Cilia and flagella associated protein 157

Overview
NameCilia and flagella associated protein 157
Smed IDSMED30008882
Length (bp)1644
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Cilia and flagella associated protein 157 (SMED30008882) t-SNE clustered cells

Violin plots show distribution of expression levels for Cilia and flagella associated protein 157 (SMED30008882) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Cilia and flagella associated protein 157 (SMED30008882) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Cilia and flagella associated protein 157 (SMED30008882) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30008882

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 13

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30008882h1SMcG0014004 SmedASXL_014549SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
Smed sexual biotypeSMED30008882h1SMcG0014004 Contig48692newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30008882h1SMcG0014004 Contig48692uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
pharynxSMED30008882h1SMcG0014004 dd_Smed_v4_9862_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30008882h1SMcG0014004 dd_Smed_v4_9862_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30008882h1SMcG0014004 dd_Smed_v4_9862_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30008882h1SMcG0014004 dd_Smed_v4_9862_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30008882h1SMcG0014004 dd_Smed_v4_9862_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30008882h1SMcG0014004 dd_Smed_v4_9862_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
cilated neuronSMED30008882h1SMcG0014004 dd_Smed_v4_9862_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30008882h1SMcG0014004 dd_Smed_v6_9862_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30008882h1SMcG0014004 dd_Smed_v4_9862_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ciliated epithelial cellSMED30008882h1SMcG0014004 dd_Smed_v4_9862_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Cilia and flagella associated protein 157 vs. Ensembl Human
Match: CFAP157 (cilia and flagella associated protein 157 [Source:HGNC Symbol;Acc:HGNC:27843])

HSP 1 Score: 174.481 bits (441), Expect = 3.047e-48
Identity = 101/244 (41.39%), Postives = 161/244 (65.98%), Query Frame = 3
Query:  123 PLEDLAPKLSAEHKDNFLIQVKDLEKQIAYYQRKCDYLEIINDKFDSEFNQTNENKQDISEHLDILLRIRVDEITKLNSELTKLQELRDQEKAAFEQQIQQKKVEFEETIEQLTSDKRIKSGQLASMEEFKVQKEDLMMKFTELQEEINKLEDFNKEEIYQKERSNVVDMDRLKKETISRVNNVSSEFRKVSNRQMAETNKKTIRENVELSNMIKKRSEKTMELIEENDKLRAIDNENKRQIEI 854
            P+  + P L+ E K+ + IQ++DLE ++A YQRK D L +    F  EF Q   NK++I   L   L  +VDEIT LN +L  LQ  ++ EK AFE Q+ Q + EF+ET +QLT++  I  G+LA++EEF++QKE++  KFT L+E++ K E+  ++  Y  E+ +V+D DRL+KE I RVN V++EF KV+  +M ET K+ I+EN  ++  + + S++ M+L++EN++L+   N   +Q+E+
Sbjct:   25 PVVAVEPPLAKEMKEFYHIQIRDLEDRLARYQRKWDELAVQEKMFRQEFEQLANNKKEIVAFLKRTLNQQVDEITDLNEQLQNLQLAKEMEKDAFEAQLAQVRHEFQETKDQLTTENIILGGKLAALEEFRLQKEEVTDKFTLLEEQVRKQENEFRDYAYNLEKKSVLDKDRLRKEIIQRVNLVANEFHKVTTNRMWETTKRAIKENNGITLQMARVSQQGMKLLQENEQLKGRQNNLCKQLEL 268          
BLAST of Cilia and flagella associated protein 157 vs. Ensembl Human
Match: CFAP157 (cilia and flagella associated protein 157 [Source:HGNC Symbol;Acc:HGNC:27843])

HSP 1 Score: 174.096 bits (440), Expect = 2.721e-47
Identity = 101/244 (41.39%), Postives = 161/244 (65.98%), Query Frame = 3
Query:  123 PLEDLAPKLSAEHKDNFLIQVKDLEKQIAYYQRKCDYLEIINDKFDSEFNQTNENKQDISEHLDILLRIRVDEITKLNSELTKLQELRDQEKAAFEQQIQQKKVEFEETIEQLTSDKRIKSGQLASMEEFKVQKEDLMMKFTELQEEINKLEDFNKEEIYQKERSNVVDMDRLKKETISRVNNVSSEFRKVSNRQMAETNKKTIRENVELSNMIKKRSEKTMELIEENDKLRAIDNENKRQIEI 854
            P+  + P L+ E K+ + IQ++DLE ++A YQRK D L +    F  EF Q   NK++I   L   L  +VDEIT LN +L  LQ  ++ EK AFE Q+ Q + EF+ET +QLT++  I  G+LA++EEF++QKE++  KFT L+E++ K E+  ++  Y  E+ +V+D DRL+KE I RVN V++EF KV+  +M ET K+ I+EN  ++  + + S++ M+L++EN++L+   N   +Q+E+
Sbjct:   25 PVVAVEPPLAKEMKEFYHIQIRDLEDRLARYQRKWDELAVQEKMFRQEFEQLANNKKEIVAFLKRTLNQQVDEITDLNEQLQNLQLAKEMEKDAFEAQLAQVRHEFQETKDQLTTENIILGGKLAALEEFRLQKEEVTDKFTLLEEQVRKQENEFRDYAYNLEKKSVLDKDRLRKEIIQRVNLVANEFHKVTTNRMWETTKRAIKENNGITLQMARVSQQGMKLLQENEQLKGRQNNLCKQLEL 268          
BLAST of Cilia and flagella associated protein 157 vs. Ensembl Fly
Match: CG17122 (gene:FBgn0036962 transcript:FBtr0074849)

HSP 1 Score: 81.6481 bits (200), Expect = 4.826e-16
Identity = 62/216 (28.70%), Postives = 119/216 (55.09%), Query Frame = 3
Query:  135 LAPKLSAEHKD-NFLIQV---------KDLEKQIAYYQRKCDYLEIINDKFDSEFNQTNENKQDISEHLDILLRIRVDEITKLNSELTKLQELRDQEKAAFEQQIQQKKVEFEETIEQLTSDKRIKSGQLASMEEFKVQKEDLMMKFTELQEEINKLEDFNKEEIYQKERSNVVDMDRLKKETISRVNNVSSEFRKVSNRQMAETNKKTIRENVEL 752
            + PK+  E KD N + QV          DL +++A  +     ++  N     +  +   +  D++ HL+  L  R + IT+L   L ++ ++RD E    +++I   + +++   +QLTS+ ++ +G+L S++EF++Q++ L+ KF E + ++N+ E  +KE +Y  E+  VV+ D LKKE   ++  VS +F + S  + A   ++ IREN+ L
Sbjct:    1 MPPKVKKEKKDVNKVTQVDRTFYELTITDLNQKLARLRSHVTTVDESNITLTEKLKEVEADGVDVAAHLERTLAERNNSITELEERLVEITKVRDVENRVAQEKIGDLESKYKAMHDQLTSEIKLLNGKLNSLDEFRIQRDVLLAKFDEQEADLNEREKDHKEALYNMEQRAVVEKDALKKEVEQKLLQVSEDFTRSSEIRNAGYTRRLIRENIAL 216          
BLAST of Cilia and flagella associated protein 157 vs. Ensembl Zebrafish
Match: cfap157 (cilia and flagella associated protein 157 [Source:NCBI gene;Acc:794225])

