Copper-transporting ATPase 1

Overview
NameCopper-transporting ATPase 1
Smed IDSMED30008855
Length (bp)3467
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Copper-transporting ATPase 1 (SMED30008855) t-SNE clustered cells

Violin plots show distribution of expression levels for Copper-transporting ATPase 1 (SMED30008855) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Copper-transporting ATPase 1 (SMED30008855) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Copper-transporting ATPase 1 (SMED30008855) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30008855

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30008855h1SMcG0013526 dd_Smed_v4_8956_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30008855h1SMcG0013526 dd_Smed_v4_8956_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30008855h1SMcG0013526 dd_Smed_v4_8956_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30008855h1SMcG0013526 dd_Smed_v4_8956_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
tail regionSMED30008855h1SMcG0013526 dd_Smed_v6_8956_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
gutSMED30008855h1SMcG0013526 SMED30008855smed_20140614PMID:26457503
Tu et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
cephalic gangliaSMED30008855h1SMcG0013526 SMED30008855smed_20140614PMID:26457503
Tu et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymaSMED30008855h1SMcG0013526 SMED30008855smed_20140614PMID:26457503
Tu et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Copper-transporting ATPase 1 vs. Ensembl Human
Match: ATP7B (ATPase copper transporting beta [Source:HGNC Symbol;Acc:HGNC:870])

HSP 1 Score: 821.231 bits (2120), Expect = 0.000e+0
Identity = 450/931 (48.34%), Postives = 611/931 (65.63%), Query Frame = 1
Query:  259 LINKNKETDNTKELFKCHMRIQGMTCSSCVHTIENQVLKLKGVKSALINLLSTIGEVTYDPDLIMASDIADTINDMGFDAEIFQFKEHTKDIIEVMIQGMTCSSCVYTIESKLAQMQGILSVKVALTTEKGKFKFDPQIISPRDILDAIEEMGFDAKLAPKKTNKYN-DHVGESIKKWKHSFLISLIFGVPTMIVMMVFMYGFSHRMQVIHLKNGINVTVMVSNAPIXXXXXXXXXXXXXXXXXPVQFYGARYFYVQAYKSIKHGSANMDVLVVMATSVSYIYSFIVILVSMILRQDSSPQTFFETTPMLIVFLSLGRWLEHIAKGKTSEALSKLLSLQAFEATIIV--NDN---QERKISXXXXXXXXXXXXXPGEKIPIDGRVVSGKSRCDESLITGESMSVEKIPGSDVIGGTLNISGMLIIRATLVGEDSALNQIVKLVEEAQTSKAPIQELADKVAGLFVPGVIICSMFTLLIWIAIG----------YTNPNLLPGHSSINTDNTELIWKYAFQLAITVLSVACPCSLGLATPTAVMVGTGVGAINGILIKGGVPLEKMHQLDVIVFDKTGTITTGKPSVTNFVMCVENVTSQIRNCILLMLGAAESSSEHPIGKAILQYVRETCDINEMPQVVHSKSVSGFGLECSLKLQSDMFVPDSEIDNVLVKINDFQENNLTENLKET-SVKWRKINEPVEVVLYLGNRNMMKENHISIPDKLDELMSRDEDNGRTVVLMAIDKVLLAMISIADQVKKEAALVVYTLEKMGVEVFLLTGDNHKTATAIAKEIGIRNVFAEVLPSHKVAKIQQIQNMSKYKRSWLFSCCSKPSKLTNVAMVGDGINDSPALAQADVGIAIGTGTDVAVEAADVVLIRNSLLDVIAAMKLSKDTVRRIRQNFVAATMYNLIGIPIAAGALMPIGVVFMPWMA 3000
            ++ K+ ++       KC ++I+GMTC+SCV  IE  + K  GV S L+ L++   E+ YDP++I   +IA  I D+GF+A + +    +   IE+ I GMTC+SCV+ IESKL +  GI    VAL T K   KFDP+II PRDI+  IEE+GF A LA +  N ++ DH  E IK+WK SFL SL+FG+P M +M+  +   +   Q + L + I   + + N                     VQ  G  YFYVQAYKS++H SANMDVL+V+ATS++Y+YS ++++V++  + + SP TFF+T PML VF++LGRWLEH+AK KTSEAL+KL+SLQA EAT++    DN   +E ++ ++LV++GD+VKV+PG K P+DG+V+ G +  DESLITGE+M V K PGS VI G++N  G ++I+AT VG D+ L QIVKLVEEAQ SKAPIQ+LAD+ +G FVP +II S  TL++WI IG          + NPN        +   TE+I ++AFQ +ITVL +ACPCSLGLATPTAVMVGTGV A NGILIKGG PLE  H++  ++FDKTGTIT G P V   ++  +  T  +R  +L ++G AE+SSEHP+G A+ +Y +E      +      ++V G G+ C +          S ++ +L   ++   +    +L E  S+   K   P    + +GNR  ++ N ++I   + + M+  E  G+T +L+AID VL  MI+IAD VK+EAAL V+TL+ MGV+V L+TGDN KTA AIA ++GI  VFAEVLPSHKVAK+Q++QN  K                  VAMVGDG+NDSPALAQAD+G+AIGTGTDVA+EAADVVLIRN LLDV+A++ LSK TVRRIR N V A +YNL+GIPIAAG  MPIG+V  PWM 
Sbjct:  474 ILAKSPQSTRAVAPQKCFLQIKGMTCASCVSNIERNLQKEAGVLSVLVALMAGKAEIKYDPEVIQPLEIAQFIQDLGFEAAVMEDYAGSDGNIELTITGMTCASCVHNIESKLTRTNGITYASVALATSKALVKFDPEIIGPRDIIKIIEEIGFHASLAQRNPNAHHLDHKME-IKQWKKSFLCSLVFGIPVMALMIYMLIPSNEPHQSMVLDHNIIPGLSILNLIFFILCTF------------VQLLGGWYFYVQAYKSLRHRSANMDVLIVLATSIAYVYSLVILVVAVAEKAERSPVTFFDTPPMLFVFIALGRWLEHLAKSKTSEALAKLMSLQATEATVVTLGEDNLIIREEQVPMELVQRGDIVKVVPGGKFPVDGKVLEGNTMADESLITGEAMPVTKKPGSTVIAGSINAHGSVLIKATHVGNDTTLAQIVKLVEEAQMSKAPIQQLADRFSGYFVPFIIIMSTLTLVVWIVIGFIDFGVVQRYFPNPNK-------HISQTEVIIRFAFQTSITVLCIACPCSLGLATPTAVMVGTGVAAQNGILIKGGKPLEMAHKIKTVMFDKTGTITHGVPRVMRVLLLGDVATLPLRK-VLAVVGTAEASSEHPLGVAVTKYCKEELGTETLGYCTDFQAVPGCGIGCKV----------SNVEGILAH-SERPLSAPASHLNEAGSLPAEKDAVPQTFSVLIGNREWLRRNGLTISSDVSDAMTDHEMKGQTAILVAIDGVLCGMIAIADAVKQEAALAVHTLQSMGVDVVLITGDNRKTARAIATQVGINKVFAEVLPSHKVAKVQELQNKGK-----------------KVAMVGDGVNDSPALAQADMGVAIGTGTDVAIEAADVVLIRNDLLDVVASIHLSKRTVRRIRINLVLALIYNLVGIPIAAGVFMPIGIVLQPWMG 1355          

HSP 2 Score: 112.079 bits (279), Expect = 3.271e-24
Identity = 53/152 (34.87%), Postives = 91/152 (59.87%), Query Frame = 1
Query:  313 MRIQGMTCSSCVHTIENQVLKLKGVKSALINLLSTIGEVTYDPDLIMASDIADTINDMGFDAEIFQFKEHT---------KDIIEVMIQGMTCSSCVYTIESKLAQMQGILSVKVALTTEKGKFKFDPQIISPRDILDAIEEMGFDAKLAPK 741
            +RI GMTC SCV +IE+++  LKG+ S  ++L      V Y P ++    +   I DMGF+A I + K  +         + ++++ ++GMTC SCV +IE K+ ++QG++ VKV+L+ ++    + P +I P D+ D + +MGF+A +  K
Sbjct:   62 VRILGMTCQSCVKSIEDRISNLKGIISMKVSLEQGSATVKYVPSVVCLQQVCHQIGDMGFEASIAEGKAASWPSRSLPAQEAVVKLRVEGMTCQSCVSSIEGKVRKLQGVVRVKVSLSNQEAVITYQPYLIQPEDLRDHVNDMGFEAAIKSK 213          

HSP 3 Score: 92.4337 bits (228), Expect = 3.607e-18
Identity = 57/192 (29.69%), Postives = 86/192 (44.79%), Query Frame = 1
Query:  313 MRIQGMTCSSCVHTIENQVLKLKGVKSALINLLSTIGEVTYDPDLIMASDIADTINDMGFDAEI----------------FQFKEHTKDI----------------------IEVMIQGMTCSSCVYTIESKLAQMQGILSVKVALTTEKGKFKFDPQIISPRDILDAIEEM---GFDAKLAPKKTNKYNDH 765
            +R++GMTC SCV +IE +V KL+GV    ++L +    +TY P LI   D+ D +NDMGF+A I                 Q     + +                      +++ I GM C SCV  IE  + Q+ G+ S++V+L  +  + K+DP   SP  +  AIE +    F   L         DH
Sbjct:  147 LRVEGMTCQSCVSSIEGKVRKLQGVVRVKVSLSNQEAVITYQPYLIQPEDLRDHVNDMGFEAAIKSKVAPLSLGPIDIERLQSTNPKRPLSSANQNFNNSETLGHQGSHVVTLQLRIDGMHCKSCVLNIEENIGQLLGVQSIQVSLENKTAQVKYDPSCTSPVALQRAIEALPPGNFKVSLPDGAEGSGTDH 338          

HSP 4 Score: 83.1889 bits (204), Expect = 2.258e-15
Identity = 51/180 (28.33%), Postives = 82/180 (45.56%), Query Frame = 1
Query:  310 HMRIQGMTCSSCVHTIENQVLKLKGVKSALINLLSTIGEVTYDPDLI----------------MASDIADTINDMGFDAEIFQFK----------EHTKDIIEVMIQGMTCSSCVYTIESKLAQMQGILSVKVALTTEKGKFKFDPQIISPRDILDAIEEMGFDAKLAPK--KTNKYNDH 765
             +RI GM C SCV  IE  + +L GV+S  ++L +   +V YDP                       + D     G D                 + T     + I GMTC+SCV++IE  ++Q++G+  + V+L        ++P +ISP ++  AIE+MGF+A +  +   TN   +H
Sbjct:  260 QLRIDGMHCKSCVLNIEENIGQLLGVQSIQVSLENKTAQVKYDPSCTSPVALQRAIEALPPGNFKVSLPDGAEGSGTDHRSSSSHSPGSPPRNQVQGTCSTTLIAIAGMTCASCVHSIEGMISQLEGVQQISVSLAEGTATVLYNPSVISPEELRAAIEDMGFEASVVSESCSTNPLGNH 439          

HSP 5 Score: 58.151 bits (139), Expect = 1.159e-7
Identity = 26/72 (36.11%), Postives = 44/72 (61.11%), Query Frame = 1
Query:  541 VMIQGMTCSSCVYTIESKLAQMQGILSVKVALTTEKGKFKFDPQIISPRDILDAIEEMGFDAKLAPKKTNKY 756
            V I GMTC SCV +IE +++ ++GI+S+KV+L       K+ P ++  + +   I +MGF+A +A  K   +
Sbjct:   62 VRILGMTCQSCVKSIEDRISNLKGIISMKVSLEQGSATVKYVPSVVCLQQVCHQIGDMGFEASIAEGKAASW 133          
BLAST of Copper-transporting ATPase 1 vs. Ensembl Human
Match: ATP7A (ATPase copper transporting alpha [Source:HGNC Symbol;Acc:HGNC:869])

HSP 1 Score: 820.461 bits (2118), Expect = 0.000e+0
Identity = 459/931 (49.30%), Postives = 627/931 (67.35%), Query Frame = 1
Query:  274 KETDNTKELFKCHMRIQGMTCSSCVHTIENQVLKLKGVKSALINLLSTIGEVTYDPDLIMASDIADTINDMGFDAEIFQFKEHTKDIIEVMIQGMTCSSCVYTIESKLAQMQGILSVKVALTTEKGKFKFDPQIISPRDILDAIEEMGFDAKLAPK-KTNKYNDHVGESIKKWKHSFLISLIFGVPTM---IVMMVFMYGFS--HRMQVIHLKNGINVTVMVSNAPIXXXXXXXXXXXXXXXXXPVQFYGARYFYVQAYKSIKHGSANMDVLVVMATSVSYIYSFIVILVSMILRQDSSPQTFFETTPMLIVFLSLGRWLEHIAKGKTSEALSKLLSLQAFEATIIVNDN-----QERKISXXXXXXXXXXXXXPGEKIPIDGRVVSGKSRCDESLITGESMSVEKIPGSDVIGGTLNISGMLIIRATLVGEDSALNQIVKLVEEAQTSKAPIQELADKVAGLFVPGVIICSMFTLLIWIAIGYTN----PNLLPGHSSINTDNTELIWKYAFQLAITVLSVACPCSLGLATPTAVMVGTGVGAINGILIKGGVPLEKMHQLDVIVFDKTGTITTGKPSVTNFVMCVENVTSQIRNCILLMLGAAESSSEHPIGKAILQYVRETCDINEMPQVVHSKSVSGFGLEC------SLKLQSDMFVPDSEIDNV-LVKINDFQENNLTENLKETSVKWRKINEPVEVVLYLGNRNMMKENHISIPDKLDELMSRDEDNGRTVVLMAIDKVLLAMISIADQVKKEAALVVYTLEKMGVEVFLLTGDNHKTATAIAKEIGIRNVFAEVLPSHKVAKIQQIQNMSKYKRSWLFSCCSKPSKLTNVAMVGDGINDSPALAQADVGIAIGTGTDVAVEAADVVLIRNSLLDVIAAMKLSKDTVRRIRQNFVAATMYNLIGIPIAAGALMPIGVVFMPWMA 3000
            ++ +  K   KC++++ GMTC+SCV  IE  + + +G+ S L+ L++   EV Y+P +I    IA+ I ++GF A + +  +    ++E++++GMTC+SCV+ IES L + +GIL   VAL T K   K+DP+II PRDI+  IE +GF+A L  K ++  + DH  E I++W+ SFL+SL F +P M   I MMV  + F+  H  Q +  +  IN+   +     + PGLS+ NLL FL   PVQF+G  YFY+QAYK++KH +ANMDVL+V+AT++++ YS I++LV+M  R   +P TFF+T PML VF++LGRWLEHIAKGKTSEAL+KL+SLQA EATI+  D+      E ++ V+LV++GD++KV+PG K P+DGRV+ G S  DESLITGE+M V K PGS VI G++N +G L+I AT VG D+ L+QIVKLVEEAQTSKAPIQ+ ADK++G FVP ++  S+ TLL+WI IG+ N        PG++  +   TE I ++AFQ +ITVL +ACPCSLGLATPTAVMVGTGVGA NGILIKGG PLE  H++ V+VFDKTGTIT G P V N V  +        + IL ++G AES+SEHP+G AI +Y ++  D   +   +  + V G G+ C       L  +++  + D+ I N  LV+I+   E + T +      +        +  + +GNR  M  N + I + +++ M+  E  GRT VL+A+D  L  +I+IAD VK EA L ++ L+ MG+EV L+TGDN KTA +IA ++GI  VFAEVLPSHKVAK++Q+Q   K                  VAMVGDGINDSPALA A+VGIAIGTGTDVA+EAADVVLIRN LLDV+A++ LS+ TV+RIR NFV A +YNL+GIPIAAG  MPIG+V  PWM 
Sbjct:  479 QDKEEGKNSSKCYIQVTGMTCASCVANIERNLRREEGIYSILVALMAGKAEVRYNPAVIQPPMIAEFIRELGFGATVIENADEGDGVLELVVRGMTCASCVHKIESSLTKHRGILYCSVALATNKAHIKYDPEIIGPRDIIHTIESLGFEASLVKKDRSASHLDHKRE-IRQWRRSFLVSLFFCIPVMGLMIYMMVMDHHFATLHHNQNMSKEEMINLHSSMFLERQILPGLSVMNLLSFLLCVPVQFFGGWYFYIQAYKALKHKTANMDVLIVLATTIAFAYSLIILLVAMYERAKVNPITFFDTPPMLFVFIALGRWLEHIAKGKTSEALAKLISLQATEATIVTLDSDNILLSEEQVDVELVQRGDIIKVVPGGKFPVDGRVIEGHSMVDESLITGEAMPVAKKPGSTVIAGSINQNGSLLICATHVGADTTLSQIVKLVEEAQTSKAPIQQFADKLSGYFVPFIVFVSIATLLVWIVIGFLNFEIVETYFPGYNR-SISRTETIIRFAFQASITVLCIACPCSLGLATPTAVMVGTGVGAQNGILIKGGEPLEMAHKVKVVVFDKTGTITHGTP-VVNQVKVLTESNRISHHKILAIVGTAESNSEHPLGTAITKYCKQELDTETLGTCIDFQVVPGCGISCKVTNIEGLLHKNNWNIEDNNIKNASLVQIDASNEQSSTSSSMIIDAQISNALNAQQYKVLIGNREWMIRNGLVINNDVNDFMTEHERKGRTAVLVAVDDELCGLIAIADTVKPEAELAIHILKSMGLEVVLMTGDNSKTARSIASQVGITKVFAEVLPSHKVAKVKQLQEEGK-----------------RVAMVGDGINDSPALAMANVGIAIGTGTDVAIEAADVVLIRNDLLDVVASIDLSRKTVKRIRINFVFALIYNLVGIPIAAGVFMPIGLVLQPWMG 1389          

HSP 2 Score: 97.0561 bits (240), Expect = 1.678e-19
Identity = 61/173 (35.26%), Postives = 84/173 (48.55%), Query Frame = 1
Query:  313 MRIQGMTCSSCVHTIENQVLKLKGVKSALINLLSTIGEVTYDPDLIMASDIADTINDMGFDAEI---------------------------------FQFKEHTKDIIEVMIQ--GMTCSSCVYTIESKLAQMQGILSVKVALTTEKGKFKFDPQIISPRDILDAIEEMGFDA 726
            + I GMTC+SCV +IE  + K  GVKS  ++L ++ G V YDP L     +   I DMGFDA +                                  Q KE  K+  +  IQ  GMTC+SCV  IE  L + +GI S+ VAL   K + +++P +I P  I + I E+GF A
Sbjct:  381 INIDGMTCNSCVQSIEGVISKKPGVKSIRVSLANSNGTVEYDPLLTSPETLRGAIEDMGFDATLSDTNEPLVVIAQPSSEMPLLTSTNEFYTKGMTPVQDKEEGKNSSKCYIQVTGMTCASCVANIERNLRREEGIYSILVALMAGKAEVRYNPAVIQPPMIAEFIRELGFGA 553          

HSP 3 Score: 73.1738 bits (178), Expect = 3.110e-12
Identity = 47/162 (29.01%), Postives = 76/162 (46.91%), Query Frame = 1
Query:  313 MRIQGMTCSSCVHTIENQVLKLKGVKSALINLLSTIGEVTYDPDLIMASDIADTINDMGFDAEIFQFKEHTK-DIIEV-----------------------------MIQGMTCSSCVYTIESKLAQMQGILSVKVALTTEKGKFKFDPQIISPRDILDAIE 708
            M+++GMTC SC  TIE ++ KL+GV+   ++L +    + Y P LI   ++   I  MGF A + +  ++ K   I+V                             +I GM C SCV  IES L+ +Q + S+ V+L       K++   ++P  +  AIE
Sbjct:  175 MKVEGMTCHSCTSTIEGKIGKLQGVQRIKVSLDNQEATIVYQPHLISVEEMKKQIEAMGFPAFVKKQPKYLKLGAIDVERLKNTPVKSSEGSQQRSPSYTNDSTATFIIDGMHCKSCVSNIESTLSALQYVSSIVVSLENRSAIVKYNASSVTPESLRKAIE 336          

HSP 4 Score: 71.633 bits (174), Expect = 8.733e-12
Identity = 49/170 (28.82%), Postives = 80/170 (47.06%), Query Frame = 1
Query:  313 MRIQGMTCSSCVHTIENQVLKLKGVKSALINLLSTIGEVTYDPDLIMASDIADTINDMGFDAEIFQFKEHTKDIIEVMIQG--MTCSSCVYT----IESKLAQMQGILSVKVALTTEKGKFKFDPQIISPRDILDAIEEMGFDAKLAPKKTNKYNDH----VGESIKKWK 792
            + ++GMTC+SCV TIE Q+ K+ GV    ++L      + YDP L     + + I+DMGFDA I     H  D + V+     +T ++ +      I+S L + +G+  +K+            P I++   I + + E+  D     KK+    DH     GE + K K
Sbjct:   12 ISVEGMTCNSCVWTIEQQIGKVNGVHHIKVSLEEKNATIIYDPKLQTPKTLQEAIDDMGFDAVI-----HNPDPLPVLTDTLFLTVTASLTLPWDHIQSTLLKTKGVTDIKIYPQKRTVAVTIIPSIVNANQIKELVPELSLDTGTLEKKSGACEDHSMAQAGEVVLKMK 176          

HSP 5 Score: 70.4774 bits (171), Expect = 1.839e-11
Identity = 47/164 (28.66%), Postives = 78/164 (47.56%), Query Frame = 1
Query:  319 IQGMTCSSCVHTIENQVLKLKGVKSALINLLSTIGEVTYDPDLIMASDIADTINDMG---FDAEIFQFKEH----------------------TKDIIEVMIQGMTCSSCVYTIESKLAQMQGILSVKVALTTEKGKFKFDPQIISPRDILDAIEEMGFDAKLA 735
            I GM C SCV  IE+ +  L+ V S +++L +    V Y+   +    +   I  +    +   I    E                       T++ + + I GMTC+SCV +IE  +++  G+ S++V+L    G  ++DP + SP  +  AIE+MGFDA L+
Sbjct:  283 IDGMHCKSCVSNIESTLSALQYVSSIVVSLENRSAIVKYNASSVTPESLRKAIEAVSPGLYRVSITSEVESTSNSPSSSSLQKIPLNVVSQPLTQETV-INIDGMTCNSCVQSIEGVISKKPGVKSIRVSLANSNGTVEYDPLLTSPETLRGAIEDMGFDATLS 445          

HSP 6 Score: 70.4774 bits (171), Expect = 1.918e-11
Identity = 55/190 (28.95%), Postives = 95/190 (50.00%), Query Frame = 1
Query:  226 TLCEAIENLGF---LINKNKETDNTKELFKCHMRIQGMTCSSCVHTIENQVLKLKGVKSALINLLSTIGEVTYDPDLIMASDIADTINDMGFDAEIFQFK-----EHT-----KDIIEVMIQGMTCSSCVYTIESKLAQMQGILSVKVALTTEKGKFKFDPQIISPRDILDAIEEMGFDAKLAPKKTNKY 756
            TL EAI+++GF   + N +     T  LF   + +         H I++ +LK KGV    I        VT  P ++ A+ I + + ++  D    + K     +H+     + ++++ ++GMTC SC  TIE K+ ++QG+  +KV+L  ++    + P +IS  ++   IE MGF A +  KK  KY
Sbjct:   61 TLQEAIDDMGFDAVIHNPDPLPVLTDTLF---LTVTASLTLPWDH-IQSTLLKTKGVTDIKIYPQKRTVAVTIIPSIVNANQIKELVPELSLDTGTLEKKSGACEDHSMAQAGEVVLKMKVEGMTCHSCTSTIEGKIGKLQGVQRIKVSLDNQEATIVYQPHLISVEEMKKQIEAMGFPAFV--KKQPKY 244          

HSP 7 Score: 65.4698 bits (158), Expect = 6.101e-10
Identity = 24/64 (37.50%), Postives = 47/64 (73.44%), Query Frame = 1
Query:  535 IEVMIQGMTCSSCVYTIESKLAQMQGILSVKVALTTEKGKFKFDPQIISPRDILDAIEEMGFDA 726
            + + ++GMTC+SCV+TIE ++ ++ G+  +KV+L  +     +DP++ +P+ + +AI++MGFDA
Sbjct:   10 VTISVEGMTCNSCVWTIEQQIGKVNGVHHIKVSLEEKNATIIYDPKLQTPKTLQEAIDDMGFDA 73          
BLAST of Copper-transporting ATPase 1 vs. Ensembl Human
Match: ATP7B (ATPase copper transporting beta [Source:HGNC Symbol;Acc:HGNC:870])

HSP 1 Score: 819.691 bits (2116), Expect = 0.000e+0
Identity = 450/931 (48.34%), Postives = 611/931 (65.63%), Query Frame = 1
Query:  259 LINKNKETDNTKELFKCHMRIQGMTCSSCVHTIENQVLKLKGVKSALINLLSTIGEVTYDPDLIMASDIADTINDMGFDAEIFQFKEHTKDIIEVMIQGMTCSSCVYTIESKLAQMQGILSVKVALTTEKGKFKFDPQIISPRDILDAIEEMGFDAKLAPKKTNKYN-DHVGESIKKWKHSFLISLIFGVPTMIVMMVFMYGFSHRMQVIHLKNGINVTVMVSNAPIXXXXXXXXXXXXXXXXXPVQFYGARYFYVQAYKSIKHGSANMDVLVVMATSVSYIYSFIVILVSMILRQDSSPQTFFETTPMLIVFLSLGRWLEHIAKGKTSEALSKLLSLQAFEATIIV--NDN---QERKISXXXXXXXXXXXXXPGEKIPIDGRVVSGKSRCDESLITGESMSVEKIPGSDVIGGTLNISGMLIIRATLVGEDSALNQIVKLVEEAQTSKAPIQELADKVAGLFVPGVIICSMFTLLIWIAIG----------YTNPNLLPGHSSINTDNTELIWKYAFQLAITVLSVACPCSLGLATPTAVMVGTGVGAINGILIKGGVPLEKMHQLDVIVFDKTGTITTGKPSVTNFVMCVENVTSQIRNCILLMLGAAESSSEHPIGKAILQYVRETCDINEMPQVVHSKSVSGFGLECSLKLQSDMFVPDSEIDNVLVKINDFQENNLTENLKET-SVKWRKINEPVEVVLYLGNRNMMKENHISIPDKLDELMSRDEDNGRTVVLMAIDKVLLAMISIADQVKKEAALVVYTLEKMGVEVFLLTGDNHKTATAIAKEIGIRNVFAEVLPSHKVAKIQQIQNMSKYKRSWLFSCCSKPSKLTNVAMVGDGINDSPALAQADVGIAIGTGTDVAVEAADVVLIRNSLLDVIAAMKLSKDTVRRIRQNFVAATMYNLIGIPIAAGALMPIGVVFMPWMA 3000
            ++ K+ ++       KC ++I+GMTC+SCV  IE  + K  GV S L+ L++   E+ YDP++I   +IA  I D+GF+A + +    +   IE+ I GMTC+SCV+ IESKL +  GI    VAL T K   KFDP+II PRDI+  IEE+GF A LA +  N ++ DH  E IK+WK SFL SL+FG+P M +M+  +   +   Q + L + I   + + N                     VQ  G  YFYVQAYKS++H SANMDVL+V+ATS++Y+YS ++++V++  + + SP TFF+T PML VF++LGRWLEH+AK KTSEAL+KL+SLQA EAT++    DN   +E ++ ++LV++GD+VKV+PG K P+DG+V+ G +  DESLITGE+M V K PGS VI G++N  G ++I+AT VG D+ L QIVKLVEEAQ SKAPIQ+LAD+ +G FVP +II S  TL++WI IG          + NPN        +   TE+I ++AFQ +ITVL +ACPCSLGLATPTAVMVGTGV A NGILIKGG PLE  H++  ++FDKTGTIT G P V   ++  +  T  +R  +L ++G AE+SSEHP+G A+ +Y +E      +      ++V G G+ C +          S ++ +L   ++   +    +L E  S+   K   P    + +GNR  ++ N ++I   + + M+  E  G+T +L+AID VL  MI+IAD VK+EAAL V+TL+ MGV+V L+TGDN KTA AIA ++GI  VFAEVLPSHKVAK+Q++QN  K                  VAMVGDG+NDSPALAQAD+G+AIGTGTDVA+EAADVVLIRN LLDV+A++ LSK TVRRIR N V A +YNL+GIPIAAG  MPIG+V  PWM 
Sbjct:  363 ILAKSPQSTRAVAPQKCFLQIKGMTCASCVSNIERNLQKEAGVLSVLVALMAGKAEIKYDPEVIQPLEIAQFIQDLGFEAAVMEDYAGSDGNIELTITGMTCASCVHNIESKLTRTNGITYASVALATSKALVKFDPEIIGPRDIIKIIEEIGFHASLAQRNPNAHHLDHKME-IKQWKKSFLCSLVFGIPVMALMIYMLIPSNEPHQSMVLDHNIIPGLSILNLIFFILCTF------------VQLLGGWYFYVQAYKSLRHRSANMDVLIVLATSIAYVYSLVILVVAVAEKAERSPVTFFDTPPMLFVFIALGRWLEHLAKSKTSEALAKLMSLQATEATVVTLGEDNLIIREEQVPMELVQRGDIVKVVPGGKFPVDGKVLEGNTMADESLITGEAMPVTKKPGSTVIAGSINAHGSVLIKATHVGNDTTLAQIVKLVEEAQMSKAPIQQLADRFSGYFVPFIIIMSTLTLVVWIVIGFIDFGVVQRYFPNPNK-------HISQTEVIIRFAFQTSITVLCIACPCSLGLATPTAVMVGTGVAAQNGILIKGGKPLEMAHKIKTVMFDKTGTITHGVPRVMRVLLLGDVATLPLRK-VLAVVGTAEASSEHPLGVAVTKYCKEELGTETLGYCTDFQAVPGCGIGCKV----------SNVEGILAH-SERPLSAPASHLNEAGSLPAEKDAVPQTFSVLIGNREWLRRNGLTISSDVSDAMTDHEMKGQTAILVAIDGVLCGMIAIADAVKQEAALAVHTLQSMGVDVVLITGDNRKTARAIATQVGINKVFAEVLPSHKVAKVQELQNKGK-----------------KVAMVGDGVNDSPALAQADMGVAIGTGTDVAIEAADVVLIRNDLLDVVASIHLSKRTVRRIRINLVLALIYNLVGIPIAAGVFMPIGIVLQPWMG 1244          

HSP 2 Score: 112.079 bits (279), Expect = 3.914e-24
Identity = 53/152 (34.87%), Postives = 91/152 (59.87%), Query Frame = 1
Query:  313 MRIQGMTCSSCVHTIENQVLKLKGVKSALINLLSTIGEVTYDPDLIMASDIADTINDMGFDAEIFQFKEHT---------KDIIEVMIQGMTCSSCVYTIESKLAQMQGILSVKVALTTEKGKFKFDPQIISPRDILDAIEEMGFDAKLAPK 741
            +RI GMTC SCV +IE+++  LKG+ S  ++L      V Y P ++    +   I DMGF+A I + K  +         + ++++ ++GMTC SCV +IE K+ ++QG++ VKV+L+ ++    + P +I P D+ D + +MGF+A +  K
Sbjct:   62 VRILGMTCQSCVKSIEDRISNLKGIISMKVSLEQGSATVKYVPSVVCLQQVCHQIGDMGFEASIAEGKAASWPSRSLPAQEAVVKLRVEGMTCQSCVSSIEGKVRKLQGVVRVKVSLSNQEAVITYQPYLIQPEDLRDHVNDMGFEAAIKSK 213          

HSP 3 Score: 57.7658 bits (138), Expect = 1.329e-7
Identity = 26/72 (36.11%), Postives = 44/72 (61.11%), Query Frame = 1
Query:  541 VMIQGMTCSSCVYTIESKLAQMQGILSVKVALTTEKGKFKFDPQIISPRDILDAIEEMGFDAKLAPKKTNKY 756
            V I GMTC SCV +IE +++ ++GI+S+KV+L       K+ P ++  + +   I +MGF+A +A  K   +
Sbjct:   62 VRILGMTCQSCVKSIEDRISNLKGIISMKVSLEQGSATVKYVPSVVCLQQVCHQIGDMGFEASIAEGKAASW 133          
BLAST of Copper-transporting ATPase 1 vs. Ensembl Human
Match: ATP7B (ATPase copper transporting beta [Source:HGNC Symbol;Acc:HGNC:870])

HSP 1 Score: 749.584 bits (1934), Expect = 0.000e+0
Identity = 428/931 (45.97%), Postives = 580/931 (62.30%), Query Frame = 1
Query:  259 LINKNKETDNTKELFKCHMRIQGMTCSSCVHTIENQVLKLKGVKSALINLLSTIGEVTYDPDLIMASDIADTINDMGFDAEIFQFKEHTKDIIEVMIQGMTCSSCVYTIESKLAQMQGILSVKVALTTEKGKFKFDPQIISPRDILDAIEEMGFDAKLAPKKTNKYN-DHVGESIKKWKHSFLISLIFGVPTMIVMMVFMYGFSHRMQVIHLKNGINVTVMVSNAPIXXXXXXXXXXXXXXXXXPVQFYGARYFYVQAYKSIKHGSANMDVLVVMATSVSYIYSFIVILVSMILRQDSSPQTFFETTPMLIVFLSLGRWLEHIAKGKTSEALSKLLSLQAFEATIIV--NDN---QERKISXXXXXXXXXXXXXPGEKIPIDGRVVSGKSRCDESLITGESMSVEKIPGSDVIGGTLNISGMLIIRATLVGEDSALNQIVKLVEEAQTSKAPIQELADKVAGLFVPGVIICSMFTLLIWIAIGY----------TNPNLLPGHSSINTDNTELIWKYAFQLAITVLSVACPCSLGLATPTAVMVGTGVGAINGILIKGGVPLEKMHQLDVIVFDKTGTITTGKPSVTNFVMCVENVTSQIRNCILLMLGAAESSSEHPIGKAILQYVRETCDINEMPQVVHSKSVSGFGLECSLKLQSDMFVPDSEIDNVLVKINDFQENNLTENLKET-SVKWRKINEPVEVVLYLGNRNMMKENHISIPDKLDELMSRDEDNGRTVVLMAIDKVLLAMISIADQVKKEAALVVYTLEKMGVEVFLLTGDNHKTATAIAKEIGIRNVFAEVLPSHKVAKIQQIQNMSKYKRSWLFSCCSKPSKLTNVAMVGDGINDSPALAQADVGIAIGTGTDVAVEAADVVLIRNSLLDVIAAMKLSKDTVRRIRQNFVAATMYNLIGIPIAAGALMPIGVVFMPWMA 3000
            ++ K+ ++       KC ++I+GMTC+SCV  IE  + K  GV S L+ L++   E+ YDP++I   +IA  I D+GF+A + +    +   IE+ I GMTC+SCV+ IESKL +  GI    VAL T K   KFDP+II PRDI+  IEE+GF A LA +  N ++ DH  E IK+WK SFL SL+FG+P M  +M++M                   ++ SN P                                     H S  +D  ++   S   I + I  ++   ++ + SP TFF+T PML VF++LGRWLEH+AK KTSEAL+KL+SLQA EAT++    DN   +E ++ ++LV++GD+VKV+PG K P+DG+V+ G +  DESLITGE+M V K PGS VI G++N  G ++I+AT VG D+ L QIVKLVEEAQ SKAPIQ+LAD+ +G FVP +II S  TL++WI IG+           NPN        +   TE+I ++AFQ +ITVL +ACPCSLGLATPTAVMVGTGV A NGILIKGG PLE  H++  ++FDKTGTIT G P V   ++  +  T  +R  +L ++G AE+SSEHP+G A+ +Y +E      +      ++V G G+ C +          S ++ +L   ++   +    +L E  S+   K   P    + +GNR  ++ N ++I   + + M+  E  G+T +L+AID VL  MI+IAD VK+EAAL V+TL+ MGV+V L+TGDN KTA AIA ++GI  VFAEVLPSHKVAK+Q++QN  K                  VAMVGDG+NDSPALAQAD+G+AIGTGTDVA+EAADVVLIRN LLDV+A++ LSK TVRRIR N V A +YNL+GIPIAAG  MPIG+V  PWM 
Sbjct:  474 ILAKSPQSTRAVAPQKCFLQIKGMTCASCVSNIERNLQKEAGVLSVLVALMAGKAEIKYDPEVIQPLEIAQFIQDLGFEAAVMEDYAGSDGNIELTITGMTCASCVHNIESKLTRTNGITYASVALATSKALVKFDPEIIGPRDIIKIIEEIGFHASLAQRNPNAHHLDHKME-IKQWKKSFLCSLVFGIPVM-ALMIYM-------------------LIPSNEP-------------------------------------HQSMVLDHNIIPGLS---ILNLIFFILCTFVQAERSPVTFFDTPPMLFVFIALGRWLEHLAKSKTSEALAKLMSLQATEATVVTLGEDNLIIREEQVPMELVQRGDIVKVVPGGKFPVDGKVLEGNTMADESLITGEAMPVTKKPGSTVIAGSINAHGSVLIKATHVGNDTTLAQIVKLVEEAQMSKAPIQQLADRFSGYFVPFIIIMSTLTLVVWIVIGFIDFGVVQRYFPNPNK-------HISQTEVIIRFAFQTSITVLCIACPCSLGLATPTAVMVGTGVAAQNGILIKGGKPLEMAHKIKTVMFDKTGTITHGVPRVMRVLLLGDVATLPLRK-VLAVVGTAEASSEHPLGVAVTKYCKEELGTETLGYCTDFQAVPGCGIGCKV----------SNVEGILAH-SERPLSAPASHLNEAGSLPAEKDAVPQTFSVLIGNREWLRRNGLTISSDVSDAMTDHEMKGQTAILVAIDGVLCGMIAIADAVKQEAALAVHTLQSMGVDVVLITGDNRKTARAIATQVGINKVFAEVLPSHKVAKVQELQNKGK-----------------KVAMVGDGVNDSPALAQADMGVAIGTGTDVAIEAADVVLIRNDLLDVVASIHLSKRTVRRIRINLVLALIYNLVGIPIAAGVFMPIGIVLQPWMG 1307          

