTRHQWNQFYSFDPIRRKLYSQEYRPNWKNFTDLPANSDLIQVAIEGIRKGIYTCQKLFANHRWNCPTPNLNNPSALLFGDIMLKGFPETAFIYAMLSASVAQTVAEACSFKLSHCPCNNKGRISQTNWIWQGCDDNVQFGRRFARKMFDPDIPDWNKKTLMNLHNTGTGRRVAVKSMNVKCVCQGTSGSCTTKICHRKVASIDEIGNILKEKYENAVKVVKEDSEVNLLANSQKRKTTNKNQQYRKALIIARKHIFIRTEKQYPYARDLVYLEDVPKNFYCDSKPEWHILGTTGRVCNSLSNSTDSCNNLCCNRPFLTRSKTIMENCNCKFIWCCKVECQQCQKRIFIETCQ 1332
            TNSLQYAFT+HQW+QFYSFDPIRRKLYSQE R NWKNFTDLPANSDLIQVAIEGIRKGIYTC+KLF NHRWNCPTPN NNPSALLFGDIMLKGFPETAFIYAMLSASV QTVAEACSF+LSHCPCNNKGRI Q+NWIWQGCDDNVQFGRRFARKMFDP+  DW+KK+LMNLHNTG GRR AVKSM VKCVCQGTSGSCTTKICHRKV+SI EIGN LK KYE AVKVV+ +++++ L +SQK K +NKN +YR  L++A+KHIFI TEK+YP   D+VYLEDVPKNFYCDSKPEWHILGTTGR+CNSLSNSTDSC+NLCCNRPFLTRSKTIME C+CKFIWCC VECQQCQKRIFIETCQ
Sbjct:    1 TNSLQYAFTKHQWHQFYSFDPIRRKLYSQEQRHNWKNFTDLPANSDLIQVAIEGIRKGIYTCKKLFINHRWNCPTPNYNNPSALLFGDIMLKGFPETAFIYAMLSASVVQTVAEACSFRLSHCPCNNKGRIFQSNWIWQGCDDNVQFGRRFARKMFDPEHADWHKKSLMNLHNTGAGRREAVKSMKVKCVCQGTSGSCTTKICHRKVSSISEIGNSLKIKYETAVKVVR-NNDIHSLLDSQKNKASNKNLKYRTGLVVAKKHIFIPTEKKYPDTSDIVYLEDVPKNFYCDSKPEWHILGTTGRICNSLSNSTDSCDNLCCNRPFLTRSKTIMEQCHCKFIWCCVVECQQCQKRIFIETCQ 359          
BLAST of wntP-1 vs. TrEMBL
Match: D3JSM8 (Protein Wnt (Fragment) OS=Schmidtea polychroa OX=50054 GN=WntP-1 PE=2 SV=1)

HSP 1 Score: 555.444 bits (1430), Expect = 0.000e+0
Identity = 263/274 (95.99%), Postives = 268/274 (97.81%), Query Frame = 1
Query:  295 QFYSFDPIRRKLYSQEYRPNWKNFTDLPANSDLIQVAIEGIRKGIYTCQKLFANHRWNCPTPNLNNPSALLFGDIMLKGFPETAFIYAMLSASVAQTVAEACSFKLSHCPCNNKGRISQTNWIWQGCDDNVQFGRRFARKMFDPDIPDWNKKTLMNLHNTGTGRRVAVKSMNVKCVCQGTSGSCTTKICHRKVASIDEIGNILKEKYENAVKVVKEDSEVNLLANSQKRKTTNKNQQYRKALIIARKHIFIRTEKQYPYARDLVYLEDVPKNFY 1116
            QFYSFDPIRRKLYSQE R NWKNFTDLPANSDLIQVAIEGIRKGIYTCQKLFANHRWNCPTPNLNNPSALLFGDIMLKGFPETAFIYAMLSASVAQTVAEACSFKLSHCPCNNKGRISQTNWIWQGCDDNVQFGRRFARKMFDPD PDWNKKTLMNLHNTG GRRVAVKSMNVKCVCQGTSGSCTTKICHRKVASIDEIG ILKEKYENAVKV KEDSEVNLLA+SQKRK+TNKNQQYRKALIIA+KHIFI+TEKQYPYA+DLVYLEDVPKNFY
Sbjct:    1 QFYSFDPIRRKLYSQEQRHNWKNFTDLPANSDLIQVAIEGIRKGIYTCQKLFANHRWNCPTPNLNNPSALLFGDIMLKGFPETAFIYAMLSASVAQTVAEACSFKLSHCPCNNKGRISQTNWIWQGCDDNVQFGRRFARKMFDPDSPDWNKKTLMNLHNTGAGRRVAVKSMNVKCVCQGTSGSCTTKICHRKVASIDEIGKILKEKYENAVKVAKEDSEVNLLADSQKRKSTNKNQQYRKALIIAKKHIFIQTEKQYPYAKDLVYLEDVPKNFY 274          
BLAST of wntP-1 vs. TrEMBL
Match: T1DF63 (Protein Wnt OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1)

HSP 1 Score: 540.806 bits (1392), Expect = 0.000e+0
Identity = 251/372 (67.47%), Postives = 299/372 (80.38%), Query Frame = 1
Query:  217 HLYKMKSDPNIATNSLQYAFTRHQWNQFYSFDPIRRKLYSQEYRPNWKNFTDLPANSDLIQVAIEGIRKGIYTCQKLFANHRWNCPTPNLNNPSALLFGDIMLKGFPETAFIYAMLSASVAQTVAEACSFKLSHCPCNNKGRISQTNWIWQGCDDNVQFGRRFARKMFDPDIPDWNKKTLMNLHNTGTGRRVAVKSMNVKCVCQGTSGSCTTKICHRKVASIDEIGNILKEKYENAVKVVKEDSEVNLLANSQKRKTTNKNQQYRKALIIARKHIFIRTEKQYPYARDLVYLEDVPKNFYCDSKPEWHILGTTGRVCNSLSNSTDSCNNLCCNRPFLTRSKTIMENCNCKFIWCCKVECQQCQKRIFIETCQ 1332
            HLYK++  PN  TN+LQYAFTRHQW+QFYSFDPIRR+LYS+E   +WKN T+LPANSDLIQ+ +EGIRKGIYTCQ+ F   RWNCPTPN NNPSALLFGDIMLKG  +TAFIYAMLSAS+ QTVAEACS +L HCPCNNKGR  Q NWIWQGCDDNV F RRFARKMFDP   DW+KK+LM+LHNTG GRR+ V+SM +KCVCQGTSGSCTTKICHRKVASI+EIG  LKEK+ENAVKV+++ S   LL  + ++   NKN +YRK LI   K    +  K YP  RDLVYLEDV  +F+C+SKPE H+ GT  R+C++ SNSTD+C+ LCC R ++++S  + E C+CKFIWCC+V+CQQC K I +ETCQ
Sbjct:   49 HLYKLRISPNFPTNNLQYAFTRHQWHQFYSFDPIRRQLYSKESNLSWKNHTNLPANSDLIQITLEGIRKGIYTCQQEFRTDRWNCPTPNYNNPSALLFGDIMLKGLRQTAFIYAMLSASLVQTVAEACSNRLPHCPCNNKGRTPQKNWIWQGCDDNVHFARRFARKMFDPSHADWHKKSLMDLHNTGVGRRLVVQSMQIKCVCQGTSGSCTTKICHRKVASIEEIGRTLKEKFENAVKVIRDKSYYQLLDVNNQKTRGNKNLKYRKGLIKFTKSTNGKFAKSYPPQRDLVYLEDVADDFFCESKPELHLKGTKNRLCSTTSNSTDNCDQLCCGRRYVSQSSNVTEKCHCKFIWCCRVKCQQCHKSITVETCQ 420          
BLAST of wntP-1 vs. Ensembl Cavefish
Match: wnt7aa (Wnt family member 7A [Source:NCBI gene;Acc:103027182])

HSP 1 Score: 193.356 bits (490), Expect = 1.114e-56
Identity = 116/323 (35.91%), Postives = 166/323 (51.39%), Query Frame = 1
Query:  388 DLIQVAIEGIRKGIYTCQKLFANHRWNCPTPNLNNPSALLFGDIMLKGFPETAFIYAMLSASVAQTVAEACS-FKLSHCPCNN--KGRISQ-TNWIWQGCDDNVQFGRRFARKMFDPDIPDWNKKTLMNLHNTGTGRRVAVKSMNVKCVCQGTSGSCTTKICHRKVASIDEIGNILKEKYENAVKVVKEDSEVNLLANSQKRKTTNKNQQYRKALIIARKHIFIRTEKQYPYAR----DLVYLEDVPKNFYCDSKPEWHILGTTGRVCNSLSNSTDSCNNLCCNRPFLTRSKTIMENCNCKFIWCCKVECQQCQKRIFIETCQ 1332
            D I V  EG + GI  CQ  F N RWNC           +FG  +  G  E AF YA++SA VA  +  AC+   LS C C+   +G  +Q   W W GC  ++++G  F++   D      N +TLMNLHN   GR++  K+M ++C C G SGSCTTK C   +    ++G ILK+KY  AV V               R + NK  +            F++ +K Y Y +    DLVY+E  P   YC++ P    +GT GR+CN  ++  +SC+ +CC R + T   + +  CNCKF+WCC V+C  C +R  + TC+
Sbjct:   58 DAIIVIGEGAQMGINECQFQFRNGRWNCSALG----ERTVFGKELKVGSKEAAFTYAIISAGVAHAITAACTRGTLSGCGCDKEKQGFYNQDEGWKWGGCSADIRYGLSFSKVFVDAREIKQNARTLMNLHNNEVGRKLLEKNMRLECKCHGVSGSCTTKTCWTTLPKFRQLGYILKDKYFQAVHV------------EPVRASRNKRPK------------FLKIKKPYSYRKPMDTDLVYIEKSPN--YCEADPITGSMGTQGRICNKTAHQANSCDLMCCGRGYNTHQYSRVWQCNCKFLWCCYVKCNTCSERTEVYTCK 350          
BLAST of wntP-1 vs. Ensembl Cavefish
Match: wnt7aa (Wnt family member 7A [Source:NCBI gene;Acc:103027182])

