Transmembrane protein 17

Overview
NameTransmembrane protein 17
Smed IDSMED30008862
Length (bp)714
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Transmembrane protein 17 (SMED30008862) t-SNE clustered cells

Violin plots show distribution of expression levels for Transmembrane protein 17 (SMED30008862) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Transmembrane protein 17 (SMED30008862) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Transmembrane protein 17 (SMED30008862) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30008862

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30008862SMESG000050386.1 SmedASXL_005834SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30008862SMESG000050386.1 dd_Smed_v4_10264_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30008862SMESG000050386.1 dd_Smed_v6_10264_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30008862SMESG000050386.1 dd_Smed_v4_10264_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Transmembrane protein 17 vs. Ensembl Human
Match: TMEM17 (transmembrane protein 17 [Source:HGNC Symbol;Acc:HGNC:26623])

HSP 1 Score: 92.0485 bits (227), Expect = 2.076e-22
Identity = 63/153 (41.18%), Postives = 95/153 (62.09%), Query Frame = 3
Query:  177 QKNRTGFEYH--------SNLPLQISLYFNAYYFPFWFIGMCLTLEQEFSRMSNIFRVINVALFILFSILEITRLIAGYSGNLAEKIPEFAGFWLLTILVQLPAIFFLLFSTDMIISPFERSLHIIEASFIVFQAVIGIFVLKMMISYQRLKF 611
              NRTG E +        S+L LQ+SLYFN YYFP W++   + L  ++S + + ++ I + + IL +++E  RL  GY GNL EK+PE AGFWLL++L+QLP I FLLF+  +   P E+++HII   F+ FQ V     L+ M++   ++F
Sbjct:   21 DSNRTGPESNEGPENEMVSSLALQMSLYFNTYYFPLWWVSSIMMLHMKYSILPDYYKFIVITVIILITLIEAIRLYLGYVGNLQEKVPELAGFWLLSLLLQLPLILFLLFNEGLTNLPLEKAIHIIFTLFLAFQVVAAFLTLRKMVNQLAVRF 173          
BLAST of Transmembrane protein 17 vs. Ensembl Zebrafish
Match: tmem17 (transmembrane protein 17 [Source:NCBI gene;Acc:568092])

HSP 1 Score: 125.176 bits (313), Expect = 2.615e-35
Identity = 61/159 (38.36%), Postives = 98/159 (61.64%), Query Frame = 3
Query:  180 KNRTGFEYHSN-----------LPLQISLYFNAYYFPFWFIGMCLTLEQEFSRMSNIFRVINVALFILFSILEITRLIAGYSGNLAEKIPEFAGFWLLTILVQLPAIFFLLFSTDMIISPFERSLHIIEASFIVFQAVIGIFVLKMMISYQRLKFLVSQ 623
            + +  FE H+N           LPLQ+SLYFN ++FPFW+I   + L+ ++S +++ ++ I + + I+ +++E  RL  G +GNL EK+PE AGFWLLT L+Q P I F LF+  +++ P ER +HII A FI  + + G   L+ M+ +   +F + Q
Sbjct:   24 RTQPSFEEHANFLDQNKDVVSSLPLQMSLYFNMWFFPFWWISEVVMLDLKYSALADYYKFILITILIVMTLIEAIRLYLGNAGNLQEKVPELAGFWLLTFLLQFPLILFQLFNEAVLVQPLERGVHIILALFIFAEVLFGFVALRTMVRHTESRFHLRQ 182          
BLAST of Transmembrane protein 17 vs. Ensembl Zebrafish
Match: zgc:112294 (zgc:112294 [Source:NCBI gene;Acc:553704])

HSP 1 Score: 118.242 bits (295), Expect = 2.825e-32
Identity = 65/179 (36.31%), Postives = 102/179 (56.98%), Query Frame = 3
Query:   96 ENKRNYVNNVIDHIF---PISDSDLEKQRLQKNRTGFEYHSNLPLQISLYFNAYYFPFWFIGMCLTLEQEFSRMSNIFRVINVALFILFSILEITRLIAGYSGNLAEKIPEFAGFWLLTILVQLPAIFFLLFSTDMIISPFERSLHIIEASFIVFQAVIGIFVLKMMISYQRLKFLVSQ 623
            +N R  + NV   +F      DS   K    +N    E  S+LPLQ+ LYFN ++FPFW+I   L L+ +FS +   ++ + V   +L SI E+ R+  GY+GNL EK+PE AGFWL++ L QLP + F +   D+II P ER++H +  +F++ + +     L++M      +F + Q
Sbjct:   10 QNLRVGLANVSGSVFINNRTRDSADFKDHYLENEACAEVSSHLPLQMMLYFNMFFFPFWWISELLMLQLKFSYLPVYYQCLLVTGMVLISIFEVLRMYLGYAGNLKEKVPELAGFWLISFLFQLPILLFFITDPDIIILPLERAVHSLYLAFLLGELMASFLALRVMTRKLAQQFHMRQ 188          
BLAST of Transmembrane protein 17 vs. Ensembl Zebrafish
Match: zgc:112294 (zgc:112294 [Source:NCBI gene;Acc:553704])