HSP 1 Score: 156.377 bits (394), Expect = 1.842e-41
Identity = 126/398 (31.66%), Postives = 225/398 (56.53%), Query Frame = 3
Query:  138 APKLSAEHKDNFLIQVKDLEKQIAYYQRKCDYLEIINDKFDSEFNQTNENKQDISEHLDILLRIRVDEITKLNSELTKLQELRDQEKAAFEQQIQQKKVEFEETIEQLTSDKRIKSGQLASMEEFKVQKEDLMMKFTELQEEINKLEDFNKEEIYQKERSNVVDMDRLKKETISRVNNVSSEFRKVSNRQMAETNKKTIRENVELSNMIKKRSEKTMELIEENDKLRAIDNENKRQIEISLTVEKELMXXXXXXXXXXXYWVEECRNNEMEVSQFESEEHRAHAEFVQSENKSLISDFDSQMEKYQYI---------EIEKNKLQLEQENIKSDILSSKNTLKIHKRLVNKTKNALIDAENLMDPSEEFTEGEVILRRQAMLSSLLELMNSAAVLGFG 1304
            A +L+   K  +  Q++DLE+++  YQ KCD LE+      S+ N   + K+DI   L   L  + D++  L   L++ Q+ ++ E+ +FE Q+   + E +E  E+ TS+    +G+LAS+EEF  Q+E L+ +   L+E++ K ++ ++ EIY  E+  V+D DRLKKE +  V  V++EFR+VS+ +M ET  + ++EN+ ++  +++ SEKT EL++END LRA + + KR+  I+  +  E+ KK+  N K +    E+C+  + EV +  ++  + H E +   + ++ ++ +   +K+  +         E+E+ K +LE+E   S + +  NT  + +      K AL D      P EE +E +V +RR  M+  LL +++ AA LG G
Sbjct:   28 AEELTESDKKFYQAQIRDLEERLERYQLKCDELEVQEKDLSSKINNVEKEKKDIVLFLKRTLAKKEDKLNDLAETLSRHQQAQEAERESFESQLSLLRRELQENKEKYTSENMTLAGKLASLEEFSTQRETLIAERRSLEEQLRKQKEDHQAEIYNLEKKAVLDNDRLKKEMLQHVATVAAEFRRVSDEKMPETTLRAMQENLSVTAQLQQLSEKTKELLKENDALRARERQLKRENGITEPLLHEITKKSVANQKVVLQLTEKCKQMQSEVEKC-TKLKQDHQELLDIHS-AVCTEIEDLRKKHAAVTEDLNQTKAEVERQKKELEEE---SRMRAQINT--VLEEAAVALKEALRDV-----PEEEDSELKVTVRRSQMMQKLLAVLDGAAALGKG 413          
BLAST of Cilia and flagella associated protein 157 vs. Ensembl Zebrafish
Match: cfap157 (cilia and flagella associated protein 157 [Source:NCBI gene;Acc:794225])

HSP 1 Score: 148.288 bits (373), Expect = 1.469e-38
Identity = 121/398 (30.40%), Postives = 221/398 (55.53%), Query Frame = 3
Query:  138 APKLSAEHKDNFLIQVKDLEKQIAYYQRKCDYLEIINDKFDSEFNQTNENKQDISEHLDILLRIRVDEITKLNSELTKLQELRDQEKAAFEQQIQQKKVEFEETIEQLTSDKRIKSGQLASMEEFKVQKEDLMMKFTELQEEINKLEDFNKEEIYQKERSNVVDMDRLKKETISRVNNVSSEFRKVSNRQMAETNKKTIRENVELSNMIKKRSEKTMELIEENDKLRAIDNENKRQIEISLTVEKELMXXXXXXXXXXXYWVEECRNNEMEVSQFESEEHRAHAEFVQSENKSLISDFDSQMEKYQYI---------EIEKNKLQLEQENIKSDILSSKNTLKIHKRLVNKTKNALIDAENLMDPSEEFTEGEVILRRQAMLSSLLELMNSAAVLGFG 1304
            A +L+   K  +  Q++DLE+++  YQ KCD LE+      S+ N   + K+DI   L   L  + D++  L   L++ Q+ ++ E+ +FE Q+   + E +E  E+ TS+    +G+LAS+EEF  Q+E L+ +   L+E++ K ++ ++ EIY  E+  V+D DRLKKE +  V  V++EFR+VS+ +M E   + ++EN+ ++  +++ SEKT +L++END LRA + + KR+ +I+  +  E+ KK+  N K +    E+C+  + EV +  ++  + H E +   + ++ ++ +   +K+  +         E+E+ K +LE+E   S + +  NT+        K     +       P EE  E +V +RR  M+  LL +++ AA LG G
Sbjct:   28 AEELTESDKKFYRAQIRDLEERLERYQLKCDELEVQEKDLSSKINNVEKEKKDIVLFLKRTLAKKEDKLNDLAETLSRHQQAQEAERESFESQLSLLRRELQENKEKYTSENMTLAGKLASLEEFSTQRETLIAERRSLEEQLRKQKEDHQAEIYNLEKKAVLDNDRLKKEMLQHVAAVAAEFRRVSDEKMPEMTLRAMQENLSVTAQLQQLSEKTKKLLKENDALRARERQLKRENDITEPLLHEITKKSVANQKVVLQLTEKCKQMQSEVEKC-TKLKQDHQELLDIHS-AVCTEIEDLRKKHAAVTEDLNQTKAEVERQKKELEEE---SRMRAQINTVLEEAAAALKEALRDV-------PEEEDCELKVTVRRSQMMQKLLAVLDGAAALGKG 413          
BLAST of Cilia and flagella associated protein 157 vs. Ensembl Xenopus
Match: cfap157 (cilia and flagella associated protein 157 [Source:NCBI gene;Acc:780234])

HSP 1 Score: 184.882 bits (468), Expect = 3.183e-51
Identity = 147/397 (37.03%), Postives = 237/397 (59.70%), Query Frame = 3
Query:  162 KDNFLIQVKDLEKQIAYYQRKCDYLEIINDKFDSEFNQTNENKQDISEHLDILLRIRVDEITKLNSELTKLQELRDQEKAAFEQQIQQKKVEFEETIEQLTSDKRIKSGQLASMEEFKVQKEDLMMKFTELQEEINKLEDFNKEEIYQKERSNVVDMDRLKKETISRVNNVSSEFRKVSNRQMAETNKKTIRENVELSNMIKKRSEKTMELIEENDKLRAIDNENKRQIEISLTVEKELMXXXXXXXXXXXYWVEECRNNEMEVSQFESEEHRAHAEFVQSENKSLISDFDSQMEKYQYIEIEKNKLQLEQENIKSDILSSKN-TLKIHKRLVNKTKNALIDAENLMDPSEEFTEGEVILRRQAMLSSLLELMNSAAVLGFGLQPREL-GKQHRSIK 1346
            KD + +Q++DLEK++  YQ K D +       ++++ Q + +K++I   L   L  R+DEI  LN +L  LQ+ +D EK A+E Q+ Q + E ++T E+LTS+  + +G+LAS+EEF+VQKE+LM KF  L+E++ + E  +KE +Y  E+  V+D DRLKKE + RV+ V++EFR+VSN QMAET K+ IRENV +S  + K S+K++ELI END L+  ++E  +Q+E+    EKEL+K N  N K I+   ++C+  +  ++  E  +H  +   +QS++ +L  +     +K   +E +  ++  E+E +   +   K  TL +   ++     A +    L   SE+ TEG  + RR  ML  L  L++S+A LG G    E   KQ  S+K
Sbjct:   33 KDFYTVQIRDLEKRLERYQSKWDEICAKEQLKEAQYEQLSNDKKEIVSFLKRTLNQRMDEIADLNDQLLGLQQAKDAEKDAYESQLTQVRHELQDTKERLTSENMLLAGKLASLEEFRVQKEELMGKFAALEEKVKEQEQEHKEAMYILEKKVVLDKDRLKKEMVQRVSTVAAEFRRVSNNQMAETTKRAIRENVSISLQLDKMSDKSIELISENDLLKDRNSELTKQLEMLEENEKELVKNNLSNQKVIRMLTDKCQQQQEILTLLEHTQHALNE--LQSQHHNLKDESQQLKQKLVSLEDDLQRVTQEKEGLSRQLEEEKQRTLAVD--MILSQAAAFLKDMLLQTHSEDETEGMQLERRNKMLQQLQLLLDSSATLGLGSSLHEFETKQGHSLK 425          
BLAST of Cilia and flagella associated protein 157 vs. Ensembl Mouse
Match: Cfap157 (cilia and flagella associated protein 157 [Source:MGI Symbol;Acc:MGI:2447809])