HSP 1 Score: 192.971 bits (489), Expect = 1.777e-56
Identity = 116/323 (35.91%), Postives = 166/323 (51.39%), Query Frame = 1
Query:  388 DLIQVAIEGIRKGIYTCQKLFANHRWNCPTPNLNNPSALLFGDIMLKGFPETAFIYAMLSASVAQTVAEACS-FKLSHCPCNN--KGRISQ-TNWIWQGCDDNVQFGRRFARKMFDPDIPDWNKKTLMNLHNTGTGRRVAVKSMNVKCVCQGTSGSCTTKICHRKVASIDEIGNILKEKYENAVKVVKEDSEVNLLANSQKRKTTNKNQQYRKALIIARKHIFIRTEKQYPYAR----DLVYLEDVPKNFYCDSKPEWHILGTTGRVCNSLSNSTDSCNNLCCNRPFLTRSKTIMENCNCKFIWCCKVECQQCQKRIFIETCQ 1332
            D I V  EG + GI  CQ  F N RWNC           +FG  +  G  E AF YA++SA VA  +  AC+   LS C C+   +G  +Q   W W GC  ++++G  F++   D      N +TLMNLHN   GR++  K+M ++C C G SGSCTTK C   +    ++G ILK+KY  AV V               R + NK  +            F++ +K Y Y +    DLVY+E  P   YC++ P    +GT GR+CN  ++  +SC+ +CC R + T   + +  CNCKF+WCC V+C  C +R  + TC+
Sbjct:   57 DAIIVIGEGAQMGINECQFQFRNGRWNCSALG----ERTVFGKELKVGSKEAAFTYAIISAGVAHAITAACTRGTLSGCGCDKEKQGFYNQDEGWKWGGCSADIRYGLSFSKVFVDAREIKQNARTLMNLHNNEVGRKLLEKNMRLECKCHGVSGSCTTKTCWTTLPKFRQLGYILKDKYFQAVHV------------EPVRASRNKRPK------------FLKIKKPYSYRKPMDTDLVYIEKSPN--YCEADPITGSMGTQGRICNKTAHQANSCDLMCCGRGYNTHQYSRVWQCNCKFLWCCYVKCNTCSERTEVYTCK 349          
BLAST of wntP-1 vs. Ensembl Cavefish
Match: wnt7bb (protein Wnt-7b [Source:NCBI gene;Acc:103026929])

HSP 1 Score: 190.66 bits (483), Expect = 1.127e-55
Identity = 117/319 (36.68%), Postives = 161/319 (50.47%), Query Frame = 1
Query:  388 DLIQVAIEGIRKGIYTCQKLFANHRWNCPTPNLNNPSALLFGDIMLKGFPETAFIYAMLSASVAQTVAEACS-FKLSHCPCN--NKGRISQT-NWIWQGCDDNVQFGRRFARKMFDPDIPDWNKKTLMNLHNTGTGRRVAVKSMNVKCVCQGTSGSCTTKICHRKVASIDEIGNILKEKYENAVKVVKEDSEVNLLANSQKRKTTNKNQQYRKALIIARKHIFIRTEKQYPYARDLVYLEDVPKNFYCDSKPEWHILGTTGRVCNSLSNSTDSCNNLCCNRPFLTRSKTIMENCNCKFIWCCKVECQQCQKRIFIETCQ 1332
            D I V  EG + GI  CQ  F   RWNC           +FG  +  G  E AF YA+ +A VA  V  ACS   +SHC C+   +G  +Q   W W GC  ++++G  F+R+  D      N + LMNLHN   GR+   + M ++C C G SGSCTTK C   +    EIG +LK+KY  AV        V ++  ++ R+ T         L + + H +     Q P   DLVY+E  P   YC+   +   +GT GR+CN  S  TD C+ +CC R + T   T +  CNCKF WCC V+C  C +R  + TC+
Sbjct:   61 DAIIVIGEGAQLGINECQYQFRYGRWNCSALG----ERTVFGQELRVGSREAAFTYAITAAGVAHAVTAACSQGNMSHCGCDREKQGYYNQEEGWKWGGCSADIKYGIEFSRRFVDAREIKKNARRLMNLHNNEAGRKALEERMKLECKCHGVSGSCTTKTCWTTLPKFREIGYMLKDKYNKAV-------HVEVVRATRLRQPT--------FLKVKKTHGY-----QKPLETDLVYIERSPN--YCEEDAKTGSVGTQGRLCNRTSPHTDGCDLMCCGRGYNTHQYTKVWQCNCKFQWCCFVKCNTCSERTEVFTCK 353          
BLAST of wntP-1 vs. Ensembl Cavefish
Match: wnt7bb (protein Wnt-7b [Source:NCBI gene;Acc:103026929])

HSP 1 Score: 189.889 bits (481), Expect = 2.593e-55
Identity = 117/319 (36.68%), Postives = 161/319 (50.47%), Query Frame = 1
Query:  388 DLIQVAIEGIRKGIYTCQKLFANHRWNCPTPNLNNPSALLFGDIMLKGFPETAFIYAMLSASVAQTVAEACS-FKLSHCPCN--NKGRISQT-NWIWQGCDDNVQFGRRFARKMFDPDIPDWNKKTLMNLHNTGTGRRVAVKSMNVKCVCQGTSGSCTTKICHRKVASIDEIGNILKEKYENAVKVVKEDSEVNLLANSQKRKTTNKNQQYRKALIIARKHIFIRTEKQYPYARDLVYLEDVPKNFYCDSKPEWHILGTTGRVCNSLSNSTDSCNNLCCNRPFLTRSKTIMENCNCKFIWCCKVECQQCQKRIFIETCQ 1332
            D I V  EG + GI  CQ  F   RWNC           +FG  +  G  E AF YA+ +A VA  V  ACS   +SHC C+   +G  +Q   W W GC  ++++G  F+R+  D      N + LMNLHN   GR+   + M ++C C G SGSCTTK C   +    EIG +LK+KY  AV        V ++  ++ R+ T         L + + H +     Q P   DLVY+E  P   YC+   +   +GT GR+CN  S  TD C+ +CC R + T   T +  CNCKF WCC V+C  C +R  + TC+
Sbjct:   64 DAIIVIGEGAQLGINECQYQFRYGRWNCSALG----ERTVFGQELRVGSREAAFTYAITAAGVAHAVTAACSQGNMSHCGCDREKQGYYNQEEGWKWGGCSADIKYGIEFSRRFVDAREIKKNARRLMNLHNNEAGRKALEERMKLECKCHGVSGSCTTKTCWTTLPKFREIGYMLKDKYNKAV-------HVEVVRATRLRQPT--------FLKVKKTHGY-----QKPLETDLVYIERSPN--YCEEDAKTGSVGTQGRLCNRTSPHTDGCDLMCCGRGYNTHQYTKVWQCNCKFQWCCFVKCNTCSERTEVFTCK 356          
BLAST of wntP-1 vs. Ensembl Cavefish
Match: wnt4 (wingless-type MMTV integration site family, member 4 [Source:NCBI gene;Acc:30123])

HSP 1 Score: 187.963 bits (476), Expect = 6.375e-55
Identity = 122/358 (34.08%), Postives = 181/358 (50.56%), Query Frame = 1
Query:  316 IRRKLYSQEYR---PNWKNFT-DLPA------NSDLIQVAIEGIRKGIYTCQKLFANHRWNCPTPNLNNPSALLFGDIMLKGFPETAFIYAMLSASVAQTVAEACS-FKLSHCPCN-NKGRISQTNWIWQGCDDNVQFGRRFARKMFDPDIPDWNK-----KTLMNLHNTGTGRRVAVKSMNVKCVCQGTSGSCTTKICHRKVASIDEIGNILKEKYENAVKVVKEDSEVNLLANSQKRKTTNKNQQYRKALIIARKHIFIRTEKQYPYA-RDLVYLEDVPKNFYCDSKPEW-HILGTTGRVCNSLSNSTDSCNNLCCNRPFLTRSKTIMENCNCKFIWCCKVECQQCQKRIFIETCQ 1332
            ++R  Y QE     P+  +FT  LP       N +++     G +  I  CQ  F N RWNC T      +  +FG ++ +G  E AF+YA+ +ASVA  V  ACS  +L  C C+ N   +S   + W GC DN+ +G  F++   D  I +  K     + LMNLHN   GR+  +  M V+C C G SGSC  K C + +    ++GN++KEK++ A +V             Q++  T K       +++ R   F       P+   DLVYL+  P   +CD  P    +LGT GR CN  S + D C  +CC R F T    +++ C+CKF WCC V+C+QC+K + + TC+
Sbjct:    2 LKRCHYEQEVSGSNPSSCSFTIKLPVCFRCKRNVEVMDAVRRGAQLAIDECQYQFRNRRWNCSTLE----TVPVFGKVVTQGTREAAFVYAISAASVAFAVTRACSSGELEKCGCDRNVHGVSPDGFQWSGCSDNIAYGVAFSQSFVD--IRERGKGQSSNRALMNLHNNEAGRKAILNHMRVECKCHGVSGSCEVKTCWKAMPPFRKVGNVIKEKFDGATEV------------EQRKIGTTK-------VLVPRNSQF------KPHTDEDLVYLDPSPD--FCDHDPRTPGMLGTVGRYCNKTSKAIDGCELMCCGRGFHTEEVEVVDRCSCKFHWCCYVKCKQCRKMVEMHTCR 326          
BLAST of wntP-1 vs. Ensembl Sea Lamprey
Match: wnt3 (wingless-type MMTV integration site family, member 3 [Source:ZFIN;Acc:ZDB-GENE-081003-1])