HSP 1 Score: 117.857 bits (294), Expect = 2.925e-32
Identity = 63/167 (37.72%), Postives = 98/167 (58.68%), Query Frame = 3
Query:   96 ENKRNYVNNVIDHIF---PISDSDLEKQRLQKNRTGFEYHSNLPLQISLYFNAYYFPFWFIGMCLTLEQEFSRMSNIFRVINVALFILFSILEITRLIAGYSGNLAEKIPEFAGFWLLTILVQLPAIFFLLFSTDMIISPFERSLHIIEASFIVFQAVIGIFVLKMM 587
            +N R  + NV   +F      DS   K    +N    E  S+LPLQ+ LYFN ++FPFW+I   L L+ +FS +   ++ + V   +L SI E+ R+  GY+GNL EK+PE AGFWL++ L QLP + F +   D+II P ER++H +  +F++ + +     L++M
Sbjct:   10 QNLRVGLANVSGSVFINNRTRDSADFKDHYLENEACAEVSSHLPLQMMLYFNMFFFPFWWISELLMLQLKFSYLPVYYQCLLVTGMVLISIFEVLRMYLGYAGNLKEKVPELAGFWLISFLFQLPILLFFITDPDIIILPLERAVHSLYLAFLLGELMASFLALRVM 176          
BLAST of Transmembrane protein 17 vs. Ensembl Xenopus
Match: Tmem17-b (transmembrane protein 17 [Source:NCBI gene;Acc:100124937])

HSP 1 Score: 92.8189 bits (229), Expect = 1.508e-22
Identity = 62/159 (38.99%), Postives = 99/159 (62.26%), Query Frame = 3
Query:  186 RTGFEYHSNLPLQISLYFNAYYFPFWFIGMCLTLEQEFSRMSNIFRVINVALFILFSILEITRLIAGYSGNLAEKIPEFAGFWLLTILVQLPAIFFLLFSTDMIISPFERSLHIIEASFIVFQAVIGIFVLKMMISYQRLKFLVSQPAKAPSRYQVPNN 662
            ++G +  S+LPLQ+ LYFNA++FPFW I   +T+E +F R+S  ++++     ++ +++E  RL  GY GNL EK+PE AGF +LT+L+QLP + FLL     ++ P + ++H+I   FI  + VI   VLK M     L++ + Q     S++ VP N
Sbjct:   38 QSGHDLLSSLPLQMMLYFNAFFFPFWIISEIITMELKFGRLSGYYQILLTTSLVILTLVESLRLYIGYVGNLHEKVPELAGFLILTLLIQLPLLLFLLTDNRNLLLPLDLAVHMIYLMFINAEIVISFLVLKTMTRQFALEYYLQQSEILVSKH-VPVN 195          
BLAST of Transmembrane protein 17 vs. Ensembl Mouse
Match: Tmem17 (transmembrane protein 17 [Source:MGI Symbol;Acc:MGI:2144205])

HSP 1 Score: 91.6633 bits (226), Expect = 2.239e-22
Identity = 57/138 (41.30%), Postives = 88/138 (63.77%), Query Frame = 3
Query:  198 EYHSNLPLQISLYFNAYYFPFWFIGMCLTLEQEFSRMSNIFRVINVALFILFSILEITRLIAGYSGNLAEKIPEFAGFWLLTILVQLPAIFFLLFSTDMIISPFERSLHIIEASFIVFQAVIGIFVLKMMISYQRLKF 611
            E  S+L LQ+SLYFN+Y+FP W++   + L  ++S + + ++ I V + IL +++E  RL  G  GNL EK+PE AGFWLL++L+QLP I FLL +  +   P E+++HII   F+ FQ +     LK M++    +F
Sbjct:   36 EMVSSLALQMSLYFNSYFFPLWWVSCIVMLHLKYSILPDYYKFIVVTVVILITLIEAIRLYLGCMGNLQEKVPELAGFWLLSLLLQLPLILFLLLNDGLRNLPLEKAIHIIFTIFLTFQVISAFLTLKKMVNQLAARF 173          
BLAST of Transmembrane protein 17 vs. UniProt/SwissProt
Match: sp|A5D6V4|TM17B_DANRE (Transmembrane protein 17B OS=Danio rerio OX=7955 GN=Tmem17b PE=2 SV=1)

HSP 1 Score: 125.176 bits (313), Expect = 1.974e-34
Identity = 61/159 (38.36%), Postives = 98/159 (61.64%), Query Frame = 3
Query:  180 KNRTGFEYHSN-----------LPLQISLYFNAYYFPFWFIGMCLTLEQEFSRMSNIFRVINVALFILFSILEITRLIAGYSGNLAEKIPEFAGFWLLTILVQLPAIFFLLFSTDMIISPFERSLHIIEASFIVFQAVIGIFVLKMMISYQRLKFLVSQ 623
            + +  FE H+N           LPLQ+SLYFN ++FPFW+I   + L+ ++S +++ ++ I + + I+ +++E  RL  G +GNL EK+PE AGFWLLT L+Q P I F LF+  +++ P ER +HII A FI  + + G   L+ M+ +   +F + Q
Sbjct:   24 RTQPSFEEHANFLDQNKDVVSSLPLQMSLYFNMWFFPFWWISEVVMLDLKYSALADYYKFILITILIVMTLIEAIRLYLGNAGNLQEKVPELAGFWLLTFLLQFPLILFQLFNEAVLVQPLERGVHIILALFIFAEVLFGFVALRTMVRHTESRFHLRQ 182          
BLAST of Transmembrane protein 17 vs. UniProt/SwissProt
Match: sp|E1BY51|TMM17_CHICK (Transmembrane protein 17 OS=Gallus gallus OX=9031 GN=TMEM17 PE=3 SV=1)