HSP 1 Score: 156.377 bits (394), Expect = 5.538e-41
Identity = 96/241 (39.83%), Postives = 155/241 (64.32%), Query Frame = 3
Query:  138 APKLSA--EHKDNFLIQVKDLEKQIAYYQRKCDYLEIINDKFDSEFNQTNENKQDISEHLDILLRIRVDEITKLNSELTKLQELRDQEKAAFEQQIQQKKVEFEETIEQLTSDKRIKSGQLASMEEFKVQKEDLMMKFTELQEEINKLEDFNKEEIYQKERSNVVDMDRLKKETISRVNNVSSEFRKVSNRQMAETNKKTIRENVELSNMIKKRSEKTMELIEENDKLRAIDNENKRQIEI 854
             P+L+   E K+ +  Q++DLE ++A YQRK D L +    F  EF Q   NK++I   L   L  +VDEIT LN +L  L+  +D EK AFE Q+ Q + EF+E  +QLT++      +L+S+EEF++QKE+L  K+  L+E++++ E   KE +Y  E+ +V+D DRL+KE I RVN V++EFRK++  QM ET ++ I EN  ++  + K S+  ++L++EN++L+   N+  +Q+E+
Sbjct:   30 TPELAMVEELKEFYHKQIQDLEDRLARYQRKWDELAVREKLFHQEFEQLANNKKEIVAFLKRTLNQKVDEITDLNDQLQSLEVAKDMEKDAFEAQLAQVRHEFQEIKDQLTTENIALGIKLSSLEEFRLQKEELTEKYLALEEQLHRQEGEYKEYVYNLEKKSVLDKDRLRKEIIQRVNLVATEFRKMATNQMWETTRRAILENNSVTLQLNKVSKHGVQLLQENEQLKGTQNKLCQQLEM 270          
BLAST of Cilia and flagella associated protein 157 vs. UniProt/SwissProt
Match: sp|Q0VFN8|CF157_XENTR (Cilia- and flagella-associated protein 157 OS=Xenopus tropicalis OX=8364 GN=cfap157 PE=2 SV=1)

HSP 1 Score: 185.652 bits (470), Expect = 6.551e-51
Identity = 148/397 (37.28%), Postives = 239/397 (60.20%), Query Frame = 3
Query:  162 KDNFLIQVKDLEKQIAYYQRKCDYLEIINDKFDSEFNQTNENKQDISEHLDILLRIRVDEITKLNSELTKLQELRDQEKAAFEQQIQQKKVEFEETIEQLTSDKRIKSGQLASMEEFKVQKEDLMMKFTELQEEINKLEDFNKEEIYQKERSNVVDMDRLKKETISRVNNVSSEFRKVSNRQMAETNKKTIRENVELSNMIKKRSEKTMELIEENDKLRAIDNENKRQIEISLTVEKELMXXXXXXXXXXXYWVEECRNNEMEVSQFESEEHRAHAEFVQSENKSLISDFDSQMEKYQYIEIEKNKLQLEQENIKSDILSSKN-TLKIHKRLVNKTKNALIDAENLMDPSEEFTEGEVILRRQAMLSSLLELMNSAAVLGFGLQPREL-GKQHRSIK 1346
            KD + +Q++DLEK++  YQ K D +       ++++ Q + +K++I   L   L  R+DEI  LN +L  LQ+ +D EK A+E Q+ Q + E ++T E+LTS+  + +G+LAS+EEF+VQKE+LM KF  L+E++ + E  +KE +Y  E+  V+D DRLKKE + RV+ V++EFR+VSN QMAET K+ IRENV +S  + K S+K++ELI END L+  ++E  +Q+E+    EKEL+K N  N K I+   ++C+  +  ++  E  +H  +   +QS++ +L  +     +K   +E +  ++  E+E +   +   K  TL +   L   ++ A    + L+  SE+ TEG  + RR  ML  L  L++S+A LG G    E   KQ  S+K
Sbjct:   33 KDFYTVQIRDLEKRLERYQSKWDEICAKEQLKEAQYEQLSNDKKEIVSFLKRTLNQRMDEIADLNDQLLGLQQAKDAEKDAYESQLTQVRHELQDTKERLTSENMLLAGKLASLEEFRVQKEELMGKFAALEEKVKEQEQEHKEAMYILEKKVVLDKDRLKKEMVQRVSTVAAEFRRVSNNQMAETTKRAIRENVSISLQLDKMSDKSIELISENDLLKDRNSELTKQLEMLEENEKELVKNNLSNQKVIRMLTDKCQQQQEILTLLEHTQHALNE--LQSQHHNLKDESQQLKQKLVSLEDDLQRVTQEKEGLSRQLEEEKQRTLAVDMIL---SQAAAFLKDMLLTHSEDETEGMQLERRNKMLQQLQLLLDSSATLGLGSSLHEFETKQGHSLK 424          
BLAST of Cilia and flagella associated protein 157 vs. UniProt/SwissProt
Match: sp|Q5JU67|CF157_HUMAN (Cilia- and flagella-associated protein 157 OS=Homo sapiens OX=9606 GN=CFAP157 PE=2 SV=1)

HSP 1 Score: 174.096 bits (440), Expect = 1.307e-46
Identity = 101/244 (41.39%), Postives = 161/244 (65.98%), Query Frame = 3
Query:  123 PLEDLAPKLSAEHKDNFLIQVKDLEKQIAYYQRKCDYLEIINDKFDSEFNQTNENKQDISEHLDILLRIRVDEITKLNSELTKLQELRDQEKAAFEQQIQQKKVEFEETIEQLTSDKRIKSGQLASMEEFKVQKEDLMMKFTELQEEINKLEDFNKEEIYQKERSNVVDMDRLKKETISRVNNVSSEFRKVSNRQMAETNKKTIRENVELSNMIKKRSEKTMELIEENDKLRAIDNENKRQIEI 854
            P+  + P L+ E K+ + IQ++DLE ++A YQRK D L +    F  EF Q   NK++I   L   L  +VDEIT LN +L  LQ  ++ EK AFE Q+ Q + EF+ET +QLT++  I  G+LA++EEF++QKE++  KFT L+E++ K E+  ++  Y  E+ +V+D DRL+KE I RVN V++EF KV+  +M ET K+ I+EN  ++  + + S++ M+L++EN++L+   N   +Q+E+
Sbjct:   25 PVVAVEPPLAKEMKEFYHIQIRDLEDRLARYQRKWDELAVQEKMFRQEFEQLANNKKEIVAFLKRTLNQQVDEITDLNEQLQNLQLAKEMEKDAFEAQLAQVRHEFQETKDQLTTENIILGGKLAALEEFRLQKEEVTDKFTLLEEQVRKQENEFRDYAYNLEKKSVLDKDRLRKEIIQRVNLVANEFHKVTTNRMWETTKRAIKENNGITLQMARVSQQGMKLLQENEQLKGRQNNLCKQLEL 268          
BLAST of Cilia and flagella associated protein 157 vs. UniProt/SwissProt
Match: sp|A2BDR7|CF157_DANRE (Cilia- and flagella-associated protein 157 OS=Danio rerio OX=7955 GN=cfap157 PE=2 SV=1)