HSP 2 Score: 112.079 bits (279), Expect = 3.716e-24
Identity = 53/152 (34.87%), Postives = 91/152 (59.87%), Query Frame = 1
Query:  313 MRIQGMTCSSCVHTIENQVLKLKGVKSALINLLSTIGEVTYDPDLIMASDIADTINDMGFDAEIFQFKEHT---------KDIIEVMIQGMTCSSCVYTIESKLAQMQGILSVKVALTTEKGKFKFDPQIISPRDILDAIEEMGFDAKLAPK 741
            +RI GMTC SCV +IE+++  LKG+ S  ++L      V Y P ++    +   I DMGF+A I + K  +         + ++++ ++GMTC SCV +IE K+ ++QG++ VKV+L+ ++    + P +I P D+ D + +MGF+A +  K
Sbjct:   62 VRILGMTCQSCVKSIEDRISNLKGIISMKVSLEQGSATVKYVPSVVCLQQVCHQIGDMGFEASIAEGKAASWPSRSLPAQEAVVKLRVEGMTCQSCVSSIEGKVRKLQGVVRVKVSLSNQEAVITYQPYLIQPEDLRDHVNDMGFEAAIKSK 213          

HSP 3 Score: 92.4337 bits (228), Expect = 3.716e-18
Identity = 57/192 (29.69%), Postives = 86/192 (44.79%), Query Frame = 1
Query:  313 MRIQGMTCSSCVHTIENQVLKLKGVKSALINLLSTIGEVTYDPDLIMASDIADTINDMGFDAEI----------------FQFKEHTKDI----------------------IEVMIQGMTCSSCVYTIESKLAQMQGILSVKVALTTEKGKFKFDPQIISPRDILDAIEEM---GFDAKLAPKKTNKYNDH 765
            +R++GMTC SCV +IE +V KL+GV    ++L +    +TY P LI   D+ D +NDMGF+A I                 Q     + +                      +++ I GM C SCV  IE  + Q+ G+ S++V+L  +  + K+DP   SP  +  AIE +    F   L         DH
Sbjct:  147 LRVEGMTCQSCVSSIEGKVRKLQGVVRVKVSLSNQEAVITYQPYLIQPEDLRDHVNDMGFEAAIKSKVAPLSLGPIDIERLQSTNPKRPLSSANQNFNNSETLGHQGSHVVTLQLRIDGMHCKSCVLNIEENIGQLLGVQSIQVSLENKTAQVKYDPSCTSPVALQRAIEALPPGNFKVSLPDGAEGSGTDH 338          

HSP 4 Score: 83.1889 bits (204), Expect = 2.370e-15
Identity = 51/180 (28.33%), Postives = 82/180 (45.56%), Query Frame = 1
Query:  310 HMRIQGMTCSSCVHTIENQVLKLKGVKSALINLLSTIGEVTYDPDLI----------------MASDIADTINDMGFDAEIFQFK----------EHTKDIIEVMIQGMTCSSCVYTIESKLAQMQGILSVKVALTTEKGKFKFDPQIISPRDILDAIEEMGFDAKLAPK--KTNKYNDH 765
             +RI GM C SCV  IE  + +L GV+S  ++L +   +V YDP                       + D     G D                 + T     + I GMTC+SCV++IE  ++Q++G+  + V+L        ++P +ISP ++  AIE+MGF+A +  +   TN   +H
Sbjct:  260 QLRIDGMHCKSCVLNIEENIGQLLGVQSIQVSLENKTAQVKYDPSCTSPVALQRAIEALPPGNFKVSLPDGAEGSGTDHRSSSSHSPGSPPRNQVQGTCSTTLIAIAGMTCASCVHSIEGMISQLEGVQQISVSLAEGTATVLYNPSVISPEELRAAIEDMGFEASVVSESCSTNPLGNH 439          

HSP 5 Score: 58.151 bits (139), Expect = 1.285e-7
Identity = 26/72 (36.11%), Postives = 44/72 (61.11%), Query Frame = 1
Query:  541 VMIQGMTCSSCVYTIESKLAQMQGILSVKVALTTEKGKFKFDPQIISPRDILDAIEEMGFDAKLAPKKTNKY 756
            V I GMTC SCV +IE +++ ++GI+S+KV+L       K+ P ++  + +   I +MGF+A +A  K   +
Sbjct:   62 VRILGMTCQSCVKSIEDRISNLKGIISMKVSLEQGSATVKYVPSVVCLQQVCHQIGDMGFEASIAEGKAASW 133          
BLAST of Copper-transporting ATPase 1 vs. Ensembl Human
Match: ATP7B (ATPase copper transporting beta [Source:HGNC Symbol;Acc:HGNC:870])

HSP 1 Score: 729.169 bits (1881), Expect = 0.000e+0
Identity = 419/969 (43.24%), Postives = 582/969 (60.06%), Query Frame = 1
Query:  319 IQGMTCSSCVHTIENQVLKLKGVKSALINLLSTIGEVTYDPDLIMASDIADTINDMGFDAEIFQFK--------------------------------------EHTKDIIE---------------VMIQGMTCSSCVYTIESKLAQMQGILSVKVALTTEKGKFKFDPQIISPRDILDAIEEMGFDAKLAPKKTNKYNDHVGESIKKWKHSFLISLIFGVPTMIVMMVFMYGFSHRMQVIHLKNGINVTVMVSNAPIXXXXXXXXXXXXXXXXXP------VQFYGARYFYVQAYKSIKHGSANMDVLVVMATSVSYIYSFIVILVSMILRQDSSPQTFFETTPMLIVFLSLGRWLEHIAKGKTSEALSKLLSLQAFEATIIV--NDN---QERKISXXXXXXXXXXXXXPGEKIPIDGRVVSGKSRCDESLITGESMSVEKIPGSDVIGGTLNISGMLIIRATLVGEDSALNQIVKLVEEAQTSKAPIQELADKVAGLFVPGVIICSMFTLLIWIAIGY----------TNPNLLPGHSSINTDNTELIWKYAFQLAITVLSVACPCSLGLATPTAVMVGTGVGAINGILIKGGVPLEKMHQLDVIVFDKTGTITTGKPSVTNFVMCVENVTSQIRNCILLMLGAAESSSEHPIGKAILQYVRETCDINEMPQVVHSKSVSGFGLECSLKLQSDMFVPDSEIDNVLVKINDFQENNLTENLKET-SVKWRKINEPVEVVLYLGNRNMMKENHISIPDKLDELMSRDEDNGRTVVLMAIDKVLLAMISIADQVKKEAALVVYTLEKMGVEVFLLTGDNHKTATAIAKEIGIRNVFAEVLPSHKVAKIQQIQNMSKYKRSWLFSCCSKPSKLTNVAMVGDGINDSPALAQADVGIAIGTGTDVAVEAADVVLIRNSLLDVIAAMKLSKDTVRRIRQNFVAATMYNLIGIPIAAGALMPIGVVFMPWMA 3000
            I GMTC+SCVH+IE  + +L+GV+   ++L      V Y+P +I   ++   I DMGF+A +                                           H  DI+                + I+GMTC+SCV  IE  L +  G+LSV VAL   K + K+DP++I P +I   I+++GF+A +         D+ G                       + + + G +    V ++++ +  T  ++ A +                 P      ++  G  YFYVQAYKS++H SANMDVL+V+ATS++Y+YS ++++V++  + + SP TFF+T PML VF++LGRWLEH+AK KTSEAL+KL+SLQA EAT++    DN   +E ++ ++LV++GD+VKV+PG K P+DG+V+ G +  DESLITGE+M V K PGS VI G++N  G ++I+AT VG D+ L QIVKLVEEAQ SKAPIQ+LAD+ +G FVP +II S  TL++WI IG+           NPN        +   TE+I ++AFQ +ITVL +ACPCSLGLATPTAVMVGTGV A NGILIKGG PLE  H++  ++FDKTGTIT G P V   ++  +  T  +R  +L ++G AE+SSEHP+G A+ +Y +E      +      ++V G G+ C +          S ++ +L   ++   +    +L E  S+   K   P    + +GNR  ++ N ++I   + + M+  E  G+T +L+AID VL  MI+IAD VK+EAAL V+TL+ MGV+V L+TGDN KTA AIA ++GI  VFAEVLPSHKVAK+Q++QN  K                  VAMVGDG+NDSPALAQAD+G+AIGTGTDVA+EAADVVLIRN LLDV+A++ LSK TVRRIR N V A +YNL+GIPIAAG  MPIG+V  PWM 
Sbjct:  365 IAGMTCASCVHSIEGMISQLEGVQQISVSLAEGTATVLYNPSVISPEELRAAIEDMGFEASVVSESCSTNPLGNHSAGNSMVQTTDGTPTSVQEVAPHTGRLPANHAPDILAKSPQSTRAVAPQKCFLQIKGMTCASCVSNIERNLQKEAGVLSVLVALMAGKAEIKYDPEVIQPLEIAQFIQDLGFEAAV-------MEDYAGSDGN-------------------IELTITGMTCASCVHNIESKLTRTNGITYASVALATSKALVKFDPEIIGPRDIIKIIELLGGWYFYVQAYKSLRHRSANMDVLIVLATSIAYVYSLVILVVAVAEKAERSPVTFFDTPPMLFVFIALGRWLEHLAKSKTSEALAKLMSLQATEATVVTLGEDNLIIREEQVPMELVQRGDIVKVVPGGKFPVDGKVLEGNTMADESLITGEAMPVTKKPGSTVIAGSINAHGSVLIKATHVGNDTTLAQIVKLVEEAQMSKAPIQQLADRFSGYFVPFIIIMSTLTLVVWIVIGFIDFGVVQRYFPNPNK-------HISQTEVIIRFAFQTSITVLCIACPCSLGLATPTAVMVGTGVAAQNGILIKGGKPLEMAHKIKTVMFDKTGTITHGVPRVMRVLLLGDVATLPLRK-VLAVVGTAEASSEHPLGVAVTKYCKEELGTETLGYCTDFQAVPGCGIGCKV----------SNVEGILAH-SERPLSAPASHLNEAGSLPAEKDAVPQTFSVLIGNREWLRRNGLTISSDVSDAMTDHEMKGQTAILVAIDGVLCGMIAIADAVKQEAALAVHTLQSMGVDVVLITGDNRKTARAIATQVGINKVFAEVLPSHKVAKVQELQNKGK-----------------KVAMVGDGVNDSPALAQADMGVAIGTGTDVAIEAADVVLIRNDLLDVVASIHLSKRTVRRIRINLVLALIYNLVGIPIAAGVFMPIGIVLQPWMG 1271          

HSP 2 Score: 134.035 bits (336), Expect = 6.841e-31
Identity = 66/153 (43.14%), Postives = 95/153 (62.09%), Query Frame = 1
Query:  259 LINKNKETDNTKELFKCHMRIQGMTCSSCVHTIENQVLKLKGVKSALINLLSTIGEVTYDPDLIMASDIADTINDMGFDAEIFQFKEHTKDIIEVMIQGMTCSSCVYTIESKLAQMQGILSVKVALTTEKGKFKFDPQIISPRDILDAIEEMG 717
            ++ K+ ++       KC ++I+GMTC+SCV  IE  + K  GV S L+ L++   E+ YDP++I   +IA  I D+GF+A + +    +   IE+ I GMTC+SCV+ IESKL +  GI    VAL T K   KFDP+II PRDI+  IE +G
Sbjct:  474 ILAKSPQSTRAVAPQKCFLQIKGMTCASCVSNIERNLQKEAGVLSVLVALMAGKAEIKYDPEVIQPLEIAQFIQDLGFEAAVMEDYAGSDGNIELTITGMTCASCVHNIESKLTRTNGITYASVALATSKALVKFDPEIIGPRDIIKIIELLG 626          

HSP 3 Score: 112.079 bits (279), Expect = 3.227e-24
Identity = 53/152 (34.87%), Postives = 91/152 (59.87%), Query Frame = 1
Query:  313 MRIQGMTCSSCVHTIENQVLKLKGVKSALINLLSTIGEVTYDPDLIMASDIADTINDMGFDAEIFQFKEHT---------KDIIEVMIQGMTCSSCVYTIESKLAQMQGILSVKVALTTEKGKFKFDPQIISPRDILDAIEEMGFDAKLAPK 741
            +RI GMTC SCV +IE+++  LKG+ S  ++L      V Y P ++    +   I DMGF+A I + K  +         + ++++ ++GMTC SCV +IE K+ ++QG++ VKV+L+ ++    + P +I P D+ D + +MGF+A +  K
Sbjct:   62 VRILGMTCQSCVKSIEDRISNLKGIISMKVSLEQGSATVKYVPSVVCLQQVCHQIGDMGFEASIAEGKAASWPSRSLPAQEAVVKLRVEGMTCQSCVSSIEGKVRKLQGVVRVKVSLSNQEAVITYQPYLIQPEDLRDHVNDMGFEAAIKSK 213          

HSP 4 Score: 92.4337 bits (228), Expect = 3.438e-18
Identity = 57/192 (29.69%), Postives = 86/192 (44.79%), Query Frame = 1
Query:  313 MRIQGMTCSSCVHTIENQVLKLKGVKSALINLLSTIGEVTYDPDLIMASDIADTINDMGFDAEI----------------FQFKEHTKDI----------------------IEVMIQGMTCSSCVYTIESKLAQMQGILSVKVALTTEKGKFKFDPQIISPRDILDAIEEM---GFDAKLAPKKTNKYNDH 765
            +R++GMTC SCV +IE +V KL+GV    ++L +    +TY P LI   D+ D +NDMGF+A I                 Q     + +                      +++ I GM C SCV  IE  + Q+ G+ S++V+L  +  + K+DP   SP  +  AIE +    F   L         DH
Sbjct:  147 LRVEGMTCQSCVSSIEGKVRKLQGVVRVKVSLSNQEAVITYQPYLIQPEDLRDHVNDMGFEAAIKSKVAPLSLGPIDIERLQSTNPKRPLSSANQNFNNSETLGHQGSHVVTLQLRIDGMHCKSCVLNIEENIGQLLGVQSIQVSLENKTAQVKYDPSCTSPVALQRAIEALPPGNFKVSLPDGAEGSGTDH 338          

HSP 5 Score: 83.5741 bits (205), Expect = 2.141e-15
Identity = 51/180 (28.33%), Postives = 82/180 (45.56%), Query Frame = 1
Query:  310 HMRIQGMTCSSCVHTIENQVLKLKGVKSALINLLSTIGEVTYDPDLI----------------MASDIADTINDMGFDAEIFQFK----------EHTKDIIEVMIQGMTCSSCVYTIESKLAQMQGILSVKVALTTEKGKFKFDPQIISPRDILDAIEEMGFDAKLAPK--KTNKYNDH 765
             +RI GM C SCV  IE  + +L GV+S  ++L +   +V YDP                       + D     G D                 + T     + I GMTC+SCV++IE  ++Q++G+  + V+L        ++P +ISP ++  AIE+MGF+A +  +   TN   +H
Sbjct:  260 QLRIDGMHCKSCVLNIEENIGQLLGVQSIQVSLENKTAQVKYDPSCTSPVALQRAIEALPPGNFKVSLPDGAEGSGTDHRSSSSHSPGSPPRNQVQGTCSTTLIAIAGMTCASCVHSIEGMISQLEGVQQISVSLAEGTATVLYNPSVISPEELRAAIEDMGFEASVVSESCSTNPLGNH 439          

HSP 6 Score: 58.151 bits (139), Expect = 1.236e-7
Identity = 26/72 (36.11%), Postives = 44/72 (61.11%), Query Frame = 1
Query:  541 VMIQGMTCSSCVYTIESKLAQMQGILSVKVALTTEKGKFKFDPQIISPRDILDAIEEMGFDAKLAPKKTNKY 756
            V I GMTC SCV +IE +++ ++GI+S+KV+L       K+ P ++  + +   I +MGF+A +A  K   +
Sbjct:   62 VRILGMTCQSCVKSIEDRISNLKGIISMKVSLEQGSATVKYVPSVVCLQQVCHQIGDMGFEASIAEGKAASW 133          
BLAST of Copper-transporting ATPase 1 vs. Ensembl Celegans
Match: cua-1 (CU (Copper) ATPase [Source:UniProtKB/TrEMBL;Acc:G5ED40])

HSP 1 Score: 715.687 bits (1846), Expect = 0.000e+0
Identity = 454/983 (46.19%), Postives = 625/983 (63.58%), Query Frame = 1
Query:  268 KNKETDNTKELFKCHMRIQGMTCSSCVHTIENQVLKLKGVKSALINLLSTIGEVTYDPDLIMASDIADTI-NDMGFDAEIFQFKEHTKDI--IEVMIQGMTCSSCVYTIESKLAQMQGILSVKVALTTEKGKFKFDPQIISPRDILDAIEEMGFDAKLAPKKTN-KYNDHVGESIKKWKHSFLISLIFGVPTMIVMMVFMYGFSHRMQVIHLKNGINVTVMVSNAPIXXXXXXXXXXXXXXXXXPVQFYGARYFYVQAYKSIKHGSANMDVLVVMATSVSYIYSFIVILVSMILRQDSSPQTFFETTPMLIVFLSLGRWLEHIAKGKTSEALSKLLSLQAFEATIIVNDNQ-----ERKISXXXXXXXXXXXXXPGEKIPIDGRVVSGKSRCDESLITGESMSVEKIPGSDVIGGTLNISGMLIIRATLVGEDSALNQIVKLVEEAQTSKAPIQELADKVAGLFVPGVIICSMFTLLIWIAIGYT---NPNLLPGHSSINTDNTELIWKYAFQLAITVLSVACPCSLGLATPTAVMVGTGVGAINGILIKGGVPLEKMHQLDVIVFDKTGTITTGKPSVTNFVMCVENVTSQIRNCILLMLGAAESSSEHPIGKAILQYVRETCDINEMPQVVHSKSVSGFGLECSLK--LQSDMFVPDSEIDNVLVKINDFQENNL--TE-NLKETSVKWRKINEPVEVVLYLGNRNMMKENHISIPDKLDELMSRDEDNGRTVVLMAIDKVLLAMISIADQVKKEAALVVYTLEKMGVEVFLLTGDNHKTATAIAKEIGIRNVFAEVLPSHKVAKIQQIQNMSKYKRSWLFSCCSKPSKLTNVAMVGDGINDSPALAQADVGIAIGTGTDVAVEAADVVLIRNSLLDVIAAMKLSKDTVRRIRQNFVAATMYNLIGIPIAAGALMPIGVVFMPWMASVAMAASSICVVCXXXXXXXXXXPNEDQLANQEFKNHLECLKYGDMEVGVNLGKD 3165
            K  +  ++  L KC   ++GMTC+SCV  IE  + K++GV S ++ L++   EV YD  +  +  I + +  ++G+ A +        +   I ++I  ++  S    IES +    GI S  V++ T     +F PQ+I PRDI++ +E +GF A LA +    K  DH  + +KKW+++F I+LIFGVP MI+M++F +     M                  PI  P LSL+N LL    +PVQ +G RYFYV ++K+IKHG+ANMDVL++++T+++Y YS +V+L+++I +  SSP TFF+  PMLIVF++LGR LEH AKGKTSEALSKL+SLQA EAT++  D++     E+ I+++LV++ DL+KV+PG K+P+DG VV GKS  DES ITGESM V K PGS VIGG++N  G+LI++AT VG DS L+QIV+LVEEAQT++APIQ+LADK+AG FVP VI+ S+FTL +WI I Y    N NL PG         E   K AF+ AITVL++ACPCSLGLATPTAVMVGTGVGA NGILIKGG PLE +H++  IVFDKTGTIT G+P V      V   T  ++  I  + GA E+ SEHPIG A+  + ++  +    P        +G G+ C +    QS   +  S     + ++ D Q   +  TE NL + S K      P    + +G   MM+ + I + + +   +S ++  G   V+ AI+  ++A+ISIADQVKKEA+L +YTL +MG+ V LLTGDN KTA + AK++GI  VFAEVLP+ K  KI+Q++    YK                VAMVGDG+NDSPALA+A+VGIAI  G+DVA+E+A +VL+RN L+DV+ A+KLSK T RRIR NF+ A +YN IGIPIAAG   P G +  PWMA+ AMA SS+ VV  SLLLK ++KP    L    FK H + L+ G  +V V+ G D
Sbjct:  117 KYSKEGSSDHLEKCTFAVEGMTCASCVQYIERNISKIEGVHSIVVALIAAKAEVIYDGRVTSSDAIREHMTGELGYKATLLDSMGANPNYSKIRLIIGNLSTESDANRIESHVLSKSGIDSCNVSIATSMALVEFSPQVIGPRDIINVVESLGFTADLATRDDQMKRLDH-SDDVKKWRNTFFIALIFGVPVMIIMIIFHWILRTPMHPDK------------QTPIFTPALSLDNFLLLCLCTPVQIFGGRYFYVASWKAIKHGNANMDVLIMLSTTIAYTYSIVVLLLAIIFKWPSSPMTFFDVPPMLIVFIALGRMLEHKAKGKTSEALSKLMSLQAKEATLVTMDSEGRLTSEKGINIELVQRNDLIKVVPGAKVPVDGVVVDGKSSVDESFITGESMPVVKKPGSTVIGGSVNQKGVLIVKATHVGNDSTLSQIVRLVEEAQTNRAPIQQLADKIAGYFVPFVIVLSLFTLGVWIYIEYNSARNANLPPGL------RFEEALKIAFEAAITVLAIACPCSLGLATPTAVMVGTGVGAANGILIKGGEPLESVHKVTTIVFDKTGTITEGRPRVVQIASFVNPSTMSLK-LITFLSGATEALSEHPIGNAVAAFAKQLLNEPTWPNTSRFHVSAGHGVTCRIDSIRQSFSSLALSGSTCEIPRLPDGQTITIPGTEVNLLQVSSKEVSQPNPDTANIVIGTERMMERHGIPVSEVVKMTLSEEQRKGHISVICAINAEVVAVISIADQVKKEASLAIYTLREMGLRVVLLTGDNSKTAESTAKQVGIDEVFAEVLPNQKQQKIKQLKG---YK--------------NKVAMVGDGVNDSPALAEANVGIAIAAGSDVAIESAGIVLVRNDLVDVVGAIKLSKMTTRRIRLNFLFAIIYNAIGIPIAAGVFRPFGFMLQPWMAAAAMALSSVSVVSSSLLLKNFRKPTIANLYTTSFKRHQKFLESGSFQVQVHRGLD 1062          

HSP 2 Score: 68.9366 bits (167), Expect = 2.141e-11
Identity = 47/183 (25.68%), Postives = 84/183 (45.90%), Query Frame = 1
Query:  319 IQGMTCSSCVHTIENQVLKLKGVKSALINLLSTIGEVTYDPDLIMASDIADTINDMGFDAEIFQ-----------------------------------------FKEHTKDIIE---VMIQGMTCSSCVYTIESKLAQMQGILSVKVALTTEKGKFKFDPQIISPRDILDAIE-EMGFDAKL 732
            I+GMTC +CV+ I++ V    G+   +++L    G V Y+ +      +A++I+DMGFD ++                                            KE + D +E     ++GMTC+SCV  IE  +++++G+ S+ VAL   K +  +D ++ S   I + +  E+G+ A L
Sbjct:   14 IEGMTCHACVNNIQDTVGSKDGIVKIVVSLEQKQGTVDYNSEKWNGESVAESIDDMGFDCKLITDQEIAAVEPQKASTTKLSISPLKTVDLSDGKVELQLNGVKYSKEGSSDHLEKCTFAVEGMTCASCVQYIERNISKIEGVHSIVVALIAAKAEVIYDGRVTSSDAIREHMTGELGYKATL 196          
BLAST of Copper-transporting ATPase 1 vs. Ensembl Celegans
Match: cua-1 (CU (Copper) ATPase [Source:UniProtKB/TrEMBL;Acc:G5ED40])

HSP 1 Score: 714.531 bits (1843), Expect = 0.000e+0
Identity = 454/983 (46.19%), Postives = 625/983 (63.58%), Query Frame = 1
Query:  268 KNKETDNTKELFKCHMRIQGMTCSSCVHTIENQVLKLKGVKSALINLLSTIGEVTYDPDLIMASDIADTI-NDMGFDAEIFQFKEHTKDI--IEVMIQGMTCSSCVYTIESKLAQMQGILSVKVALTTEKGKFKFDPQIISPRDILDAIEEMGFDAKLAPKKTN-KYNDHVGESIKKWKHSFLISLIFGVPTMIVMMVFMYGFSHRMQVIHLKNGINVTVMVSNAPIXXXXXXXXXXXXXXXXXPVQFYGARYFYVQAYKSIKHGSANMDVLVVMATSVSYIYSFIVILVSMILRQDSSPQTFFETTPMLIVFLSLGRWLEHIAKGKTSEALSKLLSLQAFEATIIVNDNQ-----ERKISXXXXXXXXXXXXXPGEKIPIDGRVVSGKSRCDESLITGESMSVEKIPGSDVIGGTLNISGMLIIRATLVGEDSALNQIVKLVEEAQTSKAPIQELADKVAGLFVPGVIICSMFTLLIWIAIGYT---NPNLLPGHSSINTDNTELIWKYAFQLAITVLSVACPCSLGLATPTAVMVGTGVGAINGILIKGGVPLEKMHQLDVIVFDKTGTITTGKPSVTNFVMCVENVTSQIRNCILLMLGAAESSSEHPIGKAILQYVRETCDINEMPQVVHSKSVSGFGLECSLK--LQSDMFVPDSEIDNVLVKINDFQENNL--TE-NLKETSVKWRKINEPVEVVLYLGNRNMMKENHISIPDKLDELMSRDEDNGRTVVLMAIDKVLLAMISIADQVKKEAALVVYTLEKMGVEVFLLTGDNHKTATAIAKEIGIRNVFAEVLPSHKVAKIQQIQNMSKYKRSWLFSCCSKPSKLTNVAMVGDGINDSPALAQADVGIAIGTGTDVAVEAADVVLIRNSLLDVIAAMKLSKDTVRRIRQNFVAATMYNLIGIPIAAGALMPIGVVFMPWMASVAMAASSICVVCXXXXXXXXXXPNEDQLANQEFKNHLECLKYGDMEVGVNLGKD 3165
            K  +  ++  L KC   ++GMTC+SCV  IE  + K++GV S ++ L++   EV YD  +  +  I + +  ++G+ A +        +   I ++I  ++  S    IES +    GI S  V++ T     +F PQ+I PRDI++ +E +GF A LA +    K  DH  + +KKW+++F I+LIFGVP MI+M++F +     M                  PI  P LSL+N LL    +PVQ +G RYFYV ++K+IKHG+ANMDVL++++T+++Y YS +V+L+++I +  SSP TFF+  PMLIVF++LGR LEH AKGKTSEALSKL+SLQA EAT++  D++     E+ I+++LV++ DL+KV+PG K+P+DG VV GKS  DES ITGESM V K PGS VIGG++N  G+LI++AT VG DS L+QIV+LVEEAQT++APIQ+LADK+AG FVP VI+ S+FTL +WI I Y    N NL PG         E   K AF+ AITVL++ACPCSLGLATPTAVMVGTGVGA NGILIKGG PLE +H++  IVFDKTGTIT G+P V      V   T  ++  I  + GA E+ SEHPIG A+  + ++  +    P        +G G+ C +    QS   +  S     + ++ D Q   +  TE NL + S K      P    + +G   MM+ + I + + +   +S ++  G   V+ AI+  ++A+ISIADQVKKEA+L +YTL +MG+ V LLTGDN KTA + AK++GI  VFAEVLP+ K  KI+Q++    YK                VAMVGDG+NDSPALA+A+VGIAI  G+DVA+E+A +VL+RN L+DV+ A+KLSK T RRIR NF+ A +YN IGIPIAAG   P G +  PWMA+ AMA SS+ VV  SLLLK ++KP    L    FK H + L+ G  +V V+ G D
Sbjct:  239 KYSKEGSSDHLEKCTFAVEGMTCASCVQYIERNISKIEGVHSIVVALIAAKAEVIYDGRVTSSDAIREHMTGELGYKATLLDSMGANPNYSKIRLIIGNLSTESDANRIESHVLSKSGIDSCNVSIATSMALVEFSPQVIGPRDIINVVESLGFTADLATRDDQMKRLDH-SDDVKKWRNTFFIALIFGVPVMIIMIIFHWILRTPMHPDK------------QTPIFTPALSLDNFLLLCLCTPVQIFGGRYFYVASWKAIKHGNANMDVLIMLSTTIAYTYSIVVLLLAIIFKWPSSPMTFFDVPPMLIVFIALGRMLEHKAKGKTSEALSKLMSLQAKEATLVTMDSEGRLTSEKGINIELVQRNDLIKVVPGAKVPVDGVVVDGKSSVDESFITGESMPVVKKPGSTVIGGSVNQKGVLIVKATHVGNDSTLSQIVRLVEEAQTNRAPIQQLADKIAGYFVPFVIVLSLFTLGVWIYIEYNSARNANLPPGL------RFEEALKIAFEAAITVLAIACPCSLGLATPTAVMVGTGVGAANGILIKGGEPLESVHKVTTIVFDKTGTITEGRPRVVQIASFVNPSTMSLK-LITFLSGATEALSEHPIGNAVAAFAKQLLNEPTWPNTSRFHVSAGHGVTCRIDSIRQSFSSLALSGSTCEIPRLPDGQTITIPGTEVNLLQVSSKEVSQPNPDTANIVIGTERMMERHGIPVSEVVKMTLSEEQRKGHISVICAINAEVVAVISIADQVKKEASLAIYTLREMGLRVVLLTGDNSKTAESTAKQVGIDEVFAEVLPNQKQQKIKQLKG---YK--------------NKVAMVGDGVNDSPALAEANVGIAIAAGSDVAIESAGIVLVRNDLVDVVGAIKLSKMTTRRIRLNFLFAIIYNAIGIPIAAGVFRPFGFMLQPWMAAAAMALSSVSVVSSSLLLKNFRKPTIANLYTTSFKRHQKFLESGSFQVQVHRGLD 1184          

HSP 2 Score: 86.2705 bits (212), Expect = 1.171e-16
Identity = 45/148 (30.41%), Postives = 82/148 (55.41%), Query Frame = 1
Query:  313 MRIQGMTCSSCVHTIENQVLKLKGVKSALINLLSTIGEVTYDPDLIMASDIADTINDMGFDAEIFQFKEHTKDIIE--------VMIQGMTCSSCVYTIESKLAQMQGILSVKVALTTEKGKFKFDPQIISPRDILDAIEEMGFDAKL 732
            + I+GMTC+SCV  I++ +    G+ S  +NL     + ++D     A  +A+ ++DMGFD ++ + KE    + E        V I+GMTC +CV  I+  +    GI+ + V+L  ++G   ++ +  +   + ++I++MGFD KL
Sbjct:   51 LEIKGMTCNSCVKNIQDVIGAKPGIHSIQVNLKEENAKCSFDTTKWTAEKVAEAVDDMGFDCKVLK-KEPPTQMAEKPKIRRAIVSIEGMTCHACVNNIQDTVGSKDGIVKIVVSLEQKQGTVDYNSEKWNGESVAESIDDMGFDCKL 197          

HSP 3 Score: 77.0258 bits (188), Expect = 7.961e-14
Identity = 60/257 (23.35%), Postives = 114/257 (44.36%), Query Frame = 1
Query:  112 LKIIEDFFQFNDNIKTVVIDYEKNLVRICCHNDNCTYLTLCEAIENLGFLINKNKETDNTKELFKCHMR-----IQGMTCSSCVHTIENQVLKLKGVKSALINLLSTIGEVTYDPDLIMASDIADTINDMGFDAEIFQ-----------------------------------------FKEHTKDIIE---VMIQGMTCSSCVYTIESKLAQMQGILSVKVALTTEKGKFKFDPQIISPRDILDAIE-EMGFDAKL 732
            +K I+D       I ++ ++ ++   +        T   + EA++++GF     K+   T+   K  +R     I+GMTC +CV+ I++ V    G+   +++L    G V Y+ +      +A++I+DMGFD ++                                            KE + D +E     ++GMTC+SCV  IE  +++++G+ S+ VAL   K +  +D ++ S   I + +  E+G+ A L
Sbjct:   62 VKNIQDVIGAKPGIHSIQVNLKEENAKCSFDTTKWTAEKVAEAVDDMGFDCKVLKKEPPTQMAEKPKIRRAIVSIEGMTCHACVNNIQDTVGSKDGIVKIVVSLEQKQGTVDYNSEKWNGESVAESIDDMGFDCKLITDQEIAAVEPQKASTTKLSISPLKTVDLSDGKVELQLNGVKYSKEGSSDHLEKCTFAVEGMTCASCVQYIERNISKIEGVHSIVVALIAAKAEVIYDGRVTSSDAIREHMTGELGYKATL 318          

HSP 4 Score: 52.373 bits (124), Expect = 2.144e-6
Identity = 25/66 (37.88%), Postives = 39/66 (59.09%), Query Frame = 1
Query:  547 IQGMTCSSCVYTIESKLAQMQGILSVKVALTTEKGKFKFDPQIISPRDILDAIEEMGFDAKLAPKK 744
            I+GMTC+SCV  I+  +    GI S++V L  E  K  FD    +   + +A+++MGFD K+  K+
Sbjct:   53 IKGMTCNSCVKNIQDVIGAKPGIHSIQVNLKEENAKCSFDTTKWTAEKVAEAVDDMGFDCKVLKKE 118          
BLAST of Copper-transporting ATPase 1 vs. Ensembl Celegans
Match: catp-1 (Cation transporting ATPase [Source:UniProtKB/TrEMBL;Acc:G5EBE7])

HSP 1 Score: 78.5666 bits (192), Expect = 2.100e-14
Identity = 54/175 (30.86%), Postives = 93/175 (53.14%), Query Frame = 1
Query: 2437 DKVLLAMISIADQVKKEAALVVYTLEKMGVEVFLLTGDNHKTATAIAKEIGIRNVFAEVLPSHKVAKIQQIQN---------MSKYKRS-W---------LFSCCSKPSKL----------TNVAMVGDGINDSPALAQADVGIAIG-TGTDVAVEAADVVLIRNSLLDVIAAMK 2871
            D V L M +I D  + E A  +   +  GV+VF++TGD+  TATAIA++IG+      +  S  +  +++ QN         +  YK+S W         +F+  +   KL            VA+ G G++D+P LA A+VGIA+G +G+D+A + AD+VL+ ++   ++  ++
Sbjct:  694 DLVFLGMAAIMDPPRPETAAAIEQCKMAGVKVFMITGDHPTTATAIARQIGL------IGSSTNLNDVEKPQNSWAVVTGDQLKNYKKSDWNLLLKNHNIVFARTNTEQKLEIVQEVQRRGETVAVTGGGVDDTPVLAHANVGIAMGQSGSDIAKQTADIVLLDDNFASIVMGIE 862          
BLAST of Copper-transporting ATPase 1 vs. Ensembl Celegans
Match: catp-1 (Cation transporting ATPase [Source:UniProtKB/TrEMBL;Acc:G5EBE7])

HSP 1 Score: 78.1814 bits (191), Expect = 3.041e-14
Identity = 54/175 (30.86%), Postives = 93/175 (53.14%), Query Frame = 1
Query: 2437 DKVLLAMISIADQVKKEAALVVYTLEKMGVEVFLLTGDNHKTATAIAKEIGIRNVFAEVLPSHKVAKIQQIQN---------MSKYKRS-W---------LFSCCSKPSKL----------TNVAMVGDGINDSPALAQADVGIAIG-TGTDVAVEAADVVLIRNSLLDVIAAMK 2871
            D V L M +I D  + E A  +   +  GV+VF++TGD+  TATAIA++IG+      +  S  +  +++ QN         +  YK+S W         +F+  +   KL            VA+ G G++D+P LA A+VGIA+G +G+D+A + AD+VL+ ++   ++  ++
Sbjct:  694 DLVFLGMAAIMDPPRPETAAAIEQCKMAGVKVFMITGDHPTTATAIARQIGL------IGSSTNLNDVEKPQNSWAVVTGDQLKNYKKSDWNLLLKNHNIVFARTNTEQKLEIVQEVQRRGETVAVTGGGVDDTPVLAHANVGIAMGQSGSDIAKQTADIVLLDDNFASIVMGIE 862          
BLAST of Copper-transporting ATPase 1 vs. Ensembl Celegans
Match: sca-1 (Calcium-transporting ATPase [Source:UniProtKB/TrEMBL;Acc:Q9XU13])