HSP 1 Score: 124.405 bits (311), Expect = 5.409e-34
Identity = 69/149 (46.31%), Postives = 98/149 (65.77%), Query Frame = 3
Query:  147 SDSDLEKQRLQKNRTGFEYHSNLPLQISLYFNAYYFPFWFIGMCLTLEQEFSRMSNIFRVINVALFILFSILEITRLIAGYSGNLAEKIPEFAGFWLLTILVQLPAIFFLLFSTDMIISPFERSLHIIEASFIVFQAVIGIFVLKMMIS 593
            +DS     +    R   E  S+LPLQ+SLYFN Y+FPFW++     L+ ++  +S+ ++ I V + IL S++E+ RL  GY GNL EK+PE AGFWLLT+L+QLP I FLLF+  + I P ERS++II A F+VFQ +     LK M++
Sbjct:   20 TDSRRAGPQYPSERADNEILSSLPLQMSLYFNVYFFPFWWLSTVFMLQLKYPVLSDYYKFILVTVMILTSLIEVIRLYLGYMGNLQEKVPELAGFWLLTLLLQLPVILFLLFNEGLNIQPLERSVNIIFALFLVFQVIAAFVTLKRMVN 168          
BLAST of Transmembrane protein 17 vs. UniProt/SwissProt
Match: sp|Q502E0|TM17A_DANRE (Transmembrane protein 17A OS=Danio rerio OX=7955 GN=tmem17a PE=2 SV=2)

HSP 1 Score: 118.242 bits (295), Expect = 1.998e-31
Identity = 63/167 (37.72%), Postives = 98/167 (58.68%), Query Frame = 3
Query:   96 ENKRNYVNNVIDHIF---PISDSDLEKQRLQKNRTGFEYHSNLPLQISLYFNAYYFPFWFIGMCLTLEQEFSRMSNIFRVINVALFILFSILEITRLIAGYSGNLAEKIPEFAGFWLLTILVQLPAIFFLLFSTDMIISPFERSLHIIEASFIVFQAVIGIFVLKMM 587
            +N R  + NV   +F      DS   K    +N    E  S+LPLQ+ LYFN ++FPFW+I   L L+ +FS +   ++ + V   +L SI E+ R+  GY+GNL EK+PE AGFWL++ L QLP + F +   D+II P ER++H +  +F++ + +     L++M
Sbjct:   10 QNLRVGLANVSGSVFINNRTRDSADFKDHYLENEACAEVSSHLPLQMMLYFNMFFFPFWWISELLMLQLKFSYLPVYYQCLLVTGMVLISIFEVLRMYLGYAGNLKEKVPELAGFWLISFLFQLPILLFFITDPDIIILPLERAVHSLYLAFLLGELMASFLALRVM 176          
BLAST of Transmembrane protein 17 vs. UniProt/SwissProt
Match: sp|A4FUY9|TMM17_BOVIN (Transmembrane protein 17 OS=Bos taurus OX=9913 GN=TMEM17 PE=2 SV=1)

HSP 1 Score: 93.2041 bits (230), Expect = 4.034e-22
Identity = 64/153 (41.83%), Postives = 96/153 (62.75%), Query Frame = 3
Query:  177 QKNRTGFEYH--------SNLPLQISLYFNAYYFPFWFIGMCLTLEQEFSRMSNIFRVINVALFILFSILEITRLIAGYSGNLAEKIPEFAGFWLLTILVQLPAIFFLLFSTDMIISPFERSLHIIEASFIVFQAVIGIFVLKMMISYQRLKF 611
              NRTG EY+        S+L LQ+SLYFN Y+FP W++   + L+ ++S + + ++ I V + IL +++E  RL  GY GNL EK+PE AGFWLL++L+QLP I FLLF+  +   P E+++HII   F+ FQ V     L+ M++    +F
Sbjct:   21 DSNRTGPEYNEGPDNEMVSSLALQMSLYFNTYFFPLWWVSSIMMLQMKYSILPDYYKFIVVTIIILITLIEAIRLYLGYMGNLQEKVPELAGFWLLSLLLQLPLILFLLFNEGLTNLPLEKAVHIIFTIFLTFQVVSAFLTLRKMVNQLATRF 173          
BLAST of Transmembrane protein 17 vs. UniProt/SwissProt
Match: sp|F6RWY9|TM17B_XENTR (Transmembrane protein 17B OS=Xenopus tropicalis OX=8364 GN=Tmem17-b PE=2 SV=2)