HSP 1 Score: 156.377 bits (394), Expect = 1.390e-40
Identity = 126/398 (31.66%), Postives = 225/398 (56.53%), Query Frame = 3
Query:  138 APKLSAEHKDNFLIQVKDLEKQIAYYQRKCDYLEIINDKFDSEFNQTNENKQDISEHLDILLRIRVDEITKLNSELTKLQELRDQEKAAFEQQIQQKKVEFEETIEQLTSDKRIKSGQLASMEEFKVQKEDLMMKFTELQEEINKLEDFNKEEIYQKERSNVVDMDRLKKETISRVNNVSSEFRKVSNRQMAETNKKTIRENVELSNMIKKRSEKTMELIEENDKLRAIDNENKRQIEISLTVEKELMXXXXXXXXXXXYWVEECRNNEMEVSQFESEEHRAHAEFVQSENKSLISDFDSQMEKYQYI---------EIEKNKLQLEQENIKSDILSSKNTLKIHKRLVNKTKNALIDAENLMDPSEEFTEGEVILRRQAMLSSLLELMNSAAVLGFG 1304
            A +L+   K  +  Q++DLE+++  YQ KCD LE+      S+ N   + K+DI   L   L  + D++  L   L++ Q+ ++ E+ +FE Q+   + E +E  E+ TS+    +G+LAS+EEF  Q+E L+ +   L+E++ K ++ ++ EIY  E+  V+D DRLKKE +  V  V++EFR+VS+ +M ET  + ++EN+ ++  +++ SEKT EL++END LRA + + KR+  I+  +  E+ KK+  N K +    E+C+  + EV +  ++  + H E +   + ++ ++ +   +K+  +         E+E+ K +LE+E   S + +  NT  + +      K AL D      P EE +E +V +RR  M+  LL +++ AA LG G
Sbjct:   28 AEELTESDKKFYQAQIRDLEERLERYQLKCDELEVQEKDLSSKINNVEKEKKDIVLFLKRTLAKKEDKLNDLAETLSRHQQAQEAERESFESQLSLLRRELQENKEKYTSENMTLAGKLASLEEFSTQRETLIAERRSLEEQLRKQKEDHQAEIYNLEKKAVLDNDRLKKEMLQHVATVAAEFRRVSDEKMPETTLRAMQENLSVTAQLQQLSEKTKELLKENDALRARERQLKRENGITEPLLHEITKKSVANQKVVLQLTEKCKQMQSEVEKC-TKLKQDHQELLDIHS-AVCTEIEDLRKKHAAVTEDLNQTKAEVERQKKELEEE---SRMRAQINT--VLEEAAVALKEALRDV-----PEEEDSELKVTVRRSQMMQKLLAVLDGAAALGKG 413          
BLAST of Cilia and flagella associated protein 157 vs. UniProt/SwissProt
Match: sp|Q4V7B0|CF157_RAT (Cilia- and flagella-associated protein 157 OS=Rattus norvegicus OX=10116 GN=Cfap157 PE=1 SV=2)

HSP 1 Score: 157.532 bits (397), Expect = 1.474e-40
Identity = 97/241 (40.25%), Postives = 155/241 (64.32%), Query Frame = 3
Query:  138 APKLSA--EHKDNFLIQVKDLEKQIAYYQRKCDYLEIINDKFDSEFNQTNENKQDISEHLDILLRIRVDEITKLNSELTKLQELRDQEKAAFEQQIQQKKVEFEETIEQLTSDKRIKSGQLASMEEFKVQKEDLMMKFTELQEEINKLEDFNKEEIYQKERSNVVDMDRLKKETISRVNNVSSEFRKVSNRQMAETNKKTIRENVELSNMIKKRSEKTMELIEENDKLRAIDNENKRQIEI 854
             P+L+   E K+ +  Q++DLE ++A YQRK D L +    F  EF Q   NK++I   L   L  RVDEIT LN +L  LQ  ++ EK AFE Q+ Q + EF+ET +QLT++      +L+S+EEF++QKE+L  K+  L+E++ + E   K+ +Y  E+ +V+D DRL+KE I RVN V++EFRKV+  QM ET ++ I EN  ++  + K S++ ++L++EN++L+    +  +Q+E+
Sbjct:   31 TPELAMVEELKEFYHKQIQDLEDRLARYQRKWDELAVQEKLFRQEFEQLANNKKEIVAFLKRTLNQRVDEITDLNDQLQSLQVAKEMEKDAFEAQLAQVRHEFQETKDQLTTENIALGIKLSSLEEFRLQKEELTEKYMALEEQLRRQEGEYKDYVYNLEKKSVLDKDRLRKEIIQRVNLVATEFRKVATNQMWETTRRAILENNNVTLQLSKVSKQGVQLLQENEQLKGAQGKLCQQLEL 271          
BLAST of Cilia and flagella associated protein 157 vs. UniProt/SwissProt
Match: sp|Q0VFX2|CF157_MOUSE (Cilia- and flagella-associated protein 157 OS=Mus musculus OX=10090 GN=Cfap157 PE=1 SV=1)

HSP 1 Score: 156.377 bits (394), Expect = 3.874e-40
Identity = 96/241 (39.83%), Postives = 155/241 (64.32%), Query Frame = 3
Query:  138 APKLSA--EHKDNFLIQVKDLEKQIAYYQRKCDYLEIINDKFDSEFNQTNENKQDISEHLDILLRIRVDEITKLNSELTKLQELRDQEKAAFEQQIQQKKVEFEETIEQLTSDKRIKSGQLASMEEFKVQKEDLMMKFTELQEEINKLEDFNKEEIYQKERSNVVDMDRLKKETISRVNNVSSEFRKVSNRQMAETNKKTIRENVELSNMIKKRSEKTMELIEENDKLRAIDNENKRQIEI 854
             P+L+   E K+ +  Q++DLE ++A YQRK D L +    F  EF Q   NK++I   L   L  +VDEIT LN +L  L+  +D EK AFE Q+ Q + EF+E  +QLT++      +L+S+EEF++QKE+L  K+  L+E++++ E   KE +Y  E+ +V+D DRL+KE I RVN V++EFRK++  QM ET ++ I EN  ++  + K S+  ++L++EN++L+   N+  +Q+E+
Sbjct:   30 TPELAMVEELKEFYHKQIQDLEDRLARYQRKWDELAVREKLFHQEFEQLANNKKEIVAFLKRTLNQKVDEITDLNDQLQSLEVAKDMEKDAFEAQLAQVRHEFQEIKDQLTTENIALGIKLSSLEEFRLQKEELTEKYLALEEQLHRQEGEYKEYVYNLEKKSVLDKDRLRKEIIQRVNLVATEFRKMATNQMWETTRRAILENNSVTLQLNKVSKHGVQLLQENEQLKGTQNKLCQQLEM 270          
BLAST of Cilia and flagella associated protein 157 vs. TrEMBL
Match: A0A1S3H860 (cilia- and flagella-associated protein 157 isoform X1 OS=Lingula unguis OX=7574 GN=LOC106152964 PE=4 SV=1)