HSP 1 Score: 78.1814 bits (191), Expect = 3.086e-14
Identity = 72/309 (23.30%), Postives = 144/309 (46.60%), Query Frame = 1
Query: 2137 KSVSGFGLECSLKLQSDMFVPDSEIDNVLVKINDFQENNLTENLKETSVKWRKINEPVEVVLYLGNRNMMKENHISIPDKLDELMSRDEDNGRTVVLMAIDKVLLAMISIADQVKKEAALVVYTLEKMGVEVFLLTGDNHKTATAIAKEIGI----RNVFAEVLPSHKVAKIQQIQNMSKYKRSWLFSCC--SKPSKLTNV--------AMVGDGINDSPALAQADVGIAIGTGTDVAVEAADVVLIRNSLLDVIAAMKLSKDTVRRIRQ-----------NFVAATMYNLIGIPIAAGALMPIGVVFM 2988
            KS+S +    S    + MFV  +  + VL +    + N   + +  TS   +KI +  + V Y   R+ ++   +   D    + + + ++    V    D   + ++ + D  + E +  +      G+ V ++TGDN  TA AI + IG+     +   +     +   +   Q     +R+ LF+    S  SK+ ++        AM GDG+ND+PAL +A++GI++G+GT VA  A+++VL  ++   +++A++  +     ++Q             V+  M   +GIP    AL+P+ ++++
Sbjct:  369 KSMSAYCFPASGGSGAKMFVKGAP-EGVLGRCTHVRVNG--QKVPLTSAMTQKIVD--QCVQYGTGRDTLRCLALGTIDTPVSVSNMNLEDSTQFVKYEQDITFVGVVGMLDPPRTEVSDSIKACNHAGIRVIMITGDNKNTAEAIGRRIGLFGENEDTTGKAYTGREFDDLPPEQQSEACRRAKLFARVEPSHKSKIVDILQSQGEITAMTGDGVNDAPALKKAEIGISMGSGTAVAKSASEMVLADDNFASIVSAVEEGRAIYNNMKQFIRYLISSNVGEVVSIFMVAALGIP---EALIPVQLLWV 669          
BLAST of Copper-transporting ATPase 1 vs. Ensembl Fly
Match: ATP7 (gene:FBgn0030343 transcript:FBtr0334454)

HSP 1 Score: 790.03 bits (2039), Expect = 0.000e+0
Identity = 451/991 (45.51%), Postives = 640/991 (64.58%), Query Frame = 1
Query:  298 LFKCHMRIQGMTCSSCVHTIENQVLKLKGVKSALINLLSTIGEVTYDPDLIMASDIADTINDMGFDAEIFQFKEHTKDIIEVMIQGMTCSSCVYTIESKLAQMQGILSVKVALTTEKGKFKFDPQIISPRDILDAIEEMGFDAKL---APKKTNKYNDHVGESIKKWKHSFLISLIFGVPTMIVMMVFMYGFSHRMQVIHLKNGINVTVMVSNAPIXXXXXXXXXXXXXXXXXPVQFYGARYFYVQAYKSIKHGSANMDVLVVMATSVSYIYSFIVILVSMILRQDSSPQTFFETTPMLIVFLSLGRWLEHIAKGKTSEALSKLLSLQAFEATII-----VNDNQERKISXXXXXXXXXXXXXPGEKIPIDGRVVSGKSRCDESLITGESMSVEKIPGSDVIGGTLNISGMLIIRATLVGEDSALNQIVKLVEEAQTSKAPIQELADKVAGLFVPGVIICSMFTLLIWIAIGYTNPNLLP--GHSSINTDNTELIWKYAFQLAITVLSVACPCSLGLATPTAVMVGTGVGAINGILIKGGVPLEKMHQLDVIVFDKTGTITTGKPSVTNFVMCV-ENVTSQIRNCILLMLGAAESSSEHPIGKAILQYVRETCDINEMPQV------VHSKSVSGFGLECSLKLQSDMFVPDSEIDNVLVKINDFQEN-----------NLTENLKETSVKW------------------------RKINEPVEVVLYLGNRNMMKENHISIPDKLDELMSRDEDNGRTVVLMAIDKVLLAMISIADQVKKEAALVVYTLEKMGVEVFLLTGDNHKTATAIAKEIGIRNVFAEVLPSHKVAKIQQIQNMSKYKRSWLFSCCSKPSKLTNVAMVGDGINDSPALAQADVGIAIGTGTDVAVEAADVVLIRNSLLDVIAAMKLSKDTVRRIRQNFVAATMYNLIGIPIAAGALMPIGVVFMPWMASVAMAASSICVVCXXXXXXXXXXPNEDQLANQEFKNHL 3114
            L KC + I+GMTC+SCV  IE    K+ G+ S L+ LL+   EV ++ +++ A +IA +I ++GF  E+    ++ +  +E+ I GMTC+SCV  IES + +++G+ +  V L T++GKF++  +   PR I +AIE +GF+AKL     K  + Y +H  E I+KW+++FL+SLIFG P M+ M+ FM   S        K   N+  +V    +    + L +        PVQF+G  +FYVQ+Y++IKHG+ NMDVL+ M T++SY+YS  V++ +++L Q+SSP TFF+T PML++F+SLGRWLEHIAKGKTSEALSKLLSL+A +A ++      +   E+ ISVD V++GD++KV+PG K+P+DG+V+ G S CDESLITGESM V K  GS VIGG++N +G+L++ AT  GE++ L QIV+LVEEAQTSKAPIQ+LAD++AG FVP V++ S  TL+ WI IG++NPNL+P      ++ D   +I  YAF+ A++VL++ACPC+LGLATPTAVMV TG GAING+L+KG   LE  H++  +VFDKTGTIT G P  +   + V   V S  R   L ++GAAE +SEHPI  AI+ + ++  ++   PQ        H ++V G G+  ++             D ++   N  + +           ++   L + SV+                         +KI +  E+++ +GNR  M+ N I +P ++ + M+ +E  G T VL A++  L+ M +++D VK EA L VYTL++MG++V LLTGDN  TA +IA+E+GIR V+AEVLPSHKVAKIQ+IQ                 +    VAMVGDG+NDSPALAQADVGI I  GTDVA EA+D+VL+RN LLDV+A + LS+ TVRRIR NF  A+MYNL+GIP+A+G   P G   +PWMASVAMAASS+ VVC SLLLK+++KP    L   E++  L
Sbjct:  207 LTKCFLHIRGMTCASCVAAIEKHCKKIYGLDSILVALLAAKAEVKFNANVVTAENIAKSITELGFPTELIDEPDNGEAEVELEIMGMTCASCVNKIESHVLKIRGVTTASVTLLTKRGKFRYITEETGPRSICEAIEALGFEAKLMTGRDKMAHNYLEH-KEEIRKWRNAFLVSLIFGGPCMVAMIYFMLEMSD-------KGHANMCCLVPGLSMENLVMFLLST-------PVQFFGGFHFYVQSYRAIKHGTTNMDVLISMVTTISYVYSVAVVIAAVLLEQNSSPLTFFDTPPMLLIFISLGRWLEHIAKGKTSEALSKLLSLKAADALLVEISPDFDIISEKVISVDYVQRGDILKVIPGAKVPVDGKVLYGHSSCDESLITGESMPVAKRKGSVVIGGSINQNGVLLVEATHTGENTTLAQIVRLVEEAQTSKAPIQQLADRIAGYFVPFVVVVSSITLIAWIIIGFSNPNLVPVAMEHKMHMDQNTIIVSYAFKCALSVLAIACPCALGLATPTAVMVATGTGAINGVLVKGATALENAHKVKTVVFDKTGTITHGTPMTSKVTLFVTAQVCSLAR--ALTIVGAAEQNSEHPIASAIVHFAKDMLNVGATPQAGSFGKSSHFQAVPGCGIRVTVSNYEQTLRQACNADRIINYENLHRTHPQGSVPVDNGASIEHLLPQRSVRKSMELNNQQLLSDLVLEPEEELLTDQKIIDSPEILVLIGNREWMERNAIEVPLEISDCMTHEERKGHTAVLCALNGQLVCMFAVSDMVKPEAHLAVYTLKRMGIDVVLLTGDNKNTAASIAREVGIRTVYAEVLPSHKVAKIQRIQ-----------------ANGIRVAMVGDGVNDSPALAQADVGITIAAGTDVAAEASDIVLMRNDLLDVVACLDLSRCTVRRIRYNFFFASMYNLLGIPLASGLFAPYGFTLLPWMASVAMAASSVSVVCSSLLLKMYRKPTAKTLRTAEYEAQL 1163          

HSP 2 Score: 82.8037 bits (203), Expect = 1.355e-15
Identity = 47/149 (31.54%), Postives = 70/149 (46.98%), Query Frame = 1
Query:  310 HMRIQGMTCSSCVHTIENQVLKLKGVKSALINLLSTIGEVTYDPDLIMASDIADTINDMGFDAEIFQFKEHTKDIIE--------VMIQGMTCSSCVYTIESKLAQMQGILSVKVALTTEKGKFKFDPQIISPRDILDAIEEMGFDAKL 732
             + I GMTC SCV  I   + +  G+    + L    G   YDP     + IA  I+DMGF+     +     D  E        + + GMTC SCV  IE  +    GI S++V L  +  + ++DP    P  I + I++MGF+A +
Sbjct:   15 RLPIVGMTCQSCVRNITEHIGQKSGILGVRVILEENAGYFDYDPRQTDPARIASDIDDMGFEC---SYPGDAADPPETPASAWTNIRVVGMTCQSCVRNIEGNIGTKPGIHSIEVQLAAKNARVQYDPAQYDPAQIAELIDDMGFEASV 160          

HSP 3 Score: 58.9214 bits (141), Expect = 3.154e-8
Identity = 28/69 (40.58%), Postives = 37/69 (53.62%), Query Frame = 1
Query:  517 EHTKDIIEVMIQGMTCSSCVYTIESKLAQMQGILSVKVALTTEKGKFKFDPQIISPRDILDAIEEMGFD 723
            E T   + + I GMTC SCV  I   + Q  GIL V+V L    G F +DP+   P  I   I++MGF+
Sbjct:    8 EATMSTVRLPIVGMTCQSCVRNITEHIGQKSGILGVRVILEENAGYFDYDPRQTDPARIASDIDDMGFE 76          
BLAST of Copper-transporting ATPase 1 vs. Ensembl Fly
Match: ATP7 (gene:FBgn0030343 transcript:FBtr0273257)

HSP 1 Score: 790.03 bits (2039), Expect = 0.000e+0
Identity = 451/991 (45.51%), Postives = 640/991 (64.58%), Query Frame = 1
Query:  298 LFKCHMRIQGMTCSSCVHTIENQVLKLKGVKSALINLLSTIGEVTYDPDLIMASDIADTINDMGFDAEIFQFKEHTKDIIEVMIQGMTCSSCVYTIESKLAQMQGILSVKVALTTEKGKFKFDPQIISPRDILDAIEEMGFDAKL---APKKTNKYNDHVGESIKKWKHSFLISLIFGVPTMIVMMVFMYGFSHRMQVIHLKNGINVTVMVSNAPIXXXXXXXXXXXXXXXXXPVQFYGARYFYVQAYKSIKHGSANMDVLVVMATSVSYIYSFIVILVSMILRQDSSPQTFFETTPMLIVFLSLGRWLEHIAKGKTSEALSKLLSLQAFEATII-----VNDNQERKISXXXXXXXXXXXXXPGEKIPIDGRVVSGKSRCDESLITGESMSVEKIPGSDVIGGTLNISGMLIIRATLVGEDSALNQIVKLVEEAQTSKAPIQELADKVAGLFVPGVIICSMFTLLIWIAIGYTNPNLLP--GHSSINTDNTELIWKYAFQLAITVLSVACPCSLGLATPTAVMVGTGVGAINGILIKGGVPLEKMHQLDVIVFDKTGTITTGKPSVTNFVMCV-ENVTSQIRNCILLMLGAAESSSEHPIGKAILQYVRETCDINEMPQV------VHSKSVSGFGLECSLKLQSDMFVPDSEIDNVLVKINDFQEN-----------NLTENLKETSVKW------------------------RKINEPVEVVLYLGNRNMMKENHISIPDKLDELMSRDEDNGRTVVLMAIDKVLLAMISIADQVKKEAALVVYTLEKMGVEVFLLTGDNHKTATAIAKEIGIRNVFAEVLPSHKVAKIQQIQNMSKYKRSWLFSCCSKPSKLTNVAMVGDGINDSPALAQADVGIAIGTGTDVAVEAADVVLIRNSLLDVIAAMKLSKDTVRRIRQNFVAATMYNLIGIPIAAGALMPIGVVFMPWMASVAMAASSICVVCXXXXXXXXXXPNEDQLANQEFKNHL 3114
            L KC + I+GMTC+SCV  IE    K+ G+ S L+ LL+   EV ++ +++ A +IA +I ++GF  E+    ++ +  +E+ I GMTC+SCV  IES + +++G+ +  V L T++GKF++  +   PR I +AIE +GF+AKL     K  + Y +H  E I+KW+++FL+SLIFG P M+ M+ FM   S        K   N+  +V    +    + L +        PVQF+G  +FYVQ+Y++IKHG+ NMDVL+ M T++SY+YS  V++ +++L Q+SSP TFF+T PML++F+SLGRWLEHIAKGKTSEALSKLLSL+A +A ++      +   E+ ISVD V++GD++KV+PG K+P+DG+V+ G S CDESLITGESM V K  GS VIGG++N +G+L++ AT  GE++ L QIV+LVEEAQTSKAPIQ+LAD++AG FVP V++ S  TL+ WI IG++NPNL+P      ++ D   +I  YAF+ A++VL++ACPC+LGLATPTAVMV TG GAING+L+KG   LE  H++  +VFDKTGTIT G P  +   + V   V S  R   L ++GAAE +SEHPI  AI+ + ++  ++   PQ        H ++V G G+  ++             D ++   N  + +           ++   L + SV+                         +KI +  E+++ +GNR  M+ N I +P ++ + M+ +E  G T VL A++  L+ M +++D VK EA L VYTL++MG++V LLTGDN  TA +IA+E+GIR V+AEVLPSHKVAKIQ+IQ                 +    VAMVGDG+NDSPALAQADVGI I  GTDVA EA+D+VL+RN LLDV+A + LS+ TVRRIR NF  A+MYNL+GIP+A+G   P G   +PWMASVAMAASS+ VVC SLLLK+++KP    L   E++  L
Sbjct:  207 LTKCFLHIRGMTCASCVAAIEKHCKKIYGLDSILVALLAAKAEVKFNANVVTAENIAKSITELGFPTELIDEPDNGEAEVELEIMGMTCASCVNKIESHVLKIRGVTTASVTLLTKRGKFRYITEETGPRSICEAIEALGFEAKLMTGRDKMAHNYLEH-KEEIRKWRNAFLVSLIFGGPCMVAMIYFMLEMSD-------KGHANMCCLVPGLSMENLVMFLLST-------PVQFFGGFHFYVQSYRAIKHGTTNMDVLISMVTTISYVYSVAVVIAAVLLEQNSSPLTFFDTPPMLLIFISLGRWLEHIAKGKTSEALSKLLSLKAADALLVEISPDFDIISEKVISVDYVQRGDILKVIPGAKVPVDGKVLYGHSSCDESLITGESMPVAKRKGSVVIGGSINQNGVLLVEATHTGENTTLAQIVRLVEEAQTSKAPIQQLADRIAGYFVPFVVVVSSITLIAWIIIGFSNPNLVPVAMEHKMHMDQNTIIVSYAFKCALSVLAIACPCALGLATPTAVMVATGTGAINGVLVKGATALENAHKVKTVVFDKTGTITHGTPMTSKVTLFVTAQVCSLAR--ALTIVGAAEQNSEHPIASAIVHFAKDMLNVGATPQAGSFGKSSHFQAVPGCGIRVTVSNYEQTLRQACNADRIINYENLHRTHPQGSVPVDNGASIEHLLPQRSVRKSMELNNQQLLSDLVLEPEEELLTDQKIIDSPEILVLIGNREWMERNAIEVPLEISDCMTHEERKGHTAVLCALNGQLVCMFAVSDMVKPEAHLAVYTLKRMGIDVVLLTGDNKNTAASIAREVGIRTVYAEVLPSHKVAKIQRIQ-----------------ANGIRVAMVGDGVNDSPALAQADVGITIAAGTDVAAEASDIVLMRNDLLDVVACLDLSRCTVRRIRYNFFFASMYNLLGIPLASGLFAPYGFTLLPWMASVAMAASSVSVVCSSLLLKMYRKPTAKTLRTAEYEAQL 1163          

HSP 2 Score: 82.8037 bits (203), Expect = 1.355e-15
Identity = 47/149 (31.54%), Postives = 70/149 (46.98%), Query Frame = 1
Query:  310 HMRIQGMTCSSCVHTIENQVLKLKGVKSALINLLSTIGEVTYDPDLIMASDIADTINDMGFDAEIFQFKEHTKDIIE--------VMIQGMTCSSCVYTIESKLAQMQGILSVKVALTTEKGKFKFDPQIISPRDILDAIEEMGFDAKL 732
             + I GMTC SCV  I   + +  G+    + L    G   YDP     + IA  I+DMGF+     +     D  E        + + GMTC SCV  IE  +    GI S++V L  +  + ++DP    P  I + I++MGF+A +
Sbjct:   15 RLPIVGMTCQSCVRNITEHIGQKSGILGVRVILEENAGYFDYDPRQTDPARIASDIDDMGFEC---SYPGDAADPPETPASAWTNIRVVGMTCQSCVRNIEGNIGTKPGIHSIEVQLAAKNARVQYDPAQYDPAQIAELIDDMGFEASV 160          

HSP 3 Score: 58.9214 bits (141), Expect = 3.154e-8
Identity = 28/69 (40.58%), Postives = 37/69 (53.62%), Query Frame = 1
Query:  517 EHTKDIIEVMIQGMTCSSCVYTIESKLAQMQGILSVKVALTTEKGKFKFDPQIISPRDILDAIEEMGFD 723
            E T   + + I GMTC SCV  I   + Q  GIL V+V L    G F +DP+   P  I   I++MGF+
Sbjct:    8 EATMSTVRLPIVGMTCQSCVRNITEHIGQKSGILGVRVILEENAGYFDYDPRQTDPARIASDIDDMGFE 76          
BLAST of Copper-transporting ATPase 1 vs. Ensembl Fly
Match: SPoCk (gene:FBgn0052451 transcript:FBtr0078531)

HSP 1 Score: 77.411 bits (189), Expect = 6.088e-14
Identity = 57/170 (33.53%), Postives = 85/170 (50.00%), Query Frame = 1
Query: 2437 DKVLLAMISIADQVKKEAALVVYTLEKMGVEVFLLTGDNHKTATAIAKEIGIRNVFAEVLPSHKVAKIQQIQNMSKYKRSWLFSCCSKPSKL----------TNVAMVGDGINDSPALAQADVGIAIG-TGTDVAVEAADVVLIRNSLLDVIAAMKLSKDTVRRIRQNFV 2913
            D +   ++ I D  +      +  L + GV V ++TGD  +TA AIA  IGI  +  + L   ++ ++ + Q         +F   S   KL            V M GDG+ND  AL +AD+GIA+G  GTDV  EAAD++L+ +    +IAA++  K     IR NFV
Sbjct:  518 DLIYCGLVGITDPPRPLVRESIEMLMQSGVRVKMVTGDAQETALAIANLIGIDTIHHQTLSGQEMDQMNEHQLDKVANNVSVFYRVSPRHKLEIVKSLQRSGNIVGMTGDGVNDGVALKKADIGIAMGKNGTDVCKEAADMILVNDDFHTIIAAIEEGKGIFYNIR-NFV 686          
BLAST of Copper-transporting ATPase 1 vs. Ensembl Fly
Match: SPoCk (gene:FBgn0052451 transcript:FBtr0306600)

HSP 1 Score: 77.411 bits (189), Expect = 6.470e-14
Identity = 57/170 (33.53%), Postives = 85/170 (50.00%), Query Frame = 1
Query: 2437 DKVLLAMISIADQVKKEAALVVYTLEKMGVEVFLLTGDNHKTATAIAKEIGIRNVFAEVLPSHKVAKIQQIQNMSKYKRSWLFSCCSKPSKL----------TNVAMVGDGINDSPALAQADVGIAIG-TGTDVAVEAADVVLIRNSLLDVIAAMKLSKDTVRRIRQNFV 2913
            D +   ++ I D  +      +  L + GV V ++TGD  +TA AIA  IGI  +  + L   ++ ++ + Q         +F   S   KL            V M GDG+ND  AL +AD+GIA+G  GTDV  EAAD++L+ +    +IAA++  K     IR NFV
Sbjct:  534 DLIYCGLVGITDPPRPLVRESIEMLMQSGVRVKMVTGDAQETALAIANLIGIDTIHHQTLSGQEMDQMNEHQLDKVANNVSVFYRVSPRHKLEIVKSLQRSGNIVGMTGDGVNDGVALKKADIGIAMGKNGTDVCKEAADMILVNDDFHTIIAAIEEGKGIFYNIR-NFV 702          
BLAST of Copper-transporting ATPase 1 vs. Ensembl Fly
Match: SPoCk (gene:FBgn0052451 transcript:FBtr0302134)

HSP 1 Score: 77.411 bits (189), Expect = 6.470e-14
Identity = 57/170 (33.53%), Postives = 85/170 (50.00%), Query Frame = 1
Query: 2437 DKVLLAMISIADQVKKEAALVVYTLEKMGVEVFLLTGDNHKTATAIAKEIGIRNVFAEVLPSHKVAKIQQIQNMSKYKRSWLFSCCSKPSKL----------TNVAMVGDGINDSPALAQADVGIAIG-TGTDVAVEAADVVLIRNSLLDVIAAMKLSKDTVRRIRQNFV 2913
            D +   ++ I D  +      +  L + GV V ++TGD  +TA AIA  IGI  +  + L   ++ ++ + Q         +F   S   KL            V M GDG+ND  AL +AD+GIA+G  GTDV  EAAD++L+ +    +IAA++  K     IR NFV
Sbjct:  534 DLIYCGLVGITDPPRPLVRESIEMLMQSGVRVKMVTGDAQETALAIANLIGIDTIHHQTLSGQEMDQMNEHQLDKVANNVSVFYRVSPRHKLEIVKSLQRSGNIVGMTGDGVNDGVALKKADIGIAMGKNGTDVCKEAADMILVNDDFHTIIAAIEEGKGIFYNIR-NFV 702          
BLAST of Copper-transporting ATPase 1 vs. Ensembl Zebrafish
Match: atp7a (ATPase copper transporting alpha [Source:ZFIN;Acc:ZDB-GENE-060825-45])

HSP 1 Score: 825.469 bits (2131), Expect = 0.000e+0
Identity = 455/932 (48.82%), Postives = 613/932 (65.77%), Query Frame = 1
Query:  286 NTKELFKCHMRIQGMTCSSCVHTIENQVLKLKGVKSALINLLSTIGEVTYDPDLIMASDIADTINDMGFDAEIFQFKEHTKDIIEVMIQGMTCSSCVYTIESKLAQMQGILSVKVALTTEKGKFKFDPQIISPRDILDAIEEMGFDAKLAPK-KTNKYNDHVGESIKKWKHSFLISLIFGVPTMIVMMVFMYGFSHRMQVIHLKNGINVTVMVSNAPIXXXXXXXXXXXXXXXX------XPVQFYGARYFYVQAYKSIKHGSANMDVLVVMATSVSYIYSFIVILVSMILRQDSSPQTFFETTPMLIVFLSLGRWLEHIAKGKTSEALSKLLSLQAFEATII-VNDN----QERKISXXXXXXXXXXXXXPGEKIPIDGRVVSGKSRCDESLITGESMSVEKIPGSDVIGGTLNISGMLIIRATLVGEDSALNQIVKLVEEAQTSKAPIQELADKVAGLFVPGVIICSMFTLLIWIAIGYTNPNLL----PGHSSINTDNTELIWKYAFQLAITVLSVACPCSLGLATPTAVMVGTGVGAINGILIKGGVPLEKMHQLDVIVFDKTGTITTGKPSVTNFVMCVENVTSQIRNCILLMLGAAESSSEHPIGKAILQYVRETCDINEMPQVVHSKSVSGFGLEC------SLKLQSDMFVPDSEIDNVLVKINDFQENNLTENLKETSVKWRKINEPVEVVLYLGNRNMMKENHISIPDKLDELMSRDEDNGRTVVLMAIDKVLLAMISIADQVKKEAALVVYTLEKMGVEVFLLTGDNHKTATAIAKEIGIRNVFAEVLPSHKVAKIQQIQNMSKYKRSWLFSCCSKPSKLTNVAMVGDGINDSPALAQADVGIAIGTGTDVAVEAADVVLIRNSLLDVIAAMKLSKDTVRRIRQNFVAATMYNLIGIPIAAGALMPIGVVFMPWMASVAMA 3015
            +T  + KC ++I GMTC+SCV  IE  +    G+ S L+ L+++  EV Y P +I    IA+ I ++GF A +    + +   +E++++GMTC+SCV+ IES L + +GIL   VAL+T K   K+DP++  PRDI+  IE MGF A L  K +   + DH  E I++WK SF ISL F VP M  MM++M    H +   H  +             +F    L   L  +         PVQF G RYFY QAYK++KH +ANMDVL+V+AT++++ YS +V+LV+M+ R   +P TFF+T PML VF+SLGRWLE IAK KTSEALSKL+SLQA EAT++ +N++     E ++ V+LV++GD+VKV+PG K P+DGRV+ G S  DESLITGE+M V K PGS VI G++N +G L+I+AT VG D+ L+QIVKLVEEAQTSKAPIQ+ ADK++  FVP +++ S+ TLL WI IG+ N +L+    PG+   +    E + ++AFQ +ITVL +ACPCSLGLATPTAVMVGTGVGA NGILIKGG PLE  H++  +VFDKTGTIT G P V    M  E      R+ +L ++G AE+SSEHP+G AI +Y ++      +      ++V G G+ C      +L  + D    +++ + VL++I+D + ++ TE+      +   + +     + +GNR  M+ N + +   +DE M+  E  G T VL+A+D  L AM++IAD VK EA L V+ L  MG+EV L+TGDN KTA AIA ++GIR VFAEVLPSHKVAK++Q+Q   K                  VAMVGDG+NDSPALA ADVGIAIGTGTDVA+EAADVVLIRN LLDV+ ++ LSK TV+RIR NFV A MYNL+GIPIAAG  MP+G+V  PWM S AMA
Sbjct:  468 STNTISKCFIQIGGMTCASCVANIERNLKNEYGIHSVLVALMASKAEVRYSPSVIDPLRIAELIRELGFTATVMDNYDGSDGSLELVVRGMTCASCVHKIESNLMKQKGILYASVALSTNKAHIKYDPEVTGPRDIIRLIENMGFTASLVKKDRPGSHLDHSRE-IRQWKRSFQISLFFCVPVM-GMMIYMIVVDHMIDKYHQHHNATAEDRAKYHSTMFLEKQLLPGLSIMNLISFLFCVPVQFIGGRYFYCQAYKAVKHRTANMDVLIVLATTIAFTYSVVVLLVAMVERAKVNPITFFDTPPMLFVFISLGRWLEQIAKSKTSEALSKLMSLQATEATVVTLNEDMSVLSEEQVDVELVQRGDVVKVVPGGKFPVDGRVIEGHSMADESLITGEAMPVTKKPGSTVIAGSINQNGSLLIKATHVGTDTTLSQIVKLVEEAQTSKAPIQQFADKISSYFVPFIVVISVLTLLAWIIIGFVNFSLVQTYFPGYDK-SISEAEAVIRFAFQASITVLCIACPCSLGLATPTAVMVGTGVGAQNGILIKGGEPLEMAHKIQSVVFDKTGTITYGAPKVVQVKMLAEG-NRLPRSKLLAIVGTAENSSEHPLGAAITKYCKQELGTESLGTCTDFQAVPGCGIRCLVSNTENLLKREDSDSEENQHNAVLIQISDARAHS-TEHPLIMDPQPLTVVQTASYTVLIGNREWMRRNALQVRADVDEAMTEHERRGCTAVLVAVDNELCAMVAIADTVKPEAELAVHVLSAMGLEVVLMTGDNSKTARAIAAQVGIRKVFAEVLPSHKVAKVEQLQQEGK-----------------RVAMVGDGVNDSPALAMADVGIAIGTGTDVAIEAADVVLIRNDLLDVVGSIDLSKKTVKRIRINFVFALMYNLVGIPIAAGVFMPVGLVLQPWMGSAAMA 1377          

HSP 2 Score: 97.8265 bits (242), Expect = 4.911e-20
Identity = 52/148 (35.14%), Postives = 85/148 (57.43%), Query Frame = 1
Query:  313 MRIQGMTCSSCVHTIENQVLKLKGVKSALINLLSTIGEVTYDPDLIMASDIADTINDM---GFDAEIFQ-----FKEHTKDIIEVMIQGMTCSSCVYTIESKLAQMQGILSVKVALTTEKGKFKFDPQIISPRDILDAIEEMGFDAKL 732
             ++ GM C+SCV  I++ + KL  V S +++L +    + ++P  + A ++   I  +    F A I       F +    + E+ I+GMTC SCV +IE  L+Q +G+ S +V+L   KG F++DP + SP ++  AIE+MGFDA L
Sbjct:  279 FQVTGMHCNSCVVNIQDNISKLPAVTSVVVSLENRQASIQHNPKQVSAVELQKAIEALPPGNFKAIIPASPEPGFLQPLVSVAEIHIEGMTCGSCVQSIEGTLSQKKGVRSAQVSLANHKGTFEYDPLLTSPEELRAAIEDMGFDAFL 426          

HSP 3 Score: 94.7449 bits (234), Expect = 4.644e-19
Identity = 70/246 (28.46%), Postives = 105/246 (42.68%), Query Frame = 1
Query:  121 IEDFFQFNDNIKTVVIDYEKNLVRICCHNDNCTYLTLCEAIE-----NLGFLINKNKETDNTKELFK-CHMRIQGMTCSSCVHTIENQVLKLKGVKSALINLLSTIGEVTYDPDLIMASDIADTINDMGFDAEIFQFKEHTKDIIE--------------------------------------VMIQGMTCSSCVYTIESKLAQMQGILSVKVALTTEKGKFKFDPQIISPRDILDAIEEMGFDA 726
            I+D       + +VV+  E     I  +    + + L +AIE     N   +I  + E    + L     + I+GMTC SCV +IE  + + KGV+SA ++L +  G   YDP L    ++   I DMGFDA + +       +++                                      + I GMTC+SCV  IE  L    GI SV VAL   K + ++ P +I P  I + I E+GF A
Sbjct:  293 IQDNISKLPAVTSVVVSLENRQASIQHNPKQVSAVELQKAIEALPPGNFKAIIPASPEPGFLQPLVSVAEIHIEGMTCGSCVQSIEGTLSQKKGVRSAQVSLANHKGTFEYDPLLTSPEELRAAIEDMGFDAFLPETNSLVPSVVKSPSLSVRSSSLSPVRSAVKENEAESDAEPSTNTISKCFIQIGGMTCASCVANIERNLKNEYGIHSVLVALMASKAEVRYSPSVIDPLRIAELIRELGFTA 538          

HSP 4 Score: 59.3066 bits (142), Expect = 3.309e-8
Identity = 40/153 (26.14%), Postives = 69/153 (45.10%), Query Frame = 1
Query:  298 LFKCHMRIQGMTCSSCVHTIENQVLKLKGVKSALINLLSTIGEVTYDPDLIMASDIADTINDMGFDAEIFQFKEHTKDIIEVMIQGMTCSS-CVYTIESKLAQMQGILSVKVALTTEKGKFKFDPQIISPRDILDAIEEMGFDAKLAPKKTNK 753
            L +  + ++GMTC SCV +IE ++  L GV    ++L      VTYD        IAD I DMGF++ +             +     CS+  V    S LAQ++G++  + +   +     F P ++S   + + ++ +  D    P  + K
Sbjct:    7 LCRVTLGVEGMTCGSCVQSIEGRIGGLPGVIHIQVSLEQNNATVTYDHTQHTPQSIADAIEDMGFESSLTNATSTPVQTETKVFSKAGCSADSVQQALSTLAQIKGVIETQESADNQGLAVTFVPSLVSEDQLGEVLKCLAPDTACRPPLSPK 159          

HSP 5 Score: 55.0694 bits (131), Expect = 6.883e-7
Identity = 47/204 (23.04%), Postives = 96/204 (47.06%), Query Frame = 1
Query:  166 IDYEKNLVRICCHNDNCTYLTLCEAIENLGFLINKNKETDNTKELFKCHMRI-QGMTCSS-CVHTIENQVLKLKGVKSALINLLSTIGEVTYDPDLIMASDIADTINDMGFDAEI---FQFKEHTK-------DIIEVMIQGMTCSSCVYTIESKLAQMQGILSVKVALTTEKGKFKFDPQIISPRDILDAIEEMGFDAKLAPK 741
            +  E+N   +   +   T  ++ +AIE++GF   ++  T+ T    +   ++     CS+  V    + + ++KGV     +  +    VT+ P L+    + + +  +  D         KE +        + +++ I+GM C SC  TIE K+ +++G+  +KV+L +++    + P II+  +I+  IE  GF A +  K
Sbjct:   41 VSLEQNNATVTYDHTQHTPQSIADAIEDMGF---ESSLTNATSTPVQTETKVFSKAGCSADSVQQALSTLAQIKGVIETQESADNQGLAVTFVPSLVSEDQLGEVLKCLAPDTACRPPLSPKEGSTSRSFSGVEAVKMRIEGMVCLSCTTTIEGKIGKLKGVEKIKVSLESQEAAVVYLPYIITVDEIVKQIEVAGFKATVKSK 241          
BLAST of Copper-transporting ATPase 1 vs. Ensembl Zebrafish
Match: atp7b (ATPase copper transporting beta [Source:ZFIN;Acc:ZDB-GENE-061220-5])

HSP 1 Score: 817.379 bits (2110), Expect = 0.000e+0
Identity = 457/943 (48.46%), Postives = 626/943 (66.38%), Query Frame = 1
Query:  241 IENLGF-----------LINKNKETDNT--KELFKCHMRIQGMTCSSCVHTIENQVLKLKGVKSALINLLSTIGEVTYDPDLIMASDIADTINDMGFDAEIFQFKEHTKDIIEVMIQGMTCSSCVYTIESKLAQMQGILSVKVALTTEKGKFKFDPQIISPRDILDAIEEMGFDAKLAPKKT-NKYNDHVGESIKKWKHSFLISLIFGVPTMIVMMVFMYGFSHRMQVIHLKNGINVTVMVSNAPIXXXXXXXXXXXXXXXXXPVQFYGARYFYVQAYKSIKHGSANMDVLVVMATSVSYIYSFIVILVSMILRQDSSPQTFFETTPMLIVFLSLGRWLEHIAKGKTSEALSKLLSLQAFEATIIV--NDN---QERKISXXXXXXXXXXXXXPGEKIPIDGRVVSGKSRCDESLITGESMSVEKIPGSDVIGGTLNISGMLIIRATLVGEDSALNQIVKLVEEAQTSKAPIQELADKVAGLFVPGVIICSMFTLLIWIAIGYTNPNL----LPGHSSINTDNTELIWKYAFQLAITVLSVACPCSLGLATPTAVMVGTGVGAINGILIKGGVPLEKMHQLDVIVFDKTGTITTGKPSVTNFVMCVENVTSQIRNCILLMLGAAESSSEHPIGKAILQYVRETCDINEMPQVVHSKSVSGFGLECSLKLQSDMFVPDSEIDNVLVKINDFQENNLTENLKETSVKWRKINEPVEVVLYLGNRNMMKENHISIPDKLDELMSRDEDNGRTVVLMAIDKVLLAMISIADQVKKEAALVVYTLEKMGVEVFLLTGDNHKTATAIAKEIGIRNVFAEVLPSHKVAKIQQIQNMSKYKRSWLFSCCSKPSKLTNVAMVGDGINDSPALAQADVGIAIGTGTDVAVEAADVVLIRNSLLDVIAAMKLSKDTVRRIRQNFVAATMYNLIGIPIAAGALMPIGVVFMPWMA 3000
            IE++GF           + NK K  D T  +EL KC + + GMTC+SCV  IE  ++K +G+KS L+ L++   EV YDP L+  + I   I+ +GF A + +       ++++ + GMTC+SCV+ IESKL + +GI    VAL T K   KFD  ++  RDI+  IE +GF   L   +  N   DH  E I++WKHSFL SL+FG+P M +M+  M      M   H ++G ++    +  P    GLS+ NL  FL  +PVQF G RYFY+QAY+S++HG ANMDVL+V+AT+++Y+YSF V++V+MI     SP TFF+T PML VF++LGRWLEH+AK KTSEAL+KL+SLQA +ATI+    DN   +E ++SVDLV++GD+VKV PG K P+DG+V+ G S  DESLITGE M V K  GS VI G++N  G L++ AT VG ++ L+QIVKLVEEAQTSKAPIQ+LADK++G FVP +++ S+ T+  W+ IG+ + ++     PG++  N   TE+I ++AFQ +ITVLS+ACPCSLGLATPTAVMVGTGVGA NGILIKGG PLE  H++  ++FDKTGTIT G P VT  ++  +     +R  +L ++G AE+SSEHP+G A+ ++ +E      +      ++V G G+ C +          S ++++L       E++L  +    S      + P   VL +GNR  M  N + +   +D  MS  E  G+T +L+AID VL AMI++AD VK E+AL V+TL  MG+EV+++TGDN +TA AIA ++GIR VFAEVLPSHKVAK+Q++Q                  +   VAMVGDG+NDSPALA AD+GIAIGTGTDVA+EAAD+VLIRN LLDV+A+++LSK TV+RIR NFV A +YNL+GIP AAG  MP+G+V  PWM 
Sbjct:  236 IEDMGFEAWLNQGRYLLIHNKYKNADGTGERELRKCFVHVTGMTCASCVSNIERNLVKHEGIKSVLVALMAGKAEVKYDPGLLDPAQIVQLISHLGFGASVMEEHSVQDGVLDLSVTGMTCASCVHNIESKLLRTKGIQEASVALATNKAHVKFDSDLVGSRDIVRIIEGLGFGVSLIKNEGLNNTLDH-QEEIRQWKHSFLFSLVFGIPVMGLMIYMMV-----MDSQHKEHGGSMPADQNILP----GLSIINLAFFLLCTPVQFLGGRYFYIQAYRSLRHGVANMDVLIVLATTIAYVYSFTVLIVAMIEGAKQSPLTFFDTPPMLFVFIALGRWLEHVAKSKTSEALAKLMSLQATDATIVSLGPDNTIIREEQVSVDLVQRGDVVKVAPGGKFPVDGKVIEGTSMADESLITGEPMPVIKKAGSCVIAGSINAHGALLVEATHVGSETTLSQIVKLVEEAQTSKAPIQQLADKLSGYFVPFIVVISILTVTAWLIIGFLDFDVVSKNFPGYNQ-NISRTEVIVRFAFQASITVLSIACPCSLGLATPTAVMVGTGVGAQNGILIKGGEPLEMAHKVGAVMFDKTGTITNGVPQVTRVLVLWDRARLPLRT-VLAVVGTAEASSEHPLGMAVAKHCKEELGAETLGFCHDFQAVPGCGISCKV----------SSVEDLLQNRVTTDESSLVADTDSGS------DSPSYSVL-IGNRQWMLRNGLEVTADVDNAMSSHETKGQTAILVAIDGVLCAMIAVADTVKAESALAVHTLSSMGIEVYMITGDNRRTARAIATQVGIRKVFAEVLPSHKVAKVQELQE-----------------RGLKVAMVGDGVNDSPALAHADLGIAIGTGTDVAIEAADIVLIRNDLLDVVASIELSKKTVQRIRINFVFALIYNLLGIPFAAGVFMPLGLVLQPWMG 1132          