HSP 1 Score: 92.8189 bits (229), Expect = 7.991e-22
Identity = 62/159 (38.99%), Postives = 99/159 (62.26%), Query Frame = 3
Query:  186 RTGFEYHSNLPLQISLYFNAYYFPFWFIGMCLTLEQEFSRMSNIFRVINVALFILFSILEITRLIAGYSGNLAEKIPEFAGFWLLTILVQLPAIFFLLFSTDMIISPFERSLHIIEASFIVFQAVIGIFVLKMMISYQRLKFLVSQPAKAPSRYQVPNN 662
            ++G +  S+LPLQ+ LYFNA++FPFW I   +T+E +F R+S  ++++     ++ +++E  RL  GY GNL EK+PE AGF +LT+L+QLP + FLL     ++ P + ++H+I   FI  + VI   VLK M     L++ + Q     S++ VP N
Sbjct:   38 QSGHDLLSSLPLQMMLYFNAFFFPFWIISEIITMELKFGRLSGYYQILLTTSLVILTLVESLRLYIGYVGNLHEKVPELAGFLILTLLIQLPLLLFLLTDNRNLLLPLDLAVHMIYLMFINAEIVISFLVLKTMTRQFALEYYLQQSEILVSKH-VPVN 195          
BLAST of Transmembrane protein 17 vs. TrEMBL
Match: A0A3P6PDS9 (Uncharacterized protein OS=Dibothriocephalus latus OX=60516 GN=DILT_LOCUS621 PE=4 SV=1)

HSP 1 Score: 182.956 bits (463), Expect = 1.684e-54
Identity = 85/179 (47.49%), Postives = 122/179 (68.16%), Query Frame = 3
Query:  105 RNYVNNVIDHIFPISDSDLEKQRLQKNRTGFEYHSNLPLQISLYFNAYYFPFWFIGMCLTLEQEFSRMSNIFRVINVALFILFSILEITRLIAGYSGNLAEKIPEFAGFWLLTILVQLPAIFFLLFSTDMIISPFERSLHIIEASFIVFQAVIGIFVLKMMISYQRLKFLVSQPAKAPS 641
            +  VN V  ++FP+++S+LE  RL K + GF Y SNLP Q+ LYFNA+Y PFWFIG  +    EF  +S I +V+ +A+F+ +   EITRL  G+ GNLAEK+PE AGFWLL++L+QLP IF+LL  T +I+S FER++H +EA+F++ +   G FV+K+M+  Q +KF        P 
Sbjct:    6 KQAVNRVTAYVFPVTNSELETLRL-KQKFGFAYTSNLPPQMMLYFNAFYAPFWFIGTMICFIIEFEFLSQIRKVVGIAVFLTYIFTEITRLYLGFIGNLAEKVPELAGFWLLSLLIQLPGIFYLLLDTGLILSSFERTIHAVEATFVILETTTGFFVVKLMVQNQAVKFYTLTQGAVPE 183          
BLAST of Transmembrane protein 17 vs. TrEMBL
Match: G4VHQ1 (Putative transmembrane protein 17 OS=Schistosoma mansoni OX=6183 GN=Smp_151020 PE=4 SV=1)

HSP 1 Score: 175.637 bits (444), Expect = 1.062e-51
Identity = 88/175 (50.29%), Postives = 124/175 (70.86%), Query Frame = 3
Query:   90 MFENKRNYVNNVIDHIFPISDSDLEKQRLQKNR-TGFEYHSNLPLQISLYFNAYYFPFWFIGMCLTLEQEFSRMSNIFRVINVALFILFSILEITRLIAGYSGNLAEKIPEFAGFWLLTILVQLPAIFFLLFSTDMIISPFERSLHIIEASFIVFQAVIGIFVLKMMISYQRLKF 611
            M +N +  + +V D++F   ++        KNR   FEY +NLPLQ+S YFN+ Y PFWFIG  +TL  EF  +  +++VIN A+F+L+S+LE  RL  GY+GNL E +PE  G WLLTIL+QLPAI F+LF++DMI+S FER++HIIE   +VF++++G FVLK+M+  Q LKF
Sbjct:    1 MSKNAKRALKSVADYLFLSKNA--HGSIYSKNRHKEFEYVTNLPLQMSFYFNSLYSPFWFIGTLMTLIMEFEYLDPVYKVINTAVFVLYSVLEGLRLYLGYAGNLMELVPELTGSWLLTILIQLPAISFMLFNSDMILSSFERTIHIIEFIMVVFESLVGFFVLKLMVQTQALKF 173          
BLAST of Transmembrane protein 17 vs. TrEMBL
Match: A0A183QJ43 (Uncharacterized protein OS=Schistosoma rodhaini OX=6188 PE=4 SV=1)

HSP 1 Score: 173.326 bits (438), Expect = 4.113e-51
Identity = 82/141 (58.16%), Postives = 110/141 (78.01%), Query Frame = 3
Query:  189 TGFEYHSNLPLQISLYFNAYYFPFWFIGMCLTLEQEFSRMSNIFRVINVALFILFSILEITRLIAGYSGNLAEKIPEFAGFWLLTILVQLPAIFFLLFSTDMIISPFERSLHIIEASFIVFQAVIGIFVLKMMISYQRLKF 611
            T FEY +NLPLQ+S YFN+ Y PFWFIG  +TL  EF  +  +++VIN A+F+L+S+LE  RL  GY+GNL E +PE AG WLLTIL+QLPAI F+LF++DMI+S FER++HIIE   +VF++++G FVLK+M+  Q LKF
Sbjct:    5 TEFEYVTNLPLQMSFYFNSLYSPFWFIGTLMTLIMEFQYLDPVYKVINTAVFVLYSVLEGLRLYLGYAGNLMELVPELAGSWLLTILIQLPAISFMLFNSDMILSSFERTIHIIEFIMVVFESLVGFFVLKLMVQMQALKF 145          
BLAST of Transmembrane protein 17 vs. TrEMBL
Match: A0A430PYR7 (Transmembrane protein 17 OS=Schistosoma bovis OX=6184 GN=DC041_0011805 PE=4 SV=1)