HSP 1 Score: 261.151 bits (666), Expect = 3.404e-76
Identity = 175/410 (42.68%), Postives = 251/410 (61.22%), Query Frame = 3
Query:  162 KDNFLIQVKDLEKQIAYYQRKCDYLEIINDKFDSEFNQTNENKQDISEHLDILLRIRVDEITKLNSELTKLQELRDQEKAAFEQQIQQKKVEFEETIEQLTSDKRIKSGQLASMEEFKVQKEDLMMKFTELQEEINKLEDFNKEEIYQKERSNVVDMDRLKKETISRVNNVSSEFRKVSNRQMAETNKKTIRENVELSNMIKKRSEKTMELIEENDKLRAIDNENKRQIEISLTVEKELMXXXXXXXXXXXYWVEECRNNEMEVSQFESEEH------------RAHAEFVQSENKSLIS-----DFDSQMEKYQYIEIEKNKLQLEQENIKSDILSSKN-TLKIHKRLVNKTKNALIDAENLMDPSEEFTEGEVILRRQAMLSSLLELMNSAAVLGFGLQPRELGKQHR 1337
            K+ FL+Q++DLE ++  YQRKCD L + N K+  ++NQ    K+DI E L   L  + DEI  LN  L  LQ+L+D EK  +E+Q+ Q K +++ET +QLTSD  I +G+L+S+EEFKVQKEDLM KF  L+ E+ + +   K  IY  ER +VVD DRLKK+ + RVNNV++EFRKVSN+QMAET K+TIRENV ++  ++K S+KTMELI+END  R  + + ++QI++  T EKEL KKN+ N+K I+   E+C++ E  +++FE  E             R   E  + E +SL       D D Q  + Q  E  KNK +LE+      ILS     LK+   +++ T  A  D ++ +D +E       + +R  ML  LL ++NSAA LG G  P  +GKQ +
Sbjct:   38 KEFFLVQIRDLENRLVRYQRKCDELGVQNSKYQDDYNQEKREKKDIIEFLKKSLETKTDEIADLNDRLVGLQQLKDSEKEEYEKQLNQLKADYQETKDQLTSDNLILAGKLSSLEEFKVQKEDLMQKFANLEAELERQQKEFKNTIYDMERKSVVDKDRLKKDMVIRVNNVAAEFRKVSNKQMAETTKRTIRENVAINAQLQKMSDKTMELIQENDDFRGKEKKQRQQIDMLETNEKELAKKNHSNLKVIRMLTEKCKSQEAMIAEFELREQEYQEMESEVDLLRQQVESSRDEIQSLAKENEQLDTDLQSNQQQLRETSKNKKKLEK------ILSDAALALKL---VLSNTGEAWGDEDHRVDLNE-------VEKRDNMLEHLLVILNSAAALGVGPDPSAMGKQFK 431          
BLAST of Cilia and flagella associated protein 157 vs. TrEMBL
Match: A0A0B6ZCN1 (Uncharacterized protein OS=Arion vulgaris OX=1028688 GN=ORF58026 PE=4 SV=1)

HSP 1 Score: 253.447 bits (646), Expect = 2.441e-73
Identity = 166/405 (40.99%), Postives = 257/405 (63.46%), Query Frame = 3
Query:  138 APKLSAEHKDNFLIQVKDLEKQIAYYQRKCDYLEIINDKFDSEFNQTNENKQDISEHLDILLRIRVDEITKLNSELTKLQELRDQEKAAFEQQIQQKKVEFEETIEQLTSDKRIKSGQLASMEEFKVQKEDLMMKFTELQEEINKLEDFNKEEIYQKERSNVVDMDRLKKETISRVNNVSSEFRKVSNRQMAETNKKTIRENVELSNMIKKRSEKTMELIEENDKLRAIDNENKRQIEISLTVEKELMXXXXXXXXXXXYWVEECRNNEMEVSQFESEEHRAHAEF--VQSENKSLISDFDSQMEKYQYIEIEKNKLQLEQENI-KSDILSSKNTLKIHKRLVNKTKNALIDAENLMDPSEEFTEGEVIL----RRQAMLSSLLELMNSAAVLGFGLQPRELGKQ 1331
            APK+  E K+  ++Q++DLEK++A YQ++CD LE+ N +F  +F Q   +K++I       L  + DEI  L      LQ+ RD E+  F++QIQ+ + E++E  +QL+++  I  G+LAS+EEFKVQKEDLM KF  ++EE+ + E  +KE IY  E+  V+D DRLKKE I RVN V++EFRKVSN+QMAET K+TIRENV +S  + K S+KT+ELI+END LR  +   K++IE+     KEL KKNN ++K I+   ++C++ E  ++ FE ++    ++F  ++ E ++L        E+ Q + IE   L+LE++   +  ++ SK   KI + L+ +  +++  A     P +E  + + ++    +R  ML SLL L+NSAA LG G +P+ELGKQ
Sbjct:   31 APKVGEETKEFLILQIQDLEKRLARYQKRCDELEVANGQFHDKFEQMATDKKEIVAFWKKQLEQKTDEIADLTDRHIGLQQTRDNERETFKKQIQELRTEYQEMKDQLSAENMILGGKLASLEEFKVQKEDLMAKFAMMEEEVARKEAEHKENIYLMEKKAVMDKDRLKKEMILRVNQVAAEFRKVSNKQMAETTKRTIRENVSISAQLAKMSDKTIELIQENDDLREKERTFKQKIELLDASSKELSKKNNSSLKLIRMITDKCKDQEAVINHFEMKQ----SDFKELEVEAETLHHQVAIMSEQLQNLTIENTTLELEKKQCEEKHLIESKTKTKIEEVLI-EAADSIQKALTSTAPDDEDIDEDTMINNLRKRDHMLESLLVLLNSAAALGVGPKPKELGKQ 430          
BLAST of Cilia and flagella associated protein 157 vs. TrEMBL
Match: A0A210R0V4 (Uncharacterized protein OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT04376 PE=4 SV=1)

HSP 1 Score: 248.054 bits (632), Expect = 2.916e-71
Identity = 170/403 (42.18%), Postives = 240/403 (59.55%), Query Frame = 3
Query:  162 KDNFLIQVKDLEKQIAYYQRKCDYLEIINDKFDSEFNQTNENKQDISEHLDILLRIRVDEITKLNSELTKLQELRDQEKAAFEQQIQQKKVEFEETIEQLTSDKRIKSGQLASMEEFKVQKEDLMMKFTELQEEINKLEDFNKEEIYQKERSNVVDMDRLKKETISRVNNVSSEFRKVSNRQMAETNKKTIRENVELSNMIKKRSEKTMELIEENDKLRAIDNENKRQIEISLTVEKELMXXXXXXXXXXXYWVEECRNNEMEVSQFESEEHRAHAEFVQSENKSLISDFDSQMEKYQYIEIEKNKLQLEQENIKSDILSSKNTLKIHKRLVNKTKNALIDAENLM-------DPSEEFTEGEVIL----RRQAMLSSLLELMNSAAVLGFGLQPRELGKQHR 1337
            K+ +LIQ++DLE ++A YQ+KCD LE+    F  +F+Q   +K DI       + ++ DE   L  +L  LQ+ R+QEK      IQQ + EF+ET +QLTSD  I  G+LAS+EEFKVQKEDLM KF  +++++ + ++ +K+ IY  E+  V+D DRLKKE +SRVN V++EFRKVSN+QMAET K+TIRENV +   + ++S+KTMELI+END LRA + + K+ I++  T EKEL KKN+ N K I+   E+CR  E  V + E  E     + V++E++ L     SQ E  Q       KL  E E     +  +K+  ++ KR   K    L DA N +       D  EE       L    RR  ML +LL L+NSAA +G G +P  LGK  +
Sbjct:   37 KEYYLIQIRDLENRLARYQKKCDELEVSQGAFKDQFDQMARDKNDIVSFWKRQVDLKTDENADLQEQLIGLQQTREQEKEQANATIQQLRQEFQETKDQLTSDNMILGGKLASLEEFKVQKEDLMAKFAAMEDDLKQKDEDHKKMIYDLEKKAVIDKDRLKKEMVSRVNTVAAEFRKVSNKQMAETTKRTIRENVSIMAQLVQKSDKTMELIQENDDLRAKEKKQKQHIDMLETTEKELAKKNHSNQKVIRMLTEKCRAQEAMVGELEMREQ--EYQEVEAEHELLQQQLQSQREDIQ-------KLAKENETYDESLKDAKDKHRVEKRNREKLDKVLYDAANALRLALGKYDEEEEMPVYGAGLNDIERRDNMLENLLVLLNSAAAVGVGPEPGALGKHQK 430          
BLAST of Cilia and flagella associated protein 157 vs. TrEMBL
Match: H3JAA3 (Uncharacterized protein OS=Strongylocentrotus purpuratus OX=7668 PE=4 SV=1)