HSP 2 Score: 84.3445 bits (207), Expect = 6.174e-16
Identity = 51/169 (30.18%), Postives = 83/169 (49.11%), Query Frame = 1
Query:  313 MRIQGMTCSSCVHTIENQVLKLKGVKSALINLLSTIGEVTYDPDLIMASDIADTINDMGFDAEI-FQFKEHTKDIIEVMIQGMTCSSCVYTIESKLAQMQGILSVKVALTTEKGKFKFDPQIISPRDILDAIEEMGFDAKLAPKKT----NKYNDHVGESIKKWKHSFL 804
            + ++GM C SCV  I   +  + GV S  ++L     ++ +DP L+    +       GF  EI           + + I+GMTC+SCV  IE  ++Q  G+ S+KV L  +KG   FD  +  P ++   IE+MGF+A L   +     NKY +  G   ++ +  F+
Sbjct:  111 LGVEGMHCGSCVKNITETLSGMLGVNSVFVSLEKGSVDLRFDPSLLTLETVK------GFLEEIPLNSASTPTQSVTIGIEGMTCNSCVQAIEGMMSQRAGVCSIKVYLQEKKGIVTFDSTVTCPEELRAEIEDMGFEAWLNQGRYLLIHNKYKNADGTGERELRKCFV 273          
BLAST of Copper-transporting ATPase 1 vs. Ensembl Zebrafish
Match: atp7a (ATPase copper transporting alpha [Source:ZFIN;Acc:ZDB-GENE-060825-45])

HSP 1 Score: 814.298 bits (2102), Expect = 0.000e+0
Identity = 455/950 (47.89%), Postives = 613/950 (64.53%), Query Frame = 1
Query:  286 NTKELFKCHMRIQGMTCSSCVHTIENQVLKLKGVKSALINLLSTIGEVTYDPDLIMASDIADTINDMGFDAEIFQFKEHTKDIIEVMIQGMTCSSCVYTIESKLAQMQGILSVKVALTTEKGKFKFDPQIISPRDILDAIEEMGFDAKLAPK-KTNKYNDHVGESIKKWKHSFLISLIFGVPTMIVMMVFMYGFSHRMQVIHLKNGINVTVMVSNAPIXXXXXXXXXXXXXXXX------XPVQFYGARYFYVQAYKSIKHGSANMDVLVVMATSVSYIYSFIVILVSMILRQDSSPQTFFETTPMLIVFLSLGRWLEHIAKGKTSEALSKLLSLQAFEATII-VNDN----QERKISXXXXXXXXXXXXXPGEKIPIDGRVVSGKSRCDESLITGESMSVEKIPGSDVIGGTLNISGMLIIRATLVGEDSALNQIVKLVEEAQTSKAPIQELADKVAGLFVPGVIICSMFTLLIWIAIGYTNPNLL----PGHSSINTDNTELIWKYAFQLAITVLSVACPCSLGLATPTAVMVGTGVGAINGILIKGGVPLEKMHQLDVIVFDKTGTITTGKPSVTNFVMCVENVTSQIRNCILLMLGAAESSSEHPIGKAILQYVRETCDINEMPQVVHSKSVSGFGLEC------SLKLQSDMFVPDSEIDNVLVKINDFQENNLTENLKETSVKWRKINEPVEVVLYLGNRNMMKENHISIPDKLDELMSRDEDNGRTVVLMAIDKVLLAMISIADQVKKEAALVVYTLEKMGVEVFLLTGDNHKTATAIAKEI------------------GIRNVFAEVLPSHKVAKIQQIQNMSKYKRSWLFSCCSKPSKLTNVAMVGDGINDSPALAQADVGIAIGTGTDVAVEAADVVLIRNSLLDVIAAMKLSKDTVRRIRQNFVAATMYNLIGIPIAAGALMPIGVVFMPWMASVAMA 3015
            +T  + KC ++I GMTC+SCV  IE  +    G+ S L+ L+++  EV Y P +I    IA+ I ++GF A +    + +   +E++++GMTC+SCV+ IES L + +GIL   VAL+T K   K+DP++  PRDI+  IE MGF A L  K +   + DH  E I++WK SF ISL F VP M  MM++M    H +   H  +             +F    L   L  +         PVQF G RYFY QAYK++KH +ANMDVL+V+AT++++ YS +V+LV+M+ R   +P TFF+T PML VF+SLGRWLE IAK KTSEALSKL+SLQA EAT++ +N++     E ++ V+LV++GD+VKV+PG K P+DGRV+ G S  DESLITGE+M V K PGS VI G++N +G L+I+AT VG D+ L+QIVKLVEEAQTSKAPIQ+ ADK++  FVP +++ S+ TLL WI IG+ N +L+    PG+   +    E + ++AFQ +ITVL +ACPCSLGLATPTAVMVGTGVGA NGILIKGG PLE  H++  +VFDKTGTIT G P V    M  E      R+ +L ++G AE+SSEHP+G AI +Y ++      +      ++V G G+ C      +L  + D    +++ + VL++I+D + ++ TE+      +   + +     + +GNR  M+ N + +   +DE M+  E  G T VL+A+D  L AM++IAD VK EA L V+ L  MG+EV L+TGDN KTA AIA ++                  GIR VFAEVLPSHKVAK++Q+Q   K                  VAMVGDG+NDSPALA ADVGIAIGTGTDVA+EAADVVLIRN LLDV+ ++ LSK TV+RIR NFV A MYNL+GIPIAAG  MP+G+V  PWM S AMA
Sbjct:  468 STNTISKCFIQIGGMTCASCVANIERNLKNEYGIHSVLVALMASKAEVRYSPSVIDPLRIAELIRELGFTATVMDNYDGSDGSLELVVRGMTCASCVHKIESNLMKQKGILYASVALSTNKAHIKYDPEVTGPRDIIRLIENMGFTASLVKKDRPGSHLDHSRE-IRQWKRSFQISLFFCVPVM-GMMIYMIVVDHMIDKYHQHHNATAEDRAKYHSTMFLEKQLLPGLSIMNLISFLFCVPVQFIGGRYFYCQAYKAVKHRTANMDVLIVLATTIAFTYSVVVLLVAMVERAKVNPITFFDTPPMLFVFISLGRWLEQIAKSKTSEALSKLMSLQATEATVVTLNEDMSVLSEEQVDVELVQRGDVVKVVPGGKFPVDGRVIEGHSMADESLITGEAMPVTKKPGSTVIAGSINQNGSLLIKATHVGTDTTLSQIVKLVEEAQTSKAPIQQFADKISSYFVPFIVVISVLTLLAWIIIGFVNFSLVQTYFPGYDK-SISEAEAVIRFAFQASITVLCIACPCSLGLATPTAVMVGTGVGAQNGILIKGGEPLEMAHKIQSVVFDKTGTITYGAPKVVQVKMLAEG-NRLPRSKLLAIVGTAENSSEHPLGAAITKYCKQELGTESLGTCTDFQAVPGCGIRCLVSNTENLLKREDSDSEENQHNAVLIQISDARAHS-TEHPLIMDPQPLTVVQTASYTVLIGNREWMRRNALQVRADVDEAMTEHERRGCTAVLVAVDNELCAMVAIADTVKPEAELAVHVLSAMGLEVVLMTGDNSKTARAIAAQVKNHLILPQNAPILLFRMVGIRKVFAEVLPSHKVAKVEQLQQEGK-----------------RVAMVGDGVNDSPALAMADVGIAIGTGTDVAIEAADVVLIRNDLLDVVGSIDLSKKTVKRIRINFVFALMYNLVGIPIAAGVFMPVGLVLQPWMGSAAMA 1395          

HSP 2 Score: 98.2117 bits (243), Expect = 4.769e-20
Identity = 52/148 (35.14%), Postives = 85/148 (57.43%), Query Frame = 1
Query:  313 MRIQGMTCSSCVHTIENQVLKLKGVKSALINLLSTIGEVTYDPDLIMASDIADTINDM---GFDAEIFQ-----FKEHTKDIIEVMIQGMTCSSCVYTIESKLAQMQGILSVKVALTTEKGKFKFDPQIISPRDILDAIEEMGFDAKL 732
             ++ GM C+SCV  I++ + KL  V S +++L +    + ++P  + A ++   I  +    F A I       F +    + E+ I+GMTC SCV +IE  L+Q +G+ S +V+L   KG F++DP + SP ++  AIE+MGFDA L
Sbjct:  279 FQVTGMHCNSCVVNIQDNISKLPAVTSVVVSLENRQASIQHNPKQVSAVELQKAIEALPPGNFKAIIPASPEPGFLQPLVSVAEIHIEGMTCGSCVQSIEGTLSQKKGVRSAQVSLANHKGTFEYDPLLTSPEELRAAIEDMGFDAFL 426          

HSP 3 Score: 94.7449 bits (234), Expect = 4.825e-19
Identity = 70/246 (28.46%), Postives = 105/246 (42.68%), Query Frame = 1
Query:  121 IEDFFQFNDNIKTVVIDYEKNLVRICCHNDNCTYLTLCEAIE-----NLGFLINKNKETDNTKELFK-CHMRIQGMTCSSCVHTIENQVLKLKGVKSALINLLSTIGEVTYDPDLIMASDIADTINDMGFDAEIFQFKEHTKDIIE--------------------------------------VMIQGMTCSSCVYTIESKLAQMQGILSVKVALTTEKGKFKFDPQIISPRDILDAIEEMGFDA 726
            I+D       + +VV+  E     I  +    + + L +AIE     N   +I  + E    + L     + I+GMTC SCV +IE  + + KGV+SA ++L +  G   YDP L    ++   I DMGFDA + +       +++                                      + I GMTC+SCV  IE  L    GI SV VAL   K + ++ P +I P  I + I E+GF A
Sbjct:  293 IQDNISKLPAVTSVVVSLENRQASIQHNPKQVSAVELQKAIEALPPGNFKAIIPASPEPGFLQPLVSVAEIHIEGMTCGSCVQSIEGTLSQKKGVRSAQVSLANHKGTFEYDPLLTSPEELRAAIEDMGFDAFLPETNSLVPSVVKSPSLSVRSSSLSPVRSAVKENEAESDAEPSTNTISKCFIQIGGMTCASCVANIERNLKNEYGIHSVLVALMASKAEVRYSPSVIDPLRIAELIRELGFTA 538          

HSP 4 Score: 59.3066 bits (142), Expect = 3.460e-8
Identity = 40/153 (26.14%), Postives = 69/153 (45.10%), Query Frame = 1
Query:  298 LFKCHMRIQGMTCSSCVHTIENQVLKLKGVKSALINLLSTIGEVTYDPDLIMASDIADTINDMGFDAEIFQFKEHTKDIIEVMIQGMTCSS-CVYTIESKLAQMQGILSVKVALTTEKGKFKFDPQIISPRDILDAIEEMGFDAKLAPKKTNK 753
            L +  + ++GMTC SCV +IE ++  L GV    ++L      VTYD        IAD I DMGF++ +             +     CS+  V    S LAQ++G++  + +   +     F P ++S   + + ++ +  D    P  + K
Sbjct:    7 LCRVTLGVEGMTCGSCVQSIEGRIGGLPGVIHIQVSLEQNNATVTYDHTQHTPQSIADAIEDMGFESSLTNATSTPVQTETKVFSKAGCSADSVQQALSTLAQIKGVIETQESADNQGLAVTFVPSLVSEDQLGEVLKCLAPDTACRPPLSPK 159          

HSP 5 Score: 55.0694 bits (131), Expect = 6.446e-7
Identity = 47/204 (23.04%), Postives = 96/204 (47.06%), Query Frame = 1
Query:  166 IDYEKNLVRICCHNDNCTYLTLCEAIENLGFLINKNKETDNTKELFKCHMRI-QGMTCSS-CVHTIENQVLKLKGVKSALINLLSTIGEVTYDPDLIMASDIADTINDMGFDAEI---FQFKEHTK-------DIIEVMIQGMTCSSCVYTIESKLAQMQGILSVKVALTTEKGKFKFDPQIISPRDILDAIEEMGFDAKLAPK 741
            +  E+N   +   +   T  ++ +AIE++GF   ++  T+ T    +   ++     CS+  V    + + ++KGV     +  +    VT+ P L+    + + +  +  D         KE +        + +++ I+GM C SC  TIE K+ +++G+  +KV+L +++    + P II+  +I+  IE  GF A +  K
Sbjct:   41 VSLEQNNATVTYDHTQHTPQSIADAIEDMGF---ESSLTNATSTPVQTETKVFSKAGCSADSVQQALSTLAQIKGVIETQESADNQGLAVTFVPSLVSEDQLGEVLKCLAPDTACRPPLSPKEGSTSRSFSGVEAVKMRIEGMVCLSCTTTIEGKIGKLKGVEKIKVSLESQEAAVVYLPYIITVDEIVKQIEVAGFKATVKSK 241          
BLAST of Copper-transporting ATPase 1 vs. Ensembl Zebrafish
Match: atp7b (ATPase copper transporting beta [Source:ZFIN;Acc:ZDB-GENE-061220-5])

HSP 1 Score: 805.438 bits (2079), Expect = 0.000e+0
Identity = 447/932 (47.96%), Postives = 616/932 (66.09%), Query Frame = 1
Query:  259 LINKNKETDNTKELFKCHMRIQGMTCSSCVHTIENQVLKLKGVKSALINLLSTIGEVTYDPDLIMASDIADTINDMGFDAEIFQFKEHTKDIIEVMIQGMTCSSCVYTIESKLAQMQGILSVKVALTTEKGKFKFDPQIISPRDILDAIEEMGFDAKLAPKKT-NKYNDHVGESIKKWKHSFLISLIFGVPTMIVMMVFMYGFSHRMQVIHLKNGINVTVMVSNAPIXXXXXXXXXXXXXXXXXPVQFYGARYFYVQAYKSIKHGSANMDVLVVMATSVSYIYSFIVILVSMILRQDSSPQTFFETTPMLIVFLSLGRWLEHIAKGKTSEALSKLLSLQAFEATIIV--NDN---QERKISXXXXXXXXXXXXXPGEKIPIDGRVVSGKSRCDESLITGESMSVEKIPGSDVIGGTLNISGMLIIRATLVGEDSALNQIVKLVEEAQTSKAPIQELADKVAGLFVPGVIICSMFTLLIWIAIGYTNPNL----LPGHSSINTDNTELIWKYAFQLAITVLSVACPCSLGLATPTAVMVGTGVGAINGILIKGGVPLEKMHQLDVIVFDKTGTITTGKPSVTNFVMCVENVTSQIRNCILLMLGAAESSSEHPIGKAILQYVRETCDINEMPQVVHSKSVSGFGLECSLKLQSDMFVPDSEIDNVLVKINDFQENNLTENLKETSVKWRKI--------NEPVEVVLYLGNRNMMKENHISIPDKLDELMSRDEDNGRTVVLMAIDKVLLAMISIADQVKKEAALVVYTLEKMGVEVFLLTGDNHKTATAIAKEIGIRNVFAEVLPSHKVAKIQQIQNMSKYKRSWLFSCCSKPSKLTNVAMVGDGINDSPALAQADVGIAIGTGTDVAVEAADVVLIRNSLLDVIAAMKLSKDTVRRIRQNFVAATMYNLIGIPIAAGALMPIGVVFMPWMA 3000
            +  +N +    +EL KC + + GMTC+SCV  IE  ++K +G+KS L+ L++   EV YDP L+  + I   I+ +GF A + +       ++++ + GMTC+SCV+ IESKL + +GI    VAL T K   KFD  ++  RDI+  IE +GF   L   +  N   DH  E   +WKHSFL SL+FG+P M +M+  M      M   H ++G ++    +  P    GLS+ NL  FL  +PVQF G RYFY+QAY+S++HG ANMDVL+V+AT+++Y+YSF V++V+MI     SP TFF+T PML VF++LGRWLEH+AK KTSEAL+KL+SLQA +ATI+    DN   +E ++SVDLV++GD+VKV PG K P+DG+V+ G S  DESLITGE M V K  GS VI G++N  G L++ AT VG ++ L+QIVKLVEEAQTSKAPIQ+LADK++G FVP +++ S+ T+  W+ IG+ + ++     PG++  N   TE+I ++AFQ +ITVLS+ACPCSLGLATPTAVMVGTGVGA NGILIKGG PLE  H++  ++FDKTGTIT G P VT  ++  +     +R  +L ++G AE+SSEHP+G A+ ++ +E      +      ++V G G+ C +    D+     +      K +  ++  L   L+  +     +        + P   VL +GNR  M  N + +   +D  MS  E  G+T +L+AID VL AMI++AD VK E+AL V+TL  MG+EV+++TGDN +TA AIA ++GIR VFAEVLPSHKVAK+Q++Q                  +   VAMVGDG+NDSPALA AD+GIAIGTGTDVA+EAAD+VLIRN LLDV+A+++LSK TV+RIR NFV A +YNL+GIP AAG  MP+G+V  PWM 
Sbjct:  369 ITKENADGTGERELRKCFVHVTGMTCASCVSNIERNLVKHEGIKSVLVALMAGKAEVKYDPGLLDPAQIVQLISHLGFGASVMEEHSVQDGVLDLSVTGMTCASCVHNIESKLLRTKGIQEASVALATNKAHVKFDSDLVGSRDIVRIIEGLGFGVSLIKNEGLNNTLDHQEE--IRWKHSFLFSLVFGIPVMGLMIYMMV-----MDSQHKEHGGSMPADQNILP----GLSIINLAFFLLCTPVQFLGGRYFYIQAYRSLRHGVANMDVLIVLATTIAYVYSFTVLIVAMIEGAKQSPLTFFDTPPMLFVFIALGRWLEHVAKSKTSEALAKLMSLQATDATIVSLGPDNTIIREEQVSVDLVQRGDVVKVAPGGKFPVDGKVIEGTSMADESLITGEPMPVIKKAGSCVIAGSINAHGALLVEATHVGSETTLSQIVKLVEEAQTSKAPIQQLADKLSGYFVPFIVVISILTVTAWLIIGFLDFDVVSKNFPGYNQ-NISRTEVIVRFAFQASITVLSIACPCSLGLATPTAVMVGTGVGAQNGILIKGGEPLEMAHKVGAVMFDKTGTITNGVPQVTRVLVLWDRARLPLRT-VLAVVGTAEASSEHPLGMAVAKHCKEELGAETLGFCHDFQAVPGCGISCKVSSVEDLLQNSPKTQET--KASAVKQTPLLVTLQGVTTDESSLVADTDSGSDSPSYSVL-IGNRQWMLRNGLEVTADVDNAMSSHETKGQTAILVAIDGVLCAMIAVADTVKAESALAVHTLSSMGIEVYMITGDNRRTARAIATQVGIRKVFAEVLPSHKVAKVQELQE-----------------RGLKVAMVGDGVNDSPALAHADLGIAIGTGTDVAIEAADIVLIRNDLLDVVASIELSKKTVQRIRINFVFALIYNLLGIPFAAGVFMPLGLVLQPWMG 1267          

HSP 2 Score: 82.4185 bits (202), Expect = 2.475e-15
Identity = 47/140 (33.57%), Postives = 76/140 (54.29%), Query Frame = 1
Query:  313 MRIQGMTCSSCVHTIENQVLKLKGVKSALINLLSTIGEVTYDPDLIMASDIADTINDMGFDAEIF----QFKEHTKDIIEVM--IQGMTCSSCVYTIESKLAQMQGILSVKVALTTEKGKFKFDPQIISPRDILDAIEEM 714
            ++++GMTC SCV +IE Q+ +L+GV    ++L      + ++P  +   D+   I DMGFDA I     Q +  + D  EV   ++GM C SCV  I   L+ M G+ SV V+L       +FDP +++   +   +EE+
Sbjct:  103 IQVEGMTCQSCVRSIEEQIGRLEGVIGVQVSLSDKEAILRFNPAKVTPEDMRKRIEDMGFDALILALQGQIQPLSTDWSEVTLGVEGMHCGSCVKNITETLSGMLGVNSVFVSLEKGSVDLRFDPSLLTLETVKGFLEEI 242          

HSP 3 Score: 80.8777 bits (198), Expect = 7.321e-15
Identity = 56/179 (31.28%), Postives = 79/179 (44.13%), Query Frame = 1
Query:  319 IQGMTCSSCVHTIENQVLKLKGVKSALINLLSTIGEVTYDPDLIMASDIADTINDMGFDAEIFQ----------------------------------FKEHTKDIIE-------VMIQGMTCSSCVYTIESKLAQMQGILSVKVALTTEKGKFKFDPQIISPRDILDAIEEMGFDAKL 732
            I+GMTC+SCV  IE  + +  GV S  + L    G VT+D  +    ++   I DMGF+A + Q                                   KE+     E       V + GMTC+SCV  IE  L + +GI SV VAL   K + K+DP ++ P  I+  I  +GF A +
Sbjct:  272 IEGMTCNSCVQAIEGMMSQRAGVCSIKVYLQEKKGIVTFDSTVTCPEELRAEIEDMGFEAWLNQDSEICEVSSVSQMPSGLKHLPSQRHPSKPSPSPITKENADGTGERELRKCFVHVTGMTCASCVSNIERNLVKHEGIKSVLVALMAGKAEVKYDPGLLDPAQIVQLISHLGFGASV 450          

HSP 4 Score: 80.1073 bits (196), Expect = 1.543e-14
Identity = 49/178 (27.53%), Postives = 89/178 (50.00%), Query Frame = 1
Query:  241 IENLGF----LINKNKETDNTKELFKCHMRIQGMTCSSCVHTIENQVLKLKGVKSALINLLSTIGEVTYDPDLIMASDIADTINDM----------GFDAEIFQFKEHTKDIIEVMIQGMTCSSCVYTIESKLAQMQGILSVKVALTTEKGKFKFDPQIISPRDILDAIEEMGFDAKL 732
            IE++GF    L  + +    + +  +  + ++GM C SCV  I   +  + GV S  ++L     ++ +DP L+    +   + ++          G+ + +      T+ +  + I+GMTC+SCV  IE  ++Q  G+ S+KV L  +KG   FD  +  P ++   IE+MGF+A L
Sbjct:  157 IEDMGFDALILALQGQIQPLSTDWSEVTLGVEGMHCGSCVKNITETLSGMLGVNSVFVSLEKGSVDLRFDPSLLTLETVKGFLEEIPPGNFRVSIPGWSSRLNSASTPTQSVT-IGIEGMTCNSCVQAIEGMMSQRAGVCSIKVYLQEKKGIVTFDSTVTCPEELRAEIEDMGFEAWL 333          

HSP 5 Score: 68.1662 bits (165), Expect = 5.799e-11
Identity = 24/67 (35.82%), Postives = 50/67 (74.63%), Query Frame = 1
Query:  526 KDIIEVMIQGMTCSSCVYTIESKLAQMQGILSVKVALTTEKGKFKFDPQIISPRDILDAIEEMGFDA 726
            + ++++ ++GMTC SCV +IE ++ +++G++ V+V+L+ ++   +F+P  ++P D+   IE+MGFDA
Sbjct:   98 EGMVKIQVEGMTCQSCVRSIEEQIGRLEGVIGVQVSLSDKEAILRFNPAKVTPEDMRKRIEDMGFDA 164          
BLAST of Copper-transporting ATPase 1 vs. Ensembl Zebrafish
Match: atp7a (ATPase copper transporting alpha [Source:ZFIN;Acc:ZDB-GENE-060825-45])

HSP 1 Score: 765.763 bits (1976), Expect = 0.000e+0
Identity = 435/928 (46.88%), Postives = 582/928 (62.72%), Query Frame = 1
Query:  286 NTKELFKCHMRIQGMTCSSCVHTIENQVLKLKGVKSALINLLSTIGEVTYDPDLIMASDIADTINDMGFDAEIFQFKEHTKDIIEVMIQGMTCSSCVYTIESKLAQMQGILSVKVALTTEKGKFKFDPQIISPRDILDAIEEMGFDAKLAPK-KTNKYNDHVGESIKKWKHSFLISLIFGVPTMIVMMVFMYGFSHRMQVIHLKNGINVTVMVSNAPIXXXXXXXXXXXXXXXX------XPVQFYGARYFYVQAYKSIKHGSANMDVLVVMATSVSYIYSFIVILVSMILRQDSSPQTFFETTPMLIVFLSLGRWLEHIAKGKTSEALSKLLSLQAFEATII-VNDN----QERKISXXXXXXXXXXXXXPGEKIPIDGRVVSGKSRCDESLITGESMSVEKIPGSDVIGGTLNISGMLIIRATLVGEDSALNQIVKLVEEAQTSKAPIQELADKVAGLFVPGVIICSMFTLLIWIAIGYTNPNLLPGHSSINTDNTELIWKYAFQLAITVLSVACPCSLGLATPTAVMVGTGVGAINGILIKGGVPLEKMHQLDVIVFDKTGTITTGKPSVTNFVMCVENVTSQIRNCILLMLGAAESSSEHPIGKAILQYVRETCDINEMPQVVHSKSVSGFGLEC------SLKLQSDMFVPDSEIDNVLVKINDFQENNLTENLKETSVKWRKINEPVEVVLYLGNRNMMKENHISIPDKLDELMSRDEDNGRTVVLMAIDKVLLAMISIADQVKKEAALVVYTLEKMGVEVFLLTGDNHKTATAIAKEIGIRNVFAEVLPSHKVAKIQQIQNMSKYKRSWLFSCCSKPSKLTNVAMVGDGINDSPALAQADVGIAIGTGTDVAVEAADVVLIRNSLLDVIAAMKLSKDTVRRIRQNFVAATMYNLIGIPIAAGALMPIGVVFMPWMASVAMA 3015
            +T  + KC ++I GMTC+SCV  IE  +    G+ S L+ L+++  EV Y P +I    IA+ I ++GF A +    + +   +E++++GMTC+SCV+ IES L + +GIL   VAL+T K   K+DP++  PRDI+  IE MGF A L  K +   + DH  E I++WK SF ISL F VP M  MM++M    H +   H  +             +F    L   L  +         PVQF G RYFY QAYK++KH +ANMDVL+V+AT++++ YS +V+LV+M+ R   +P TFF+T PML VF+SLGRWLE IAK KTSEALSKL+SLQA EAT++ +N++     E ++ V+LV++GD+VKV+PG K P+DGRV+ G S  DESLITGE+M V K PGS VI G++N +G L+I+AT VG D+ L+QIVKLVEEAQTSK                                GY            +    E + ++AFQ +ITVL +ACPCSLGLATPTAVMVGTGVGA NGILIKGG PLE  H++  +VFDKTGTIT G P V    M  E      R+ +L ++G AE+SSEHP+G AI +Y ++      +      ++V G G+ C      +L  + D    +++ + VL++I+D + ++ TE+      +   + +     + +GNR  M+ N + +   +DE M+  E  G T VL+A+D  L AM++IAD VK EA L V+ L  MG+EV L+TGDN KTA AIA ++GIR VFAEVLPSHKVAK++Q+Q   K                  VAMVGDG+NDSPALA ADVGIAIGTGTDVA+EAADVVLIRN LLDV+ ++ LSK TV+RIR NFV A MYNL+GIPIAAG  MP+G+V  PWM S AMA
Sbjct:  468 STNTISKCFIQIGGMTCASCVANIERNLKNEYGIHSVLVALMASKAEVRYSPSVIDPLRIAELIRELGFTATVMDNYDGSDGSLELVVRGMTCASCVHKIESNLMKQKGILYASVALSTNKAHIKYDPEVTGPRDIIRLIENMGFTASLVKKDRPGSHLDHSRE-IRQWKRSFQISLFFCVPVM-GMMIYMIVVDHMIDKYHQHHNATAEDRAKYHSTMFLEKQLLPGLSIMNLISFLFCVPVQFIGGRYFYCQAYKAVKHRTANMDVLIVLATTIAFTYSVVVLLVAMVERAKVNPITFFDTPPMLFVFISLGRWLEQIAKSKTSEALSKLMSLQATEATVVTLNEDMSVLSEEQVDVELVQRGDVVKVVPGGKFPVDGRVIEGHSMADESLITGEAMPVTKKPGSTVIAGSINQNGSLLIKATHVGTDTTLSQIVKLVEEAQTSK--------------------------------GYDK----------SISEAEAVIRFAFQASITVLCIACPCSLGLATPTAVMVGTGVGAQNGILIKGGEPLEMAHKIQSVVFDKTGTITYGAPKVVQVKMLAEG-NRLPRSKLLAIVGTAENSSEHPLGAAITKYCKQELGTESLGTCTDFQAVPGCGIRCLVSNTENLLKREDSDSEENQHNAVLIQISDARAHS-TEHPLIMDPQPLTVVQTASYTVLIGNREWMRRNALQVRADVDEAMTEHERRGCTAVLVAVDNELCAMVAIADTVKPEAELAVHVLSAMGLEVVLMTGDNSKTARAIAAQVGIRKVFAEVLPSHKVAKVEQLQQEGK-----------------RVAMVGDGVNDSPALAMADVGIAIGTGTDVAIEAADVVLIRNDLLDVVGSIDLSKKTVKRIRINFVFALMYNLVGIPIAAGVFMPVGLVLQPWMGSAAMA 1332          

HSP 2 Score: 97.8265 bits (242), Expect = 5.324e-20
Identity = 52/147 (35.37%), Postives = 85/147 (57.82%), Query Frame = 1
Query:  316 RIQGMTCSSCVHTIENQVLKLKGVKSALINLLSTIGEVTYDPDLIMASDIADTINDM---GFDAEIFQ-----FKEHTKDIIEVMIQGMTCSSCVYTIESKLAQMQGILSVKVALTTEKGKFKFDPQIISPRDILDAIEEMGFDAKL 732
            ++ GM C+SCV  I++ + KL  V S +++L +    + ++P  + A ++   I  +    F A I       F +    + E+ I+GMTC SCV +IE  L+Q +G+ S +V+L   KG F++DP + SP ++  AIE+MGFDA L
Sbjct:  280 QVTGMHCNSCVVNIQDNISKLPAVTSVVVSLENRQASIQHNPKQVSAVELQKAIEALPPGNFKAIIPASPEPGFLQPLVSVAEIHIEGMTCGSCVQSIEGTLSQKKGVRSAQVSLANHKGTFEYDPLLTSPEELRAAIEDMGFDAFL 426          

HSP 3 Score: 94.7449 bits (234), Expect = 5.300e-19
Identity = 70/246 (28.46%), Postives = 105/246 (42.68%), Query Frame = 1
Query:  121 IEDFFQFNDNIKTVVIDYEKNLVRICCHNDNCTYLTLCEAIE-----NLGFLINKNKETDNTKELFK-CHMRIQGMTCSSCVHTIENQVLKLKGVKSALINLLSTIGEVTYDPDLIMASDIADTINDMGFDAEIFQFKEHTKDIIE--------------------------------------VMIQGMTCSSCVYTIESKLAQMQGILSVKVALTTEKGKFKFDPQIISPRDILDAIEEMGFDA 726
            I+D       + +VV+  E     I  +    + + L +AIE     N   +I  + E    + L     + I+GMTC SCV +IE  + + KGV+SA ++L +  G   YDP L    ++   I DMGFDA + +       +++                                      + I GMTC+SCV  IE  L    GI SV VAL   K + ++ P +I P  I + I E+GF A
Sbjct:  293 IQDNISKLPAVTSVVVSLENRQASIQHNPKQVSAVELQKAIEALPPGNFKAIIPASPEPGFLQPLVSVAEIHIEGMTCGSCVQSIEGTLSQKKGVRSAQVSLANHKGTFEYDPLLTSPEELRAAIEDMGFDAFLPETNSLVPSVVKSPSLSVRSSSLSPVRSAVKENEAESDAEPSTNTISKCFIQIGGMTCASCVANIERNLKNEYGIHSVLVALMASKAEVRYSPSVIDPLRIAELIRELGFTA 538          

HSP 4 Score: 58.9214 bits (141), Expect = 3.734e-8
Identity = 40/153 (26.14%), Postives = 69/153 (45.10%), Query Frame = 1
Query:  298 LFKCHMRIQGMTCSSCVHTIENQVLKLKGVKSALINLLSTIGEVTYDPDLIMASDIADTINDMGFDAEIFQFKEHTKDIIEVMIQGMTCSS-CVYTIESKLAQMQGILSVKVALTTEKGKFKFDPQIISPRDILDAIEEMGFDAKLAPKKTNK 753
            L +  + ++GMTC SCV +IE ++  L GV    ++L      VTYD        IAD I DMGF++ +             +     CS+  V    S LAQ++G++  + +   +     F P ++S   + + ++ +  D    P  + K
Sbjct:    7 LCRVTLGVEGMTCGSCVQSIEGRIGGLPGVIHIQVSLEQNNATVTYDHTQHTPQSIADAIEDMGFESSLTNATSTPVQTETKVFSKAGCSADSVQQALSTLAQIKGVIETQESADNQGLAVTFVPSLVSEDQLGEVLKCLAPDTACRPPLSPK 159          

HSP 5 Score: 54.6842 bits (130), Expect = 8.039e-7
Identity = 47/204 (23.04%), Postives = 96/204 (47.06%), Query Frame = 1
Query:  166 IDYEKNLVRICCHNDNCTYLTLCEAIENLGFLINKNKETDNTKELFKCHMRI-QGMTCSS-CVHTIENQVLKLKGVKSALINLLSTIGEVTYDPDLIMASDIADTINDMGFDAEI---FQFKEHTK-------DIIEVMIQGMTCSSCVYTIESKLAQMQGILSVKVALTTEKGKFKFDPQIISPRDILDAIEEMGFDAKLAPK 741
            +  E+N   +   +   T  ++ +AIE++GF   ++  T+ T    +   ++     CS+  V    + + ++KGV     +  +    VT+ P L+    + + +  +  D         KE +        + +++ I+GM C SC  TIE K+ +++G+  +KV+L +++    + P II+  +I+  IE  GF A +  K
Sbjct:   41 VSLEQNNATVTYDHTQHTPQSIADAIEDMGF---ESSLTNATSTPVQTETKVFSKAGCSADSVQQALSTLAQIKGVIETQESADNQGLAVTFVPSLVSEDQLGEVLKCLAPDTACRPPLSPKEGSTSRSFSGVEAVKMRIEGMVCLSCTTTIEGKIGKLKGVEKIKVSLESQEAAVVYLPYIITVDEIVKQIEVAGFKATVKSK 241          
BLAST of Copper-transporting ATPase 1 vs. Ensembl Xenopus
Match: dhx34 (DEAH-box helicase 34 [Source:Xenbase;Acc:XB-GENE-1009178])