HSP 1 Score: 171.4 bits (433), Expect = 4.970e-50
Identity = 86/174 (49.43%), Postives = 121/174 (69.54%), Query Frame = 3
Query:   90 MFENKRNYVNNVIDHIFPISDSDLEKQRLQKNRTGFEYHSNLPLQISLYFNAYYFPFWFIGMCLTLEQEFSRMSNIFRVINVALFILFSILEITRLIAGYSGNLAEKIPEFAGFWLLTILVQLPAIFFLLFSTDMIISPFERSLHIIEASFIVFQAVIGIFVLKMMISYQRLKF 611
            M +  +  + ++ D++F +S S       +     FEY +NLPLQ+  YFN+ Y PFWFIG  +TL  EF  +  +++VIN A+F+L+S+LE  RL  GY+GNL E +PE AG WLLTIL+QLPAI F+LF+ DMIIS FER++HIIE   +VF++++G FVLK+M+  Q LKF
Sbjct:    1 MSKKAKRALKSIADYLF-LSKSAHGSIYSKNRHKEFEYVTNLPLQMLFYFNSLYSPFWFIGTLMTLIIEFEYLDPVYKVINTAVFVLYSVLEGLRLYLGYAGNLMELVPELAGSWLLTILIQLPAISFMLFNCDMIISSFERTIHIIEFIMVVFESLVGFFVLKLMVQMQALKF 173          
BLAST of Transmembrane protein 17 vs. TrEMBL
Match: A0A095A273 (Transmembrane protein 17B (Fragment) OS=Schistosoma haematobium OX=6185 GN=MS3_09881 PE=4 SV=1)

HSP 1 Score: 168.703 bits (426), Expect = 6.757e-49
Identity = 82/145 (56.55%), Postives = 109/145 (75.17%), Query Frame = 3
Query:  180 KNR-TGFEYHSNLPLQISLYFNAYYFPFWFIGMCLTLEQEFSRMSNIFRVINVALFILFSILEITRLIAGYSGNLAEKIPEFAGFWLLTILVQLPAIFFLLFSTDMIISPFERSLHIIEASFIVFQAVIGIFVLKMMISYQRLKF 611
            KNR   FEY +NLPLQ+  YFN+ Y PFWFIG  +TL  EF  +  +++VIN A+F+L+S+LE  RL  GY+GNL E +PE AG WLLT+L+QLPAI F+LF+ DMIIS FER++H IE   +VF++++G FVLK+M+  Q LKF
Sbjct:   27 KNRHKEFEYVTNLPLQMLFYFNSLYSPFWFIGTLMTLIIEFEYLDPVYKVINTAVFVLYSVLEGLRLYLGYAGNLMELVPELAGSWLLTVLIQLPAISFMLFNCDMIISSFERTIHTIEFIMVVFESLVGFFVLKLMVQMQALKF 171          
BLAST of Transmembrane protein 17 vs. Ensembl Cavefish
Match: tmem17 (transmembrane protein 17 [Source:NCBI gene;Acc:103042375])

HSP 1 Score: 117.472 bits (293), Expect = 2.034e-32
Identity = 64/166 (38.55%), Postives = 103/166 (62.05%), Query Frame = 3
Query:  126 IDHIFPISDSDLEKQRLQKNRTGFEYHSNLPLQISLYFNAYYFPFWFIGMCLTLEQEFSRMSNIFRVINVALFILFSILEITRLIAGYSGNLAEKIPEFAGFWLLTILVQLPAIFFLLFSTDMIISPFERSLHIIEASFIVFQAVIGIFVLKMMISYQRLKFLVSQ 623
            +D  F     +   + L +NR   E  S+LPLQ+SL+FN ++FP W+I   + L+ ++  + + ++ I + + IL +++E  RL  GY+GNL EK+PE AGFWLL++L+Q P   FLLF+  ++I P ER +HII A FI+ +A+ G   L+ M+     +F + Q
Sbjct:   20 VDQTFSKLTPEDHVKFLNQNR---EVVSSLPLQMSLFFNLWFFPLWWISEVVMLQLKYPALPDYYKFILITVLILMTLIEGIRLYLGYAGNLQEKVPELAGFWLLSLLLQFPLTLFLLFNEAILIQPLERGVHIILALFILAEALSGFVALRAMVRNTESRFHLRQ 182          
BLAST of Transmembrane protein 17 vs. Ensembl Cavefish
Match: zgc:112294 (transmembrane protein 17A-like [Source:NCBI gene;Acc:103036215])