HSP 1 Score: 172.17 bits (435), Expect = 2.906e-49
Identity = 106/317 (33.44%), Postives = 154/317 (48.58%), Query Frame = 1
Query:  388 DLIQVAIEGIRKGIYTCQKLFANHRWNCPTPNLNNPSALLFGDIMLKGFPETAFIYAMLSASVAQTVAEACSFKLSH-CPCNNKGRISQTN-WIWQGCDDNVQFGRRFARKMFDPDIPDWNKKTLMNLHNTGTGRRVAVKSMNVKCVCQGTSGSCTTKICHRKVASIDEIGNILKEKYENAVKVVKEDSEVNLLANSQKRKTTNKNQQYRKALIIARKHIFIRTEKQYPYARDLVYLEDVPKNFYCDSKPEWHILGTTGRVCNSLSNSTDSCNNLCCNRPFLTRSKTIMENCNCKFIWCCKVECQQCQKRIFIETCQ 1332
            +L+    EG+R GI  CQ  F   RWNC T     P+  +FG ++ +   E +F++A+ SA V   V  AC+   S  C C+NK R   +  W W GC ++  FG   +R+  D      + ++ MN HN   GR   +  M  KC C G SGSC  K C     S   +G+ LK+KY++A +++ E          + R++    +  R    + +           P  RDLVY E  P   +C+   E   LGT GR CN  S+  D C+ LCC+R + T ++   E C C F WCC V CQ+C +   I TC+
Sbjct:   64 ELMPSVAEGVRLGIQECQHQFRGRRWNCTT-MTEGPA--IFGPVLERATREASFVHAVSSAGVGFAVTRACADGTSTICGCDNKHRGEPSGGWKWGGCSEDADFGVMVSREFADARENRPDARSAMNRHNNEAGRVSILDFMQRKCKCHGLSGSCEVKTCWWAQPSFRTVGDHLKDKYDSASEMLVE----------RHRESRGWVETLRPKYPLFKP----------PAERDLVYYETSPN--FCEPSAETGSLGTHGRPCNLTSHGIDGCDLLCCSRGYNTHTERRREKCKCVFHWCCYVSCQECARVYDIHTCK 355          
BLAST of wntP-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010914.1 (pep scaffold:Pmarinus_7.0:GL478525:6655:13730:-1 gene:ENSPMAG00000009890.1 transcript:ENSPMAT00000010914.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 168.703 bits (426), Expect = 7.524e-48
Identity = 107/330 (32.42%), Postives = 152/330 (46.06%), Query Frame = 1
Query:  388 DLIQVAIEGIRKGIYTCQKLFANHRWNCPTPNLNNPSALLFGDIMLKGFPETAFIYAMLSASVAQTVAEAC-SFKLSHCPCNN--KGRISQTNWIWQGCDDNVQFGRRFARKMFDPDIPDW----------------------NKKTLMNLHNTGTGRRVAVKSMNVKCVCQGTSGSCTTKICHRKVASIDEIGNILKEKYENAVKVVKEDSEVNLLANSQKRKTTNKNQQYRKALIIARKHIFIRTEKQYPYARDLVYLEDVPKNFYCDSKPEWHILGTTGRVCNSLSNSTDSCNNLCCNRPFLTRSKTIMENCNCKFIWCCKVECQQC 1302
            D +    +G R  +  CQ  F   RWNC     ++    +FG +   G  ETAF +A+ +A VA  V+ AC   +L+ C C+   + R  Q +W+W GC DN+++G RFAR+  D    +                       + +TLMNLHN   GRR      +V C C G SGSC+ K C  ++A   ++G  LKEKY++A                ++ K    N+++                   P A DLVYL+  P   YC        LGT GR CN  S   D C  +CC R +     T++E CNCKF WCC V+C++C
Sbjct:   67 DHVPHIADGARLAVRECQHQFRTRRWNCSAGEGDS----VFGRLTHIGSRETAFAHAISAAGVAHAVSRACREGELATCGCSRAPRPRELQRDWLWGGCGDNLEYGYRFAREFVDAREREQGGQQQQQQQQQQQQLAARHSVEHSRTLMNLHNNEAGRRAVYGLADVACKCHGVSGSCSLKTCWLQLADFRKVGKFLKEKYDSASAA----------RAGRRAKLEPANRKFSP-----------------PSAGDLVYLDASPD--YCVRNETTGSLGTIGRSCNKTSEGMDGCELMCCGRGYDHFKATVVERCNCKFHWCCYVKCKKC 363          
BLAST of wntP-1 vs. Ensembl Sea Lamprey
Match: wnt1 (wingless-type MMTV integration site family, member 1 [Source:NCBI gene;Acc:30128])

HSP 1 Score: 152.91 bits (385), Expect = 4.053e-43
Identity = 92/276 (33.33%), Postives = 132/276 (47.83%), Query Frame = 1
Query:  520 MLKGFPETAFIYAMLSASVAQTVAEACS-FKLSHCPCN--NKGRISQTNWIWQGCDDNVQFGRRFARKMFDP--DIPDWNKKTLMNLHNTGTGRRVAVKSMNVKCVCQGTSGSCTTKICHRKVASIDEIGNILKEKYENAVKVVKEDSEVNLLANSQKRKTTNKNQQYRKALIIARKHIFIRTEKQYPYARDLVYLEDVPKNFYCDSKP-EWHILGTTGRVCNSLSNSTDSCNNLCCNRPFLTRSKTIMENCNCKFIWCCKVECQQCQKRIFIETC 1329
            +L G  ETAFI+A++SA++A  VA ACS   ++ C C+   +GR    +W W GC DN+ FG RFAR++     +    + + LM+ HN   G R     M  +C C G SGSC  K C  ++     +G+ LKE+++ A +V     E N  +    R                  H       + P  RDLVY+++ P+  + D+    W   GT GRVC   S     C  LCC R + +R   + E C C F WCC V CQ C +   +  C
Sbjct:    1 LLAGCRETAFIHAVMSAALAHGVARACSEGSIASCTCDYGRRGR-GGPDWEWGGCSDNLPFGTRFARELAAGAGERGGRDARALMDRHNEEAGMRTVDSEMRRECKCHGMSGSCALKTCWLRLPPFRAVGDRLKERFDGATQVADYGREGNRASKDSDRGGGGSGGGGGHLRPADPAH-------KPPGGRDLVYVDESPEFCHADTAGLSW--PGTRGRVCVRGSPGLGGCELLCCGRGWTSREARVSERCLCTFHWCCTVTCQNCTRVETVHEC 266          
BLAST of wntP-1 vs. Ensembl Sea Lamprey
Match: wnt10a (wingless-type MMTV integration site family, member 10a [Source:NCBI gene;Acc:30171])

HSP 1 Score: 129.798 bits (325), Expect = 3.132e-34
Identity = 85/276 (30.80%), Postives = 125/276 (45.29%), Query Frame = 1
Query:  514 DIMLKGFPETAFIYAM--LSASVAQTVAEACSFKLSHCPCNNKGRISQTNWIWQGCDDNVQFGRRFARKMFDPDIPDWNKKTLMNLHNTGTGRRVAVKSMNVKCVCQGTSGSCTTKICHRKVASIDEIGNILKEKYENAVKVVKEDSE-VNLLANSQKRKTTNKNQQYRKALIIARKHIFIRTEKQYPYARDLVYLEDVPKNFYCDSKPEWHILGTTGRVCNSLSNSTDSCNNLCCNRPFLTRSKTIMENCNCKFIWCCKVECQQCQKRIFIETCQ 1332
            D  LKG  E AF   +  L   +      A +  L H P +  G  S   W W GC  +++FG +F+R   D      +      LHN   GRRV ++    KC C GTSGSC  K C +       +G+ L++++  A  +   +   V  LA        + +Q    A +  R++       + P   +L+Y E  P      +  EW   GT GRVCN  S+  D C ++CC R     S++ ME CNCKF WCC V C++C    ++  C+
Sbjct:   35 DEKLKG-DEEAFRVKLIKLKMQMLSQGKAAANGVLPHVPADAPG--SPDTWEWGGCSHDLEFGEKFSRDFLDSRETSRDIHARTRLHNNRVGRRVVLEHKRRKCKCHGTSGSCQLKTCWQVSPDFRTVGDTLRDRFHLAAFLAPHNRHGVPALALVSGGGHHHHHQGSSSAQVTGRRY-------RPPDDGELLYFERSPTFCERGAGSEW--PGTQGRVCNRTSSGADGCESMCCGRGHNQISESRMERCNCKFHWCCYVVCEECHSSAWVNVCK 298          
BLAST of wntP-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001922.1 (pep scaffold:Pmarinus_7.0:GL482023:1913:9516:-1 gene:ENSPMAG00000001738.1 transcript:ENSPMAT00000001922.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 125.176 bits (313), Expect = 2.449e-32
Identity = 99/329 (30.09%), Postives = 135/329 (41.03%), Query Frame = 1
Query:  379 ANSDLIQVAIEGIRKGIYTCQKLFANHRWNCPTPNLNNPSALLFGDIMLKGFPETAFIYAMLSASVAQTVAEACSF---KLSHCPCNNKGRISQTNWIWQGCDDNVQFGRRFARKMFDPDIPDWNKKT--LMNLHNTGTGRR------VAVKSMNVKCVCQGTSGSCTTKICHRKVASIDEIGNILKEKYENAVKVVKEDSEVNLLANSQKRKTTNKNQQYRKALIIARKHIFIRTEKQYPYARDLVYLEDVPKNFYCDSKPEWHILGTTGRVCNSLSNSTDSCNNLCCNRPFLTRSKTIMENCNCKFIWCCKVECQQCQKRIFIETCQ 1332
            +  D+I V  EG + GI  CQ  F   RWNC           +FG  +      T F        + + + + C +   +LS C    +GR     W+     D  QFG++ +          +N +   L  L      RR      V  + M ++C C G SGSCTTK C   +    E+G  LK+KYE+ V V        +     K K   K++ YRK                 P   +LV+ E  P   YC+  P     GT GR+CN  S   D C+ LCC R + T   T    CNCKF WCC V C  C +R    TC+
Sbjct:   23 SRPDVIIVIGEGAQLGISECQYQFRFGRWNCTALGERT----VFGQELKVAIRSTHFTDIQSGGGLFERIHQRCRYGAHELSLCSQLTRGREGPHPWLRMTPLDE-QFGQKTSSTFLKIVYIHYNYRNSDLAQLMQKVPYRRFHSTDQVLEEKMKLECKCHGVSGSCTTKTCWTTLPKFREVGYALKDKYEHTVHVEPVSGSRYMRPMFLKVK---KSRSYRK-----------------PLDTELVFTERSPN--YCEEDPATGSAGTRGRLCNRTSPHADGCDLLCCGRGYNTHQYTRAWQCNCKFHWCCYVRCSTCSERTEEYTCK 324          
BLAST of wntP-1 vs. Ensembl Nematostella
Match: EDO49431 (Protein Wnt [Source:UniProtKB/TrEMBL;Acc:A7RGH9])