HSP 1 Score: 841.647 bits (2173), Expect = 0.000e+0
Identity = 481/1006 (47.81%), Postives = 672/1006 (66.80%), Query Frame = 1
Query:  238 AIENLGF----LINKNKETD-----NTKELFKCHMRIQGMTCSSCVHTIENQVLKLKGVKSALINLLSTIGEVTYDPDLIMASDIADTINDMGFDAEIFQFKEHTKDIIEVMIQGMTCSSCVYTIESKLAQMQGILSVKVALTTEKGKFKFDPQIISPRDILDAIEEMGFDAKLAPK-KTNKYNDHVGESIKKWKHSFLISLIFGVPTMIVMMVFMYGFSHRMQVIHLKNGINVTVMVSNAPIXXXX------XXXXXXXXXXXXXPVQFYGARYFYVQAYKSIKHGSANMDVLVVMATSVSYIYSFIVILVSMILRQDSSPQTFFETTPMLIVFLSLGRWLEHIAKGKTSEALSKLLSLQAFEATIIVND-----NQERKISXXXXXXXXXXXXXPGEKIPIDGRVVSGKSRCDESLITGESMSVEKIPGSDVIGGTLNISGMLIIRATLVGEDSALNQIVKLVEEAQTSKAPIQELADKVAGLFVPGVIICSMFTLLIWIAIGYTN----PNLLPGHSSINTDNTELIWKYAFQLAITVLSVACPCSLGLATPTAVMVGTGVGAINGILIKGGVPLEKMHQLDVIVFDKTGTITTGKPSVTNFVMCVENVTSQIRNCILLMLGAAESSSEHPIGKAILQYVRETCDINEMPQVVHSKSVSGFGLECSLK----LQSDMFVPDSEIDNVLVKINDFQENNLTENLKETSVKWRKINEPVEVV-LYLGNRNMMKENHISIPDKLDELMSRDEDNGRTVVLMAIDKVLLAMISIADQVKKEAALVVYTLEKMGVEVFLLTGDNHKTATAIAKEIGIRNVFAEVLPSHKVAKIQQIQNMSKYKRSWLFSCCSKPSKLTNVAMVGDGINDSPALAQADVGIAIGTGTDVAVEAADVVLIRNSLLDVIAAMKLSKDTVRRIRQNFVAATMYNLIGIPIAAGALMPIGVVFMPWMASVAMAASSICVVCXXXXXXXXXXPNEDQLANQEFKNHLECLKYGDMEVGVNLGKD 3165
            AIE++GF    L   NKET        + + KC ++I GMTC+SCV  IE  + + +G+ S L+ L++   EV Y+P+++  S IA+ I ++GF+A + +  +    I+E++++GMTC+SCV+ IES+L + +G+L   VAL T K   KFDP++I PRDI+  I ++GF   L  K ++  + DH  E I++WK SFLISLIF +P M +M+  M+  +H +   H  + + +  + S  P +         LS+ NL+  L   PVQF G  YFY+QAYK++KH +ANMDVL+V+ATSV++IYS IV++V++  +   +P TFF+T PML VF++LGRWLEHIAK KTSEALS+L+SLQA EAT+++ D       E ++ V+LV++GD+V+V PG K P+DGRV+ G+S  DESLITGE+M V K PGS VI G++N +G L+I AT VG D+ L+QIVKLVE+AQTSKAPIQ+ ADK++G FVP ++  S+ TL +WI IGY N        PG++  +    E+I ++AFQ AITVL +ACPCSLGLATPTAVMVGTGVGA NGILIKGG PLE  H++  +VFDKTGTIT G P V    + VE+      N +L ++G AES+SEHP+G A+++Y +E  +   +      ++V G G+ C +     L      PD++ + VLV+I+   E+++   L   +V     + P +   + +GNR  M  N +++  + D LM+  E  GRT VL+A+D VL  +I+IAD VK EAAL +++L  MG+++ L+TGDN KTA  IA ++GI  VFAEVLPSHKVAK++Q+Q                    T VAMVGDGINDSPALA ADVGI IG+GTDVA+EAADVVLIRN LLDV+A++ LS+ TV+RIR NFV A +YNL+GIPIAAG  MP+G++  PWM S AMAASS+ VV  SLLLKL++KP+ ++L  Q  +  +      D+ V + L ++
Sbjct:  434 AIEDMGFDASLLERTNKETPVHSKPEKRTVNKCFIQITGMTCASCVANIERNLRREEGIYSVLVALMAGKAEVRYNPEVLQPSGIAELIQELGFEASVLENYDDGTGILELLVRGMTCASCVHKIESRLMKTKGVLYSSVALATNKAHIKFDPEVIGPRDIMKIINDLGFSTSLVKKDRSASHLDHRVE-IQRWKRSFLISLIFCIPVMGLMVHMMFMENHYLMPHH--HNMTMEDIASYHPTMVLEYQIIPGLSIMNLVSLLLCIPVQFLGGWYFYIQAYKALKHRTANMDVLIVLATSVAFIYSLIVLIVAIFEKSKVNPITFFDTPPMLFVFIALGRWLEHIAKSKTSEALSRLISLQATEATVVILDPDNTVKSEEQVDVELVQRGDIVRVTPGGKFPVDGRVIEGQSMVDESLITGEAMPVSKKPGSSVIAGSINQNGSLLIAATHVGSDTTLSQIVKLVEDAQTSKAPIQQFADKLSGYFVPFIVAVSVLTLFVWIIIGYHNFEIVEKYFPGYNK-SISKGEVIVRFAFQAAITVLCIACPCSLGLATPTAVMVGTGVGAQNGILIKGGEPLEMAHKVKTVVFDKTGTITKGTPVVMQVKVLVES-NRMPSNKLLAIVGTAESNSEHPLGSAVIKYCKEVLNAETLGTCYDFQAVPGCGISCKVNNIEPLLHAANGPDNKRNAVLVQIDGQHEDSI---LPSITVSQNPSSSPPQTYSVLIGNREWMNRNFLTLTAETDSLMTEHEKKGRTAVLVAVDGVLCGLIAIADTVKPEAALAIHSLRSMGLDIVLMTGDNSKTAKTIAAQVGITKVFAEVLPSHKVAKVKQLQEQG-----------------TRVAMVGDGINDSPALAMADVGITIGSGTDVAIEAADVVLIRNDLLDVVASIDLSRKTVKRIRINFVFALIYNLVGIPIAAGVFMPVGLILQPWMGSAAMAASSVSVVFSSLLLKLYRKPSREKL-EQRVQGQMRQKSLSDISVHIGLTEN 1413          

HSP 2 Score: 84.3445 bits (207), Expect = 9.808e-16
Identity = 56/183 (30.60%), Postives = 89/183 (48.63%), Query Frame = 1
Query:  295 ELFKCHMRIQGMTCSSCVHTIENQVLKLKGVKS----------------------ALINLLSTIGEVTYDPDLIMASDIADTIN-----DMGFDAEIFQF---KEHTKDIIEVMIQGMTCSSCVYTIESKLAQMQGILSVKVALTTEKGKFKFDPQIISPRDILDAIEEMGFDAKLAPKKTNK 753
            +L +   +I+GM C SCV  IE+ +    GV S                      ALI  +  +   T+   L    ++A+T +     +     EIF     ++    +  + I+GMTC SCV +IE  +++  G+ S++V+L    G  ++DP + SP DI  AIE+MGFDA L  ++TNK
Sbjct:  269 DLIRAIFQIEGMHCKSCVVNIESNIGSQHGVSSIEVSLENKLAVIHFYSNITTSDALIQAIEALSPGTFKVSLCNHPELAETFSMQKNSEASCAKEIFSSPSNQDFCSKVTVINIEGMTCMSCVQSIEGLISKKPGVKSIQVSLVNNNGTVQYDPAVTSPEDIRAAIEDMGFDASLL-ERTNK 450          

HSP 3 Score: 71.633 bits (174), Expect = 9.018e-12
Identity = 48/187 (25.67%), Postives = 86/187 (45.99%), Query Frame = 1
Query:  229 LCEAIENLGFLINKNKETDNTKELFKCHMRIQGMTCSSCVHTIENQVLKLKGVKSALINLLSTIGEVTYDPDLIMASDIADTINDMGFDAEIFQFKEHTKDIIE------------VMIQGMTCSSCVYTIESKLAQMQGILSVKVALTTEKGKFKFDPQIISPRDILDAIEEMGFDAKLAPKKTNK 753
            L EA+E++GF    +        +    +R   ++       I + + + KGV     +L   +  VT+ P ++    +   I  +  D+     K+ T   +E            + I+GMTC SC  TIE K+ +++G+  +KV+L +++ +  + P +I P DI   IEE GF A++  K   K
Sbjct:   58 LQEAVEDMGFESTLSYANPQPVPMDSTFLR---LSAEQSAEQIRSGLSQFKGVLDVKTSLEGKVACVTFIPSVVNPGLLIQKIPGLSLDS--MASKKTTSGSVESRSSVASDVLVKMKIEGMTCHSCTSTIEGKVGKLKGVQRIKVSLDSQEAQILYQPHLIKPEDIRTQIEEAGFIAQIKSKPPQK 239          

HSP 4 Score: 68.9366 bits (167), Expect = 5.515e-11
Identity = 40/149 (26.85%), Postives = 74/149 (49.66%), Query Frame = 1
Query:  301 FKCHMRIQGMTCSSCVHTIENQVLKLKGVKSALINLLSTIGEVTYDPDLIMASDIADTINDMGFDAEIFQFKEHTKDIIEVMIQGMTCSSCVYTIESKLAQMQGILSVKVALTTEKGKFKFDPQIISPRDILDAIEEMGFDAKLAPKKT 747
            F   + ++GMTC+SCV TIE ++  + GV S  ++L      + YD  L     + + + DMGF++ +         +    ++ ++       I S L+Q +G+L VK +L  +     F P +++P  ++  I  +  D+ +A KKT
Sbjct:    4 FLAFIPVEGMTCNSCVQTIEQKIGSINGVHSIKVSLEGKNAAIIYDAKLQTPKALQEAVEDMGFESTLSYANPQPVPMDSTFLR-LSAEQSAEQIRSGLSQFKGVLDVKTSLEGKVACVTFIPSVVNPGLLIQKIPGLSLDS-MASKKT 150          
BLAST of Copper-transporting ATPase 1 vs. Ensembl Xenopus
Match: dhx34 (DEAH-box helicase 34 [Source:Xenbase;Acc:XB-GENE-1009178])

HSP 1 Score: 837.025 bits (2161), Expect = 0.000e+0
Identity = 451/935 (48.24%), Postives = 629/935 (67.27%), Query Frame = 1
Query:  271 NKETD-----NTKELFKCHMRIQGMTCSSCVHTIENQVLKLKGVKSALINLLSTIGEVTYDPDLIMASDIADTINDMGFDAEIFQFKEHTKDIIEVMIQGMTCSSCVYTIESKLAQMQGILSVKVALTTEKGKFKFDPQIISPRDILDAIEEMGFDAKLAPK-KTNKYNDHVGESIKKWKHSFLISLIFGVPTMIVMMVFMYGFSHRMQVIHLKNGINVTVMVSNAPIXXXX------XXXXXXXXXXXXXPVQFYGARYFYVQAYKSIKHGSANMDVLVVMATSVSYIYSFIVILVSMILRQDSSPQTFFETTPMLIVFLSLGRWLEHIAKGKTSEALSKLLSLQAFEATIIVND-----NQERKISXXXXXXXXXXXXXPGEKIPIDGRVVSGKSRCDESLITGESMSVEKIPGSDVIGGTLNISGMLIIRATLVGEDSALNQIVKLVEEAQTSKAPIQELADKVAGLFVPGVIICSMFTLLIWIAIGYTN----PNLLPGHSSINTDNTELIWKYAFQLAITVLSVACPCSLGLATPTAVMVGTGVGAINGILIKGGVPLEKMHQLDVIVFDKTGTITTGKPSVTNFVMCVENVTSQIRNCILLMLGAAESSSEHPIGKAILQYVRETCDINEMPQVVHSKSVSGFGLECSLK----LQSDMFVPDSEIDNVLVKINDFQENNLTENLKETSVKWRKINEPVEVVLYLGNRNMMKENHISIPDKLDELMSRDEDNGRTVVLMAIDKVLLAMISIADQVKKEAALVVYTLEKMGVEVFLLTGDNHKTATAIAKEIGIRNVFAEVLPSHKVAKIQQIQNMSKYKRSWLFSCCSKPSKLTNVAMVGDGINDSPALAQADVGIAIGTGTDVAVEAADVVLIRNSLLDVIAAMKLSKDTVRRIRQNFVAATMYNLIGIPIAAGALMPIGVVFMPWMA 3000
            NKET        + + KC ++I GMTC+SCV  IE  + + +G+ S L+ L++   EV Y+P+++  S IA+ I ++GF+A + +  +    I+E++++GMTC+SCV+ IES+L + +G+L   VAL T K   KFDP++I PRDI+  I ++GF   L  K ++  + DH  E I++WK SFLISLIF +P M +M+  M+  +H +   H  + + +  + S  P +         LS+ NL+  L   PVQF G  YFY+QAYK++KH +ANMDVL+V+ATSV++IYS IV++V++  +   +P TFF+T PML VF++LGRWLEHIAK KTSEALS+L+SLQA EAT+++ D       E ++ V+LV++GD+V+V PG K P+DGRV+ G+S  DESLITGE+M V K PGS VI G++N +G L+I AT VG D+ L+QIVKLVE+AQTSKAPIQ+ ADK++G FVP ++  S+ TL +WI IGY N        PG++  +    E+I ++AFQ AITVL +ACPCSLGLATPTAVMVGTGVGA NGILIKGG PLE  H++  +VFDKTGTIT G P V    + VE+      N +L ++G AES+SEHP+G A+++Y +E  +   +      ++V G G+ C +     L      PD++ + VLV+I+   E+++  ++  +       + P    + +GNR  M  N +++  + D LM+  E  GRT VL+A+D VL  +I+IAD VK EAAL +++L  MG+++ L+TGDN KTA  IA ++GI  VFAEVLPSHKVAK++Q+Q                    T VAMVGDGINDSPALA ADVGI IG+GTDVA+EAADVVLIRN LLDV+A++ LS+ TV+RIR NFV A +YNL+GIPIAAG  MP+G++  PWM 
Sbjct:  472 NKETPVHSKPEKRTVNKCFIQITGMTCASCVANIERNLRREEGIYSVLVALMAGKAEVRYNPEVLQPSGIAELIQELGFEASVLENYDDGTGILELLVRGMTCASCVHKIESRLMKTKGVLYSSVALATNKAHIKFDPEVIGPRDIMKIINDLGFSTSLVKKDRSASHLDHRVE-IQRWKRSFLISLIFCIPVMGLMVHMMFMENHYLMPHH--HNMTMEDIASYHPTMVLEYQIIPGLSIMNLVSLLLCIPVQFLGGWYFYIQAYKALKHRTANMDVLIVLATSVAFIYSLIVLIVAIFEKSKVNPITFFDTPPMLFVFIALGRWLEHIAKSKTSEALSRLISLQATEATVVILDPDNTVKSEEQVDVELVQRGDIVRVTPGGKFPVDGRVIEGQSMVDESLITGEAMPVSKKPGSSVIAGSINQNGSLLIAATHVGSDTTLSQIVKLVEDAQTSKAPIQQFADKLSGYFVPFIVAVSVLTLFVWIIIGYHNFEIVEKYFPGYNK-SISKGEVIVRFAFQAAITVLCIACPCSLGLATPTAVMVGTGVGAQNGILIKGGEPLEMAHKVKTVVFDKTGTITKGTPVVMQVKVLVES-NRMPSNKLLAIVGTAESNSEHPLGSAVIKYCKEVLNAETLGTCYDFQAVPGCGISCKVNNIEPLLHAANGPDNKRNAVLVQIDGQHEDSILPSITVSQNPSNGSSPPQTYSVLIGNREWMNRNFLTLTAETDSLMTEHEKKGRTAVLVAVDGVLCGLIAIADTVKPEAALAIHSLRSMGLDIVLMTGDNSKTAKTIAAQVGITKVFAEVLPSHKVAKVKQLQEQG-----------------TRVAMVGDGINDSPALAMADVGITIGSGTDVAIEAADVVLIRNDLLDVVASIDLSRKTVKRIRINFVFALIYNLVGIPIAAGVFMPVGLILQPWMG 1384          

HSP 2 Score: 82.4185 bits (202), Expect = 4.303e-15
Identity = 53/176 (30.11%), Postives = 84/176 (47.73%), Query Frame = 1
Query:  295 ELFKCHMRIQGMTCSSCVHTIENQVLKLKGVKS----------------------ALINLLSTIGEVTYDPDLIMASDIADTIN-----DMGFDAEIFQF---KEHTKDIIEVMIQGMTCSSCVYTIESKLAQMQGILSVKVALTTEKGKFKFDPQIISPRDILDAIEEMGFDAKL 732
            +L +   +I+GM C SCV  IE+ +    GV S                      ALI  +  +   T+   L    ++A+T +     +     EIF     ++    +  + I+GMTC SCV +IE  +++  G+ S++V+L    G  ++DP + SP DI  AIE+MGFDA L
Sbjct:  273 DLIRAIFQIEGMHCKSCVVNIESNIGSQHGVSSIEVSLENKLAVIHFYSNITTSDALIQAIEALSPGTFKVSLCNHPELAETFSMQKNSEASCAKEIFSSPSNQDFCSKVTVINIEGMTCMSCVQSIEGLISKKPGVKSIQVSLVNNNGTVQYDPAVTSPEDIRAAIEDMGFDASL 448          

HSP 3 Score: 71.2478 bits (173), Expect = 1.046e-11
Identity = 48/187 (25.67%), Postives = 86/187 (45.99%), Query Frame = 1
Query:  229 LCEAIENLGFLINKNKETDNTKELFKCHMRIQGMTCSSCVHTIENQVLKLKGVKSALINLLSTIGEVTYDPDLIMASDIADTINDMGFDAEIFQFKEHTKDIIE------------VMIQGMTCSSCVYTIESKLAQMQGILSVKVALTTEKGKFKFDPQIISPRDILDAIEEMGFDAKLAPKKTNK 753
            L EA+E++GF    +        +    +R   ++       I + + + KGV     +L   +  VT+ P ++    +   I  +  D+     K+ T   +E            + I+GMTC SC  TIE K+ +++G+  +KV+L +++ +  + P +I P DI   IEE GF A++  K   K
Sbjct:   62 LQEAVEDMGFESTLSYANPQPVPMDSTFLR---LSAEQSAEQIRSGLSQFKGVLDVKTSLEGKVACVTFIPSVVNPGLLIQKIPGLSLDS--MASKKTTSGSVESRSSVASDVLVKMKIEGMTCHSCTSTIEGKVGKLKGVQRIKVSLDSQEAQILYQPHLIKPEDIRTQIEEAGFIAQIKSKPPQK 243          

HSP 4 Score: 68.9366 bits (167), Expect = 5.776e-11
Identity = 40/149 (26.85%), Postives = 74/149 (49.66%), Query Frame = 1
Query:  301 FKCHMRIQGMTCSSCVHTIENQVLKLKGVKSALINLLSTIGEVTYDPDLIMASDIADTINDMGFDAEIFQFKEHTKDIIEVMIQGMTCSSCVYTIESKLAQMQGILSVKVALTTEKGKFKFDPQIISPRDILDAIEEMGFDAKLAPKKT 747
            F   + ++GMTC+SCV TIE ++  + GV S  ++L      + YD  L     + + + DMGF++ +         +    ++ ++       I S L+Q +G+L VK +L  +     F P +++P  ++  I  +  D+ +A KKT
Sbjct:    8 FLAFIPVEGMTCNSCVQTIEQKIGSINGVHSIKVSLEGKNAAIIYDAKLQTPKALQEAVEDMGFESTLSYANPQPVPMDSTFLR-LSAEQSAEQIRSGLSQFKGVLDVKTSLEGKVACVTFIPSVVNPGLLIQKIPGLSLDS-MASKKT 154          
BLAST of Copper-transporting ATPase 1 vs. Ensembl Xenopus
Match: dhx34 (DEAH-box helicase 34 [Source:Xenbase;Acc:XB-GENE-1009178])

HSP 1 Score: 836.254 bits (2159), Expect = 0.000e+0
Identity = 451/935 (48.24%), Postives = 629/935 (67.27%), Query Frame = 1
Query:  271 NKETD-----NTKELFKCHMRIQGMTCSSCVHTIENQVLKLKGVKSALINLLSTIGEVTYDPDLIMASDIADTINDMGFDAEIFQFKEHTKDIIEVMIQGMTCSSCVYTIESKLAQMQGILSVKVALTTEKGKFKFDPQIISPRDILDAIEEMGFDAKLAPK-KTNKYNDHVGESIKKWKHSFLISLIFGVPTMIVMMVFMYGFSHRMQVIHLKNGINVTVMVSNAPIXXXX------XXXXXXXXXXXXXPVQFYGARYFYVQAYKSIKHGSANMDVLVVMATSVSYIYSFIVILVSMILRQDSSPQTFFETTPMLIVFLSLGRWLEHIAKGKTSEALSKLLSLQAFEATIIVND-----NQERKISXXXXXXXXXXXXXPGEKIPIDGRVVSGKSRCDESLITGESMSVEKIPGSDVIGGTLNISGMLIIRATLVGEDSALNQIVKLVEEAQTSKAPIQELADKVAGLFVPGVIICSMFTLLIWIAIGYTN----PNLLPGHSSINTDNTELIWKYAFQLAITVLSVACPCSLGLATPTAVMVGTGVGAINGILIKGGVPLEKMHQLDVIVFDKTGTITTGKPSVTNFVMCVENVTSQIRNCILLMLGAAESSSEHPIGKAILQYVRETCDINEMPQVVHSKSVSGFGLECSLK----LQSDMFVPDSEIDNVLVKINDFQENNLTENLKETSVKWRKINEPVEVVLYLGNRNMMKENHISIPDKLDELMSRDEDNGRTVVLMAIDKVLLAMISIADQVKKEAALVVYTLEKMGVEVFLLTGDNHKTATAIAKEIGIRNVFAEVLPSHKVAKIQQIQNMSKYKRSWLFSCCSKPSKLTNVAMVGDGINDSPALAQADVGIAIGTGTDVAVEAADVVLIRNSLLDVIAAMKLSKDTVRRIRQNFVAATMYNLIGIPIAAGALMPIGVVFMPWMA 3000
            NKET        + + KC ++I GMTC+SCV  IE  + + +G+ S L+ L++   EV Y+P+++  S IA+ I ++GF+A + +  +    I+E++++GMTC+SCV+ IES+L + +G+L   VAL T K   KFDP++I PRDI+  I ++GF   L  K ++  + DH  E I++WK SFLISLIF +P M +M+  M+  +H +   H  + + +  + S  P +         LS+ NL+  L   PVQF G  YFY+QAYK++KH +ANMDVL+V+ATSV++IYS IV++V++  +   +P TFF+T PML VF++LGRWLEHIAK KTSEALS+L+SLQA EAT+++ D       E ++ V+LV++GD+V+V PG K P+DGRV+ G+S  DESLITGE+M V K PGS VI G++N +G L+I AT VG D+ L+QIVKLVE+AQTSKAPIQ+ ADK++G FVP ++  S+ TL +WI IGY N        PG++  +    E+I ++AFQ AITVL +ACPCSLGLATPTAVMVGTGVGA NGILIKGG PLE  H++  +VFDKTGTIT G P V    + VE+      N +L ++G AES+SEHP+G A+++Y +E  +   +      ++V G G+ C +     L      PD++ + VLV+I+   E+++  ++  +       + P    + +GNR  M  N +++  + D LM+  E  GRT VL+A+D VL  +I+IAD VK EAAL +++L  MG+++ L+TGDN KTA  IA ++GI  VFAEVLPSHKVAK++Q+Q                    T VAMVGDGINDSPALA ADVGI IG+GTDVA+EAADVVLIRN LLDV+A++ LS+ TV+RIR NFV A +YNL+GIPIAAG  MP+G++  PWM 
Sbjct:  478 NKETPVHSKPEKRTVNKCFIQITGMTCASCVANIERNLRREEGIYSVLVALMAGKAEVRYNPEVLQPSGIAELIQELGFEASVLENYDDGTGILELLVRGMTCASCVHKIESRLMKTKGVLYSSVALATNKAHIKFDPEVIGPRDIMKIINDLGFSTSLVKKDRSASHLDHRVE-IQRWKRSFLISLIFCIPVMGLMVHMMFMENHYLMPHH--HNMTMEDIASYHPTMVLEYQIIPGLSIMNLVSLLLCIPVQFLGGWYFYIQAYKALKHRTANMDVLIVLATSVAFIYSLIVLIVAIFEKSKVNPITFFDTPPMLFVFIALGRWLEHIAKSKTSEALSRLISLQATEATVVILDPDNTVKSEEQVDVELVQRGDIVRVTPGGKFPVDGRVIEGQSMVDESLITGEAMPVSKKPGSSVIAGSINQNGSLLIAATHVGSDTTLSQIVKLVEDAQTSKAPIQQFADKLSGYFVPFIVAVSVLTLFVWIIIGYHNFEIVEKYFPGYNK-SISKGEVIVRFAFQAAITVLCIACPCSLGLATPTAVMVGTGVGAQNGILIKGGEPLEMAHKVKTVVFDKTGTITKGTPVVMQVKVLVES-NRMPSNKLLAIVGTAESNSEHPLGSAVIKYCKEVLNAETLGTCYDFQAVPGCGISCKVNNIEPLLHAANGPDNKRNAVLVQIDGQHEDSILPSITVSQNPSNGSSPPQTYSVLIGNREWMNRNFLTLTAETDSLMTEHEKKGRTAVLVAVDGVLCGLIAIADTVKPEAALAIHSLRSMGLDIVLMTGDNSKTAKTIAAQVGITKVFAEVLPSHKVAKVKQLQEQG-----------------TRVAMVGDGINDSPALAMADVGITIGSGTDVAIEAADVVLIRNDLLDVVASIDLSRKTVKRIRINFVFALIYNLVGIPIAAGVFMPVGLILQPWMG 1390          

HSP 2 Score: 82.0333 bits (201), Expect = 4.729e-15
Identity = 53/176 (30.11%), Postives = 84/176 (47.73%), Query Frame = 1
Query:  295 ELFKCHMRIQGMTCSSCVHTIENQVLKLKGVKS----------------------ALINLLSTIGEVTYDPDLIMASDIADTIN-----DMGFDAEIFQF---KEHTKDIIEVMIQGMTCSSCVYTIESKLAQMQGILSVKVALTTEKGKFKFDPQIISPRDILDAIEEMGFDAKL 732
            +L +   +I+GM C SCV  IE+ +    GV S                      ALI  +  +   T+   L    ++A+T +     +     EIF     ++    +  + I+GMTC SCV +IE  +++  G+ S++V+L    G  ++DP + SP DI  AIE+MGFDA L
Sbjct:  273 DLIRAIFQIEGMHCKSCVVNIESNIGSQHGVSSIEVSLENKLAVIHFYSNITTSDALIQAIEALSPGTFKVSLCNHPELAETFSMQKNSEASCAKEIFSSPSNQDFCSKVTVINIEGMTCMSCVQSIEGLISKKPGVKSIQVSLVNNNGTVQYDPAVTSPEDIRAAIEDMGFDASL 448          

HSP 3 Score: 71.2478 bits (173), Expect = 1.021e-11
Identity = 48/187 (25.67%), Postives = 86/187 (45.99%), Query Frame = 1
Query:  229 LCEAIENLGFLINKNKETDNTKELFKCHMRIQGMTCSSCVHTIENQVLKLKGVKSALINLLSTIGEVTYDPDLIMASDIADTINDMGFDAEIFQFKEHTKDIIE------------VMIQGMTCSSCVYTIESKLAQMQGILSVKVALTTEKGKFKFDPQIISPRDILDAIEEMGFDAKLAPKKTNK 753
            L EA+E++GF    +        +    +R   ++       I + + + KGV     +L   +  VT+ P ++    +   I  +  D+     K+ T   +E            + I+GMTC SC  TIE K+ +++G+  +KV+L +++ +  + P +I P DI   IEE GF A++  K   K
Sbjct:   62 LQEAVEDMGFESTLSYANPQPVPMDSTFLR---LSAEQSAEQIRSGLSQFKGVLDVKTSLEGKVACVTFIPSVVNPGLLIQKIPGLSLDS--MASKKTTSGSVESRSSVASDVLVKMKIEGMTCHSCTSTIEGKVGKLKGVQRIKVSLDSQEAQILYQPHLIKPEDIRTQIEEAGFIAQIKSKPPQK 243          

HSP 4 Score: 69.707 bits (169), Expect = 2.793e-11
Identity = 43/157 (27.39%), Postives = 78/157 (49.68%), Query Frame = 1
Query:  277 ETDNTKELFKCHMRIQGMTCSSCVHTIENQVLKLKGVKSALINLLSTIGEVTYDPDLIMASDIADTINDMGFDAEIFQFKEHTKDIIEVMIQGMTCSSCVYTIESKLAQMQGILSVKVALTTEKGKFKFDPQIISPRDILDAIEEMGFDAKLAPKKT 747
            ETD+    F   + ++GMTC+SCV TIE ++  + GV S  ++L      + YD  L     + + + DMGF++ +         +    ++ ++       I S L+Q +G+L VK +L  +     F P +++P  ++  I  +  D+ +A KKT
Sbjct:    2 ETDS--RAFLAFIPVEGMTCNSCVQTIEQKIGSINGVHSIKVSLEGKNAAIIYDAKLQTPKALQEAVEDMGFESTLSYANPQPVPMDSTFLR-LSAEQSAEQIRSGLSQFKGVLDVKTSLEGKVACVTFIPSVVNPGLLIQKIPGLSLDS-MASKKT 154          
BLAST of Copper-transporting ATPase 1 vs. Ensembl Xenopus
Match: dhx34 (DEAH-box helicase 34 [Source:Xenbase;Acc:XB-GENE-1009178])

HSP 1 Score: 835.099 bits (2156), Expect = 0.000e+0
Identity = 474/991 (47.83%), Postives = 663/991 (66.90%), Query Frame = 1
Query:  271 NKETD-----NTKELFKCHMRIQGMTCSSCVHTIENQVLKLKGVKSALINLLSTIGEVTYDPDLIMASDIADTINDMGFDAEIFQFKEHTKDIIEVMIQGMTCSSCVYTIESKLAQMQGILSVKVALTTEKGKFKFDPQIISPRDILDAIEEMGFDAKLAPK-KTNKYNDHVGESIKKWKHSFLISLIFGVPTMIVMMVFMYGFSHRMQVIHLKNGINVTVMVSNAPIXXXXX------XXXXXXXXXXXXPVQFYGARYFYVQAYKSIKHGSANMDVLVVMATSVSYIYSFIVILVSMILRQDSSPQTFFETTPMLIVFLSLGRWLEHIAKGKTSEALSKLLSLQAFEATIIVND-----NQERKISXXXXXXXXXXXXXPGEKIPIDGRVVSGKSRCDESLITGESMSVEKIPGSDVIGGTLNISGMLIIRATLVGEDSALNQIVKLVEEAQTSKAPIQELADKVAGLFVPGVIICSMFTLLIWIAIGYTN----PNLLPGHSSINTDNTELIWKYAFQLAITVLSVACPCSLGLATPTAVMVGTGVGAINGILIKGGVPLEKMHQLDVIVFDKTGTITTGKPSVTNFVMCVENVTSQIRNCILLMLGAAESSSEHPIGKAILQYVRETCDINEMPQVVHSKSVSGFGLECSLK----LQSDMFVPDSEIDNVLVKINDFQENNLTENLKETSVKWRKINEPVEVV-LYLGNRNMMKENHISIPDKLDELMSRDEDNGRTVVLMAIDKVLLAMISIADQVKKEAALVVYTLEKMGVEVFLLTGDNHKTATAIAKEIGIRNVFAEVLPSHKVAKIQQIQNMSKYKRSWLFSCCSKPSKLTNVAMVGDGINDSPALAQADVGIAIGTGTDVAVEAADVVLIRNSLLDVIAAMKLSKDTVRRIRQNFVAATMYNLIGIPIAAGALMPIGVVFMPWMASVAMAASSICVVCXXXXXXXXXXPNEDQLANQEFKNHLECLKYGDMEVGVNLGKD 3165
            NKET        + + KC ++I GMTC+SCV  IE  + + +G+ S L+ L++   EV Y+P+++  S IA+ I ++GF+A + +  +    I+E++++GMTC+SCV+ IES+L + +G+L   VAL T K   KFDP++I PRDI+  I ++GF   L  K ++  + DH  E I++WK SFLISLIF +P M +M+  M+  +H +   H  + + +  + S  P +          S+ NL+  L   PVQF G  YFY+QAYK++KH +ANMDVL+V+ATSV++IYS IV++V++  +   +P TFF+T PML VF++LGRWLEHIAK KTSEALS+L+SLQA EAT+++ D       E ++ V+LV++GD+V+V PG K P+DGRV+ G+S  DESLITGE+M V K PGS VI G++N +G L+I AT VG D+ L+QIVKLVE+AQTSKAPIQ+ ADK++G FVP ++  S+ TL +WI IGY N        PG++  +    E+I ++AFQ AITVL +ACPCSLGLATPTAVMVGTGVGA NGILIKGG PLE  H++  +VFDKTGTIT G P V    + VE+      N +L ++G AES+SEHP+G A+++Y +E  +   +      ++V G G+ C +     L      PD++ + VLV+I+   E+++   L   +V     + P +   + +GNR  M  N +++  + D LM+  E  GRT VL+A+D VL  +I+IAD VK EAAL +++L  MG+++ L+TGDN KTA  IA ++GI  VFAEVLPSHKVAK++Q+Q                    T VAMVGDGINDSPALA ADVGI IG+GTDVA+EAADVVLIRN LLDV+A++ LS+ TV+RIR NFV A +YNL+GIPIAAG  MP+G++  PWM S AMAASS+ VV  SLLLKL++KP+ ++L  Q  +  +      D+ V + L ++
Sbjct:  435 NKETPVHSKPEKRTVNKCFIQITGMTCASCVANIERNLRREEGIYSVLVALMAGKAEVRYNPEVLQPSGIAELIQELGFEASVLENYDDGTGILELLVRGMTCASCVHKIESRLMKTKGVLYSSVALATNKAHIKFDPEVIGPRDIMKIINDLGFSTSLVKKDRSASHLDHRVE-IQRWKRSFLISLIFCIPVMGLMVHMMFMENHYLMPHH--HNMTMEDIASYHPTMVLEYQIIPGLSIMNLVSLLLCIPVQFLGGWYFYIQAYKALKHRTANMDVLIVLATSVAFIYSLIVLIVAIFEKSKVNPITFFDTPPMLFVFIALGRWLEHIAKSKTSEALSRLISLQATEATVVILDPDNTVKSEEQVDVELVQRGDIVRVTPGGKFPVDGRVIEGQSMVDESLITGEAMPVSKKPGSSVIAGSINQNGSLLIAATHVGSDTTLSQIVKLVEDAQTSKAPIQQFADKLSGYFVPFIVAVSVLTLFVWIIIGYHNFEIVEKYFPGYNK-SISKGEVIVRFAFQAAITVLCIACPCSLGLATPTAVMVGTGVGAQNGILIKGGEPLEMAHKVKTVVFDKTGTITKGTPVVMQVKVLVES-NRMPSNKLLAIVGTAESNSEHPLGSAVIKYCKEVLNAETLGTCYDFQAVPGCGISCKVNNIEPLLHAANGPDNKRNAVLVQIDGQHEDSI---LPSITVSQNPSSSPPQTYSVLIGNREWMNRNFLTLTAETDSLMTEHEKKGRTAVLVAVDGVLCGLIAIADTVKPEAALAIHSLRSMGLDIVLMTGDNSKTAKTIAAQVGITKVFAEVLPSHKVAKVKQLQEQG-----------------TRVAMVGDGINDSPALAMADVGITIGSGTDVAIEAADVVLIRNDLLDVVASIDLSRKTVKRIRINFVFALIYNLVGIPIAAGVFMPVGLILQPWMGSAAMAASSVSVVFSSLLLKLYRKPSREKL-EQRVQGQMRQKSLSDISVHIGLTEN 1399          

HSP 2 Score: 93.9745 bits (232), Expect = 1.112e-18
Identity = 59/178 (33.15%), Postives = 89/178 (50.00%), Query Frame = 1
Query:  313 MRIQGMTCSSCVHTIENQVLKLKGVKS----------------------ALINLLSTIGEVTYDPDLIMASDIADTIN-----DMGFDAEIFQF---KEHTKDIIEVMIQGMTCSSCVYTIESKLAQMQGILSVKVALTTEKGKFKFDPQIISPRDILDAIEEMGFDAKLAPKKTNKY 756
            M+I+GMTC SC  TIE +V KLKGV+                       ALI  +  +   T+   L    ++A+T +     +     EIF     ++    +  + I+GMTC SCV +IE  +++  G+ S++V+L    G  ++DP + SP DI  AIE+MGFDA L  K +  Y
Sbjct:  173 MKIEGMTCHSCTSTIEGKVGKLKGVQRIKVSLENKLAVIHFYSNITTSDALIQAIEALSPGTFKVSLCNHPELAETFSMQKNSEASCAKEIFSSPSNQDFCSKVTVINIEGMTCMSCVQSIEGLISKKPGVKSIQVSLVNNNGTVQYDPAVTSPEDIRAAIEDMGFDASLLGKYSFFY 350          

HSP 3 Score: 70.0922 bits (170), Expect = 2.321e-11
Identity = 43/157 (27.39%), Postives = 78/157 (49.68%), Query Frame = 1
Query:  277 ETDNTKELFKCHMRIQGMTCSSCVHTIENQVLKLKGVKSALINLLSTIGEVTYDPDLIMASDIADTINDMGFDAEIFQFKEHTKDIIEVMIQGMTCSSCVYTIESKLAQMQGILSVKVALTTEKGKFKFDPQIISPRDILDAIEEMGFDAKLAPKKT 747
            ETD+    F   + ++GMTC+SCV TIE ++  + GV S  ++L      + YD  L     + + + DMGF++ +         +    ++ ++       I S L+Q +G+L VK +L  +     F P +++P  ++  I  +  D+ +A KKT
Sbjct:    2 ETDS--RAFLAFIPVEGMTCNSCVQTIEQKIGSINGVHSIKVSLEGKNAAIIYDAKLQTPKALQEAVEDMGFESTLSYANPQPVPMDSTFLR-LSAEQSAEQIRSGLSQFKGVLDVKTSLEGKVACVTFIPSVVNPGLLIQKIPGLSLDS-MASKKT 154          
BLAST of Copper-transporting ATPase 1 vs. Ensembl Xenopus
Match: dhx34 (DEAH-box helicase 34 [Source:Xenbase;Acc:XB-GENE-1009178])