HSP 1 Score: 113.235 bits (282), Expect = 1.857e-30
Identity = 57/159 (35.85%), Postives = 91/159 (57.23%), Query Frame = 3
Query:  147 SDSDLEKQRLQKNRTGFEYHSNLPLQISLYFNAYYFPFWFIGMCLTLEQEFSRMSNIFRVINVALFILFSILEITRLIAGYSGNLAEKIPEFAGFWLLTILVQLPAIFFLLFSTDMIISPFERSLHIIEASFIVFQAVIGIFVLKMMISYQRLKFLVSQ 623
               DL +  ++    G E  S+LPLQ+ LYFN +YFPFW+I   + L+ +F  +   ++ + V   +L S+ E+ R+  GY GNL EK+PE AGFWL++ L QLP + F L    ++I P ER++H +   F++ +       L++M     L+F + Q
Sbjct:   31 DSGDLREHSVEDEVCG-EVSSHLPLQMLLYFNMFYFPFWWISEIVMLDLKFPMLPGYYQCLMVMGMVLISLFEVIRVYLGYVGNLKEKVPELAGFWLISFLFQLPILLFFLSDEGLLILPLERAVHALYLVFLLGEVSTSFMALRVMTRKLALQFHLRQ 188          
BLAST of Transmembrane protein 17 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008724.1 (pep scaffold:Pmarinus_7.0:GL487172:3442:7113:-1 gene:ENSPMAG00000007892.1 transcript:ENSPMAT00000008724.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 67.0106 bits (162), Expect = 4.656e-14
Identity = 27/74 (36.49%), Postives = 48/74 (64.86%), Query Frame = 3
Query:  207 SNLPLQISLYFNAYYFPFWFIGMCLTLEQEFSRMSNIFRVINVALFILFSILEITRLIAGYSGNLAEKIPEFAG 428
            S+LPLQ+SLYF+A+Y+P W     + L  + + ++  + V+   + +  +++E++RL  GY+GNL EK+P  A 
Sbjct:   39 SSLPLQMSLYFSAFYYPCWVTSEAVMLATKTNVLATHYAVVLTTVLVFMAVIEMSRLYLGYAGNLGEKVPAAAA 112          
BLAST of Transmembrane protein 17 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008719.1 (pep scaffold:Pmarinus_7.0:GL487172:3406:7113:-1 gene:ENSPMAG00000007892.1 transcript:ENSPMAT00000008719.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 66.2402 bits (160), Expect = 8.114e-14
Identity = 26/70 (37.14%), Postives = 46/70 (65.71%), Query Frame = 3
Query:  207 SNLPLQISLYFNAYYFPFWFIGMCLTLEQEFSRMSNIFRVINVALFILFSILEITRLIAGYSGNLAEKIP 416
            S+LPLQ+SLYF+A+Y+P W     + L  +   ++  + V+   + +  +++E++RL  GY+GNL EK+P
Sbjct:   41 SSLPLQMSLYFSAFYYPCWVTSEAVMLATKHQYLATHYAVVLTTVLVFMAVIEMSRLYLGYAGNLGEKVP 110          
BLAST of Transmembrane protein 17 vs. Ensembl Nematostella
Match: EDO39291 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SAJ8])

HSP 1 Score: 121.324 bits (303), Expect = 1.430e-34
Identity = 58/145 (40.00%), Postives = 95/145 (65.52%), Query Frame = 3
Query:  189 TGFEYHSNLPLQISLYFNAYYFPFWFIGMCLTLEQEFSRMSNIFRVINVALFILFSILEITRLIAGYSGNLAEKIPEFAGFWLLTILVQLPAIFFLLFSTDMIISPFERSLHIIEASFIVFQAVIGIFVLKMMISYQRLKFLVSQ 623
             G E  S+LPLQ++LYFN Y+ PFWF+   + L  ++ ++   ++ + +A++I+ +I+E TRL  GY GNL EK+PE AGFWLLT+++Q P    LL +  M+I P ER+++I+   F++ + + G  V+K +  +Q  KF + Q
Sbjct:   11 VGNEIVSDLPLQMALYFNVYFSPFWFLTAFVILAAKYDKLDFYYKFVLIAIYIVMAIVESTRLYLGYLGNLHEKVPELAGFWLLTLVLQFPLTLVLLLNESMLIMPTERAMNILMTIFVLVEIIQGYRVIKALADHQVSKFHLHQ 155          
BLAST of Transmembrane protein 17 vs. Ensembl Medaka
Match: zgc:112294 (transmembrane protein 17A-like [Source:NCBI gene;Acc:101163086])

HSP 1 Score: 108.612 bits (270), Expect = 1.079e-28
Identity = 57/164 (34.76%), Postives = 91/164 (55.49%), Query Frame = 3
Query:  147 SDSDLEKQRLQKNRTGFEYH-SNLPLQISLYFNAYYFPFWFIGMCLTLEQEFSRMSNIFRVINVALFILFSILEITRLIAGYSGNLAEKIPEFAGFWLLTILVQLPAIFFLLFSTDMIISPFERSLHIIEASFIVFQAVIGIFVLKMMISYQRLKFLVSQPAKA 635
            +DSD  ++         EY  SNLPLQ+ LYFN +YFP W+    + L+ +F  ++  ++ + +   +L +I+E+ RL  GY GNL EK+PE A FWLL+   QLP + F +    ++I P ER +H++   F++ Q +     L+ M     L F + Q  +A
Sbjct:   30 ADSDFGREP--------EYQVSNLPLQMLLYFNLFYFPCWWFSAVVMLDIKFHHLAGYYQALLITGLVLVTIIEVIRLYLGYVGNLEEKVPELAAFWLLSFTFQLPVLLFFMTDEGILILPLERGIHLVYLLFLLAQILTSFMALRTMTQKLTLLFYLRQFGRA 185          
BLAST of Transmembrane protein 17 vs. Ensembl Medaka
Match: zgc:112294 (transmembrane protein 17A-like [Source:NCBI gene;Acc:101163086])