HSP 1 Score: 203.371 bits (516), Expect = 9.035e-61
Identity = 123/355 (34.65%), Postives = 175/355 (49.30%), Query Frame = 1
Query:  289 WNQFYSFDPIRRKLYSQEYRPNW------KNFTDLPANSDLIQVAIEGIRKGIYTCQKLFANHRWNCPTPNLNNPSALLFGDIMLKGFPETAFIYAMLSASVAQTVAEACS-FKLSHCPCNNKGR-ISQTNWIWQGCDDNVQFGRRFARKMFDPDIPDWNKKTLMNLHNTGTGRRVAVKSMNVKCVCQGTSGSCTTKICHRKVASIDEIGNILKEKYENAVKVVKEDSEVNLLANSQKRKTTNKNQQYRKALIIARKHIFIRTEKQYPYARDLVYLEDVPKNFYCDSKPEWHILGTTGRVCNSLSNSTDSCNNLCCNRPFLTRSKTIMENCNCKFIWCCKVECQQCQKRIFIETC 1329
            WN  + F+ ++     Q   PN       K         +LIQ    G R  I+ CQ  F N +WNC   +  N    +FG I+ +   ETAF YA+ +A V+  +A AC   KLS C C+ + R +S+  W W GC DN+ F   F+++  D      + +  +NLHN   GR     +M V+C C G S +CT K C +++     +G+ LK K++NA  V  + +  N  +N  + +          AL I  K    R     P   DLVY E  P   +C+  P    LGT GR CN+ S  TD C  +CC R F T S+  +ENCNC+F WCC+V+CQ+C+ R  I  C
Sbjct:   27 WNLGFGFEDLKNDYNIQLSPPNQIRALTQKQIRISRRYPELIQYIAGGARTAIHECQHQFRNRKWNCSAHSPEN----VFGKILKRACRETAFTYAITAAGVSHAIARACGEGKLSACSCDQRYRGVSKQGWQWGGCSDNIHFADNFSKRFVDAQEKGRDFRAQINLHNNEAGRAAVRNNMIVECKCHGLSEACTVKTCWKRLPDFRLVGDDLKRKFDNASMVEYQQNNNNRNSNRNRNEDP--------ALFIPSKPYLRR-----PTVYDLVYYEHSPN--FCERNPSAGSLGTQGRECNTTSMGTDGCELMCCGRGFTTSSQERVENCNCRFFWCCEVKCQKCKTRRIISNC 362          
BLAST of wntP-1 vs. Ensembl Nematostella
Match: WNT2 (Protein Wnt [Source:UniProtKB/TrEMBL;Acc:A7S3E5])

HSP 1 Score: 200.675 bits (509), Expect = 8.143e-60
Identity = 118/311 (37.94%), Postives = 161/311 (51.77%), Query Frame = 1
Query:  382 NSDLIQVAIEGIRKGIYTCQKLFANHRWNCPTPNLNNPSALLFGDIMLKGFPETAFIYAMLSASVAQTVAEACSF-KLSHCPCNNKGRISQTNWIWQGCDDNVQFGRRFARKMFDPDIPDWNKKTLMNLHNTGTGRRVAVKSMNVKCVCQGTSGSCTTKICHRKVASIDEIGNILKEKYENAVKVVKEDSEVNLLANSQKRKTTNKNQQYRKALIIARKHIFIRTEKQYPYARDLVYLEDVPKNFYCDSKPEWHILGTTGRVCN-SLSNSTDSCNNLCCNRPFLTRSKTIMENCNCKFIWCCKVECQQCQK 1308
            N D++    +G + G+  CQ  F + RWNC T N +   A +FG +M +   ETAF+YA+ SA V   V  +CS  +L  C C NK   S+  + W GC DN+Q+G  FA+   D    + + + LMNLHN   GRRV   +M++ C C G SGSC+ + C + ++S   +G  L+EKY  AV+V    S   L         TN    Y+K                 P   DLVYLED P   YC        LGT+GR CN S S++T +C+ LCC R F T        C+CKF WCC V+CQ C++
Sbjct:   59 NPDVMVSIGKGAKLGVEECQHQFRDQRWNCSTVNGD---ATVFGKVMRRASRETAFVYAISSAGVVHEVTRSCSLGELKDCSCRNKKGRSRKGFEWGGCSDNIQYGLNFAKAFVDSREVEKDARALMNLHNNHVGRRVVKTNMSLDCKCHGVSGSCSVRTCWKSISSFRIVGQHLREKYTTAVQVTVGQSGGEL---------TNAEVSYKK-----------------PSRDDLVYLEDSPN--YCMVDSNTGSLGTSGRECNGSASDTTGACSLLCCGRGFNTIQIEEEYKCHCKFHWCCYVKCQTCRR 338          
BLAST of wntP-1 vs. Ensembl Nematostella
Match: EDO37387 (Protein Wnt [Source:UniProtKB/TrEMBL;Acc:A7SFU2])

HSP 1 Score: 194.897 bits (494), Expect = 1.112e-57
Identity = 105/316 (33.23%), Postives = 156/316 (49.37%), Query Frame = 1
Query:  388 DLIQVAIEGIRKGIYTCQKLFANHRWNCPTPNLNNPSALLFGDIMLKGFPETAFIYAMLSASVAQTVAEACSF-KLSHCPCNNKGRISQTNWIWQGCDDNVQFGRRFARKMFDPDIPDWNKKTLMNLHNTGTGRRVAVKSMNVKCVCQGTSGSCTTKICHRKVASIDEIGNILKEKYENAVKVVKEDSEVNLLANSQKRKTTNKNQQYRKALIIARKHIFIRTEKQYPYARDLVYLEDVPKNFYCDSKPEWHILGTTGRVCNSLSNSTDSCNNLCCNRPFLTRSKTIMENCNCKFIWCCKVECQQCQKRIFIETCQ 1332
            D++  A++G++  I+ C   F   RWNC +  + N + L    ++ +GF ETAF++A+LSA +  +VA ACS  KL+ C C+   R   T W W GC DN+ +G   + K  D      +  ++MN+HN   GR    ++   KC C G  GSC+ K C + V  I EIG+ L EKY++A  +   +  + L                         H+  R  ++    R LVY ED P   YC    E  I GT GR+C+  S  TD+C NLCC R + T+   + + C C F WCC + C  C++   +  C 
Sbjct:   62 DVVASALQGMQYAIHECLAQFRYRRWNCSSLEMKNRNPLA-NPLLSRGFRETAFVHAILSAGMTSSVARACSMGKLAKCGCDESLRGRGTGWEWGGCGDNIDYGIETSAKFLDSREKGRDLHSMMNMHNNMVGRTTLSENAKTKCKCHGMCGSCSVKTCWKTVPDIREIGDRLMEKYDHATTIGMGNGRLRL-------------------------HLTRRKARRSSVGRALVYYEDSPN--YCIENKELGIFGTRGRICSPESLDTDNCQNLCCERGYTTKKLQVTKRCRCHFSWCCYLICDTCRETSTVSICS 349          
BLAST of wntP-1 vs. Ensembl Nematostella
Match: WNT3 (Protein Wnt [Source:UniProtKB/TrEMBL;Acc:A7RXF5])

HSP 1 Score: 192.586 bits (488), Expect = 6.911e-57
Identity = 113/320 (35.31%), Postives = 169/320 (52.81%), Query Frame = 1
Query:  382 NSDLIQVAIEGIRKGIYTCQKLFANHRWNCPTPNLNNPSALLFGDIMLKGFPETAFIYAMLSASVAQTVAEACS-FKLSHCPC--NNKGRISQTNWIWQGCDDNVQFGRRFARKMFDPDIPDWNKKTLMNLHNTGTGRRVAVKSMNVKCVCQGTSGSCTTKICHRKVASIDEIGNILKEKYENAVKVVKEDSEVNLLANSQKRKTTNKNQQYRKALIIARKHIFIRTEKQYPYARDLVYLEDVPKNFYCDSKPEWHILGTTGRVCNSLSNSTDSCNNLCCNRPFLTRSKTIMENCNCKFIWCCKVECQQCQKRIFIETCQ 1332
            N DL++    G + G++ C+  F N RWNC T      S  LF  ++ KG  E AF++A+ +A VA +V +ACS  ++  C C  N  GR S+  W W GC+ N++FG  F+++  +      + + +MN HN+  GR+   + +  KC C G SGSC+ K C  + A+  +IG+ LK KY++AV++                 TT  N++ +K L     H       + P  +DL+Y E  P   YCD       LGT+GR CN  SN  D C  LCC R    +   I  NCNC F WCC+V+C++C++ + I TC+
Sbjct:   59 NPDLMEHVAHGAKYGVHECRHQFRNRRWNCSTIR---ESGSLFESVLSKGCREAAFVHAVTAAGVAHSVTDACSKGRIESCDCDRNLSGRSSK-GWTWSGCNSNIKFGVWFSKQFTEARERGGDLRQIMNRHNSRAGRKALEELVWRKCKCHGLSGSCSMKTCWMQQANFRQIGDHLKVKYDSAVEM-----------------TTKVNRRGKKRLKPKYSHF------KKPSDKDLIYFETSPN--YCDKNVTVGSLGTSGRQCNYTSNGIDGCELLCCGRGHNIQQAKITRNCNCVFKWCCEVKCERCKEVVNIYTCK 349          
BLAST of wntP-1 vs. Ensembl Nematostella
Match: EDO31000 (Protein Wnt [Source:UniProtKB/TrEMBL;Acc:A7SZ54])