HSP 1 Score: 831.632 bits (2147), Expect = 0.000e+0
Identity = 455/955 (47.64%), Postives = 635/955 (66.49%), Query Frame = 1
Query:  238 AIENLGFLINKNKETDNTK---ELF-----------KCHMRIQGMTCSSCVHTIENQVLKLKGVKSALINLLSTIGEVTYDPDLIMASDIADTINDMGFDAEIFQFKEHTKDIIEVMIQGMTCSSCVYTIESKLAQMQGILSVKVALTTEKGKFKFDPQIISPRDILDAIEEMGFDAKLAPK-KTNKYNDHVGESIKKWKHSFLISLIFGVPTMIVMMVFMYGFSHRMQVIHLKNGINVTVMVSNAPIXXXX------XXXXXXXXXXXXXPVQFYGARYFYVQAYKSIKHGSANMDVLVVMATSVSYIYSFIVILVSMILRQDSSPQTFFETTPMLIVFLSLGRWLEHIAKGKTSEALSKLLSLQAFEATIIVND-----NQERKISXXXXXXXXXXXXXPGEKIPIDGRVVSGKSRCDESLITGESMSVEKIPGSDVIGGTLNISGMLIIRATLVGEDSALNQIVKLVEEAQTSKAPIQELADKVAGLFVPGVIICSMFTLLIWIAIGYTN----PNLLPGHSSINTDNTELIWKYAFQLAITVLSVACPCSLGLATPTAVMVGTGVGAINGILIKGGVPLEKMHQLDVIVFDKTGTITTGKPSVTNFVMCVENVTSQIRNCILLMLGAAESSSEHPIGKAILQYVRETCDINEMPQVVHSKSVSGFGLECSLK----LQSDMFVPDSEIDNVLVKINDFQENNLTENLKETSVKWRKINEPVEVVLYLGNRNMMKENHISIPDKLDELMSRDEDNGRTVVLMAIDKVLLAMISIADQVKKEAALVVYTLEKMGVEVFLLTGDNHKTATAIAKEIGIRNVFAEVLPSHKVAKIQQIQNMSKYKRSWLFSCCSKPSKLTNVAMVGDGINDSPALAQADVGIAIGTGTDVAVEAADVVLIRNSLLDVIAAMKLSKDTVRRIRQNFVAATMYNLIGIPIAAGALMPIGVVFMPWMA 3000
            AIE++GF  +  +E    K   EL+           KC ++I GMTC+SCV  IE  + + +G+ S L+ L++   EV Y+P+++  S IA+ I ++GF+A + +  +    I+E++++GMTC+SCV+ IES+L + +G+L   VAL T K   KFDP++I PRDI+  I ++GF   L  K ++  + DH  E I++WK SFLISLIF +P M +M+  M+  +H +   H  + + +  + S  P +         LS+ NL+  L   PVQF G  YFY+QAYK++KH +ANMDVL+V+ATSV++IYS IV++V++  +   +P TFF+T PML VF++LGRWLEHIAK KTSEALS+L+SLQA EAT+++ D       E ++ V+LV++GD+V+V PG K P+DGRV+ G+S  DESLITGE+M V K PGS VI G++N +G L+I AT VG D+ L+QIVKLVE+AQTSKAPIQ+ ADK++G FVP ++  S+ TL +WI IGY N        PG++  +    E+I ++AFQ AITVL +ACPCSLGLATPTAVMVGTGVGA NGILIKGG PLE  H++  +VFDKTGTIT G P V    + VE+      N +L ++G AES+SEHP+G A+++Y +E  +   +      ++V G G+ C +     L      PD++ + VLV+I+   E+++   +  +  ++            +GNR  M  N +++  + D LM+  E  GRT VL+A+D VL  +I+IAD VK EAAL +++L  MG+++ L+TGDN KTA  IA ++GI  VFAEVLPSHKVAK++Q+Q                    T VAMVGDGINDSPALA ADVGI IG+GTDVA+EAADVVLIRN LLDV+A++ LS+ TV+RIR NFV A +YNL+GIPIAAG  MP+G++  PWM 
Sbjct:  438 AIEDMGFDQHVAREPLVGKFDFELYCSCKPEKRTVNKCFIQITGMTCASCVANIERNLRREEGIYSVLVALMAGKAEVRYNPEVLQPSGIAELIQELGFEASVLENYDDGTGILELLVRGMTCASCVHKIESRLMKTKGVLYSSVALATNKAHIKFDPEVIGPRDIMKIINDLGFSTSLVKKDRSASHLDHRVE-IQRWKRSFLISLIFCIPVMGLMVHMMFMENHYLMPHH--HNMTMEDIASYHPTMVLEYQIIPGLSIMNLVSLLLCIPVQFLGGWYFYIQAYKALKHRTANMDVLIVLATSVAFIYSLIVLIVAIFEKSKVNPITFFDTPPMLFVFIALGRWLEHIAKSKTSEALSRLISLQATEATVVILDPDNTVKSEEQVDVELVQRGDIVRVTPGGKFPVDGRVIEGQSMVDESLITGEAMPVSKKPGSSVIAGSINQNGSLLIAATHVGSDTTLSQIVKLVEDAQTSKAPIQQFADKLSGYFVPFIVAVSVLTLFVWIIIGYHNFEIVEKYFPGYNK-SISKGEVIVRFAFQAAITVLCIACPCSLGLATPTAVMVGTGVGAQNGILIKGGEPLEMAHKVKTVVFDKTGTITKGTPVVMQVKVLVES-NRMPSNKLLAIVGTAESNSEHPLGSAVIKYCKEVLNAETLGTCYDFQAVPGCGISCKVNNIEPLLHAANGPDNKRNAVLVQIDGQHEDSILNVVNLSQFRF-----------LIGNREWMNRNFLTLTAETDSLMTEHEKKGRTAVLVAVDGVLCGLIAIADTVKPEAALAIHSLRSMGLDIVLMTGDNSKTAKTIAAQVGITKVFAEVLPSHKVAKVKQLQEQG-----------------TRVAMVGDGINDSPALAMADVGITIGSGTDVAIEAADVVLIRNDLLDVVASIDLSRKTVKRIRINFVFALIYNLVGIPIAAGVFMPVGLILQPWMG 1359          

HSP 2 Score: 80.4925 bits (197), Expect = 1.591e-14
Identity = 52/177 (29.38%), Postives = 84/177 (47.46%), Query Frame = 1
Query:  295 ELFKCHMRIQGMTCSSCVHTIENQVLKLKGVKS----------------------ALINLLSTIGEVTYDPDLIMASDIADTIN-----DMGFDAEIFQF---KEHTKDIIEVMIQGMTCSSCVYTIESKLAQMQGILSVKVALTTEKGKFKFDPQIISPRDILDAIEEMGFDAKLA 735
            +L +   +I+GM C SCV  IE+ +    GV S                      ALI  +  +   T+   L    ++A+T +     +     EIF     ++    +  + I+GMTC SCV +IE  +++  G+ S++V+L    G  ++DP + SP DI  AIE+MGFD  +A
Sbjct:  273 DLIRAIFQIEGMHCKSCVVNIESNIGSQHGVSSIEVSLENKLAVIHFYSNITTSDALIQAIEALSPGTFKVSLCNHPELAETFSMQKNSEASCAKEIFSSPSNQDFCSKVTVINIEGMTCMSCVQSIEGLISKKPGVKSIQVSLVNNNGTVQYDPAVTSPEDIRAAIEDMGFDQHVA 449          

HSP 3 Score: 70.8626 bits (172), Expect = 1.213e-11
Identity = 48/187 (25.67%), Postives = 86/187 (45.99%), Query Frame = 1
Query:  229 LCEAIENLGFLINKNKETDNTKELFKCHMRIQGMTCSSCVHTIENQVLKLKGVKSALINLLSTIGEVTYDPDLIMASDIADTINDMGFDAEIFQFKEHTKDIIE------------VMIQGMTCSSCVYTIESKLAQMQGILSVKVALTTEKGKFKFDPQIISPRDILDAIEEMGFDAKLAPKKTNK 753
            L EA+E++GF    +        +    +R   ++       I + + + KGV     +L   +  VT+ P ++    +   I  +  D+     K+ T   +E            + I+GMTC SC  TIE K+ +++G+  +KV+L +++ +  + P +I P DI   IEE GF A++  K   K
Sbjct:   62 LQEAVEDMGFESTLSYANPQPVPMDSTFLR---LSAEQSAEQIRSGLSQFKGVLDVKTSLEGKVACVTFIPSVVNPGLLIQKIPGLSLDS--MASKKTTSGSVESRSSVASDVLVKMKIEGMTCHSCTSTIEGKVGKLKGVQRIKVSLDSQEAQILYQPHLIKPEDIRTQIEEAGFIAQIKSKPPQK 243          

HSP 4 Score: 69.707 bits (169), Expect = 3.024e-11
Identity = 43/157 (27.39%), Postives = 78/157 (49.68%), Query Frame = 1
Query:  277 ETDNTKELFKCHMRIQGMTCSSCVHTIENQVLKLKGVKSALINLLSTIGEVTYDPDLIMASDIADTINDMGFDAEIFQFKEHTKDIIEVMIQGMTCSSCVYTIESKLAQMQGILSVKVALTTEKGKFKFDPQIISPRDILDAIEEMGFDAKLAPKKT 747
            ETD+    F   + ++GMTC+SCV TIE ++  + GV S  ++L      + YD  L     + + + DMGF++ +         +    ++ ++       I S L+Q +G+L VK +L  +     F P +++P  ++  I  +  D+ +A KKT
Sbjct:    2 ETDS--RAFLAFIPVEGMTCNSCVQTIEQKIGSINGVHSIKVSLEGKNAAIIYDAKLQTPKALQEAVEDMGFESTLSYANPQPVPMDSTFLR-LSAEQSAEQIRSGLSQFKGVLDVKTSLEGKVACVTFIPSVVNPGLLIQKIPGLSLDS-MASKKT 154          
BLAST of Copper-transporting ATPase 1 vs. Ensembl Mouse
Match: Atp7b (ATPase, Cu++ transporting, beta polypeptide [Source:MGI Symbol;Acc:MGI:103297])

HSP 1 Score: 828.935 bits (2140), Expect = 0.000e+0
Identity = 445/908 (49.01%), Postives = 607/908 (66.85%), Query Frame = 1
Query:  304 KCHMRIQGMTCSSCVHTIENQVLKLKGVKSALINLLSTIGEVTYDPDLIMASDIADTINDMGFDAEIFQFKEHTKDIIEVMIQGMTCSSCVYTIESKLAQMQGILSVKVALTTEKGKFKFDPQIISPRDILDAIEEMGFDAKLAPKKTNKYN-DHVGESIKKWKHSFLISLIFGVPTMIVMMVFMYGFSHRMQVIHLKNGINVTVMVSNAPIXXXXXXXXXXXXXXXXXPVQFYGARYFYVQAYKSIKHGSANMDVLVVMATSVSYIYSFIVILVSMILRQDSSPQTFFETTPMLIVFLSLGRWLEHIAKGKTSEALSKLLSLQAFEATIIV--NDN---QERKISXXXXXXXXXXXXXPGEKIPIDGRVVSGKSRCDESLITGESMSVEKIPGSDVIGGTLNISGMLIIRATLVGEDSALNQIVKLVEEAQTSKAPIQELADKVAGLFVPGVIICSMFTLLIWIAIGYTNPNLLPGH---SSINTDNTELIWKYAFQLAITVLSVACPCSLGLATPTAVMVGTGVGAINGILIKGGVPLEKMHQLDVIVFDKTGTITTGKPSVTNFVMCVENVTSQIRNCILLMLGAAESSSEHPIGKAILQYVRETCDINEMPQVVHSKSVSGFGLECSLKLQSDMFVPDSEIDNVLVKINDFQENNLTENLKETSVKWRKINEPVEVVLYLGNRNMMKENHISIPDKLDELMSRDEDNGRTVVLMAIDKVLLAMISIADQVKKEAALVVYTLEKMGVEVFLLTGDNHKTATAIAKEIGIRNVFAEVLPSHKVAKIQQIQNMSKYKRSWLFSCCSKPSKLTNVAMVGDGINDSPALAQADVGIAIGTGTDVAVEAADVVLIRNSLLDVIAAMKLSKDTVRRIRQNFVAATMYNLIGIPIAAGALMPIGVVFMPWMA 3000
            KC ++I+GMTC+SCV  IE  + +  G+ S L+ L+S   EV YDP++I +  IA  I D+GF+A + +    ++  IE++I GMTC+SCV+ IESKL +  GI    VAL T K   KFDP+I+ PRDI+  IEE+GF A LA +  N ++ DH  E IK+WK SFL SL+FG+P M +M+  +   S   + + L + I   + V N                     VQF G  YFYVQAYKS++H SANMDVL+V+AT+++Y YS ++++V++  + + SP TFF+T PML VF++LGRWLEH+AK KTSEAL+KL+SLQA EAT++    DN   +E ++ ++LV++GD++KV+PG K P+DG+V+ G +  DESLITGE+M V K PGS VI G++N  G ++++AT VG D+ L QIVKLVEEAQ SKAPIQ+LAD+ +G FVP +II S  TL++WI IG+ +  ++  +    S +   TE+I ++AFQ +ITVL +ACPCSLGLATPTAVMVGTGV A NG+LIKGG PLE  H++  ++FDKTGTIT G P V  F++  +  T  +R  +L ++G AE+SSEHP+G A+ +Y +E      +      ++V G G+ C +          S ++ +L + +D   + +      T     +   P    + +GNR  M+ N ++I   + + M+  E  G+T +L+AID VL  MI+IAD VK EAAL +YTL+ MGV+V L+TGDN KTA AIA ++GI  VFAEVLPSHKVAK+Q++QN  K                  VAMVGDG+NDSPALAQADVGIAIGTGTDVA+EAADVVLIRN LLDV+A++ LSK TVRRIR N V A +YN++GIPIAAG  MPIG+V  PWM 
Sbjct:  376 KCFVQIKGMTCASCVSNIERSLQRHAGILSVLVALMSGKAEVKYDPEIIQSPRIAQLIQDLGFEASVMEDNTVSEGDIELIITGMTCASCVHNIESKLTRTNGITYASVALATSKAHVKFDPEIVGPRDIIKIIEEIGFHASLAQRNPNAHHLDHKTE-IKQWKKSFLCSLVFGIPVMGLMVYMLIPSSTPQETMVLDHNIIPGLSVLNLIFFILCTF------------VQFLGGWYFYVQAYKSLRHRSANMDVLIVLATTIAYAYSLVILVVAVAEKAEKSPVTFFDTPPMLFVFIALGRWLEHVAKSKTSEALAKLMSLQATEATVVTLGEDNLILREEQVPMELVQRGDVIKVVPGGKFPVDGKVLEGNTMADESLITGEAMPVTKKPGSIVIAGSINAHGSVLLKATHVGNDTTLAQIVKLVEEAQMSKAPIQQLADRFSGYFVPFIIIISTLTLVVWIVIGFVDFGVVQKYFPSPSKHISQTEVIIRFAFQTSITVLCIACPCSLGLATPTAVMVGTGVAAQNGVLIKGGKPLEMAHKIKTVMFDKTGTITHGVPRVMRFLLLADVATLPLRK-VLAVVGTAEASSEHPLGVAVTKYCKEELGTETLGYSTDFQAVPGCGISCKV----------SNVEGILAR-SDLTAHPVGVGNPPTG----EGAGPQTFSVLIGNREWMRRNGLTISSDISDAMTDHEMKGQTAILVAIDGVLCGMIAIADAVKPEAALAIYTLKSMGVDVALITGDNRKTARAIATQVGINKVFAEVLPSHKVAKVQELQNEGK-----------------KVAMVGDGVNDSPALAQADVGIAIGTGTDVAIEAADVVLIRNDLLDVVASIHLSKRTVRRIRVNLVLALIYNMVGIPIAAGVFMPIGIVLQPWMG 1237          

HSP 2 Score: 102.449 bits (254), Expect = 2.437e-21
Identity = 54/163 (33.13%), Postives = 91/163 (55.83%), Query Frame = 1
Query:  319 IQGMTCSSCVHTIENQVLKLKGVKSALINLLSTIGEVTYDPDLIMASDIADTINDMGFDAEIFQFKEHT---------KDIIEVMIQGMTCSSCVYTIESKLAQMQGILSVKVALTTEKGKFKFDPQIISPRDILDAIEEMGFDA---------KLAPKKTNK 753
            I GMTC SCV +IE+++  LKG+ +  ++L      V Y P ++    I   I DMGF+A   + K  +         + ++++ ++GMTC SCV +IE K+ ++QG++ +KV+L+ ++    + P +I P D+ D I +MGF+A         +L P   NK
Sbjct:   62 ILGMTCHSCVKSIEDRISSLKGIVNIKVSLEQGSATVRYVPSVMNLQQICLQIEDMGFEASAAEGKAASWPSRSSPAQEAVVKLRVEGMTCQSCVSSIEGKIRKLQGVVRIKVSLSNQEAVITYQPYLIQPEDLRDHICDMGFEAAIKNRTAPLRLGPIDVNK 224          

HSP 3 Score: 62.3882 bits (150), Expect = 4.153e-9
Identity = 31/94 (32.98%), Postives = 53/94 (56.38%), Query Frame = 1
Query:  229 LCEAIENLGFLINKNKETDNTKELFKCHMRIQGMTCSSCVHTIENQVLKLKGVKSALINLLSTIGEVTYDPDLIMASDIADTINDMGFDAEIFQ 510
            + + I++LGF    +   DNT       + I GMTC+SCVH IE+++ +  G+  A + L ++   V +DP+++   DI   I ++GF A + Q
Sbjct:  429 IAQLIQDLGF--EASVMEDNTVSEGDIELIITGMTCASCVHNIESKLTRTNGITYASVALATSKAHVKFDPEIVGPRDIIKIIEEIGFHASLAQ 520          

HSP 4 Score: 56.225 bits (134), Expect = 2.760e-7
Identity = 26/72 (36.11%), Postives = 45/72 (62.50%), Query Frame = 1
Query:  541 VMIQGMTCSSCVYTIESKLAQMQGILSVKVALTTEKGKFKFDPQIISPRDILDAIEEMGFDAKLAPKKTNKY 756
            V I GMTC SCV +IE +++ ++GI+++KV+L       ++ P +++ + I   IE+MGF+A  A  K   +
Sbjct:   60 VNILGMTCHSCVKSIEDRISSLKGIVNIKVSLEQGSATVRYVPSVMNLQQICLQIEDMGFEASAAEGKAASW 131          
BLAST of Copper-transporting ATPase 1 vs. Ensembl Mouse
Match: Atp7a (ATPase, Cu++ transporting, alpha polypeptide [Source:MGI Symbol;Acc:MGI:99400])

HSP 1 Score: 828.165 bits (2138), Expect = 0.000e+0
Identity = 467/974 (47.95%), Postives = 637/974 (65.40%), Query Frame = 1
Query:  226 TLCEAIENLGF-----------------------LINKNKETDN--TKELFKCHMRIQGMTCSSCVHTIENQVLKLKGVKSALINLLSTIGEVTYDPDLIMASDIADTINDMGFDAEIFQFKEHTKDIIEVMIQGMTCSSCVYTIESKLAQMQGILSVKVALTTEKGKFKFDPQIISPRDILDAIEEMGFDAKLAPK-KTNKYNDHVGESIKKWKHSFLISLIFGVPTMIVMMVFMYGFSHRMQVIHLKNGINVTVMVSNAPIXXXXX------XXXXXXXXXXXXPVQFYGARYFYVQAYKSIKHGSANMDVLVVMATSVSYIYSFIVILVSMILRQDSSPQTFFETTPMLIVFLSLGRWLEHIAKGKTSEALSKLLSLQAFEATIIVNDNQ-----ERKISXXXXXXXXXXXXXPGEKIPIDGRVVSGKSRCDESLITGESMSVEKIPGSDVIGGTLNISGMLIIRATLVGEDSALNQIVKLVEEAQTSKAPIQELADKVAGLFVPGVIICSMFTLLIWIAIGYTN----PNLLPGHSSINTDNTELIWKYAFQLAITVLSVACPCSLGLATPTAVMVGTGVGAINGILIKGGVPLEKMHQLDVIVFDKTGTITTGKPSVTNFVMCVENVTSQI-RNCILLMLGAAESSSEHPIGKAILQYVRETCDINEMPQVVHSKSVSGFGLEC------SLKLQSDMFVPDSEIDNV-LVKINDFQENNLTENLKETSVKWRKINEPVEVVLYLGNRNMMKENHISIPDKLDELMSRDEDNGRTVVLMAIDKVLLAMISIADQVKKEAALVVYTLEKMGVEVFLLTGDNHKTATAIAKEIGIRNVFAEVLPSHKVAKIQQIQNMSKYKRSWLFSCCSKPSKLTNVAMVGDGINDSPALAQADVGIAIGTGTDVAVEAADVVLIRNSLLDVIAAMKLSKDTVRRIRQNFVAATMYNLIGIPIAAGALMPIGVVFMPWMA 3000
            TL EAIE++GF                       L+  + E +N  T    KC++++ GMTC+SCV  IE  + + +G+ S L+ L++   EV Y+P +I    IA+ I ++GF A + +       I+E++++GMTC+SCV+ IES L + +GI    VAL T K   K+DP+II PRDI+  I  +GF+A L  K ++  + DH  E IK+W+ SFL+SL F +P M  +MV+M    H +  +H    ++   M++    +F         S+ NLL  L   PVQF G  YFY+QAYK++KH +ANMDVL+V+AT++++ YS +++LV+M  R   +P TFF+T PML VF++LGRWLEHIAKGKTSEAL+KL+SLQA EATI+  +++     E ++ V+LV++GD++KV+PG K P+DGRV+ G S  DESLITGE+M V K PGS VI G++N +G L+IRAT VG D+ L+QIVKLVEEAQTSKAPIQ+ ADK++G FVP +++ S+ TLL+WI IG+ N        PG++  +   TE I ++AFQ +ITVL +ACPCSLGLATPTAVMVGTGVGA NGILIKGG PLE  H++ V+VFDKTGTIT G P V    + VE  +++I RN IL ++G AES+SEHP+G A+ +Y ++  D   +      + V G G+ C       L  +S++ + ++ I N  LV+I+   E + T +               +  + +GNR  M  N + I + +DE M   E  GRT VL+ ID  L  +I+IAD VK EA L V+ L+ MG+EV L+TGDN KTA +IA ++GI  VFAEVLPSHKVAK++Q+Q   K                  VAMVGDGINDSPALA A+VGIAIGTGTDVA+EAADVVLIRN LLDV+A++ LS+ TV+RIR NFV A +YNL+GIPIAAG  +PIG+V  PWM 
Sbjct:  430 TLREAIEDMGFDAALPADMKEPLVVIAQPSLETPLLPSSNELENVMTSVQNKCYIQVSGMTCASCVANIERNLRREEGIYSVLVALMAGKAEVRYNPAVIQPRVIAEFIRELGFGAMVMENAGEGNGILELVVRGMTCASCVHKIESTLTKHKGIFYCSVALATNKAHIKYDPEIIGPRDIIHTIGSLGFEASLVKKDRSANHLDHKRE-IKQWRGSFLVSLFFCIPVM-GLMVYMMVMDHHLATLHHNQNMSNEEMINMHSAMFLERQILPGLSIMNLLSLLLCLPVQFCGGWYFYIQAYKALKHKTANMDVLIVLATTIAFAYSLVILLVAMFERAKVNPITFFDTPPMLFVFIALGRWLEHIAKGKTSEALAKLISLQATEATIVTLNSENLLLSEEQVDVELVQRGDIIKVVPGGKFPVDGRVIEGHSMVDESLITGEAMPVAKKPGSTVIAGSINQNGSLLIRATHVGADTTLSQIVKLVEEAQTSKAPIQQFADKLSGYFVPFIVLVSIVTLLVWIIIGFQNFEIVETYFPGYNR-SISRTETIIRFAFQASITVLCIACPCSLGLATPTAVMVGTGVGAQNGILIKGGEPLEMAHKVKVVVFDKTGTITHGTPVVNQVKVLVE--SNKISRNKILAIVGTAESNSEHPLGAAVTKYCKKELDTETLGTCTDFQVVPGCGISCKVTNIEGLLHKSNLKIEENNIKNASLVQIDAINEQSSTSSSMIIDAHLSNAVNTQQYKVLIGNREWMIRNGLVISNDVDESMIEHERRGRTAVLVTIDDELCGLIAIADTVKPEAELAVHILKSMGLEVVLMTGDNSKTARSIASQVGITKVFAEVLPSHKVAKVKQLQEEGK-----------------RVAMVGDGINDSPALAMANVGIAIGTGTDVAIEAADVVLIRNDLLDVVASIDLSRKTVKRIRINFVFALIYNLVGIPIAAGVFLPIGLVLQPWMG 1381          

HSP 2 Score: 100.138 bits (248), Expect = 1.289e-20
Identity = 56/165 (33.94%), Postives = 83/165 (50.30%), Query Frame = 1
Query:  313 MRIQGMTCSSCVHTIENQVLKLKGVKSALINLLSTIGEVTYDPDLIMASDIADTINDMGFDA---------------------------EIFQFKEHTKDIIEVMIQGMTCSSCVYTIESKLAQMQGILSVKVALTTEKGKFKFDPQIISPRDILDAIEEMGFDA 726
            + I GMTC+SCV +IE  + K  GVKS  ++L ++ G + +DP L     + + I DMGFDA                           E+       ++   + + GMTC+SCV  IE  L + +GI SV VAL   K + +++P +I PR I + I E+GF A
Sbjct:  381 ININGMTCNSCVQSIEGVISKKPGVKSIHVSLANSTGTIEFDPLLTSPETLREAIEDMGFDAALPADMKEPLVVIAQPSLETPLLPSSNELENVMTSVQNKCYIQVSGMTCASCVANIERNLRREEGIYSVLVALMAGKAEVRYNPAVIQPRVIAEFIRELGFGA 545          

HSP 3 Score: 77.411 bits (189), Expect = 1.103e-13
Identity = 63/190 (33.16%), Postives = 94/190 (49.47%), Query Frame = 1
Query:  226 TLCEAIENLGF---LINKNKETDNTKELFKCHMRIQGMTCSSCVHTIENQVLKLKGVKSALINLLSTIGEVTYDPDLIMASDIADTINDMGFDAEIFQFK-----EH-TKDIIEVM----IQGMTCSSCVYTIESKLAQMQGILSVKVALTTEKGKFKFDPQIISPRDILDAIEEMGFDAKLAPKKTNKY 756
            TL EAI+++GF   L N N     T  +F   + +         H I++ +LK KGV    I+       VT  P ++ AS I + + D+  D    + K     EH T    EVM    ++GMTC SC  TIE K+ ++QG+  +KV+L  ++    F P +I+  +I   IE +GF A +  KK  KY
Sbjct:   61 TLQEAIDDMGFDALLHNANPLPVLTNTVF---LTVTAPLTLPWDH-IQSTLLKTKGVTGVKISPQQRSAVVTIIPSVVSASQIVELVPDLSLDMGTQEKKSGACEEHSTPQAGEVMLKMKVEGMTCHSCTSTIEGKVGKLQGVQRIKVSLDNQEATIVFQPHLITAEEIKKQIEAVGFPAFI--KKQPKY 244          

HSP 4 Score: 76.2554 bits (186), Expect = 2.322e-13
Identity = 48/162 (29.63%), Postives = 77/162 (47.53%), Query Frame = 1
Query:  319 IQGMTCSSCVHTIENQVLKLKGVKSALINLLSTIGEVTYDPDLIMAS----------------DIADTINDMGFDAEIFQFKEHTKDIIE--------VMIQGMTCSSCVYTIESKLAQMQGILSVKVALTTEKGKFKFDPQIISPRDILDAIEEMGFDAKL 732
            I+GM C SCV  IE+ +  L+ V S +++L +    V Y+  L+                    IA  +            ++   +I+         + I GMTC+SCV +IE  +++  G+ S+ V+L    G  +FDP + SP  + +AIE+MGFDA L
Sbjct:  283 IEGMHCKSCVSNIESALSTLQYVSSIVVSLENRSAIVKYNASLVTPEMLRKAIEAISPGQYRVSIASEVESTASSPSSSSLQKMPLNIVSQPLTQEAVININGMTCNSCVQSIEGVISKKPGVKSIHVSLANSTGTIEFDPLLTSPETLREAIEDMGFDAAL 444          

HSP 5 Score: 75.0998 bits (183), Expect = 5.942e-13
Identity = 49/162 (30.25%), Postives = 78/162 (48.15%), Query Frame = 1
Query:  313 MRIQGMTCSSCVHTIENQVLKLKGVKSALINLLSTIGEVTYDPDLIMASDIADTINDMGFDAEIFQFKEHTK-DIIEV-----------------------------MIQGMTCSSCVYTIESKLAQMQGILSVKVALTTEKGKFKFDPQIISPRDILDAIE 708
            M+++GMTC SC  TIE +V KL+GV+   ++L +    + + P LI A +I   I  +GF A I +  ++ K   I+V                              I+GM C SCV  IES L+ +Q + S+ V+L       K++  +++P  +  AIE
Sbjct:  175 MKVEGMTCHSCTSTIEGKVGKLQGVQRIKVSLDNQEATIVFQPHLITAEEIKKQIEAVGFPAFIKKQPKYLKLGAIDVERLKNTPVKSSEGSQQKSPSYPSDSTTMFTIEGMHCKSCVSNIESALSTLQYVSSIVVSLENRSAIVKYNASLVTPEMLRKAIE 336          

HSP 6 Score: 69.3218 bits (168), Expect = 3.450e-11
Identity = 46/168 (27.38%), Postives = 80/168 (47.62%), Query Frame = 1
Query:  319 IQGMTCSSCVHTIENQVLKLKGVKSALINLLSTIGEVTYDPDLIMASDIADTINDMGFDAEIFQFKEHTKDIIEVMIQG--MTCSSCVYT----IESKLAQMQGILSVKVALTTEKGKFKFDPQIISPRDILDAIEEMGFDAKLAPKKTNKYNDH----VGESIKKWK 792
            ++GMTC SCV TIE Q+ K+ GV    ++L      + YDP L     + + I+DMGFDA +     H  + + V+     +T ++ +      I+S L + +G+  VK++           P ++S   I++ + ++  D     KK+    +H     GE + K K
Sbjct:   14 VEGMTCISCVRTIEQQIGKVNGVHHIKVSLEEKSATIIYDPKLQTPKTLQEAIDDMGFDALL-----HNANPLPVLTNTVFLTVTAPLTLPWDHIQSTLLKTKGVTGVKISPQQRSAVVTIIPSVVSASQIVELVPDLSLDMGTQEKKSGACEEHSTPQAGEVMLKMK 176          

HSP 7 Score: 64.3142 bits (155), Expect = 1.079e-9
Identity = 26/66 (39.39%), Postives = 46/66 (69.70%), Query Frame = 1
Query:  535 IEVMIQGMTCSSCVYTIESKLAQMQGILSVKVALTTEKGKFKFDPQIISPRDILDAIEEMGFDAKL 732
            I + ++GMTC SCV TIE ++ ++ G+  +KV+L  +     +DP++ +P+ + +AI++MGFDA L
Sbjct:   10 ITITVEGMTCISCVRTIEQQIGKVNGVHHIKVSLEEKSATIIYDPKLQTPKTLQEAIDDMGFDALL 75          
BLAST of Copper-transporting ATPase 1 vs. Ensembl Mouse
Match: Atp7a (ATPase, Cu++ transporting, alpha polypeptide [Source:MGI Symbol;Acc:MGI:99400])

HSP 1 Score: 827.78 bits (2137), Expect = 0.000e+0
Identity = 467/973 (48.00%), Postives = 637/973 (65.47%), Query Frame = 1
Query:  226 TLCEAIENLGF----------------------LINKNKETDN--TKELFKCHMRIQGMTCSSCVHTIENQVLKLKGVKSALINLLSTIGEVTYDPDLIMASDIADTINDMGFDAEIFQFKEHTKDIIEVMIQGMTCSSCVYTIESKLAQMQGILSVKVALTTEKGKFKFDPQIISPRDILDAIEEMGFDAKLAPK-KTNKYNDHVGESIKKWKHSFLISLIFGVPTMIVMMVFMYGFSHRMQVIHLKNGINVTVMVSNAPIXXXXX------XXXXXXXXXXXXPVQFYGARYFYVQAYKSIKHGSANMDVLVVMATSVSYIYSFIVILVSMILRQDSSPQTFFETTPMLIVFLSLGRWLEHIAKGKTSEALSKLLSLQAFEATIIVNDNQ-----ERKISXXXXXXXXXXXXXPGEKIPIDGRVVSGKSRCDESLITGESMSVEKIPGSDVIGGTLNISGMLIIRATLVGEDSALNQIVKLVEEAQTSKAPIQELADKVAGLFVPGVIICSMFTLLIWIAIGYTN----PNLLPGHSSINTDNTELIWKYAFQLAITVLSVACPCSLGLATPTAVMVGTGVGAINGILIKGGVPLEKMHQLDVIVFDKTGTITTGKPSVTNFVMCVENVTSQI-RNCILLMLGAAESSSEHPIGKAILQYVRETCDINEMPQVVHSKSVSGFGLEC------SLKLQSDMFVPDSEIDNV-LVKINDFQENNLTENLKETSVKWRKINEPVEVVLYLGNRNMMKENHISIPDKLDELMSRDEDNGRTVVLMAIDKVLLAMISIADQVKKEAALVVYTLEKMGVEVFLLTGDNHKTATAIAKEIGIRNVFAEVLPSHKVAKIQQIQNMSKYKRSWLFSCCSKPSKLTNVAMVGDGINDSPALAQADVGIAIGTGTDVAVEAADVVLIRNSLLDVIAAMKLSKDTVRRIRQNFVAATMYNLIGIPIAAGALMPIGVVFMPWMA 3000
            TL EAIE++GF                      L+  + E +N  T    KC++++ GMTC+SCV  IE  + + +G+ S L+ L++   EV Y+P +I    IA+ I ++GF A + +       I+E++++GMTC+SCV+ IES L + +GI    VAL T K   K+DP+II PRDI+  I  +GF+A L  K ++  + DH  E IK+W+ SFL+SL F +P M  +MV+M    H +  +H    ++   M++    +F         S+ NLL  L   PVQF G  YFY+QAYK++KH +ANMDVL+V+AT++++ YS +++LV+M  R   +P TFF+T PML VF++LGRWLEHIAKGKTSEAL+KL+SLQA EATI+  +++     E ++ V+LV++GD++KV+PG K P+DGRV+ G S  DESLITGE+M V K PGS VI G++N +G L+IRAT VG D+ L+QIVKLVEEAQTSKAPIQ+ ADK++G FVP +++ S+ TLL+WI IG+ N        PG++  +   TE I ++AFQ +ITVL +ACPCSLGLATPTAVMVGTGVGA NGILIKGG PLE  H++ V+VFDKTGTIT G P V    + VE  +++I RN IL ++G AES+SEHP+G A+ +Y ++  D   +      + V G G+ C       L  +S++ + ++ I N  LV+I+   E + T +               +  + +GNR  M  N + I + +DE M   E  GRT VL+ ID  L  +I+IAD VK EA L V+ L+ MG+EV L+TGDN KTA +IA ++GI  VFAEVLPSHKVAK++Q+Q   K                  VAMVGDGINDSPALA A+VGIAIGTGTDVA+EAADVVLIRN LLDV+A++ LS+ TV+RIR NFV A +YNL+GIPIAAG  +PIG+V  PWM 
Sbjct:  430 TLREAIEDMGFDAALPDMKEPLVVIAQPSLETPLLPSSNELENVMTSVQNKCYIQVSGMTCASCVANIERNLRREEGIYSVLVALMAGKAEVRYNPAVIQPRVIAEFIRELGFGAMVMENAGEGNGILELVVRGMTCASCVHKIESTLTKHKGIFYCSVALATNKAHIKYDPEIIGPRDIIHTIGSLGFEASLVKKDRSANHLDHKRE-IKQWRGSFLVSLFFCIPVM-GLMVYMMVMDHHLATLHHNQNMSNEEMINMHSAMFLERQILPGLSIMNLLSLLLCLPVQFCGGWYFYIQAYKALKHKTANMDVLIVLATTIAFAYSLVILLVAMFERAKVNPITFFDTPPMLFVFIALGRWLEHIAKGKTSEALAKLISLQATEATIVTLNSENLLLSEEQVDVELVQRGDIIKVVPGGKFPVDGRVIEGHSMVDESLITGEAMPVAKKPGSTVIAGSINQNGSLLIRATHVGADTTLSQIVKLVEEAQTSKAPIQQFADKLSGYFVPFIVLVSIVTLLVWIIIGFQNFEIVETYFPGYNR-SISRTETIIRFAFQASITVLCIACPCSLGLATPTAVMVGTGVGAQNGILIKGGEPLEMAHKVKVVVFDKTGTITHGTPVVNQVKVLVE--SNKISRNKILAIVGTAESNSEHPLGAAVTKYCKKELDTETLGTCTDFQVVPGCGISCKVTNIEGLLHKSNLKIEENNIKNASLVQIDAINEQSSTSSSMIIDAHLSNAVNTQQYKVLIGNREWMIRNGLVISNDVDESMIEHERRGRTAVLVTIDDELCGLIAIADTVKPEAELAVHILKSMGLEVVLMTGDNSKTARSIASQVGITKVFAEVLPSHKVAKVKQLQEEGK-----------------RVAMVGDGINDSPALAMANVGIAIGTGTDVAIEAADVVLIRNDLLDVVASIDLSRKTVKRIRINFVFALIYNLVGIPIAAGVFLPIGLVLQPWMG 1380          