HSP 1 Score: 105.916 bits (263), Expect = 5.326e-28
Identity = 52/142 (36.62%), Postives = 82/142 (57.75%), Query Frame = 3
Query:  198 EYHSNLPLQISLYFNAYYFPFWFIGMCLTLEQEFSRMSNIFRVINVALFILFSILEITRLIAGYSGNLAEKIPEFAGFWLLTILVQLPAIFFLLFSTDMIISPFERSLHIIEASFIVFQAVIGIFVLKMMISYQRLKFLVSQ 623
            E  SNLPLQ+ LYFN +YFP W+    + L+ +F  ++  ++ + +   +L +I+E+ RL  GY GNL EK+PE A FWLL+   QLP + F +    ++I P ER +H++   F++ Q +     L+ M     L F + Q
Sbjct:   38 EQVSNLPLQMLLYFNLFYFPCWWFSAVVMLDIKFHHLAGYYQALLITGLVLVTIIEVIRLYLGYVGNLEEKVPELAAFWLLSFTFQLPVLLFFMTDEGILILPLERGIHLVYLLFLLAQILTSFMALRTMTQKLTLLFYLRQ 179          
BLAST of Transmembrane protein 17 vs. Ensembl Medaka
Match: tmem17 (transmembrane protein 17B [Source:NCBI gene;Acc:105354285])

HSP 1 Score: 97.8265 bits (242), Expect = 1.006e-24
Identity = 44/117 (37.61%), Postives = 77/117 (65.81%), Query Frame = 3
Query:  234 YFNAYYFPFWFIGMCLTLEQEFSRMSNIFRVINVALFILFSILEITRLIAGYSGNLAEKIPEFAGFWLLTILVQLPAIFFLLFSTDMIISPFERSLHIIEASFIVFQAVIGIFVLKM 584
            YFN  +FP+W+I   + L+ ++  + + ++ I V + +L +++E+ RL  GY+GNL EK+PE AGFWLL+IL+Q P + F LF+  ++I P ER++H++   F++ Q     F  ++
Sbjct:   45 YFNVCFFPWWWICETVMLQLKYPALPDYYKFILVTVLLLMTLIEVIRLYLGYAGNLQEKVPELAGFWLLSILLQFPLVLFQLFNEALLIQPLERAVHVVLCCFVLTQVRFCTFCCRL 161          
BLAST of Transmembrane protein 17 vs. Planmine SMEST
Match: SMESG000050386.1 (SMESG000050386.1)