HSP 1 Score: 185.267 bits (469), Expect = 5.782e-54
Identity = 117/368 (31.79%), Postives = 178/368 (48.37%), Query Frame = 1
Query:  262 LQYAFTRHQWNQFYS---FDPIRRKLYSQEYRPNWKNFTDLPANSDLIQVAIEGIRKGIYTCQKLFANHRWNCPTPNLNNPSALLFGDIMLKGFPETAFIYAMLSASVAQTVAEACS-FKLSH-CPCNNKGRISQTNWIWQGCDDNVQFGRRFARKMFDPDIPDWN----KKTLMNLHNTGTGRRVAVKSMNVKCVCQGTSGSCTTKICHRKVASIDEIGNILKEKYENAVKVVKEDSEVNLLANSQKRKTTNKNQQYRKALIIARKHIFIRTEKQY-PYAR-DLVYLEDVPKNFYCDSKPEWHILGTTGRVCNSLSNSTDSCNNLCCNRPFLTRSKTIMENCNCKFIWCCKVECQQCQKRIFIETCQ 1332
            L  A T    N+F S    D I + L  ++ +   +N   + +  D   VA+       + CQ  F    WNC T   +     +FG+ +  G  E AF++A+ SA VA  V +ACS  +L   C C+ K R     + W GC D++ FG  FA +  D            + LMNLHN   GR    K M+++C C G SGSC  K C R + +   +G+ +KEK++ A +V                       +Y+   +I  KH+ +   ++Y P+ + DLVYL   P   +C+  P+   LGT GR+CN  S + D C+ +CC R +++R++   E C CKF WCC V CQ C +R+ +  C+
Sbjct:   24 LSLALTGSNPNRFLSKKNCDEIGQLLNHRQVQVCKRNIQVMDSVKDGASVAL-------FECQHQFRYRPWNCTTVQFSRSP--VFGNSINGGTREAAFVHAISSAGVAYAVTQACSSGRLGQKCGCDRKTRGQADGFNWAGCSDDIDFGMTFATRFVDARERGSGIGSPARVLMNLHNNRGGRLAVKKFMDLQCKCHGVSGSCNIKTCWRALPNFRIVGDYIKEKFDGATEV-----------------------EYK---LIGGKHVLVPKNRKYKPHTQMDLVYLVQSPD--FCEPNPKTGSLGTQGRICNRTSQAIDGCDLMCCGRGYVSRTEVRQEQCACKFFWCCHVRCQTCMRRVEVSYCK 354          
BLAST of wntP-1 vs. Ensembl Medaka
Match: wnt1 (Wnt family member 1 [Source:NCBI gene;Acc:100125456])

HSP 1 Score: 197.208 bits (500), Expect = 7.170e-58
Identity = 110/319 (34.48%), Postives = 158/319 (49.53%), Query Frame = 1
Query:  382 NSDLIQVAIEGIRKGIYTCQKLFANHRWNCPTPNLNNPSALLFGDIMLKGFPETAFIYAMLSASVAQTVAEACS-FKLSHCPCNNKGRI-SQTNWIWQGCDDNVQFGRRFARKMFDPDIPDWNKKTLMNLHNTGTGRRVAVKSMNVKCVCQGTSGSCTTKICHRKVASIDEIGNILKEKYENAVKVVKEDSEVNLLAN-SQKRKTTNKNQQYRKALIIARKHIFIRTEKQYPYARDLVYLEDVPKNFYCDSKPEWHILGTTGRVCNSLSNSTDSCNNLCCNRPFLTRSKTIMENCNCKFIWCCKVECQQCQKRIFIETC 1329
            N  ++     G+   I  C+  F N RWNCPT +    S  +FG I+ +G  ETAF++A+ SA V   VA +CS   +  C C+ + R     +W W GC DNV+FGR F+R+  D      + + L NLHN   GR +    M+ +C C G SGSCT + C  ++ S   +G+ LK++++ A +VV  +   N  ++ +  R    +N  ++                  P   DLVY E  P   +C    +   LGT+GR CNS S   D C  LCC R F TRS+ + E C+C F WCC V C  C     +  C
Sbjct:   74 NPGILHAIAAGLHAAIKECKWQFRNRRWNCPTTH----SPAIFGKIVNRGCRETAFVFAITSAGVTHAVARSCSEGSIESCTCDYRRRGPGGPDWHWGGCSDNVEFGRVFSREFVDSSERGRDLRYLTNLHNNEAGRMIVSTEMHQECKCHGMSGSCTVRTCWMRLPSFRTVGDFLKDRFDGASRVVYANKGSNRASHRADPRHLEPENPAHKP-----------------PSTMDLVYFEKSPN--FCSHNSKTGTLGTSGRTCNSSSPGLDGCELLCCGRGFKTRSEAVTERCHCTFHWCCHVSCLNCTSTRTLHQC 369          
BLAST of wntP-1 vs. Ensembl Medaka
Match: wnt1 (Wnt family member 1 [Source:NCBI gene;Acc:100125456])

HSP 1 Score: 197.593 bits (501), Expect = 1.028e-57
Identity = 110/319 (34.48%), Postives = 158/319 (49.53%), Query Frame = 1
Query:  382 NSDLIQVAIEGIRKGIYTCQKLFANHRWNCPTPNLNNPSALLFGDIMLKGFPETAFIYAMLSASVAQTVAEACS-FKLSHCPCNNKGR-ISQTNWIWQGCDDNVQFGRRFARKMFDPDIPDWNKKTLMNLHNTGTGRRVAVKSMNVKCVCQGTSGSCTTKICHRKVASIDEIGNILKEKYENAVKVVKEDSEVNLLAN-SQKRKTTNKNQQYRKALIIARKHIFIRTEKQYPYARDLVYLEDVPKNFYCDSKPEWHILGTTGRVCNSLSNSTDSCNNLCCNRPFLTRSKTIMENCNCKFIWCCKVECQQCQKRIFIETC 1329
            N  ++     G+   I  C+  F N RWNCPT +    S  +FG I+ +G  ETAF++A+ SA V   VA +CS   +  C C+ + R     +W W GC DNV+FGR F+R+  D      + + L NLHN   GR +    M+ +C C G SGSCT + C  ++ S   +G+ LK++++ A +VV  +   N  ++ +  R    +N  ++                  P   DLVY E  P   +C    +   LGT+GR CNS S   D C  LCC R F TRS+ + E C+C F WCC V C  C     +  C
Sbjct:  102 NPGILHAIAAGLHAAIKECKWQFRNRRWNCPTTH----SPAIFGKIVNRGCRETAFVFAITSAGVTHAVARSCSEGSIESCTCDYRRRGPGGPDWHWGGCSDNVEFGRVFSREFVDSSERGRDLRYLTNLHNNEAGRMIVSTEMHQECKCHGMSGSCTVRTCWMRLPSFRTVGDFLKDRFDGASRVVYANKGSNRASHRADPRHLEPENPAHKP-----------------PSTMDLVYFEKSPN--FCSHNSKTGTLGTSGRTCNSSSPGLDGCELLCCGRGFKTRSEAVTERCHCTFHWCCHVSCLNCTSTRTLHQC 397          
BLAST of wntP-1 vs. Ensembl Medaka
Match: WNT7A (protein Wnt-7a [Source:NCBI gene;Acc:101174500])

HSP 1 Score: 194.897 bits (494), Expect = 3.361e-57
Identity = 115/319 (36.05%), Postives = 163/319 (51.10%), Query Frame = 1
Query:  388 DLIQVAIEGIRKGIYTCQKLFANHRWNCPTPNLNNPSALLFGDIMLKGFPETAFIYAMLSASVAQTVAEACS-FKLSHCPCNN--KGRISQT-NWIWQGCDDNVQFGRRFARKMFDPDIPDWNKKTLMNLHNTGTGRRVAVKSMNVKCVCQGTSGSCTTKICHRKVASIDEIGNILKEKYENAVKVVKEDSEVNLLANSQKRKTTNKNQQYRKALIIARKHIFIRTEKQYPYARDLVYLEDVPKNFYCDSKPEWHILGTTGRVCNSLSNSTDSCNNLCCNRPFLTRSKTIMENCNCKFIWCCKVECQQCQKRIFIETCQ 1332
            D I V  EG++ GI  CQ  F + RWNC           +FG  +  G  E AF YA+++A +A  V  AC+   LS C C+   +G  +Q   W W GC  +V++G  F++   D      N +TLMNLHN   GR+V  K+M ++C C G SGSCTTK C   +    ++G+ILKEKY+ AV V               R   NK   + K   + + H++ +     P   +LVY+E  P   YC++       GT GR+CN  +   DSC ++CC R + T   + +  CNCKF+WCC V C  C  R  + TC+
Sbjct:   57 DAIIVMGEGVQMGIRECQFQFRHGRWNCSALGERT----VFGRELKVGSKEAAFTYAVIAAGIAHAVTAACTRGGLSGCDCDQDKQGLYNQEEGWKWGGCSADVRYGLSFSKVFVDAREIKQNARTLMNLHNNEVGRKVLEKAMRLECKCHGVSGSCTTKTCWTTLPKFRQLGHILKEKYQQAVHV------------EPVRARRNKRPAFLK---VRKSHLYHK-----PKDTELVYIEKSPN--YCEANSVMDSTGTQGRLCNRTAQQPDSCASMCCGRGYDTHQYSRVWQCNCKFLWCCSVRCNTCSARTEVYTCK 349          
BLAST of wntP-1 vs. Ensembl Medaka
Match: wnt7bb (protein Wnt-7b [Source:NCBI gene;Acc:101155025])