HSP 2 Score: 103.605 bits (257), Expect = 1.111e-21
Identity = 59/164 (35.98%), Postives = 86/164 (52.44%), Query Frame = 1
Query:  313 MRIQGMTCSSCVHTIENQVLKLKGVKSALINLLSTIGEVTYDPDLIMASDIADTINDMGFDAEIFQFKE----------------HTKDIIEVM----------IQGMTCSSCVYTIESKLAQMQGILSVKVALTTEKGKFKFDPQIISPRDILDAIEEMGFDA 726
            + I GMTC+SCV +IE  + K  GVKS  ++L ++ G + +DP L     + + I DMGFDA +   KE                 + ++  VM          + GMTC+SCV  IE  L + +GI SV VAL   K + +++P +I PR I + I E+GF A
Sbjct:  381 ININGMTCNSCVQSIEGVISKKPGVKSIHVSLANSTGTIEFDPLLTSPETLREAIEDMGFDAALPDMKEPLVVIAQPSLETPLLPSSNELENVMTSVQNKCYIQVSGMTCASCVANIERNLRREEGIYSVLVALMAGKAEVRYNPAVIQPRVIAEFIRELGFGA 544          

HSP 3 Score: 77.411 bits (189), Expect = 1.160e-13
Identity = 63/190 (33.16%), Postives = 94/190 (49.47%), Query Frame = 1
Query:  226 TLCEAIENLGF---LINKNKETDNTKELFKCHMRIQGMTCSSCVHTIENQVLKLKGVKSALINLLSTIGEVTYDPDLIMASDIADTINDMGFDAEIFQFK-----EH-TKDIIEVM----IQGMTCSSCVYTIESKLAQMQGILSVKVALTTEKGKFKFDPQIISPRDILDAIEEMGFDAKLAPKKTNKY 756
            TL EAI+++GF   L N N     T  +F   + +         H I++ +LK KGV    I+       VT  P ++ AS I + + D+  D    + K     EH T    EVM    ++GMTC SC  TIE K+ ++QG+  +KV+L  ++    F P +I+  +I   IE +GF A +  KK  KY
Sbjct:   61 TLQEAIDDMGFDALLHNANPLPVLTNTVF---LTVTAPLTLPWDH-IQSTLLKTKGVTGVKISPQQRSAVVTIIPSVVSASQIVELVPDLSLDMGTQEKKSGACEEHSTPQAGEVMLKMKVEGMTCHSCTSTIEGKVGKLQGVQRIKVSLDNQEATIVFQPHLITAEEIKKQIEAVGFPAFI--KKQPKY 244          

HSP 4 Score: 76.2554 bits (186), Expect = 2.264e-13
Identity = 49/166 (29.52%), Postives = 78/166 (46.99%), Query Frame = 1
Query:  319 IQGMTCSSCVHTIENQVLKLKGVKSALINLLSTIGEVTYDPDLIMAS----------------DIADTINDMGFDAEIFQFKEHTKDIIE--------VMIQGMTCSSCVYTIESKLAQMQGILSVKVALTTEKGKFKFDPQIISPRDILDAIEEMGFDAKLAPKK 744
            I+GM C SCV  IE+ +  L+ V S +++L +    V Y+  L+                    IA  +            ++   +I+         + I GMTC+SCV +IE  +++  G+ S+ V+L    G  +FDP + SP  + +AIE+MGFDA L   K
Sbjct:  283 IEGMHCKSCVSNIESALSTLQYVSSIVVSLENRSAIVKYNASLVTPEMLRKAIEAISPGQYRVSIASEVESTASSPSSSSLQKMPLNIVSQPLTQEAVININGMTCNSCVQSIEGVISKKPGVKSIHVSLANSTGTIEFDPLLTSPETLREAIEDMGFDAALPDMK 448          

HSP 5 Score: 74.7146 bits (182), Expect = 6.094e-13
Identity = 49/162 (30.25%), Postives = 78/162 (48.15%), Query Frame = 1
Query:  313 MRIQGMTCSSCVHTIENQVLKLKGVKSALINLLSTIGEVTYDPDLIMASDIADTINDMGFDAEIFQFKEHTK-DIIEV-----------------------------MIQGMTCSSCVYTIESKLAQMQGILSVKVALTTEKGKFKFDPQIISPRDILDAIE 708
            M+++GMTC SC  TIE +V KL+GV+   ++L +    + + P LI A +I   I  +GF A I +  ++ K   I+V                              I+GM C SCV  IES L+ +Q + S+ V+L       K++  +++P  +  AIE
Sbjct:  175 MKVEGMTCHSCTSTIEGKVGKLQGVQRIKVSLDNQEATIVFQPHLITAEEIKKQIEAVGFPAFIKKQPKYLKLGAIDVERLKNTPVKSSEGSQQKSPSYPSDSTTMFTIEGMHCKSCVSNIESALSTLQYVSSIVVSLENRSAIVKYNASLVTPEMLRKAIE 336          

HSP 6 Score: 68.9366 bits (167), Expect = 3.508e-11
Identity = 46/168 (27.38%), Postives = 80/168 (47.62%), Query Frame = 1
Query:  319 IQGMTCSSCVHTIENQVLKLKGVKSALINLLSTIGEVTYDPDLIMASDIADTINDMGFDAEIFQFKEHTKDIIEVMIQG--MTCSSCVYT----IESKLAQMQGILSVKVALTTEKGKFKFDPQIISPRDILDAIEEMGFDAKLAPKKTNKYNDH----VGESIKKWK 792
            ++GMTC SCV TIE Q+ K+ GV    ++L      + YDP L     + + I+DMGFDA +     H  + + V+     +T ++ +      I+S L + +G+  VK++           P ++S   I++ + ++  D     KK+    +H     GE + K K
Sbjct:   14 VEGMTCISCVRTIEQQIGKVNGVHHIKVSLEEKSATIIYDPKLQTPKTLQEAIDDMGFDALL-----HNANPLPVLTNTVFLTVTAPLTLPWDHIQSTLLKTKGVTGVKISPQQRSAVVTIIPSVVSASQIVELVPDLSLDMGTQEKKSGACEEHSTPQAGEVMLKMK 176          

HSP 7 Score: 64.3142 bits (155), Expect = 1.106e-9
Identity = 26/66 (39.39%), Postives = 46/66 (69.70%), Query Frame = 1
Query:  535 IEVMIQGMTCSSCVYTIESKLAQMQGILSVKVALTTEKGKFKFDPQIISPRDILDAIEEMGFDAKL 732
            I + ++GMTC SCV TIE ++ ++ G+  +KV+L  +     +DP++ +P+ + +AI++MGFDA L
Sbjct:   10 ITITVEGMTCISCVRTIEQQIGKVNGVHHIKVSLEEKSATIIYDPKLQTPKTLQEAIDDMGFDALL 75          
BLAST of Copper-transporting ATPase 1 vs. Ensembl Mouse
Match: Atp7b (ATPase, Cu++ transporting, beta polypeptide [Source:MGI Symbol;Acc:MGI:103297])

HSP 1 Score: 827.78 bits (2137), Expect = 0.000e+0
Identity = 445/908 (49.01%), Postives = 607/908 (66.85%), Query Frame = 1
Query:  304 KCHMRIQGMTCSSCVHTIENQVLKLKGVKSALINLLSTIGEVTYDPDLIMASDIADTINDMGFDAEIFQFKEHTKDIIEVMIQGMTCSSCVYTIESKLAQMQGILSVKVALTTEKGKFKFDPQIISPRDILDAIEEMGFDAKLAPKKTNKYN-DHVGESIKKWKHSFLISLIFGVPTMIVMMVFMYGFSHRMQVIHLKNGINVTVMVSNAPIXXXXXXXXXXXXXXXXXPVQFYGARYFYVQAYKSIKHGSANMDVLVVMATSVSYIYSFIVILVSMILRQDSSPQTFFETTPMLIVFLSLGRWLEHIAKGKTSEALSKLLSLQAFEATIIV--NDN---QERKISXXXXXXXXXXXXXPGEKIPIDGRVVSGKSRCDESLITGESMSVEKIPGSDVIGGTLNISGMLIIRATLVGEDSALNQIVKLVEEAQTSKAPIQELADKVAGLFVPGVIICSMFTLLIWIAIGYTNPNLLPGH---SSINTDNTELIWKYAFQLAITVLSVACPCSLGLATPTAVMVGTGVGAINGILIKGGVPLEKMHQLDVIVFDKTGTITTGKPSVTNFVMCVENVTSQIRNCILLMLGAAESSSEHPIGKAILQYVRETCDINEMPQVVHSKSVSGFGLECSLKLQSDMFVPDSEIDNVLVKINDFQENNLTENLKETSVKWRKINEPVEVVLYLGNRNMMKENHISIPDKLDELMSRDEDNGRTVVLMAIDKVLLAMISIADQVKKEAALVVYTLEKMGVEVFLLTGDNHKTATAIAKEIGIRNVFAEVLPSHKVAKIQQIQNMSKYKRSWLFSCCSKPSKLTNVAMVGDGINDSPALAQADVGIAIGTGTDVAVEAADVVLIRNSLLDVIAAMKLSKDTVRRIRQNFVAATMYNLIGIPIAAGALMPIGVVFMPWMA 3000
            KC ++I+GMTC+SCV  IE  + +  G+ S L+ L+S   EV YDP++I +  IA  I D+GF+A + +    ++  IE++I GMTC+SCV+ IESKL +  GI    VAL T K   KFDP+I+ PRDI+  IEE+GF A LA +  N ++ DH  E IK+WK SFL SL+FG+P M +M+  +   S   + + L + I   + V N                     VQF G  YFYVQAYKS++H SANMDVL+V+AT+++Y YS ++++V++  + + SP TFF+T PML VF++LGRWLEH+AK KTSEAL+KL+SLQA EAT++    DN   +E ++ ++LV++GD++KV+PG K P+DG+V+ G +  DESLITGE+M V K PGS VI G++N  G ++++AT VG D+ L QIVKLVEEAQ SKAPIQ+LAD+ +G FVP +II S  TL++WI IG+ +  ++  +    S +   TE+I ++AFQ +ITVL +ACPCSLGLATPTAVMVGTGV A NG+LIKGG PLE  H++  ++FDKTGTIT G P V  F++  +  T  +R  +L ++G AE+SSEHP+G A+ +Y +E      +      ++V G G+ C +          S ++ +L + +D   + +      T     +   P    + +GNR  M+ N ++I   + + M+  E  G+T +L+AID VL  MI+IAD VK EAAL +YTL+ MGV+V L+TGDN KTA AIA ++GI  VFAEVLPSHKVAK+Q++QN  K                  VAMVGDG+NDSPALAQADVGIAIGTGTDVA+EAADVVLIRN LLDV+A++ LSK TVRRIR N V A +YN++GIPIAAG  MPIG+V  PWM 
Sbjct:  491 KCFVQIKGMTCASCVSNIERSLQRHAGILSVLVALMSGKAEVKYDPEIIQSPRIAQLIQDLGFEASVMEDNTVSEGDIELIITGMTCASCVHNIESKLTRTNGITYASVALATSKAHVKFDPEIVGPRDIIKIIEEIGFHASLAQRNPNAHHLDHKTE-IKQWKKSFLCSLVFGIPVMGLMVYMLIPSSTPQETMVLDHNIIPGLSVLNLIFFILCTF------------VQFLGGWYFYVQAYKSLRHRSANMDVLIVLATTIAYAYSLVILVVAVAEKAEKSPVTFFDTPPMLFVFIALGRWLEHVAKSKTSEALAKLMSLQATEATVVTLGEDNLILREEQVPMELVQRGDVIKVVPGGKFPVDGKVLEGNTMADESLITGEAMPVTKKPGSIVIAGSINAHGSVLLKATHVGNDTTLAQIVKLVEEAQMSKAPIQQLADRFSGYFVPFIIIISTLTLVVWIVIGFVDFGVVQKYFPSPSKHISQTEVIIRFAFQTSITVLCIACPCSLGLATPTAVMVGTGVAAQNGVLIKGGKPLEMAHKIKTVMFDKTGTITHGVPRVMRFLLLADVATLPLRK-VLAVVGTAEASSEHPLGVAVTKYCKEELGTETLGYSTDFQAVPGCGISCKV----------SNVEGILAR-SDLTAHPVGVGNPPTG----EGAGPQTFSVLIGNREWMRRNGLTISSDISDAMTDHEMKGQTAILVAIDGVLCGMIAIADAVKPEAALAIYTLKSMGVDVALITGDNRKTARAIATQVGINKVFAEVLPSHKVAKVQELQNEGK-----------------KVAMVGDGVNDSPALAQADVGIAIGTGTDVAIEAADVVLIRNDLLDVVASIHLSKRTVRRIRVNLVLALIYNMVGIPIAAGVFMPIGIVLQPWMG 1352          

HSP 2 Score: 102.064 bits (253), Expect = 2.898e-21
Identity = 54/163 (33.13%), Postives = 91/163 (55.83%), Query Frame = 1
Query:  319 IQGMTCSSCVHTIENQVLKLKGVKSALINLLSTIGEVTYDPDLIMASDIADTINDMGFDAEIFQFKEHT---------KDIIEVMIQGMTCSSCVYTIESKLAQMQGILSVKVALTTEKGKFKFDPQIISPRDILDAIEEMGFDA---------KLAPKKTNK 753
            I GMTC SCV +IE+++  LKG+ +  ++L      V Y P ++    I   I DMGF+A   + K  +         + ++++ ++GMTC SCV +IE K+ ++QG++ +KV+L+ ++    + P +I P D+ D I +MGF+A         +L P   NK
Sbjct:   74 ILGMTCHSCVKSIEDRISSLKGIVNIKVSLEQGSATVRYVPSVMNLQQICLQIEDMGFEASAAEGKAASWPSRSSPAQEAVVKLRVEGMTCQSCVSSIEGKIRKLQGVVRIKVSLSNQEAVITYQPYLIQPEDLRDHICDMGFEAAIKNRTAPLRLGPIDVNK 236          

HSP 3 Score: 63.5438 bits (153), Expect = 1.861e-9
Identity = 57/203 (28.08%), Postives = 83/203 (40.89%), Query Frame = 1
Query:  313 MRIQGMTCSSCVHTIENQVLKLKGVKSALINLLSTIGEVTYDPDLIMASDIADTINDMGFD----AEIF------QFKE-----HTKDIIEVMIQGM------------------TCSSCVYTIESK--------------------LAQMQGILSVKVALTTEKGKFKFDPQIISPRDILDAIEEMGFDAKLAPKKTNKYND 762
            + I G+TC+S V  IE+ + + KGV+   I+L    G V YDP ++   ++   + DMGF+    +E F       FK       T   I   +Q M                  T SS   T   K                    L +  GILSV VAL + K + K+DP+II    I   I+++GF+A +    T    D
Sbjct:  365 LTISGITCASSVQPIEDMLSQRKGVQQTSISLAEGTGAVLYDPSIVSLDELRTAVEDMGFEVSVNSETFTINPVRNFKSGNSVPQTMGDIAGSVQKMAPDTRGLPTHQGPGHSSETPSSPGATASQKCFVQIKGMTCASCVSNIERSLQRHAGILSVLVALMSGKAEVKYDPEIIQSPRIAQLIQDLGFEASVMEDNTVSEGD 567          

HSP 4 Score: 62.003 bits (149), Expect = 4.923e-9
Identity = 31/94 (32.98%), Postives = 53/94 (56.38%), Query Frame = 1
Query:  229 LCEAIENLGFLINKNKETDNTKELFKCHMRIQGMTCSSCVHTIENQVLKLKGVKSALINLLSTIGEVTYDPDLIMASDIADTINDMGFDAEIFQ 510
            + + I++LGF    +   DNT       + I GMTC+SCVH IE+++ +  G+  A + L ++   V +DP+++   DI   I ++GF A + Q
Sbjct:  544 IAQLIQDLGF--EASVMEDNTVSEGDIELIITGMTCASCVHNIESKLTRTNGITYASVALATSKAHVKFDPEIVGPRDIIKIIEEIGFHASLAQ 635          

HSP 5 Score: 56.225 bits (134), Expect = 3.129e-7
Identity = 26/72 (36.11%), Postives = 45/72 (62.50%), Query Frame = 1
Query:  541 VMIQGMTCSSCVYTIESKLAQMQGILSVKVALTTEKGKFKFDPQIISPRDILDAIEEMGFDAKLAPKKTNKY 756
            V I GMTC SCV +IE +++ ++GI+++KV+L       ++ P +++ + I   IE+MGF+A  A  K   +
Sbjct:   72 VNILGMTCHSCVKSIEDRISSLKGIVNIKVSLEQGSATVRYVPSVMNLQQICLQIEDMGFEASAAEGKAASW 143          
BLAST of Copper-transporting ATPase 1 vs. Ensembl Mouse
Match: Atp2a1 (ATPase, Ca++ transporting, cardiac muscle, fast twitch 1 [Source:MGI Symbol;Acc:MGI:105058])

HSP 1 Score: 81.6481 bits (200), Expect = 4.156e-15
Identity = 53/193 (27.46%), Postives = 97/193 (50.26%), Query Frame = 1
Query: 2368 PDKLDELMSRDEDNGRTVVLMAIDKVLLAMISIADQVKKEAALVVYTLEKMGVEVFLLTGDNHKTATAIAKEIGIRNVFAEVLPSHKVAKIQQIQNMSKYKRSWLFSCC------SKPSKLTN--------VAMVGDGINDSPALAQADVGIAIGTGTDVAVEAADVVLIRNSLLDVIAAMKLSKDTVRRIRQ 2904
            P K +E++    D+    +   +D   + ++ + D  +KE    +      G+ V ++TGDN  TA AI + IGI +   EV       +      +++ + +   +CC      S  SK+           AM GDG+ND+PAL +A++GIA+G+GT VA  A+++VL  ++   ++AA++  +     ++Q
Sbjct:  570 PPKREEMVL---DDSAKFMEYEMDLTFVGVVGMLDPPRKEVTGSIQLCRDAGIRVIMITGDNKGTAIAICRRIGIFSENEEVTDRAYTGREFDDLPLAEQREACRRACCFARVEPSHKSKIVEYLQSYDEITAMTGDGVNDAPALKKAEIGIAMGSGTAVAKTASEMVLADDNFSTIVAAVEEGRAIYNNMKQ 759          
BLAST of Copper-transporting ATPase 1 vs. UniProt/SwissProt
Match: sp|Q64446|ATP7B_MOUSE (Copper-transporting ATPase 2 OS=Mus musculus OX=10090 GN=Atp7b PE=1 SV=2)

HSP 1 Score: 827.78 bits (2137), Expect = 0.000e+0
Identity = 445/908 (49.01%), Postives = 607/908 (66.85%), Query Frame = 1
Query:  304 KCHMRIQGMTCSSCVHTIENQVLKLKGVKSALINLLSTIGEVTYDPDLIMASDIADTINDMGFDAEIFQFKEHTKDIIEVMIQGMTCSSCVYTIESKLAQMQGILSVKVALTTEKGKFKFDPQIISPRDILDAIEEMGFDAKLAPKKTNKYN-DHVGESIKKWKHSFLISLIFGVPTMIVMMVFMYGFSHRMQVIHLKNGINVTVMVSNAPIXXXXXXXXXXXXXXXXXPVQFYGARYFYVQAYKSIKHGSANMDVLVVMATSVSYIYSFIVILVSMILRQDSSPQTFFETTPMLIVFLSLGRWLEHIAKGKTSEALSKLLSLQAFEATIIV--NDN---QERKISXXXXXXXXXXXXXPGEKIPIDGRVVSGKSRCDESLITGESMSVEKIPGSDVIGGTLNISGMLIIRATLVGEDSALNQIVKLVEEAQTSKAPIQELADKVAGLFVPGVIICSMFTLLIWIAIGYTNPNLLPGH---SSINTDNTELIWKYAFQLAITVLSVACPCSLGLATPTAVMVGTGVGAINGILIKGGVPLEKMHQLDVIVFDKTGTITTGKPSVTNFVMCVENVTSQIRNCILLMLGAAESSSEHPIGKAILQYVRETCDINEMPQVVHSKSVSGFGLECSLKLQSDMFVPDSEIDNVLVKINDFQENNLTENLKETSVKWRKINEPVEVVLYLGNRNMMKENHISIPDKLDELMSRDEDNGRTVVLMAIDKVLLAMISIADQVKKEAALVVYTLEKMGVEVFLLTGDNHKTATAIAKEIGIRNVFAEVLPSHKVAKIQQIQNMSKYKRSWLFSCCSKPSKLTNVAMVGDGINDSPALAQADVGIAIGTGTDVAVEAADVVLIRNSLLDVIAAMKLSKDTVRRIRQNFVAATMYNLIGIPIAAGALMPIGVVFMPWMA 3000
            KC ++I+GMTC+SCV  IE  + +  G+ S L+ L+S   EV YDP++I +  IA  I D+GF+A + +    ++  IE++I GMTC+SCV+ IESKL +  GI    VAL T K   KFDP+I+ PRDI+  IEE+GF A LA +  N ++ DH  E IK+WK SFL SL+FG+P M +M+  +   S   + + L + I   + V N                     VQF G  YFYVQAYKS++H SANMDVL+V+AT+++Y YS ++++V++  + + SP TFF+T PML VF++LGRWLEH+AK KTSEAL+KL+SLQA EAT++    DN   +E ++ ++LV++GD++KV+PG K P+DG+V+ G +  DESLITGE+M V K PGS VI G++N  G ++++AT VG D+ L QIVKLVEEAQ SKAPIQ+LAD+ +G FVP +II S  TL++WI IG+ +  ++  +    S +   TE+I ++AFQ +ITVL +ACPCSLGLATPTAVMVGTGV A NG+LIKGG PLE  H++  ++FDKTGTIT G P V  F++  +  T  +R  +L ++G AE+SSEHP+G A+ +Y +E      +      ++V G G+ C +          S ++ +L + +D   + +      T     +   P    + +GNR  M+ N ++I   + + M+  E  G+T +L+AID VL  MI+IAD VK EAAL +YTL+ MGV+V L+TGDN KTA AIA ++GI  VFAEVLPSHKVAK+Q++QN  K                  VAMVGDG+NDSPALAQADVGIAIGTGTDVA+EAADVVLIRN LLDV+A++ LSK TVRRIR N V A +YN++GIPIAAG  MPIG+V  PWM 
Sbjct:  491 KCFVQIKGMTCASCVSNIERSLQRHAGILSVLVALMSGKAEVKYDPEIIQSPRIAQLIQDLGFEASVMEDNTVSEGDIELIITGMTCASCVHNIESKLTRTNGITYASVALATSKAHVKFDPEIVGPRDIIKIIEEIGFHASLAQRNPNAHHLDHKTE-IKQWKKSFLCSLVFGIPVMGLMVYMLIPSSTPQETMVLDHNIIPGLSVLNLIFFILCTF------------VQFLGGWYFYVQAYKSLRHRSANMDVLIVLATTIAYAYSLVILVVAVAEKAEKSPVTFFDTPPMLFVFIALGRWLEHVAKSKTSEALAKLMSLQATEATVVTLGEDNLILREEQVPMELVQRGDVIKVVPGGKFPVDGKVLEGNTMADESLITGEAMPVTKKPGSIVIAGSINAHGSVLLKATHVGNDTTLAQIVKLVEEAQMSKAPIQQLADRFSGYFVPFIIIISTLTLVVWIVIGFVDFGVVQKYFPSPSKHISQTEVIIRFAFQTSITVLCIACPCSLGLATPTAVMVGTGVAAQNGVLIKGGKPLEMAHKIKTVMFDKTGTITHGVPRVMRFLLLADVATLPLRK-VLAVVGTAEASSEHPLGVAVTKYCKEELGTETLGYSTDFQAVPGCGISCKV----------SNVEGILAR-SDLTAHPVGVGNPPTG----EGAGPQTFSVLIGNREWMRRNGLTISSDISDAMTDHEMKGQTAILVAIDGVLCGMIAIADAVKPEAALAIYTLKSMGVDVALITGDNRKTARAIATQVGINKVFAEVLPSHKVAKVQELQNEGK-----------------KVAMVGDGVNDSPALAQADVGIAIGTGTDVAIEAADVVLIRNDLLDVVASIHLSKRTVRRIRVNLVLALIYNMVGIPIAAGVFMPIGIVLQPWMG 1352          

HSP 2 Score: 102.064 bits (253), Expect = 2.027e-20
Identity = 54/163 (33.13%), Postives = 91/163 (55.83%), Query Frame = 1
Query:  319 IQGMTCSSCVHTIENQVLKLKGVKSALINLLSTIGEVTYDPDLIMASDIADTINDMGFDAEIFQFKEHT---------KDIIEVMIQGMTCSSCVYTIESKLAQMQGILSVKVALTTEKGKFKFDPQIISPRDILDAIEEMGFDA---------KLAPKKTNK 753
            I GMTC SCV +IE+++  LKG+ +  ++L      V Y P ++    I   I DMGF+A   + K  +         + ++++ ++GMTC SCV +IE K+ ++QG++ +KV+L+ ++    + P +I P D+ D I +MGF+A         +L P   NK
Sbjct:   74 ILGMTCHSCVKSIEDRISSLKGIVNIKVSLEQGSATVRYVPSVMNLQQICLQIEDMGFEASAAEGKAASWPSRSSPAQEAVVKLRVEGMTCQSCVSSIEGKIRKLQGVVRIKVSLSNQEAVITYQPYLIQPEDLRDHICDMGFEAAIKNRTAPLRLGPIDVNK 236          

HSP 3 Score: 63.5438 bits (153), Expect = 1.302e-8
Identity = 57/203 (28.08%), Postives = 83/203 (40.89%), Query Frame = 1
Query:  313 MRIQGMTCSSCVHTIENQVLKLKGVKSALINLLSTIGEVTYDPDLIMASDIADTINDMGFD----AEIF------QFKE-----HTKDIIEVMIQGM------------------TCSSCVYTIESK--------------------LAQMQGILSVKVALTTEKGKFKFDPQIISPRDILDAIEEMGFDAKLAPKKTNKYND 762
            + I G+TC+S V  IE+ + + KGV+   I+L    G V YDP ++   ++   + DMGF+    +E F       FK       T   I   +Q M                  T SS   T   K                    L +  GILSV VAL + K + K+DP+II    I   I+++GF+A +    T    D
Sbjct:  365 LTISGITCASSVQPIEDMLSQRKGVQQTSISLAEGTGAVLYDPSIVSLDELRTAVEDMGFEVSVNSETFTINPVRNFKSGNSVPQTMGDIAGSVQKMAPDTRGLPTHQGPGHSSETPSSPGATASQKCFVQIKGMTCASCVSNIERSLQRHAGILSVLVALMSGKAEVKYDPEIIQSPRIAQLIQDLGFEASVMEDNTVSEGD 567          

HSP 4 Score: 62.003 bits (149), Expect = 3.444e-8
Identity = 31/94 (32.98%), Postives = 53/94 (56.38%), Query Frame = 1
Query:  229 LCEAIENLGFLINKNKETDNTKELFKCHMRIQGMTCSSCVHTIENQVLKLKGVKSALINLLSTIGEVTYDPDLIMASDIADTINDMGFDAEIFQ 510
            + + I++LGF    +   DNT       + I GMTC+SCVH IE+++ +  G+  A + L ++   V +DP+++   DI   I ++GF A + Q
Sbjct:  544 IAQLIQDLGF--EASVMEDNTVSEGDIELIITGMTCASCVHNIESKLTRTNGITYASVALATSKAHVKFDPEIVGPRDIIKIIEEIGFHASLAQ 635          

HSP 5 Score: 56.225 bits (134), Expect = 2.188e-6
Identity = 26/72 (36.11%), Postives = 45/72 (62.50%), Query Frame = 1
Query:  541 VMIQGMTCSSCVYTIESKLAQMQGILSVKVALTTEKGKFKFDPQIISPRDILDAIEEMGFDAKLAPKKTNKY 756
            V I GMTC SCV +IE +++ ++GI+++KV+L       ++ P +++ + I   IE+MGF+A  A  K   +
Sbjct:   72 VNILGMTCHSCVKSIEDRISSLKGIVNIKVSLEQGSATVRYVPSVMNLQQICLQIEDMGFEASAAEGKAASW 143          
BLAST of Copper-transporting ATPase 1 vs. UniProt/SwissProt
Match: sp|Q64430|ATP7A_MOUSE (Copper-transporting ATPase 1 OS=Mus musculus OX=10090 GN=Atp7a PE=1 SV=3)

HSP 1 Score: 827.78 bits (2137), Expect = 0.000e+0
Identity = 467/973 (48.00%), Postives = 637/973 (65.47%), Query Frame = 1
Query:  226 TLCEAIENLGF----------------------LINKNKETDN--TKELFKCHMRIQGMTCSSCVHTIENQVLKLKGVKSALINLLSTIGEVTYDPDLIMASDIADTINDMGFDAEIFQFKEHTKDIIEVMIQGMTCSSCVYTIESKLAQMQGILSVKVALTTEKGKFKFDPQIISPRDILDAIEEMGFDAKLAPK-KTNKYNDHVGESIKKWKHSFLISLIFGVPTMIVMMVFMYGFSHRMQVIHLKNGINVTVMVSNAPIXXXXX------XXXXXXXXXXXXPVQFYGARYFYVQAYKSIKHGSANMDVLVVMATSVSYIYSFIVILVSMILRQDSSPQTFFETTPMLIVFLSLGRWLEHIAKGKTSEALSKLLSLQAFEATIIVNDNQ-----ERKISXXXXXXXXXXXXXPGEKIPIDGRVVSGKSRCDESLITGESMSVEKIPGSDVIGGTLNISGMLIIRATLVGEDSALNQIVKLVEEAQTSKAPIQELADKVAGLFVPGVIICSMFTLLIWIAIGYTN----PNLLPGHSSINTDNTELIWKYAFQLAITVLSVACPCSLGLATPTAVMVGTGVGAINGILIKGGVPLEKMHQLDVIVFDKTGTITTGKPSVTNFVMCVENVTSQI-RNCILLMLGAAESSSEHPIGKAILQYVRETCDINEMPQVVHSKSVSGFGLEC------SLKLQSDMFVPDSEIDNV-LVKINDFQENNLTENLKETSVKWRKINEPVEVVLYLGNRNMMKENHISIPDKLDELMSRDEDNGRTVVLMAIDKVLLAMISIADQVKKEAALVVYTLEKMGVEVFLLTGDNHKTATAIAKEIGIRNVFAEVLPSHKVAKIQQIQNMSKYKRSWLFSCCSKPSKLTNVAMVGDGINDSPALAQADVGIAIGTGTDVAVEAADVVLIRNSLLDVIAAMKLSKDTVRRIRQNFVAATMYNLIGIPIAAGALMPIGVVFMPWMA 3000
            TL EAIE++GF                      L+  + E +N  T    KC++++ GMTC+SCV  IE  + + +G+ S L+ L++   EV Y+P +I    IA+ I ++GF A + +       I+E++++GMTC+SCV+ IES L + +GI    VAL T K   K+DP+II PRDI+  I  +GF+A L  K ++  + DH  E IK+W+ SFL+SL F +P M  +MV+M    H +  +H    ++   M++    +F         S+ NLL  L   PVQF G  YFY+QAYK++KH +ANMDVL+V+AT++++ YS +++LV+M  R   +P TFF+T PML VF++LGRWLEHIAKGKTSEAL+KL+SLQA EATI+  +++     E ++ V+LV++GD++KV+PG K P+DGRV+ G S  DESLITGE+M V K PGS VI G++N +G L+IRAT VG D+ L+QIVKLVEEAQTSKAPIQ+ ADK++G FVP +++ S+ TLL+WI IG+ N        PG++  +   TE I ++AFQ +ITVL +ACPCSLGLATPTAVMVGTGVGA NGILIKGG PLE  H++ V+VFDKTGTIT G P V    + VE  +++I RN IL ++G AES+SEHP+G A+ +Y ++  D   +      + V G G+ C       L  +S++ + ++ I N  LV+I+   E + T +               +  + +GNR  M  N + I + +DE M   E  GRT VL+ ID  L  +I+IAD VK EA L V+ L+ MG+EV L+TGDN KTA +IA ++GI  VFAEVLPSHKVAK++Q+Q   K                  VAMVGDGINDSPALA A+VGIAIGTGTDVA+EAADVVLIRN LLDV+A++ LS+ TV+RIR NFV A +YNL+GIPIAAG  +PIG+V  PWM 
Sbjct:  430 TLREAIEDMGFDAALPDMKEPLVVIAQPSLETPLLPSSNELENVMTSVQNKCYIQVSGMTCASCVANIERNLRREEGIYSVLVALMAGKAEVRYNPAVIQPRVIAEFIRELGFGAMVMENAGEGNGILELVVRGMTCASCVHKIESTLTKHKGIFYCSVALATNKAHIKYDPEIIGPRDIIHTIGSLGFEASLVKKDRSANHLDHKRE-IKQWRGSFLVSLFFCIPVM-GLMVYMMVMDHHLATLHHNQNMSNEEMINMHSAMFLERQILPGLSIMNLLSLLLCLPVQFCGGWYFYIQAYKALKHKTANMDVLIVLATTIAFAYSLVILLVAMFERAKVNPITFFDTPPMLFVFIALGRWLEHIAKGKTSEALAKLISLQATEATIVTLNSENLLLSEEQVDVELVQRGDIIKVVPGGKFPVDGRVIEGHSMVDESLITGEAMPVAKKPGSTVIAGSINQNGSLLIRATHVGADTTLSQIVKLVEEAQTSKAPIQQFADKLSGYFVPFIVLVSIVTLLVWIIIGFQNFEIVETYFPGYNR-SISRTETIIRFAFQASITVLCIACPCSLGLATPTAVMVGTGVGAQNGILIKGGEPLEMAHKVKVVVFDKTGTITHGTPVVNQVKVLVE--SNKISRNKILAIVGTAESNSEHPLGAAVTKYCKKELDTETLGTCTDFQVVPGCGISCKVTNIEGLLHKSNLKIEENNIKNASLVQIDAINEQSSTSSSMIIDAHLSNAVNTQQYKVLIGNREWMIRNGLVISNDVDESMIEHERRGRTAVLVTIDDELCGLIAIADTVKPEAELAVHILKSMGLEVVLMTGDNSKTARSIASQVGITKVFAEVLPSHKVAKVKQLQEEGK-----------------RVAMVGDGINDSPALAMANVGIAIGTGTDVAIEAADVVLIRNDLLDVVASIDLSRKTVKRIRINFVFALIYNLVGIPIAAGVFLPIGLVLQPWMG 1380          

HSP 2 Score: 103.605 bits (257), Expect = 7.772e-21
Identity = 59/164 (35.98%), Postives = 86/164 (52.44%), Query Frame = 1
Query:  313 MRIQGMTCSSCVHTIENQVLKLKGVKSALINLLSTIGEVTYDPDLIMASDIADTINDMGFDAEIFQFKE----------------HTKDIIEVM----------IQGMTCSSCVYTIESKLAQMQGILSVKVALTTEKGKFKFDPQIISPRDILDAIEEMGFDA 726
            + I GMTC+SCV +IE  + K  GVKS  ++L ++ G + +DP L     + + I DMGFDA +   KE                 + ++  VM          + GMTC+SCV  IE  L + +GI SV VAL   K + +++P +I PR I + I E+GF A
Sbjct:  381 ININGMTCNSCVQSIEGVISKKPGVKSIHVSLANSTGTIEFDPLLTSPETLREAIEDMGFDAALPDMKEPLVVIAQPSLETPLLPSSNELENVMTSVQNKCYIQVSGMTCASCVANIERNLRREEGIYSVLVALMAGKAEVRYNPAVIQPRVIAEFIRELGFGA 544          

HSP 3 Score: 77.411 bits (189), Expect = 8.113e-13
Identity = 63/190 (33.16%), Postives = 94/190 (49.47%), Query Frame = 1
Query:  226 TLCEAIENLGF---LINKNKETDNTKELFKCHMRIQGMTCSSCVHTIENQVLKLKGVKSALINLLSTIGEVTYDPDLIMASDIADTINDMGFDAEIFQFK-----EH-TKDIIEVM----IQGMTCSSCVYTIESKLAQMQGILSVKVALTTEKGKFKFDPQIISPRDILDAIEEMGFDAKLAPKKTNKY 756
            TL EAI+++GF   L N N     T  +F   + +         H I++ +LK KGV    I+       VT  P ++ AS I + + D+  D    + K     EH T    EVM    ++GMTC SC  TIE K+ ++QG+  +KV+L  ++    F P +I+  +I   IE +GF A +  KK  KY
Sbjct:   61 TLQEAIDDMGFDALLHNANPLPVLTNTVF---LTVTAPLTLPWDH-IQSTLLKTKGVTGVKISPQQRSAVVTIIPSVVSASQIVELVPDLSLDMGTQEKKSGACEEHSTPQAGEVMLKMKVEGMTCHSCTSTIEGKVGKLQGVQRIKVSLDNQEATIVFQPHLITAEEIKKQIEAVGFPAFI--KKQPKY 244          