HSP 1 Score: 242.662 bits (618), Expect = 2.651e-69
Identity = 162/405 (40.00%), Postives = 246/405 (60.74%), Query Frame = 3
Query:  147 LSAEHKDNFLIQVKDLEKQIAYYQRKCDYLEIINDKFDSEFNQTNENKQDISEHLDILLRIRVDEITKLNSELTKLQELRDQEKAAFEQQIQQKKVEFEETIEQLTSDKRIKSGQLASMEEFKVQKEDLMMKFTELQEEINKLEDFNKEEIYQKERSNVVDMDRLKKETISRVNNVSSEFRKVSNRQMAETNKKTIRENVELSNMIKKRSEKTMELIEENDKLRAIDNENKRQIEISLTVEKELMXXXXXXXXXXXYWVEECRNNEMEVSQFESEEH------------RAHAEFVQSENKSLISDFDSQMEKYQYIEIEKNKLQLEQENIKSDILSSKNTLKIHKRLVNKTKNALIDAENLMDPSEEFTEGEVIL----RRQAMLSSLLELMNSAAVLGFGLQP 1313
            LS   K+ FLIQ++DLE+++  YQ+KCD LE+ N +F S ++Q   +K++I   L   L  R DEI  LN  L  LQ+ +D EK A+E Q+ Q + EF+ET +QLTS+  I SG+LA++EEFKVQKEDL  KF +++E+I    D +K+EIY+ E+  VVD DRLK+E + RVN V++EFRKVSN+QMA+T K+TIRENV +   + K S+KTMELIEEN+++RA + + ++QIE+  + EKEL KKN+ N K I+   E+ +  E  ++  E  E             R  ++  + E +++  + D  ME+ +   +EK   Q+    IK + + ++    +H+ L++             +P +E   G++ L     R  ML  LL ++NSAA +G G  P
Sbjct:   35 LSEVGKEFFLIQIRDLERRLVRYQQKCDELEVGNGEFKSRYDQMGTDKKEIVAFLKKQLEQRQDEIADLNDRLVGLQQAKDTEKDAYEAQLAQLRNEFQETKDQLTSENMILSGKLAALEEFKVQKEDLNKKFEQMEEDIKSQADGHKDEIYKLEKKQVVDKDRLKREMVLRVNQVAAEFRKVSNKQMADTTKRTIRENVSIHAQLAKMSDKTMELIEENEEMRAKEKKQRQQIEMLESNEKELAKKNHSNQKVIRMLTEKAKQQEDVIADLEEREKEYQELEAEMGLLRQQSDSSREELQAMGRESDQMMEQIEL--MEKEAAQMADIKIKLERILAEAAYSLHRILMH-------------NPDKESGSGKISLEEVEERDNMLEHLLVILNSAAAIGVGPGP 424          
BLAST of Cilia and flagella associated protein 157 vs. TrEMBL
Match: A0A267DGJ6 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig022018g1 PE=4 SV=1)

HSP 1 Score: 234.187 bits (596), Expect = 2.301e-66
Identity = 151/406 (37.19%), Postives = 259/406 (63.79%), Query Frame = 3
Query:  135 LAPKLSAEH-KDNFLIQVKDLEKQIAYYQRKCDYLEIINDKFDSEFNQTNENKQDISEHLDILLRIRVDEIT----KLNSELTKLQELRDQEKAAFEQQIQQKKVEFEETIEQLTSDKRIKSGQLASMEEFKVQKEDLMMKFTELQEEINKLEDFNKEEIYQKERSNVVDMDRLKKETISRVNNVSSEFRKVSNRQMAETNKKTIRENVELSNMIKKRSEKTMELIEENDKLRAIDNENKRQIEISLTVEKELMXXXXXXXXXXXYWVEECRNNEMEVSQFESEEHRAHAEFVQSENKSLISDFDSQMEKYQYIEIEKNKLQLEQENIKSDILSSKNTLKIHK---RLVNKTKNALIDAENLMDPSEEFTEGEVILRRQAMLSSLLELMNSAAVLGFGLQPRELGK 1328
            LAP L  +  ++  L Q+KDL+++++  QR+CD LE++ND+  S+    + + ++I+E+L    R RV E T    +L  EL  LQE  ++++ ++E++++++K EF +T EQL  D      +L +++E+++QKE++  KF E+ E++ + E+ +KEEIY  ER  VV  D L+KE + +VN+V+SEFRKVSNRQMAET +KTI EN  L+  +   SEK   LIEENDK++A + E +R+IE+  ++EKE++ K   ++K I+   + CR+ + ++   + EE     + VQSE+  L +  +SQ ++   +  E +  QL + +  +++  ++ T +IH+   RL+ +++ A+ DA + + P EE TE E ++ R+ ML SLLEL++ AA +G G +P  LG+
Sbjct:   36 LAPALPDKREQEAKLRQLKDLQRRVSGLQRRCDELELLNDQLKSKRVTVSGDMEEITEYL----RDRVSEKTNTCAELQEELRALQEAYEKDQKSYEERMEKQKKEFRDTKEQLEQDGFTLQSKLTTLDEYRIQKEEMHEKFQEMDEKMKRQEEIHKEEIYLLERETVVQKDSLRKEMVEKVNDVASEFRKVSNRQMAETTRKTIEENAALNRQLGSLSEKITGLIEENDKVKAKEKEQQREIEVLESIEKEMLAKTANSLKTIRSLADACRDRDTQL--IDMEERAEAGDSVQSEHSLLGAQAESQSQELVAMRTETSN-QLTELDRLAEL--ARQTARIHRRFQRLLRQSERAVSDAFSTLTPDEEMTEAEAVILRRKMLVSLLELLHMAARVGLGPEPASLGR 432          
BLAST of Cilia and flagella associated protein 157 vs. Ensembl Cavefish
Match: cfap157 (cilia and flagella associated protein 157 [Source:NCBI gene;Acc:103039819])