HSP 1 Score: 191.43 bits (485), Expect = 5.549e-56
Identity = 120/323 (37.15%), Postives = 159/323 (49.23%), Query Frame = 1
Query:  388 DLIQVAIEGIRKGIYTCQKLFANHRWNCPTPNLNNPSALLFGDIMLKGFPETAFIYAMLSASVAQTVAEACS-FKLSHCPCN--NKGRISQT-NWIWQGCDDNVQFGRRFARKMFDPDIPDWNKKTLMNLHNTGTGRRVAVKSMNVKCVCQGTSGSCTTKICHRKVASIDEIGNILKEKYENAVKVVKEDSEVNLLANSQKRKTTN----KNQQYRKALIIARKHIFIRTEKQYPYARDLVYLEDVPKNFYCDSKPEWHILGTTGRVCNSLSNSTDSCNNLCCNRPFLTRSKTIMENCNCKFIWCCKVECQQCQKRIFIETCQ 1332
            D I V  EG + GI  CQ  F   RWNC           +FG  +  G  E AF YA+ +A VA  +  ACS   LS C C+   +G  +Q   W W GC  ++++G  F+R+  D        + LMNLHN   GR+V  + M ++C C G SGSCTTK C   +    EIG ILKEKY  AV        V ++  S+ R+ T+    + Q YRK                 P   DLVY+E  P   YC+       +GT GR+CN  S  TD C+ +CC R + T   T +  CNCKF WCC V+C  C +R  + TC+
Sbjct:   61 DAIIVVGEGAQMGINECQYQFRYGRWNCSALGERT----VFGQELRVGSREAAFTYAITAAGVAHAITAACSQGNLSQCGCDREKQGYYNQEEGWKWGGCSADIKYGIEFSRRFVDAREIKKTPRRLMNLHNNEAGRKVLEERMKLECKCHGVSGSCTTKTCWTTLPKFREIGYILKEKYNEAV-------HVEVVRASRLRQPTHLKVKQTQGYRK-----------------PMETDLVYIERSPN--YCEEDAATGSVGTQGRLCNRTSPHTDGCDLMCCGRGYNTHQYTKVWQCNCKFQWCCFVKCNTCSERTEVFTCK 353          
BLAST of wntP-1 vs. Ensembl Medaka
Match: wnt7bb (protein Wnt-7b [Source:NCBI gene;Acc:101155025])

HSP 1 Score: 191.43 bits (485), Expect = 6.838e-56
Identity = 120/323 (37.15%), Postives = 159/323 (49.23%), Query Frame = 1
Query:  388 DLIQVAIEGIRKGIYTCQKLFANHRWNCPTPNLNNPSALLFGDIMLKGFPETAFIYAMLSASVAQTVAEACS-FKLSHCPCN--NKGRISQT-NWIWQGCDDNVQFGRRFARKMFDPDIPDWNKKTLMNLHNTGTGRRVAVKSMNVKCVCQGTSGSCTTKICHRKVASIDEIGNILKEKYENAVKVVKEDSEVNLLANSQKRKTTN----KNQQYRKALIIARKHIFIRTEKQYPYARDLVYLEDVPKNFYCDSKPEWHILGTTGRVCNSLSNSTDSCNNLCCNRPFLTRSKTIMENCNCKFIWCCKVECQQCQKRIFIETCQ 1332
            D I V  EG + GI  CQ  F   RWNC           +FG  +  G  E AF YA+ +A VA  +  ACS   LS C C+   +G  +Q   W W GC  ++++G  F+R+  D        + LMNLHN   GR+V  + M ++C C G SGSCTTK C   +    EIG ILKEKY  AV        V ++  S+ R+ T+    + Q YRK                 P   DLVY+E  P   YC+       +GT GR+CN  S  TD C+ +CC R + T   T +  CNCKF WCC V+C  C +R  + TC+
Sbjct:   57 DAIIVVGEGAQMGINECQYQFRYGRWNCSALG----ERTVFGQELRVGSREAAFTYAITAAGVAHAITAACSQGNLSQCGCDREKQGYYNQEEGWKWGGCSADIKYGIEFSRRFVDAREIKKTPRRLMNLHNNEAGRKVLEERMKLECKCHGVSGSCTTKTCWTTLPKFREIGYILKEKYNEAV-------HVEVVRASRLRQPTHLKVKQTQGYRK-----------------PMETDLVYIERSPN--YCEEDAATGSVGTQGRLCNRTSPHTDGCDLMCCGRGYNTHQYTKVWQCNCKFQWCCFVKCNTCSERTEVFTCK 349          
BLAST of wntP-1 vs. Planmine SMEST
Match: SMESG000024191.1 (SMESG000024191.1)

HSP 1 Score: 770.385 bits (1988), Expect = 0.000e+0
Identity = 368/368 (100.00%), Postives = 368/368 (100.00%), Query Frame = 1
Query:  229 MKSDPNIATNSLQYAFTRHQWNQFYSFDPIRRKLYSQEYRPNWKNFTDLPANSDLIQVAIEGIRKGIYTCQKLFANHRWNCPTPNLNNPSALLFGDIMLKGFPETAFIYAMLSASVAQTVAEACSFKLSHCPCNNKGRISQTNWIWQGCDDNVQFGRRFARKMFDPDIPDWNKKTLMNLHNTGTGRRVAVKSMNVKCVCQGTSGSCTTKICHRKVASIDEIGNILKEKYENAVKVVKEDSEVNLLANSQKRKTTNKNQQYRKALIIARKHIFIRTEKQYPYARDLVYLEDVPKNFYCDSKPEWHILGTTGRVCNSLSNSTDSCNNLCCNRPFLTRSKTIMENCNCKFIWCCKVECQQCQKRIFIETCQ 1332
            MKSDPNIATNSLQYAFTRHQWNQFYSFDPIRRKLYSQEYRPNWKNFTDLPANSDLIQVAIEGIRKGIYTCQKLFANHRWNCPTPNLNNPSALLFGDIMLKGFPETAFIYAMLSASVAQTVAEACSFKLSHCPCNNKGRISQTNWIWQGCDDNVQFGRRFARKMFDPDIPDWNKKTLMNLHNTGTGRRVAVKSMNVKCVCQGTSGSCTTKICHRKVASIDEIGNILKEKYENAVKVVKEDSEVNLLANSQKRKTTNKNQQYRKALIIARKHIFIRTEKQYPYARDLVYLEDVPKNFYCDSKPEWHILGTTGRVCNSLSNSTDSCNNLCCNRPFLTRSKTIMENCNCKFIWCCKVECQQCQKRIFIETCQ
Sbjct:    1 MKSDPNIATNSLQYAFTRHQWNQFYSFDPIRRKLYSQEYRPNWKNFTDLPANSDLIQVAIEGIRKGIYTCQKLFANHRWNCPTPNLNNPSALLFGDIMLKGFPETAFIYAMLSASVAQTVAEACSFKLSHCPCNNKGRISQTNWIWQGCDDNVQFGRRFARKMFDPDIPDWNKKTLMNLHNTGTGRRVAVKSMNVKCVCQGTSGSCTTKICHRKVASIDEIGNILKEKYENAVKVVKEDSEVNLLANSQKRKTTNKNQQYRKALIIARKHIFIRTEKQYPYARDLVYLEDVPKNFYCDSKPEWHILGTTGRVCNSLSNSTDSCNNLCCNRPFLTRSKTIMENCNCKFIWCCKVECQQCQKRIFIETCQ 368          
BLAST of wntP-1 vs. Planmine SMEST
Match: SMESG000067888.1 (SMESG000067888.1)

HSP 1 Score: 184.111 bits (466), Expect = 2.181e-53
Identity = 109/327 (33.33%), Postives = 162/327 (49.54%), Query Frame = 1
Query:  391 LIQVAIEGIRKGIYTCQKLFANHRWNCPTPNLNNPSALL-----------FGDIMLKGFPETAFIYAMLSASVAQTVAEACSFKLS-HCPCNNK-GRISQTNWIWQGCDDNVQFGRRFARKMFDPDIPDWNKKT----LMNLHNTGTGRRVAVKSMNVKCVCQGTSGSCTTKICHRKVASIDEIGNILKEKYENAVKVVKEDSEVNLLANSQKRKTTNKNQQYRKALIIARKHIFIRTEKQYPYARDLVYLEDVPKNFYCDSKPEWHILGTTGRVCNSLSN-----STDSCNNLCCNRPFLTRSKTIMENCNCKFIWCCKVECQQCQ 1305
            LI   I G+  GI  CQ  F N  WNC   NL+ P   +             +++ KG PE+AF+ +M SA+VA  V++ACS   + +C C+       + N+ W GC DNV FG  F+++  D       K+     L+NLHN+  G ++ + +M +KC C G SGSC TK C+R +  + ++G+ILKEK+  A+ V   D ++  + + + R T +                            DL YL+  P   +C   P +  LGT GR+CN+           SC +LCC R F T+   + E C CKF+WCC V+CQ C+
Sbjct:   35 LIPSVIHGVDIGIQECQHQFFNSYWNCAGHNLSIPDRFVSQSKKKHRKTYLDNLINKGLPESAFLLSMTSAAVAHQVSKACSSGQNKYCGCDRTIYETPEDNFQWAGCSDNVHFGAAFSKRFLDSPHKRKIKRNPSVGLVNLHNSHAGTKIVIDNMMMKCKCHGVSGSCETKTCYRALPDLRKVGDILKEKFSKAILVRMNDFKLVPMHSGESRITEH----------------------------DLTYLKRSPN--FCYHNPSYGSLGTQGRLCNNTQVLEHEFVEGSCAHLCCKRGFSTKQFLVKEKCQCKFVWCCTVQCQTCE 331          
BLAST of wntP-1 vs. Planmine SMEST
Match: SMESG000067888.1 (SMESG000067888.1)