HSP 1 Score: 413.69 bits (1062), Expect = 5.306e-149
Identity = 203/203 (100.00%), Postives = 203/203 (100.00%), Query Frame = 3
Query:   90 MFENKRNYVNNVIDHIFPISDSDLEKQRLQKNRTGFEYHSNLPLQISLYFNAYYFPFWFIGMCLTLEQEFSRMSNIFRVINVALFILFSILEITRLIAGYSGNLAEKIPEFAGFWLLTILVQLPAIFFLLFSTDMIISPFERSLHIIEASFIVFQAVIGIFVLKMMISYQRLKFLVSQPAKAPSRYQVPNNYYDEMNVYGKSK 698
            MFENKRNYVNNVIDHIFPISDSDLEKQRLQKNRTGFEYHSNLPLQISLYFNAYYFPFWFIGMCLTLEQEFSRMSNIFRVINVALFILFSILEITRLIAGYSGNLAEKIPEFAGFWLLTILVQLPAIFFLLFSTDMIISPFERSLHIIEASFIVFQAVIGIFVLKMMISYQRLKFLVSQPAKAPSRYQVPNNYYDEMNVYGKSK
Sbjct:    1 MFENKRNYVNNVIDHIFPISDSDLEKQRLQKNRTGFEYHSNLPLQISLYFNAYYFPFWFIGMCLTLEQEFSRMSNIFRVINVALFILFSILEITRLIAGYSGNLAEKIPEFAGFWLLTILVQLPAIFFLLFSTDMIISPFERSLHIIEASFIVFQAVIGIFVLKMMISYQRLKFLVSQPAKAPSRYQVPNNYYDEMNVYGKSK 203          
The following BLAST results are available for this feature:
BLAST of Transmembrane protein 17 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 1
Match NameE-valueIdentityDescription
TMEM172.076e-2241.18transmembrane protein 17 [Source:HGNC Symbol;Acc:H... [more]
back to top
BLAST of Transmembrane protein 17 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Transmembrane protein 17 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Transmembrane protein 17 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
tmem172.615e-3538.36transmembrane protein 17 [Source:NCBI gene;Acc:568... [more]
zgc:1122942.825e-3236.31zgc:112294 [Source:NCBI gene;Acc:553704][more]
zgc:1122942.925e-3237.72zgc:112294 [Source:NCBI gene;Acc:553704][more]
back to top
BLAST of Transmembrane protein 17 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Tmem17-b1.508e-2238.99transmembrane protein 17 [Source:NCBI gene;Acc:100... [more]
back to top
BLAST of Transmembrane protein 17 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Tmem172.239e-2241.30transmembrane protein 17 [Source:MGI Symbol;Acc:MG... [more]
back to top
BLAST of Transmembrane protein 17 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|A5D6V4|TM17B_DANRE1.974e-3438.36Transmembrane protein 17B OS=Danio rerio OX=7955 G... [more]
sp|E1BY51|TMM17_CHICK5.409e-3446.31Transmembrane protein 17 OS=Gallus gallus OX=9031 ... [more]
sp|Q502E0|TM17A_DANRE1.998e-3137.72Transmembrane protein 17A OS=Danio rerio OX=7955 G... [more]
sp|A4FUY9|TMM17_BOVIN4.034e-2241.83Transmembrane protein 17 OS=Bos taurus OX=9913 GN=... [more]
sp|F6RWY9|TM17B_XENTR7.991e-2238.99Transmembrane protein 17B OS=Xenopus tropicalis OX... [more]
back to top
BLAST of Transmembrane protein 17 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3P6PDS91.684e-5447.49Uncharacterized protein OS=Dibothriocephalus latus... [more]
G4VHQ11.062e-5150.29Putative transmembrane protein 17 OS=Schistosoma m... [more]
A0A183QJ434.113e-5158.16Uncharacterized protein OS=Schistosoma rodhaini OX... [more]
A0A430PYR74.970e-5049.43Transmembrane protein 17 OS=Schistosoma bovis OX=6... [more]
A0A095A2736.757e-4956.55Transmembrane protein 17B (Fragment) OS=Schistosom... [more]
back to top
BLAST of Transmembrane protein 17 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
tmem172.034e-3238.55transmembrane protein 17 [Source:NCBI gene;Acc:103... [more]
zgc:1122941.857e-3035.85transmembrane protein 17A-like [Source:NCBI gene;A... [more]
back to top
BLAST of Transmembrane protein 17 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSPMAT00000008724.14.656e-1436.49pep scaffold:Pmarinus_7.0:GL487172:3442:7113:-1 ge... [more]
ENSPMAT00000008719.18.114e-1437.14pep scaffold:Pmarinus_7.0:GL487172:3406:7113:-1 ge... [more]
back to top
BLAST of Transmembrane protein 17 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Transmembrane protein 17 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO392911.430e-3440.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Transmembrane protein 17 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
zgc:1122941.079e-2834.76transmembrane protein 17A-like [Source:NCBI gene;A... [more]
zgc:1122945.326e-2836.62transmembrane protein 17A-like [Source:NCBI gene;A... [more]
tmem171.006e-2437.61transmembrane protein 17B [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of Transmembrane protein 17 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000050386.15.306e-149100.00SMESG000050386.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30008862 ID=SMED30008862|Name=Transmembrane protein 17|organism=Schmidtea mediterranea sexual|type=transcript|length=714bp
GTAATATTTGCTGTAATTTTTATATTAATTTAAATTTTTATTAAATATTA
TATAAACATACATAAACTTCTAAATAAAAACTTTTTGAAATGTTTGAAAA
TAAAAGAAACTATGTTAACAATGTGATAGATCACATCTTCCCAATTTCAG
ATTCTGATCTCGAAAAACAAAGATTACAGAAAAATAGAACTGGATTTGAG
TATCACTCTAATTTACCATTGCAAATATCTTTGTATTTCAATGCTTATTA
TTTTCCATTTTGGTTTATCGGGATGTGCTTGACACTTGAACAAGAATTTA
GCAGGATGAGTAATATATTCCGAGTTATAAATGTAGCGCTGTTCATCTTG
TTTTCAATTCTGGAAATAACTAGATTAATTGCCGGATATTCTGGAAACTT
AGCGGAGAAAATTCCAGAATTTGCCGGATTCTGGCTATTAACAATTTTGG
TTCAGTTACCAGCGATTTTCTTTTTGCTCTTTTCTACGGATATGATCATT
TCGCCTTTCGAGCGGTCATTGCACATTATTGAGGCGTCATTTATCGTATT
CCAGGCCGTCATTGGAATATTTGTGCTGAAAATGATGATCAGTTACCAGA
GATTGAAGTTCCTGGTGTCCCAGCCGGCGAAAGCTCCATCTAGATATCAA
GTTCCCAACAATTATTACGACGAAATGAATGTCTATGGAAAAAGCAAATA
AATTCATAAATTTT
back to top

protein sequence of SMED30008862-orf-1

>SMED30008862-orf-1 ID=SMED30008862-orf-1|Name=SMED30008862-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=204bp
MFENKRNYVNNVIDHIFPISDSDLEKQRLQKNRTGFEYHSNLPLQISLYF
NAYYFPFWFIGMCLTLEQEFSRMSNIFRVINVALFILFSILEITRLIAGY
SGNLAEKIPEFAGFWLLTILVQLPAIFFLLFSTDMIISPFERSLHIIEAS
FIVFQAVIGIFVLKMMISYQRLKFLVSQPAKAPSRYQVPNNYYDEMNVYG
KSK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR019184Uncharacterised_TM-17
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR019184Uncharacterised protein family, transmembrane-17PFAMPF09799Transmemb_17coord: 46..151
e-value: 3.6E-25
score: 88.6
IPR019184Uncharacterised protein family, transmembrane-17PANTHERPTHR13531FAMILY NOT NAMEDcoord: 4..188
NoneNo IPR availablePANTHERPTHR13531:SF6TMEM (HUMAN TRANSMEMBRANE PROTEIN) HOMOLOGcoord: 4..188
NoneNo IPR availableTMHMMTMhelixcoord: 77..99
NoneNo IPR availableTMHMMTMhelixcoord: 146..163
NoneNo IPR availableTMHMMTMhelixcoord: 40..62
NoneNo IPR availableTMHMMTMhelixcoord: 112..131