HSP 1 Score: 175.252 bits (443), Expect = 6.073e-48
Identity = 125/384 (32.55%), Postives = 230/384 (59.90%), Query Frame = 3
Query:  147 LSAEHKDNFLIQVKDLEKQIAYYQRKCDYLEIINDKFDSEFNQTNENKQDISEHLDILLRIRVDEITKLNSELTKLQELRDQEKAAFEQQIQQKKVEFEETIEQLTSDKRIKSGQLASMEEFKVQKEDLMMKFTELQEEINKLEDFNKEEIYQKERSNVVDMDRLKKETISRVNNVSSEFRKVSNRQMAETNKKTIRENVELSNMIKKRSEKTMELIEENDKLRAIDNENKRQIEISLTVEKELMXXXXXXXXXXXYWVEECRNNEMEVSQFESEEHRAHAEFVQSENKSLISDFDSQMEKYQYIEIEKNKLQLEQENIKSDILSSKNTLKIHKRLVNKTKNALIDAENLMDPSEEFTEGEVILRRQAMLSSLLELMNSAAVLG 1298
            LS  +K+ +  Q++DLE++I  YQ KCD LE+    F + +N     K+DI  +L   L  + DE++ L  +L  LQ  +D EK +F  Q++  + EF+E+ ++LT++    +G+LAS+EEF++QK++LM     L+E++ + +  ++  IY  ER  V+D DRLKKE    V  V++EFR+VS+ +M ET  + I+ENV ++  +++ S+++ EL++END L+A + E KR+ EI   +  E+ KK+  N K +K   E+C+   +E+  F    H+   + +Q ++ +L  + D   +K++ +  + ++ Q E E ++ ++ + K   +  + ++ +  +AL +A   + P EE +E +V +R+  M+  LL +++SAA  G
Sbjct:   31 LSEGNKEFYRAQIRDLEERIEKYQHKCDELEVRQKDFSTHYNNVEREKKDIVLYLKRSLAHKEDELSDLAEKLQALQIAKDAEKESFTMQLRTLRHEFQESKDRLTTENMALAGKLASLEEFRMQKDELMALLASLKEQLEQQKQEHQTVIYNLERKAVLDNDRLKKEMQQHVAAVAAEFRRVSDSRMPETTMRAIQENVSVTAQLRQLSDRSKELLKENDYLKAREKELKRETEIMEPILNEMTKKSLGNQKVVKQLTEKCKQMHVELENF--TRHKQEHQQLQDDHDALQKEHDDLRQKHESVLEKFSRKQAEAEGLQKELQAEKIQQERLEMVLQEAASALKEALREV-PKEEDSEVQVYVRKSQMMQKLLAVLDSAAATG 411          
BLAST of Cilia and flagella associated protein 157 vs. Planmine SMEST
Match: SMESG000036345.1 (SMESG000036345.1)

HSP 1 Score: 789.645 bits (2038), Expect = 0.000e+0
Identity = 431/435 (99.08%), Postives = 433/435 (99.54%), Query Frame = 3
Query:   42 MPPXXXXXXXXXXXXXXXXXXXXXESVPLEDLAPKLSAEHKDNFLIQVKDLEKQIAYYQRKCDYLEIINDKFDSEFNQTNENKQDISEHLDILLRIRVDEITKLNSELTKLQELRDQEKAAFEQQIQQKKVEFEETIEQLTSDKRIKSGQLASMEEFKVQKEDLMMKFTELQEEINKLEDFNKEEIYQKERSNVVDMDRLKKETISRVNNVSSEFRKVSNRQMAETNKKTIRENVELSNMIKKRSEKTMELIEENDKLRAIDNENKRQIEISLTVEKELMXXXXXXXXXXXYWVEECRNNEMEVSQFESEEHRAHAEFVQSENKSLISDFDSQMEKYQYIEIEKNKLQLEQENIKSDILSSKNTLKIHKRLVNKTKNALIDAENLMDPSEEFTEGEVILRRQAMLSSLLELMNSAAVLGFGLQPRELGKQHRSIK 1346
            MPPKKGKKKKSGKKAKKSGKKSGKESVPLEDLAPKLS EHKDNFLIQVKDLEKQIAYYQRKCDYLEIIN+KFDSEFNQTNENKQDISEHLDILLRIRVDEITKLNSELTKLQELRDQEKAAFEQQIQQKKVEFEETIEQLTSDKRIKSGQLASMEEFKVQKEDLMMKFTELQEEINKLEDFNKEEIYQKERSNVVDMDRLKKETISRVNNVSSEFRKVSNRQMAETNKKTIRENVELSNMIKKRSEKTMELIEENDKLRAIDNENKRQIEISL VEKELMKKNNINVKNIKYW+EECRNNEMEVSQFESEEHRAHAEFVQSENKSLISDFDSQMEKYQYIEIEKNKLQLEQENIKSDILSSKNTLKIHKRLVNKTKNALIDAENLMDPSEEFTEGEVILRRQAMLSSLLELMNSAAVLGFGLQPRELGKQHRSIK
Sbjct:    1 MPPKKGKKKKSGKKAKKSGKKSGKESVPLEDLAPKLSVEHKDNFLIQVKDLEKQIAYYQRKCDYLEIINEKFDSEFNQTNENKQDISEHLDILLRIRVDEITKLNSELTKLQELRDQEKAAFEQQIQQKKVEFEETIEQLTSDKRIKSGQLASMEEFKVQKEDLMMKFTELQEEINKLEDFNKEEIYQKERSNVVDMDRLKKETISRVNNVSSEFRKVSNRQMAETNKKTIRENVELSNMIKKRSEKTMELIEENDKLRAIDNENKRQIEISLAVEKELMKKNNINVKNIKYWIEECRNNEMEVSQFESEEHRAHAEFVQSENKSLISDFDSQMEKYQYIEIEKNKLQLEQENIKSDILSSKNTLKIHKRLVNKTKNALIDAENLMDPSEEFTEGEVILRRQAMLSSLLELMNSAAVLGFGLQPRELGKQHRSIK 435          
BLAST of Cilia and flagella associated protein 157 vs. Planmine SMEST
Match: SMESG000020913.1 (SMESG000020913.1)