HSP 1 Score: 184.111 bits (466), Expect = 3.974e-53
Identity = 109/327 (33.33%), Postives = 162/327 (49.54%), Query Frame = 1
Query:  391 LIQVAIEGIRKGIYTCQKLFANHRWNCPTPNLNNPSALL-----------FGDIMLKGFPETAFIYAMLSASVAQTVAEACSFKLS-HCPCNNK-GRISQTNWIWQGCDDNVQFGRRFARKMFDPDIPDWNKKT----LMNLHNTGTGRRVAVKSMNVKCVCQGTSGSCTTKICHRKVASIDEIGNILKEKYENAVKVVKEDSEVNLLANSQKRKTTNKNQQYRKALIIARKHIFIRTEKQYPYARDLVYLEDVPKNFYCDSKPEWHILGTTGRVCNSLSN-----STDSCNNLCCNRPFLTRSKTIMENCNCKFIWCCKVECQQCQ 1305
            LI   I G+  GI  CQ  F N  WNC   NL+ P   +             +++ KG PE+AF+ +M SA+VA  V++ACS   + +C C+       + N+ W GC DNV FG  F+++  D       K+     L+NLHN+  G ++ + +M +KC C G SGSC TK C+R +  + ++G+ILKEK+  A+ V   D ++  + + + R T +                            DL YL+  P   +C   P +  LGT GR+CN+           SC +LCC R F T+   + E C CKF+WCC V+CQ C+
Sbjct:   67 LIPSVIHGVDIGIQECQHQFFNSYWNCAGHNLSIPDRFVSQSKKKHRKTYLDNLINKGLPESAFLLSMTSAAVAHQVSKACSSGQNKYCGCDRTIYETPEDNFQWAGCSDNVHFGAAFSKRFLDSPHKRKIKRNPSVGLVNLHNSHAGTKIVIDNMMMKCKCHGVSGSCETKTCYRALPDLRKVGDILKEKFSKAILVRMNDFKLVPMHSGESRITEH----------------------------DLTYLKRSPN--FCYHNPSYGSLGTQGRLCNNTQVLEHEFVEGSCAHLCCKRGFSTKQFLVKEKCQCKFVWCCTVQCQTCE 363          
BLAST of wntP-1 vs. Planmine SMEST
Match: SMESG000002069.1 (SMESG000002069.1)

HSP 1 Score: 161.384 bits (407), Expect = 1.311e-44
Identity = 100/323 (30.96%), Postives = 159/323 (49.23%), Query Frame = 1
Query:  388 DLIQVAIEGIRKGIYTCQKLFANHRWNCPTPNLNNPSALL--FGDIMLKGFPETAFIYAMLSASVAQTVAEACS-FKLSHCPCN----NKGRISQTNWIWQGCDDNVQFGRRFARKMFDP-DIPDWNKKTLMNLHNTGTGRRVAVKSMNVKCVCQGTSGSCTTKICHRKVASIDEIGNILKEKYENAVKVVKEDSEVNLLANSQKRKTTNKNQQYRKALIIARKHIFIRTEKQYPYARDLVYLEDVPKNFYCDSKPEWHILGTTGRVCNSLSNSTDSCNNLCCNRPFLTRSKTIMENCNCKFIWCCKVECQQCQKRIFIETCQ 1332
            +++   + G + G+  C + F   RWNC T N + P  +     ++  +   ETAF++++ S+ V  ++  +CS   L  C C+     + + +  ++ W GC D+++FG + +    D  D  D   +TLMN HN   GRRV  K+   KC C G SG+C+ + C +++     IG++LK+ Y    KV             QK  T +KN+  R                  P  + LVY+++     YC   P     GT GR CN  S+  DSC  LCC+R  LT    + ENC+CKF WCC+V C+ C +++F+  C+
Sbjct:   69 NMMVSIVYGAKLGLVECAQQFKYERWNC-TFNKSFPKIMTNHLHEMTTRSVKETAFLFSIWSSGVVYSITNSCSKGDLKECYCDPQRHGQDKDNVGDFTWGGCSDHIKFGMKVSTIFLDNYDRKDQTGQTLMNQHNNRVGRRVVWKTRLKKCKCHGVSGACSLRTCWQRMNDFRRIGDMLKKLYNKPQKVTYNPF--------QKSLTFSKNRFRR------------------PSKKKLVYIDNSQD--YCIQDPSIGHPGTGGRECNYTSSQHDSCQELCCHRGHLTYEMVVEENCDCKFFWCCEVRCKICSRKVFVYRCK 362          
BLAST of wntP-1 vs. Planmine SMEST
Match: SMESG000066476.1 (SMESG000066476.1)

HSP 1 Score: 153.68 bits (387), Expect = 1.532e-41
Identity = 109/392 (27.81%), Postives = 167/392 (42.60%), Query Frame = 1
Query:  277 TRHQW------NQFYSFDPIRRKLYSQEYRPNWKNFTDLPANSDLIQVAIEGIRKGIYTCQKLFANHRWNCPTPNLNNPSAL-----------------------LFGDIMLKGFPETAFIYAMLSASVAQTVAEACSFKL-SHCPCNNK--GRISQTNWIWQGCDDNVQFGRRFARKMFDPD----IPDWNKKTLMNLHNTGTGRRVAVKSMNVKCVCQGTSGSCTTKICHRKVASIDEIGNILKEKYENAVKVVKEDSEVNLLANSQKRKTTNKNQQYRKALIIARKHIFIRTEKQYPYARDLVYLEDVPKNFYCDSKPEWHILGTTGRVCNSLSNST-----DSCNNLCCNRPFLTRSKTIMENCNCKFIWCCKVECQQCQKRIFIETC 1329
            TRHQ       N++ S   I +++   +     ++F  +P+        + G   GI  CQ  FANH WNC   N  N   +                           ++ K  PE+AFI +++SA V+  V +ACS  + S+C C+         + + W GC  N+ FG  F+R+  D      +       L N+HN   GR   +  M VKC C G SGSC  + C R + S   +G+ LKE++   ++V   D+++                            I     K+     D++YL D P   +C        LGT GR+CN   N+T     +SC  LCC R +  ++    E C+CKF WCCKV C+ C++++    C
Sbjct:   47 TRHQGFQNTYANEYLSTSKICKRVLKNQKPLCEEHFPLMPS-------VVSGFMLGINECQFQFANHVWNCQGHNKTNNQQISLLQMSNTYIQKKPKRDRKLRNTYMDQLIAKSTPESAFILSIISAGVSYQVTKACSQGVHSNCGCDRTVYDAPKDSKFTWSGCSHNIHFGAAFSRRFLDAREKIRLKKQTSAALTNMHNNHVGRESVINKMIVKCKCHGVSGSCEMRTCSRNLPSFRVVGDQLKERFRKIIQVDFFDNKL----------------------------IPKYPSKEMFAEVDMLYLNDSPD--HCHHDFGKGTLGTNGRICNDTYNNTYQEPENSCYRLCCQRGYHIKTYIKDEQCHCKFKWCCKVICETCKRKVIDAIC 401          
The following BLAST results are available for this feature:
BLAST of wntP-1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
WNT13.903e-5732.70Wnt family member 1 [Source:HGNC Symbol;Acc:HGNC:1... [more]
WNT168.438e-5735.37Wnt family member 16 [Source:HGNC Symbol;Acc:HGNC:... [more]
WNT161.245e-5635.20Wnt family member 16 [Source:HGNC Symbol;Acc:HGNC:... [more]
WNT2B2.849e-5635.35Wnt family member 2B [Source:HGNC Symbol;Acc:HGNC:... [more]
WNT2B3.350e-5634.89Wnt family member 2B [Source:HGNC Symbol;Acc:HGNC:... [more]
back to top
BLAST of wntP-1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cwn-21.487e-5133.33pep chromosome:WBcel235:IV:10067824:10070251:1 gen... [more]
cwn-11.692e-4433.04pep chromosome:WBcel235:II:130983:133598:-1 gene:W... [more]
egl-201.306e-4129.91Wnt homolog [Source:UniProtKB/TrEMBL;Acc:G5EG05][more]
mom-25.177e-4129.36pep chromosome:WBcel235:V:8355988:8358185:1 gene:W... [more]
mom-25.177e-4129.36pep chromosome:WBcel235:V:8355953:8358185:1 gene:W... [more]
back to top
BLAST of wntP-1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Wnt25.827e-3931.38gene:FBgn0004360 transcript:FBtr0339383[more]
Wnt29.794e-3931.38gene:FBgn0004360 transcript:FBtr0088512[more]
wg1.260e-3133.74gene:FBgn0284084 transcript:FBtr0079432[more]
Wnt51.759e-3136.92gene:FBgn0010194 transcript:FBtr0343046[more]
Wnt51.759e-3136.92gene:FBgn0010194 transcript:FBtr0074623[more]
back to top
BLAST of wntP-1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
wnt7bb1.420e-5737.62wingless-type MMTV integration site family, member... [more]
wnt7aa1.518e-5734.98wingless-type MMTV integration site family, member... [more]
wnt7bb2.690e-5737.62wingless-type MMTV integration site family, member... [more]
wnt19.429e-5633.86wingless-type MMTV integration site family, member... [more]
wnt44.750e-5534.36wingless-type MMTV integration site family, member... [more]
back to top
BLAST of wntP-1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pdgfc1.653e-5935.89platelet derived growth factor C [Source:Xenbase;A... [more]
WNT2B1.521e-5634.78Wnt family member 2B [Source:NCBI gene;Acc:1004917... [more]
WNT2B4.217e-5634.78Wnt family member 2B [Source:NCBI gene;Acc:1004917... [more]
wnt46.366e-5634.98Wnt family member 4 [Source:NCBI gene;Acc:10049128... [more]
wnt48.098e-5634.98Wnt family member 4 [Source:NCBI gene;Acc:10049128... [more]
back to top
BLAST of wntP-1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Wnt164.790e-5835.04wingless-type MMTV integration site family, member... [more]
Wnt12.195e-5732.70wingless-type MMTV integration site family, member... [more]
Wnt7b5.470e-5636.84wingless-type MMTV integration site family, member... [more]
Wnt7b6.601e-5636.84wingless-type MMTV integration site family, member... [more]
Wnt2b3.679e-5534.89wingless-type MMTV integration site family, member... [more]
back to top
BLAST of wntP-1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5E9U6|WNT16_BOVIN1.076e-5736.79Protein Wnt-16 OS=Bos taurus OX=9913 GN=WNT16 PE=2... [more]
sp|Q9QYS1|WNT16_MOUSE3.351e-5735.04Protein Wnt-16 OS=Mus musculus OX=10090 GN=Wnt16 P... [more]
sp|Q91029|WNT1_CHICK4.049e-5733.65Protein Wnt-1 OS=Gallus gallus OX=9031 GN=WNT1 PE=... [more]
sp|P04426|WNT1_MOUSE1.536e-5632.70Proto-oncogene Wnt-1 OS=Mus musculus OX=10090 GN=W... [more]
sp|P04628|WNT1_HUMAN1.874e-5632.70Proto-oncogene Wnt-1 OS=Homo sapiens OX=9606 GN=WN... [more]
back to top
BLAST of wntP-1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
B0LMF60.000e+0100.00Protein Wnt OS=Schmidtea mediterranea OX=79327 GN=... [more]
F5C3T80.000e+084.95Protein Wnt OS=Dugesia japonica OX=6161 GN=wnt-1 P... [more]
G8DNQ30.000e+084.72Protein Wnt (Fragment) OS=Dugesia japonica OX=6161... [more]
D3JSM80.000e+095.99Protein Wnt (Fragment) OS=Schmidtea polychroa OX=5... [more]
T1DF630.000e+067.47Protein Wnt OS=Dendrocoelum lacteum OX=27895 PE=2 ... [more]
back to top
BLAST of wntP-1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
wnt7aa1.114e-5635.91Wnt family member 7A [Source:NCBI gene;Acc:1030271... [more]
wnt7aa1.777e-5635.91Wnt family member 7A [Source:NCBI gene;Acc:1030271... [more]
wnt7bb1.127e-5536.68protein Wnt-7b [Source:NCBI gene;Acc:103026929][more]
wnt7bb2.593e-5536.68protein Wnt-7b [Source:NCBI gene;Acc:103026929][more]
wnt46.375e-5534.08wingless-type MMTV integration site family, member... [more]
back to top
BLAST of wntP-1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
wnt32.906e-4933.44wingless-type MMTV integration site family, member... [more]
ENSPMAT00000010914.17.524e-4832.42pep scaffold:Pmarinus_7.0:GL478525:6655:13730:-1 g... [more]
wnt14.053e-4333.33wingless-type MMTV integration site family, member... [more]
wnt10a3.132e-3430.80wingless-type MMTV integration site family, member... [more]
ENSPMAT00000001922.12.449e-3230.09pep scaffold:Pmarinus_7.0:GL482023:1913:9516:-1 ge... [more]
back to top
BLAST of wntP-1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of wntP-1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO494319.035e-6134.65Protein Wnt [Source:UniProtKB/TrEMBL;Acc:A7RGH9][more]
WNT28.143e-6037.94Protein Wnt [Source:UniProtKB/TrEMBL;Acc:A7S3E5][more]
EDO373871.112e-5733.23Protein Wnt [Source:UniProtKB/TrEMBL;Acc:A7SFU2][more]
WNT36.911e-5735.31Protein Wnt [Source:UniProtKB/TrEMBL;Acc:A7RXF5][more]
EDO310005.782e-5431.79Protein Wnt [Source:UniProtKB/TrEMBL;Acc:A7SZ54][more]
back to top
BLAST of wntP-1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
wnt17.170e-5834.48Wnt family member 1 [Source:NCBI gene;Acc:10012545... [more]
wnt11.028e-5734.48Wnt family member 1 [Source:NCBI gene;Acc:10012545... [more]
WNT7A3.361e-5736.05protein Wnt-7a [Source:NCBI gene;Acc:101174500][more]
wnt7bb5.549e-5637.15protein Wnt-7b [Source:NCBI gene;Acc:101155025][more]
wnt7bb6.838e-5637.15protein Wnt-7b [Source:NCBI gene;Acc:101155025][more]
back to top
BLAST of wntP-1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000024191.10.000e+0100.00SMESG000024191.1[more]
SMESG000067888.12.181e-5333.33SMESG000067888.1[more]
SMESG000067888.13.974e-5333.33SMESG000067888.1[more]
SMESG000002069.11.311e-4430.96SMESG000002069.1[more]
SMESG000066476.11.532e-4127.81SMESG000066476.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30008884
GenBankABY85207.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30008884 ID=SMED30008884|Name=wntP-1|organism=Schmidtea mediterranea sexual|type=transcript|length=1530bp
GGAAAGCGAATTCTTTAAATGGATGTTGGCAATCAAAACGGGGCGGGCCT
GAAATCGCCAAGGTCGAAATAACTGTCAATCACTGTGTAGTCAACATGAC
TGAGTTGAGACAGCTACCCGACTTAATCAACGTATTTTGCTGGGCCAGGC
CTGCCAATAATCAAATATCAGTCTCTCCCAGCTGACAGATCCTATTTCCC
TTATCAAGCACGTCAGCATTTATATAAAATGAAAAGTGATCCAAATATTG
CAACTAACAGCCTTCAATATGCTTTCACCAGACACCAATGGAATCAATTT
TACAGTTTTGATCCAATTAGACGTAAGCTTTATTCTCAAGAGTACAGACC
CAATTGGAAAAACTTTACCGATTTGCCTGCTAACAGTGATCTAATTCAAG
TGGCTATTGAAGGAATCAGAAAGGGTATTTACACATGTCAAAAGTTGTTT
GCCAATCATCGCTGGAACTGTCCGACACCGAATTTGAATAATCCATCCGC
CTTACTTTTTGGTGACATTATGCTCAAAGGATTTCCCGAAACCGCTTTCA
TTTATGCGATGCTTAGTGCGAGTGTCGCTCAAACTGTCGCTGAGGCTTGT
TCGTTTAAGTTATCACACTGTCCGTGCAATAATAAAGGACGGATATCTCA
AACCAACTGGATTTGGCAAGGATGTGACGACAACGTACAATTCGGTCGAA
GATTTGCGAGAAAAATGTTTGATCCAGACATTCCAGATTGGAATAAAAAG
ACATTAATGAACCTTCACAACACGGGAACGGGTAGAAGAGTTGCAGTCAA
AAGTATGAACGTGAAATGTGTATGCCAGGGCACAAGTGGATCTTGTACGA
CCAAAATTTGCCACAGAAAGGTTGCTAGTATTGACGAAATCGGTAATATT
CTTAAAGAAAAATATGAAAATGCCGTAAAGGTCGTCAAAGAAGATAGTGA
AGTTAACTTACTTGCTAATTCGCAGAAAAGAAAAACGACTAATAAAAACC
AACAATATCGTAAGGCACTCATAATTGCAAGGAAACATATTTTCATTCGA
ACAGAAAAACAATATCCATATGCTAGAGATTTAGTTTATTTAGAAGATGT
TCCAAAAAACTTTTATTGTGATTCAAAACCCGAATGGCACATTCTGGGCA
CGACGGGGAGAGTTTGCAATTCTTTGTCAAATTCGACTGACAGTTGCAAT
AATCTTTGCTGCAACCGACCTTTCCTAACAAGATCTAAAACAATAATGGA
AAATTGTAATTGCAAATTCATTTGGTGTTGCAAAGTTGAATGTCAACAGT
GTCAAAAAAGAATTTTTATTGAAACATGCCAATAATAATAATAACAAGAA
AAACAAATCGTAACAAACGTCACAGTCAAATTTTATTATAGAAAATTATT
TTCATTTAAATTCTTTTATTTAGAGTTGTGGAATTTTATTTTTGTCCCAA
AGAAATTTATAAATTCAGCAACAATTAAATTTGCTTGTTTTATCAGGGCT
TCATATTTTTATGATTGTATGTTAAAATAC
back to top

protein sequence of SMED30008884-orf-1

>SMED30008884-orf-1 ID=SMED30008884-orf-1|Name=SMED30008884-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=369bp
MKSDPNIATNSLQYAFTRHQWNQFYSFDPIRRKLYSQEYRPNWKNFTDLP
ANSDLIQVAIEGIRKGIYTCQKLFANHRWNCPTPNLNNPSALLFGDIMLK
GFPETAFIYAMLSASVAQTVAEACSFKLSHCPCNNKGRISQTNWIWQGCD
DNVQFGRRFARKMFDPDIPDWNKKTLMNLHNTGTGRRVAVKSMNVKCVCQ
GTSGSCTTKICHRKVASIDEIGNILKEKYENAVKVVKEDSEVNLLANSQK
RKTTNKNQQYRKALIIARKHIFIRTEKQYPYARDLVYLEDVPKNFYCDSK
PEWHILGTTGRVCNSLSNSTDSCNNLCCNRPFLTRSKTIMENCNCKFIWC
CKVECQQCQKRIFIETCQ*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000032dorsal midline
PLANA:0000418head
PLANA:0000421tail
PLANA:0007525posterior pole
Vocabulary: INTERPRO
TermDefinition
IPR043158Wnt_C
IPR005817Wnt
Vocabulary: biological process
TermDefinition
GO:0007275multicellular organism development
GO:0016055Wnt signaling pathway
Vocabulary: molecular function
TermDefinition
GO:0005102signaling receptor binding
Vocabulary: cellular component
TermDefinition
GO:0005576extracellular region
GO:0005578proteinaceous extracellular matrix
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR005817WntPRINTSPR01349WNTPROTEINcoord: 284..295
score: 45.22
coord: 144..156
score: 53.34
coord: 198..212
score: 54.21
coord: 103..117
score: 50.38
IPR005817WntSMARTSM00097wnt1_3coord: 45..368
e-value: 2.1E-68
score: 243.2
IPR005817WntPFAMPF00110wntcoord: 52..368
e-value: 4.8E-84
score: 282.6
IPR005817WntPANTHERPTHR12027WNT RELATEDcoord: 50..367
IPR043158Wnt, C-terminal domainGENE3DG3DSA:3.30.2460.20coord: 308..368
e-value: 4.1E-11
score: 44.8
NoneNo IPR availablePANTHERPTHR12027:SF91PROTO-ONCOGENE WNT-1coord: 50..367