HSP 1 Score: 115.161 bits (287), Expect = 8.006e-27
Identity = 72/216 (33.33%), Postives = 129/216 (59.72%), Query Frame = 3
Query:  159 HKDNFLIQVKDLEKQIAYYQRKCDYLEIINDKFDSEFNQTNENKQDISEHLDILLRIRVDEITKLNSELTKLQELRDQEKAAFEQQIQQKKVEFEETIEQLTSDKRIKSGQLASMEEFKVQKEDLMMKFTELQEEINKLEDFNKEEIYQKERSNVVDMDRLKKETISRVNNVSSEFRKVSNRQMAETNKKTIRENVELSNMIKKRSEKTMELIEEN 806
            +K  F+  +K LE ++  Y+ K D  +  ND +  +  + ++ K D+   L+  L  R DE   L      LQ+ ++ EK  +E  +Q+ +   + + ++LT +  I S QLA++EEFKVQKE  + ++ EL+++   ++  +KE + + +     D DRLKKE +S++N V+++FR++S +Q +ET K+TIRENV +   + K  +K +EL++EN
Sbjct:   38 NKGFFIEHIKVLENKLRLYKEKTDKFQTANDNYMKKQKELSQEKHDLISFLEKNLTNRGDEYFDLKDRYFGLQQAKEAEKNQYESTLQEIRSNLQTSKDELTREISIISAQLAALEEFKVQKEKRLEEYAELEQDFESIKKNHKETLEKIQEKQNSDHDRLKKEIVSKINLVAADFRRISQKQTSETTKRTIRENVSIRTQLAKMDDKNIELMQEN 253          
The following BLAST results are available for this feature:
BLAST of Cilia and flagella associated protein 157 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 2
Match NameE-valueIdentityDescription
CFAP1573.047e-4841.39cilia and flagella associated protein 157 [Source:... [more]
CFAP1572.721e-4741.39cilia and flagella associated protein 157 [Source:... [more]
back to top
BLAST of Cilia and flagella associated protein 157 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Cilia and flagella associated protein 157 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
CG171224.826e-1628.70gene:FBgn0036962 transcript:FBtr0074849[more]
back to top
BLAST of Cilia and flagella associated protein 157 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
cfap1571.842e-4131.66cilia and flagella associated protein 157 [Source:... [more]
cfap1571.469e-3830.40cilia and flagella associated protein 157 [Source:... [more]
back to top
BLAST of Cilia and flagella associated protein 157 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
cfap1573.183e-5137.03cilia and flagella associated protein 157 [Source:... [more]
back to top
BLAST of Cilia and flagella associated protein 157 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Cfap1575.538e-4139.83cilia and flagella associated protein 157 [Source:... [more]
back to top
BLAST of Cilia and flagella associated protein 157 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q0VFN8|CF157_XENTR6.551e-5137.28Cilia- and flagella-associated protein 157 OS=Xeno... [more]
sp|Q5JU67|CF157_HUMAN1.307e-4641.39Cilia- and flagella-associated protein 157 OS=Homo... [more]
sp|A2BDR7|CF157_DANRE1.390e-4031.66Cilia- and flagella-associated protein 157 OS=Dani... [more]
sp|Q4V7B0|CF157_RAT1.474e-4040.25Cilia- and flagella-associated protein 157 OS=Ratt... [more]
sp|Q0VFX2|CF157_MOUSE3.874e-4039.83Cilia- and flagella-associated protein 157 OS=Mus ... [more]
back to top
BLAST of Cilia and flagella associated protein 157 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3H8603.404e-7642.68cilia- and flagella-associated protein 157 isoform... [more]
A0A0B6ZCN12.441e-7340.99Uncharacterized protein OS=Arion vulgaris OX=10286... [more]
A0A210R0V42.916e-7142.18Uncharacterized protein OS=Mizuhopecten yessoensis... [more]
H3JAA32.651e-6940.00Uncharacterized protein OS=Strongylocentrotus purp... [more]
A0A267DGJ62.301e-6637.19Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
back to top
BLAST of Cilia and flagella associated protein 157 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
cfap1576.073e-4832.55cilia and flagella associated protein 157 [Source:... [more]
back to top
BLAST of Cilia and flagella associated protein 157 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Cilia and flagella associated protein 157 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Cilia and flagella associated protein 157 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Cilia and flagella associated protein 157 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Cilia and flagella associated protein 157 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000036345.10.000e+099.08SMESG000036345.1[more]
SMESG000020913.18.006e-2733.33SMESG000020913.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30008882 ID=SMED30008882|Name=Cilia and flagella associated protein 157|organism=Schmidtea mediterranea sexual|type=transcript|length=1644bp
ACTTAATCACATAGTTTCCGTAACAGTTAAGGTTTTAAATAATGCCACCA
AAAAAAGGTAAAAAGAAAAAGAGTGGAAAGAAAGCTAAGAAATCTGGAAA
AAAATCGGGGAAAGAATCAGTTCCATTAGAAGATTTAGCTCCTAAATTAT
CTGCTGAACATAAAGATAATTTTCTTATTCAAGTTAAAGATCTCGAGAAA
CAAATTGCATATTATCAGAGGAAATGTGATTATCTGGAAATAATAAATGA
CAAGTTTGACTCAGAATTCAACCAGACTAATGAAAATAAACAAGACATTT
CTGAACATTTGGATATACTTTTGAGAATTCGAGTTGATGAGATCACCAAA
TTGAATTCTGAACTAACAAAATTGCAAGAATTACGAGATCAAGAGAAAGC
TGCATTTGAGCAGCAAATACAACAGAAAAAAGTAGAATTTGAAGAAACTA
TTGAACAGTTAACTTCAGACAAAAGGATAAAAAGTGGTCAATTGGCATCA
ATGGAGGAATTCAAAGTTCAGAAAGAGGACTTGATGATGAAATTCACAGA
ATTGCAGGAAGAAATCAATAAATTAGAAGATTTCAATAAAGAAGAAATTT
ACCAAAAAGAAAGATCAAATGTGGTAGATATGGATCGCCTGAAAAAGGAA
ACGATATCACGAGTCAACAATGTCTCATCGGAATTTCGCAAAGTTTCCAA
TCGACAAATGGCTGAAACGAACAAAAAAACAATCCGAGAAAATGTCGAAT
TAAGCAACATGATAAAAAAAAGAAGTGAAAAAACGATGGAACTTATTGAA
GAAAATGATAAACTTCGCGCTATCGATAATGAAAACAAAAGACAAATCGA
AATTTCGTTAACTGTGGAAAAAGAATTGATGAAAAAAAATAATATCAACG
TCAAAAACATCAAATATTGGGTTGAAGAATGTCGAAACAATGAAATGGAG
GTTTCTCAGTTCGAATCGGAGGAGCACCGCGCACATGCGGAATTCGTCCA
ATCAGAAAATAAATCTTTGATTTCTGATTTTGACTCTCAAATGGAAAAAT
ATCAATATATTGAAATCGAGAAAAACAAACTGCAGTTGGAACAGGAAAAT
ATTAAATCAGATATTCTTTCATCAAAAAACACCCTGAAAATCCATAAAAG
ATTGGTGAACAAAACCAAAAATGCCCTTATTGATGCAGAAAATTTGATGG
ATCCAAGTGAAGAATTCACTGAAGGTGAAGTGATTTTACGGCGCCAGGCG
ATGTTGAGTAGCCTGTTAGAACTAATGAATAGTGCTGCAGTTTTAGGATT
TGGACTTCAGCCTAGGGAACTTGGTAAACAACACAGATCAATAAAATTGT
GACATTATTTAAGTTTTTCTTTACTGTAGCTCGGAAATTTTTGTTTCTCG
AGATTTGAAATTATTTTCTAGAGTATTTTTTGCGTTTTTTAGAATTGCCC
TAGGATAAGTGATGAGAAGAAATTAGATTCAAACAATCAAAATGTTTACA
CAAACATTCCAATGTTTATTCTAATGATAAATTTCAAGGTCATCTGAAAA
ATCTAGATTTATCACTAACAATAAAATAAAAAACTTTCACTTTTGATTTT
GTTAAAATTTTGAAAAAAGATGAACAATTTCCATTGAATTATTT
back to top

protein sequence of SMED30008882-orf-1

>SMED30008882-orf-1 ID=SMED30008882-orf-1|Name=SMED30008882-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=437bp
MPPKKGKKKKSGKKAKKSGKKSGKESVPLEDLAPKLSAEHKDNFLIQVKD
LEKQIAYYQRKCDYLEIINDKFDSEFNQTNENKQDISEHLDILLRIRVDE
ITKLNSELTKLQELRDQEKAAFEQQIQQKKVEFEETIEQLTSDKRIKSGQ
LASMEEFKVQKEDLMMKFTELQEEINKLEDFNKEEIYQKERSNVVDMDRL
KKETISRVNNVSSEFRKVSNRQMAETNKKTIRENVELSNMIKKRSEKTME
LIEENDKLRAIDNENKRQIEISLTVEKELMKKNNINVKNIKYWVEECRNN
EMEVSQFESEEHRAHAEFVQSENKSLISDFDSQMEKYQYIEIEKNKLQLE
QENIKSDILSSKNTLKIHKRLVNKTKNALIDAENLMDPSEEFTEGEVILR
RQAMLSSLLELMNSAAVLGFGLQPRELGKQHRSIKL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0005829cytosol
GO:0005886plasma membrane
GO:0036064ciliary basal body
GO:0043231intracellular membrane-bounded organelle
GO:0005929cilium
GO:0042995cell projection
Vocabulary: biological process
TermDefinition
GO:0007288sperm axoneme assembly
Vocabulary: molecular function
TermDefinition
GO:0008017microtubule binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000106ciliated epithelial cell
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR038844CFAP157
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 154..181
NoneNo IPR availableCOILSCoilCoilcoord: 41..61
NoneNo IPR availableCOILSCoilCoilcoord: 101..143
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..28
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..20
IPR038844Cilia- and flagella-associated protein 157PANTHERPTHR31954FAMILY NOT NAMEDcoord: 1..418