HSP 4 Score: 76.2554 bits (186), Expect = 1.583e-12
Identity = 49/166 (29.52%), Postives = 78/166 (46.99%), Query Frame = 1
Query:  319 IQGMTCSSCVHTIENQVLKLKGVKSALINLLSTIGEVTYDPDLIMAS----------------DIADTINDMGFDAEIFQFKEHTKDIIE--------VMIQGMTCSSCVYTIESKLAQMQGILSVKVALTTEKGKFKFDPQIISPRDILDAIEEMGFDAKLAPKK 744
            I+GM C SCV  IE+ +  L+ V S +++L +    V Y+  L+                    IA  +            ++   +I+         + I GMTC+SCV +IE  +++  G+ S+ V+L    G  +FDP + SP  + +AIE+MGFDA L   K
Sbjct:  283 IEGMHCKSCVSNIESALSTLQYVSSIVVSLENRSAIVKYNASLVTPEMLRKAIEAISPGQYRVSIASEVESTASSPSSSSLQKMPLNIVSQPLTQEAVININGMTCNSCVQSIEGVISKKPGVKSIHVSLANSTGTIEFDPLLTSPETLREAIEDMGFDAALPDMK 448          

HSP 5 Score: 74.7146 bits (182), Expect = 4.262e-12
Identity = 49/162 (30.25%), Postives = 78/162 (48.15%), Query Frame = 1
Query:  313 MRIQGMTCSSCVHTIENQVLKLKGVKSALINLLSTIGEVTYDPDLIMASDIADTINDMGFDAEIFQFKEHTK-DIIEV-----------------------------MIQGMTCSSCVYTIESKLAQMQGILSVKVALTTEKGKFKFDPQIISPRDILDAIE 708
            M+++GMTC SC  TIE +V KL+GV+   ++L +    + + P LI A +I   I  +GF A I +  ++ K   I+V                              I+GM C SCV  IES L+ +Q + S+ V+L       K++  +++P  +  AIE
Sbjct:  175 MKVEGMTCHSCTSTIEGKVGKLQGVQRIKVSLDNQEATIVFQPHLITAEEIKKQIEAVGFPAFIKKQPKYLKLGAIDVERLKNTPVKSSEGSQQKSPSYPSDSTTMFTIEGMHCKSCVSNIESALSTLQYVSSIVVSLENRSAIVKYNASLVTPEMLRKAIE 336          

HSP 6 Score: 68.9366 bits (167), Expect = 2.454e-10
Identity = 46/168 (27.38%), Postives = 80/168 (47.62%), Query Frame = 1
Query:  319 IQGMTCSSCVHTIENQVLKLKGVKSALINLLSTIGEVTYDPDLIMASDIADTINDMGFDAEIFQFKEHTKDIIEVMIQG--MTCSSCVYT----IESKLAQMQGILSVKVALTTEKGKFKFDPQIISPRDILDAIEEMGFDAKLAPKKTNKYNDH----VGESIKKWK 792
            ++GMTC SCV TIE Q+ K+ GV    ++L      + YDP L     + + I+DMGFDA +     H  + + V+     +T ++ +      I+S L + +G+  VK++           P ++S   I++ + ++  D     KK+    +H     GE + K K
Sbjct:   14 VEGMTCISCVRTIEQQIGKVNGVHHIKVSLEEKSATIIYDPKLQTPKTLQEAIDDMGFDALL-----HNANPLPVLTNTVFLTVTAPLTLPWDHIQSTLLKTKGVTGVKISPQQRSAVVTIIPSVVSASQIVELVPDLSLDMGTQEKKSGACEEHSTPQAGEVMLKMK 176          

HSP 7 Score: 64.3142 bits (155), Expect = 7.739e-9
Identity = 26/66 (39.39%), Postives = 46/66 (69.70%), Query Frame = 1
Query:  535 IEVMIQGMTCSSCVYTIESKLAQMQGILSVKVALTTEKGKFKFDPQIISPRDILDAIEEMGFDAKL 732
            I + ++GMTC SCV TIE ++ ++ G+  +KV+L  +     +DP++ +P+ + +AI++MGFDA L
Sbjct:   10 ITITVEGMTCISCVRTIEQQIGKVNGVHHIKVSLEEKSATIIYDPKLQTPKTLQEAIDDMGFDALL 75          
BLAST of Copper-transporting ATPase 1 vs. UniProt/SwissProt
Match: sp|Q64535|ATP7B_RAT (Copper-transporting ATPase 2 OS=Rattus norvegicus OX=10116 GN=Atp7b PE=1 SV=1)

HSP 1 Score: 822.772 bits (2124), Expect = 0.000e+0
Identity = 448/911 (49.18%), Postives = 604/911 (66.30%), Query Frame = 1
Query:  304 KCHMRIQGMTCSSCVHTIENQVLKLKGVKSALINLLSTIGEVTYDPDLIMASDIADTINDMGFDAEIFQFKEHTKDIIEVMIQGMTCSSCVYTIESKLAQMQGILSVKVALTTEKGKFKFDPQIISPRDILDAIEEMGFDAKLAPKKTNKYN-DHVGESIKKWKHSFLISLIFGVPTMIVMMVFMYGFSHRMQVIHLKNGINVTVMVSNAPIXXXXXXXXXXXXXXXXXPVQFYGARYFYVQAYKSIKHGSANMDVLVVMATSVSYIYSFIVILVSMILRQDSSPQTFFETTPMLIVFLSLGRWLEHIAKGKTSEALSKLLSLQAFEATIIV--NDN---QERKISXXXXXXXXXXXXXPGEKIPIDGRVVSGKSRCDESLITGESMSVEKIPGSDVIGGTLNISGMLIIRATLVGEDSALNQIVKLVEEAQTSKAPIQELADKVAGLFVPGVIICSMFTLLIWIAIGYTNPNLLPGH---SSINTDNTELIWKYAFQLAITVLSVACPCSLGLATPTAVMVGTGVGAINGILIKGGVPLEKMHQLDVIVFDKTGTITTGKPSVTNFVMCVENVTSQIRNCILLMLGAAESSSEHPIGKAILQYVRETCDINEMPQVVHSKSVSGFGLECSLKLQSDMFVPDSEIDNVLVKINDFQENNLTENLKETSVKWRKINE---PVEVVLYLGNRNMMKENHISIPDKLDELMSRDEDNGRTVVLMAIDKVLLAMISIADQVKKEAALVVYTLEKMGVEVFLLTGDNHKTATAIAKEIGIRNVFAEVLPSHKVAKIQQIQNMSKYKRSWLFSCCSKPSKLTNVAMVGDGINDSPALAQADVGIAIGTGTDVAVEAADVVLIRNSLLDVIAAMKLSKDTVRRIRQNFVAATMYNLIGIPIAAGALMPIGVVFMPWMA 3000
            KC ++I+GMTC+SCV  IE  + +  G+ S L+ L+S   EV YDP++I +  IA  I D+GF+A I +    ++  IE++I GMTC+SCV+ IESKL +  GI    VAL T K   KFDP+II PRDI+  IEE+GF A LA +  N ++ DH  E IK+WK SFL SL+FG+P M +M+  +   S   + + L + I   + V N                     VQF G  YFYVQAYKS++H SANMDVL+V+AT+++Y YS ++++V++  + + SP TFF+T PML VF++LGRWLEH+AK KTSEAL+KL+SLQA EAT++    DN   +E ++ ++LV++GD++KV+PG K P+DG+V+ G +  DESLITGE+M V K PGS VI G++N  G ++I+AT VG D+ L QIVKLVEEAQ SKAPIQ+LAD+ +G FVP +II S  TL++WI IG+ +  ++  +    S +   TE+I ++AFQ +ITVL +ACPCSLGLATPTAVMVGTGV A NG+LIKGG PLE  H++  ++FDKTGTIT G P V  F++ V+  T  +R  +L ++G AE+SSEHP+G A+ +Y +E      +      ++V G G+ C +          S ++++L         +         V    I E   P    + +GNR  M+ N ++I   + + M+  E  G+T +L+AID VL  MI+IAD VK EAAL   TL+ MGV+V L+TGDN KTA AIA ++GI  VFAEVLPSHKVAK+Q++QN  K                  VAMVGDG+NDSPALAQADVGIAIGTGTDVA++AADVVLIRN LLDV+A++ LSK TVRRIR N V A +YN++GIPIAAG  MPIG+V  PWM 
Sbjct:  482 KCFVQIKGMTCASCVSNIERSLQRHAGILSVLVALMSGKAEVKYDPEVIQSPRIAQLIEDLGFEAAIMEDNTVSEGDIELIITGMTCASCVHNIESKLTRTNGITYASVALATSKAHVKFDPEIIGPRDIIKVIEEIGFHASLAHRNPNAHHLDHKTE-IKQWKKSFLCSLVFGIPVMGLMIYMLIPSSKPHETMVLDHNIIPGLSVLNLIFFILCTF------------VQFLGGWYFYVQAYKSLRHKSANMDVLIVLATTIAYAYSLVILVVAIAEKAEKSPVTFFDTPPMLFVFIALGRWLEHVAKSKTSEALAKLMSLQATEATVVTLGEDNLILREEQVPMELVQRGDIIKVVPGGKFPVDGKVLEGNTMADESLITGEAMPVTKKPGSIVIAGSINAHGSVLIKATHVGNDTTLAQIVKLVEEAQMSKAPIQQLADRFSGYFVPFIIIISTLTLVVWIIIGFVDFGIVQKYFPSPSKHISQTEVIIRFAFQTSITVLCIACPCSLGLATPTAVMVGTGVAAQNGVLIKGGKPLEMAHKIKTVMFDKTGTITHGVPRVMRFLLLVDVATLSLRK-VLAVVGTAEASSEHPLGVAVTKYCKEELGTETLGYSTDFQAVPGCGISCKV----------SNVESILA--------HRGPTAHPIGVGNPPIGEGTGPQTFSVLIGNREWMRRNGLTISSDISDAMTDHEMKGQTAILVAIDGVLCGMIAIADAVKPEAALASITLKSMGVDVALITGDNRKTARAIATQVGINKVFAEVLPSHKVAKVQELQNKGK-----------------KVAMVGDGVNDSPALAQADVGIAIGTGTDVAIDAADVVLIRNDLLDVVASIHLSKRTVRRIRVNLVLALIYNMVGIPIAAGVFMPIGIVLQPWMG 1343          

HSP 2 Score: 103.99 bits (258), Expect = 4.816e-21
Identity = 56/163 (34.36%), Postives = 91/163 (55.83%), Query Frame = 1
Query:  319 IQGMTCSSCVHTIENQVLKLKGVKSALINLLSTIGEVTYDPDLIMASDIADTINDMGFDAEIFQFKEHT---------KDIIEVMIQGMTCSSCVYTIESKLAQMQGILSVKVALTTEKGKFKFDPQIISPRDILDAIEEMGFDA---------KLAPKKTNK 753
            I GMTC SCV +IE+++  LKG+ S  ++L      V Y P ++    I   I DMGF+A   + K  +         + ++++ ++GMTC SCV +IE K+ ++QG++ VKV+L+ ++    + P +I P D+ D I +MGF+A         +L P   NK
Sbjct:   63 ILGMTCHSCVKSIEDRISSLKGIVSIKVSLEQGSATVKYVPSVLNLQQICLQIEDMGFEASAAEGKAASWPSRSSPAQEAVVKLRVEGMTCQSCVSSIEGKIRKLQGVVRVKVSLSNQEAVITYQPYLIQPEDLRDHICDMGFEAAIKNRTAPLRLGPIDINK 225          

HSP 3 Score: 83.9593 bits (206), Expect = 7.511e-15
Identity = 61/248 (24.60%), Postives = 107/248 (43.15%), Query Frame = 1
Query:  112 LKIIEDFFQFNDNIKTVVIDYEKNLVRICCHNDNCTYLTLCEAIENLGFLIN---------KNKETDNTKELFKCHMRIQGMTCSSCVHTIENQVLKLKGVKSALINLLSTIGEVTYDPDLIMASDIADTINDMGFDAEI-----------------------------------FQFKEHTKD---IIEVMIQGMTCSSCVYTIESKLAQMQGILSVKVALTTEKGKFKFDPQIISPRDILDAIEEM 714
            +K IED       I ++ +  E+    +           +C  IE++GF  +          ++ +   + + K  +R++GMTC SCV +IE ++ KL+GV    ++L +    +TY P LI   D+ D I DMGF+A I                                    +   H ++    + + I GM C SCV  IE  + Q+ G+ ++ V+L  +  + ++D   I+P  +  AIE +
Sbjct:   72 VKSIEDRISSLKGIVSIKVSLEQGSATVKYVPSVLNLQQICLQIEDMGFEASAAEGKAASWPSRSSPAQEAVVK--LRVEGMTCQSCVSSIEGKIRKLQGVVRVKVSLSNQEAVITYQPYLIQPEDLRDHICDMGFEAAIKNRTAPLRLGPIDINKLESTNLKRAAVPPIQNSNHLETPGHQQNHLATLPLRIDGMHCKSCVLNIEGNIGQLPGVQNIHVSLENKTAQVQYDSSCITPLFLQTAIEAL 317          

HSP 4 Score: 63.929 bits (154), Expect = 1.061e-8
Identity = 43/181 (23.76%), Postives = 77/181 (42.54%), Query Frame = 1
Query:  313 MRIQGMTCSSCVHTIENQVLKLKGVKSALINLLSTIGEVTYDPDLIMASDIADTINDM-----------GFDAEIFQFKEHTKDIIEVMIQGMTCSSCVYTI------------ESKLAQMQGILSVKVALTTEKGKFKFDPQIISPRDILDAIEEMGFDAKLAPKKTNKYNDHVGESIKK 786
            +RI GM C SCV  IE  + +L GV++  ++L +   +V YD   I    +   I  +           G + E       +    +   +   C + V TI            E  L+QM+G+  + ++L    G   +DP ++S  ++  A+E+MGF+  + P+         G S+ +
Sbjct:  260 LRIDGMHCKSCVLNIEGNIGQLPGVQNIHVSLENKTAQVQYDSSCITPLFLQTAIEALPPGYFKVSLPDGLEKESGSSSVPSLGSSQRQQEPGPCRTAVLTITGIPRDSSVQPMEDMLSQMKGVQQIDISLAEGTGAVLYDPSVVSSDELRTAVEDMGFEVSVNPENITTNRVSSGNSVPQ 440          

HSP 5 Score: 61.6178 bits (148), Expect = 4.823e-8
Identity = 32/92 (34.78%), Postives = 51/92 (55.43%), Query Frame = 1
Query:  229 LCEAIENLGFLINKNKETDNTKELFKCHMRIQGMTCSSCVHTIENQVLKLKGVKSALINLLSTIGEVTYDPDLIMASDIADTINDMGFDAEI 504
            + + IE+LGF        DNT       + I GMTC+SCVH IE+++ +  G+  A + L ++   V +DP++I   DI   I ++GF A +
Sbjct:  535 IAQLIEDLGF--EAAIMEDNTVSEGDIELIITGMTCASCVHNIESKLTRTNGITYASVALATSKAHVKFDPEIIGPRDIIKVIEEIGFHASL 624          

HSP 6 Score: 59.3066 bits (142), Expect = 2.707e-7
Identity = 28/72 (38.89%), Postives = 45/72 (62.50%), Query Frame = 1
Query:  541 VMIQGMTCSSCVYTIESKLAQMQGILSVKVALTTEKGKFKFDPQIISPRDILDAIEEMGFDAKLAPKKTNKY 756
            V I GMTC SCV +IE +++ ++GI+S+KV+L       K+ P +++ + I   IE+MGF+A  A  K   +
Sbjct:   61 VSILGMTCHSCVKSIEDRISSLKGIVSIKVSLEQGSATVKYVPSVLNLQQICLQIEDMGFEASAAEGKAASW 132          
BLAST of Copper-transporting ATPase 1 vs. UniProt/SwissProt
Match: sp|P35670|ATP7B_HUMAN (Copper-transporting ATPase 2 OS=Homo sapiens OX=9606 GN=ATP7B PE=1 SV=4)

HSP 1 Score: 821.231 bits (2120), Expect = 0.000e+0
Identity = 450/931 (48.34%), Postives = 611/931 (65.63%), Query Frame = 1
Query:  259 LINKNKETDNTKELFKCHMRIQGMTCSSCVHTIENQVLKLKGVKSALINLLSTIGEVTYDPDLIMASDIADTINDMGFDAEIFQFKEHTKDIIEVMIQGMTCSSCVYTIESKLAQMQGILSVKVALTTEKGKFKFDPQIISPRDILDAIEEMGFDAKLAPKKTNKYN-DHVGESIKKWKHSFLISLIFGVPTMIVMMVFMYGFSHRMQVIHLKNGINVTVMVSNAPIXXXXXXXXXXXXXXXXXPVQFYGARYFYVQAYKSIKHGSANMDVLVVMATSVSYIYSFIVILVSMILRQDSSPQTFFETTPMLIVFLSLGRWLEHIAKGKTSEALSKLLSLQAFEATIIV--NDN---QERKISXXXXXXXXXXXXXPGEKIPIDGRVVSGKSRCDESLITGESMSVEKIPGSDVIGGTLNISGMLIIRATLVGEDSALNQIVKLVEEAQTSKAPIQELADKVAGLFVPGVIICSMFTLLIWIAIG----------YTNPNLLPGHSSINTDNTELIWKYAFQLAITVLSVACPCSLGLATPTAVMVGTGVGAINGILIKGGVPLEKMHQLDVIVFDKTGTITTGKPSVTNFVMCVENVTSQIRNCILLMLGAAESSSEHPIGKAILQYVRETCDINEMPQVVHSKSVSGFGLECSLKLQSDMFVPDSEIDNVLVKINDFQENNLTENLKET-SVKWRKINEPVEVVLYLGNRNMMKENHISIPDKLDELMSRDEDNGRTVVLMAIDKVLLAMISIADQVKKEAALVVYTLEKMGVEVFLLTGDNHKTATAIAKEIGIRNVFAEVLPSHKVAKIQQIQNMSKYKRSWLFSCCSKPSKLTNVAMVGDGINDSPALAQADVGIAIGTGTDVAVEAADVVLIRNSLLDVIAAMKLSKDTVRRIRQNFVAATMYNLIGIPIAAGALMPIGVVFMPWMA 3000
            ++ K+ ++       KC ++I+GMTC+SCV  IE  + K  GV S L+ L++   E+ YDP++I   +IA  I D+GF+A + +    +   IE+ I GMTC+SCV+ IESKL +  GI    VAL T K   KFDP+II PRDI+  IEE+GF A LA +  N ++ DH  E IK+WK SFL SL+FG+P M +M+  +   +   Q + L + I   + + N                     VQ  G  YFYVQAYKS++H SANMDVL+V+ATS++Y+YS ++++V++  + + SP TFF+T PML VF++LGRWLEH+AK KTSEAL+KL+SLQA EAT++    DN   +E ++ ++LV++GD+VKV+PG K P+DG+V+ G +  DESLITGE+M V K PGS VI G++N  G ++I+AT VG D+ L QIVKLVEEAQ SKAPIQ+LAD+ +G FVP +II S  TL++WI IG          + NPN        +   TE+I ++AFQ +ITVL +ACPCSLGLATPTAVMVGTGV A NGILIKGG PLE  H++  ++FDKTGTIT G P V   ++  +  T  +R  +L ++G AE+SSEHP+G A+ +Y +E      +      ++V G G+ C +          S ++ +L   ++   +    +L E  S+   K   P    + +GNR  ++ N ++I   + + M+  E  G+T +L+AID VL  MI+IAD VK+EAAL V+TL+ MGV+V L+TGDN KTA AIA ++GI  VFAEVLPSHKVAK+Q++QN  K                  VAMVGDG+NDSPALAQAD+G+AIGTGTDVA+EAADVVLIRN LLDV+A++ LSK TVRRIR N V A +YNL+GIPIAAG  MPIG+V  PWM 
Sbjct:  474 ILAKSPQSTRAVAPQKCFLQIKGMTCASCVSNIERNLQKEAGVLSVLVALMAGKAEIKYDPEVIQPLEIAQFIQDLGFEAAVMEDYAGSDGNIELTITGMTCASCVHNIESKLTRTNGITYASVALATSKALVKFDPEIIGPRDIIKIIEEIGFHASLAQRNPNAHHLDHKME-IKQWKKSFLCSLVFGIPVMALMIYMLIPSNEPHQSMVLDHNIIPGLSILNLIFFILCTF------------VQLLGGWYFYVQAYKSLRHRSANMDVLIVLATSIAYVYSLVILVVAVAEKAERSPVTFFDTPPMLFVFIALGRWLEHLAKSKTSEALAKLMSLQATEATVVTLGEDNLIIREEQVPMELVQRGDIVKVVPGGKFPVDGKVLEGNTMADESLITGEAMPVTKKPGSTVIAGSINAHGSVLIKATHVGNDTTLAQIVKLVEEAQMSKAPIQQLADRFSGYFVPFIIIMSTLTLVVWIVIGFIDFGVVQRYFPNPNK-------HISQTEVIIRFAFQTSITVLCIACPCSLGLATPTAVMVGTGVAAQNGILIKGGKPLEMAHKIKTVMFDKTGTITHGVPRVMRVLLLGDVATLPLRK-VLAVVGTAEASSEHPLGVAVTKYCKEELGTETLGYCTDFQAVPGCGIGCKV----------SNVEGILAH-SERPLSAPASHLNEAGSLPAEKDAVPQTFSVLIGNREWLRRNGLTISSDVSDAMTDHEMKGQTAILVAIDGVLCGMIAIADAVKQEAALAVHTLQSMGVDVVLITGDNRKTARAIATQVGINKVFAEVLPSHKVAKVQELQNKGK-----------------KVAMVGDGVNDSPALAQADMGVAIGTGTDVAIEAADVVLIRNDLLDVVASIHLSKRTVRRIRINLVLALIYNLVGIPIAAGVFMPIGIVLQPWMG 1355          

HSP 2 Score: 112.079 bits (279), Expect = 1.571e-23
Identity = 53/152 (34.87%), Postives = 91/152 (59.87%), Query Frame = 1
Query:  313 MRIQGMTCSSCVHTIENQVLKLKGVKSALINLLSTIGEVTYDPDLIMASDIADTINDMGFDAEIFQFKEHT---------KDIIEVMIQGMTCSSCVYTIESKLAQMQGILSVKVALTTEKGKFKFDPQIISPRDILDAIEEMGFDAKLAPK 741
            +RI GMTC SCV +IE+++  LKG+ S  ++L      V Y P ++    +   I DMGF+A I + K  +         + ++++ ++GMTC SCV +IE K+ ++QG++ VKV+L+ ++    + P +I P D+ D + +MGF+A +  K
Sbjct:   62 VRILGMTCQSCVKSIEDRISNLKGIISMKVSLEQGSATVKYVPSVVCLQQVCHQIGDMGFEASIAEGKAASWPSRSLPAQEAVVKLRVEGMTCQSCVSSIEGKVRKLQGVVRVKVSLSNQEAVITYQPYLIQPEDLRDHVNDMGFEAAIKSK 213          

HSP 3 Score: 83.1889 bits (204), Expect = 1.084e-14
Identity = 51/180 (28.33%), Postives = 82/180 (45.56%), Query Frame = 1
Query:  310 HMRIQGMTCSSCVHTIENQVLKLKGVKSALINLLSTIGEVTYDPDLI----------------MASDIADTINDMGFDAEIFQFK----------EHTKDIIEVMIQGMTCSSCVYTIESKLAQMQGILSVKVALTTEKGKFKFDPQIISPRDILDAIEEMGFDAKLAPK--KTNKYNDH 765
             +RI GM C SCV  IE  + +L GV+S  ++L +   +V YDP                       + D     G D                 + T     + I GMTC+SCV++IE  ++Q++G+  + V+L        ++P +ISP ++  AIE+MGF+A +  +   TN   +H
Sbjct:  260 QLRIDGMHCKSCVLNIEENIGQLLGVQSIQVSLENKTAQVKYDPSCTSPVALQRAIEALPPGNFKVSLPDGAEGSGTDHRSSSSHSPGSPPRNQVQGTCSTTLIAIAGMTCASCVHSIEGMISQLEGVQQISVSLAEGTATVLYNPSVISPEELRAAIEDMGFEASVVSESCSTNPLGNH 439          

HSP 4 Score: 58.151 bits (139), Expect = 5.565e-7
Identity = 26/72 (36.11%), Postives = 44/72 (61.11%), Query Frame = 1
Query:  541 VMIQGMTCSSCVYTIESKLAQMQGILSVKVALTTEKGKFKFDPQIISPRDILDAIEEMGFDAKLAPKKTNKY 756
            V I GMTC SCV +IE +++ ++GI+S+KV+L       K+ P ++  + +   I +MGF+A +A  K   +
Sbjct:   62 VRILGMTCQSCVKSIEDRISNLKGIISMKVSLEQGSATVKYVPSVVCLQQVCHQIGDMGFEASIAEGKAASW 133          
BLAST of Copper-transporting ATPase 1 vs. UniProt/SwissProt
Match: sp|P70705|ATP7A_RAT (Copper-transporting ATPase 1 OS=Rattus norvegicus OX=10116 GN=Atp7a PE=1 SV=1)

HSP 1 Score: 820.846 bits (2119), Expect = 0.000e+0
Identity = 487/1027 (47.42%), Postives = 665/1027 (64.75%), Query Frame = 1
Query:  229 LCEAIENLGF-----------------------LINKNKETDN--TKELFKCHMRIQGMTCSSCVHTIENQVLKLKGVKSALINLLSTIGEVTYDPDLIMASDIADTINDMGFDAEIFQFKEHTKDIIEVMIQGMTCSSCVYTIESKLAQMQGILSVKVALTTEKGKFKFDPQIISPRDILDAIEEMGFDAKLAPK-KTNKYNDHVGESIKKWKHSFLISLIFGVPTMIVMMVFMYGFSHRMQVIHLKNGINVTVMVSNAPIXXXXX-----XXXXXXXXXXXXPVQFYGARYFYVQAYKSIKHGSANMDVLVVMATSVSYIYSFIVILVSMILRQDSSPQTFFETTPMLIVFLSLGRWLEHIAKGKTSEALSKLLSLQAFEATIIVNDNQ-----ERKISXXXXXXXXXXXXXPGEKIPIDGRVVSGKSRCDESLITGESMSVEKIPGSDVIGGTLNISGMLIIRATLVGEDSALNQIVKLVEEAQTSKAPIQELADKVAGLFVPGVIICSMFTLLIWIAIGYTNPNLL----PGHSSINTDNTELIWKYAFQLAITVLSVACPCSLGLATPTAVMVGTGVGAINGILIKGGVPLEKMHQLDVIVFDKTGTITTGKPSVTNFVMCVENVTSQI-RNCILLMLGAAESSSEHPIGKAILQYVRETCDINEMPQVVHSKSVSGFGLEC------SLKLQSDMFVPDSEIDNV-LVKINDFQENNLTENLKETSVKWRKINEPVEVVLYLGNRNMMKENHISIPDKLDELMSRDEDNGRTVVLMAIDKVLLAMISIADQVKKEAALVVYTLEKMGVEVFLLTGDNHKTATAIAKEIGIRNVFAEVLPSHKVAKIQQIQNMSKYKRSWLFSCCSKPSKLTNVAMVGDGINDSPALAQADVGIAIGTGTDVAVEAADVVLIRNSLLDVIAAMKLSKDTVRRIRQNFVAATMYNLIGIPIAAGALMPIGVVFMPWMASVAMAASSICVVCXXXXXXXXXXPNEDQLANQEFKNHLECLKYGDMEVGVNLGKD 3165
            L EAIE++GF                       L+    E +N  T    KC++++ GMTC+SCV  IE  + + +G+ S L+ L++   EV Y+P +I    IA+ I ++GF A + +       I+E++++GMTC+SCV+ IES L + +GI    VAL T K   K+DP+II PRDI+  I  +GF+A L  K ++  + DH  E IK+W+ SFL+SL F +P M +M+  M    H   + H +N  N  ++  ++ +          S+ NLL  L   PVQF G  YFY+QAYK+++H +ANMDVL+V+AT++++ YS +++LV+M  R   +P TFF+T PML VF++LGRWLEHIAKGKTSEAL+KL+SLQA EATI+  +++     E ++ V+LV++GD++KV+PG K P+DGRV+ G S  DESLITGE+M V K PGS VI G++N +G L+IRAT VG D+ L+QIVKLVEEAQTSKAPIQ+ ADK++G FVP +++ S+ TLL+WI IG+ N  ++    PG++  +   TE I ++AFQ +ITVL +ACPCSLGLATPTAVMVGTGVGA NGILIKGG PLE  H++ V+VFDKTGTIT G P V    + VE  +++I RN IL ++G AES+SEHP+G A+ +Y ++  D   +      + V G G+ C       L  +S++ + ++ I N  LV+I+   E +   +               +  + +GNR  M  N + I + +DE M   E  GRT VL+ ID  L  +I+IAD VK EA L V+ L+ MG+EV L+TGDN KTA +IA ++GI  VFAEVLPSHKVAK++Q+Q   K                  VAMVGDGINDSPALA A VGIAIGTGTDVA+EAADVVLIRN LLDV+A++ LS+ TV+RIR NFV A +YNLIGIPIAAG  +PIG+V  PWM S AMAASS+ VV  SL LKL++KP  D   N E +      +    E+ V++G D
Sbjct:  431 LREAIEDMGFDAVLPADMKEPLVVIAQPSLETPLLPSTTEPENVMTPVQNKCYIQVSGMTCASCVANIERNLRREEGIYSVLVALMAGKAEVRYNPAVIQPRVIAELIRELGFGAVVMENAGEGNGILELVVRGMTCASCVHKIESTLTKHKGIFYCSVALATNKAHIKYDPEIIGPRDIIHTIGNLGFEASLVKKDRSANHLDHKRE-IKQWRGSFLVSLFFCIPVMGLMIYMMVMDHHLATLNHNQNMSNEEMINMHSSMFLERQILPGLSIMNLLSLLLCLPVQFCGGWYFYIQAYKALRHKTANMDVLIVLATTIAFAYSLVILLVAMYERAKVNPITFFDTPPMLFVFIALGRWLEHIAKGKTSEALAKLISLQATEATIVTLNSENLLLSEEQVDVELVQRGDIIKVVPGGKFPVDGRVIEGHSMVDESLITGEAMPVAKKPGSTVIAGSINQNGSLLIRATHVGADTTLSQIVKLVEEAQTSKAPIQQFADKLSGYFVPFIVLVSIVTLLVWIIIGFQNFEIVEAYFPGYNR-SISRTETIIRFAFQASITVLCIACPCSLGLATPTAVMVGTGVGAQNGILIKGGEPLEMAHKVKVVVFDKTGTITHGTPVVNQVKVLVE--SNKISRNKILAIVGTAESNSEHPLGAAVTKYCKQELDTETLGTCTDFQVVPGCGISCKVTNIEGLLHKSNLKIEENNIKNASLVQIDAINEQSSPSSSMIIDAHLSNAVNTQQYKVLIGNREWMIRNGLVISNDVDESMIEHERRGRTAVLVTIDDELCGLIAIADTVKPEAELAVHILKSMGLEVVLMTGDNSKTARSIASQVGITKVFAEVLPSHKVAKVKQLQEEGK-----------------RVAMVGDGINDSPALAMASVGIAIGTGTDVAIEAADVVLIRNDLLDVVASIDLSRKTVKRIRINFVFALIYNLIGIPIAAGVFLPIGLVLQPWMGSAAMAASSVSVVLSSLFLKLYRKPTYD---NYELRPRSHTGQRSPSEISVHVGID 1433          

HSP 2 Score: 100.523 bits (249), Expect = 6.818e-20
Identity = 59/165 (35.76%), Postives = 84/165 (50.91%), Query Frame = 1
Query:  313 MRIQGMTCSSCVHTIENQVLKLKGVKSALINLLSTIGEVTYDPDLIMASDIADTINDMGFDAEI-FQFKEHTKDIIE--------------------------VMIQGMTCSSCVYTIESKLAQMQGILSVKVALTTEKGKFKFDPQIISPRDILDAIEEMGFDA 726
            + I GMTC+SCV +IE  + K  GVKS  ++L ++ G + YDP L     + + I DMGFDA +    KE    I +                          + + GMTC+SCV  IE  L + +GI SV VAL   K + +++P +I PR I + I E+GF A
Sbjct:  381 ININGMTCNSCVQSIEGVISKKPGVKSIHVSLTNSTGTIEYDPLLTSPEPLREAIEDMGFDAVLPADMKEPLVVIAQPSLETPLLPSTTEPENVMTPVQNKCYIQVSGMTCASCVANIERNLRREEGIYSVLVALMAGKAEVRYNPAVIQPRVIAELIRELGFGA 545          

HSP 3 Score: 78.9518 bits (193), Expect = 2.260e-13
Identity = 50/162 (30.86%), Postives = 75/162 (46.30%), Query Frame = 1
Query:  313 MRIQGMTCSSCVHTIENQVLKLKGVKSALINLLSTIGEVTYDPDLIMASDIADTINDMGFDAEIFQFKEHTK------------------------------DIIEVMIQGMTCSSCVYTIESKLAQMQGILSVKVALTTEKGKFKFDPQIISPRDILDAIE 708
            MR++GMTC SC  TIE +V KL+GV+   ++L +    + Y P LI A +I   I  +GF A I +  ++ K                                I   I GM C SCV  IES L+ +Q + S+ V+L       K++  +++P  +  AIE
Sbjct:  175 MRVEGMTCHSCTSTIEGKVGKLQGVQRIKVSLDNQEATIVYQPHLITAEEIKKQIEAVGFPAFIKKQPKYLKLGAIDVERLKSTPVKSSEGSQQKSPAYPSDSAITFTIDGMHCKSCVSNIESALSTLQYVSSIVVSLENRSAIVKYNASLVTPEILRKAIE 336          

HSP 4 Score: 75.8702 bits (185), Expect = 2.007e-12
Identity = 56/190 (29.47%), Postives = 94/190 (49.47%), Query Frame = 1
Query:  226 TLCEAIENLGF---LINKNKETDNTKELFKCHMRIQGMTCSSCVHTIENQVLKLKGVKSALINLLSTIGEVTYDPDLIMASDIADTINDMGFDAEIFQFKEHTKD----------IIEVMIQGMTCSSCVYTIESKLAQMQGILSVKVALTTEKGKFKFDPQIISPRDILDAIEEMGFDAKLAPKKTNKY 756
            TL EAI+++GF   L N N     T  +F   + +         H I++ +LK KGV    I+       VT  P ++ A+ I + + D+  D    + K  T +          ++++ ++GMTC SC  TIE K+ ++QG+  +KV+L  ++    + P +I+  +I   IE +GF A +  KK  KY
Sbjct:   61 TLQEAIDDMGFDALLHNANPLPVLTNTVF---LTVTAPLALPWDH-IQSTLLKTKGVTGVKISPQQRSAVVTIIPSVVSANQIVELVPDLSLDMGTQEKKSGTSEEHSTPQAGEVLLKMRVEGMTCHSCTSTIEGKVGKLQGVQRIKVSLDNQEATIVYQPHLITAEEIKKQIEAVGFPAFI--KKQPKY 244          

HSP 5 Score: 74.7146 bits (182), Expect = 5.136e-12
Identity = 48/163 (29.45%), Postives = 81/163 (49.69%), Query Frame = 1
Query:  319 IQGMTCSSCVHTIENQVLKLKGVKSALINLLSTIGEVTYDPDLIMASDIADTIN-------DMGFDAEI------------------FQFKEHTKDIIEVMIQGMTCSSCVYTIESKLAQMQGILSVKVALTTEKGKFKFDPQIISPRDILDAIEEMGFDAKL 732
            I GM C SCV  IE+ +  L+ V S +++L +    V Y+  L+    +   I         +   +E+                     +  T++++ + I GMTC+SCV +IE  +++  G+ S+ V+LT   G  ++DP + SP  + +AIE+MGFDA L
Sbjct:  283 IDGMHCKSCVSNIESALSTLQYVSSIVVSLENRSAIVKYNASLVTPEILRKAIEAVSPGQYRVSISSEVESPTSSPSSSSLQKMPLNLVSQPLTQEVV-ININGMTCNSCVQSIEGVISKKPGVKSIHVSLTNSTGTIEYDPLLTSPEPLREAIEDMGFDAVL 444          

HSP 6 Score: 67.781 bits (164), Expect = 5.671e-10
Identity = 42/155 (27.10%), Postives = 75/155 (48.39%), Query Frame = 1
Query:  319 IQGMTCSSCVHTIENQVLKLKGVKSALINLLSTIGEVTYDPDLIMASDIADTINDMGFDAEIFQFKEHTKDIIEVMIQG--MTCSSCVYT----IESKLAQMQGILSVKVALTTEKGKFKFDPQIISPRDILDAIEEMGFDAKLAPKKTNKYNDH 765
            ++GMTC SCV TIE Q+ K+ GV    ++L      V Y+P L     + + I+DMGFDA +     H  + + V+     +T ++ +      I+S L + +G+  VK++           P ++S   I++ + ++  D     KK+    +H
Sbjct:   14 VEGMTCISCVRTIEQQIGKVNGVHHIKVSLEEKSATVIYNPKLQTPKTLQEAIDDMGFDALL-----HNANPLPVLTNTVFLTVTAPLALPWDHIQSTLLKTKGVTGVKISPQQRSAVVTIIPSVVSANQIVELVPDLSLDMGTQEKKSGTSEEH 163          

HSP 7 Score: 62.003 bits (149), Expect = 3.458e-8
Identity = 25/66 (37.88%), Postives = 46/66 (69.70%), Query Frame = 1
Query:  535 IEVMIQGMTCSSCVYTIESKLAQMQGILSVKVALTTEKGKFKFDPQIISPRDILDAIEEMGFDAKL 732
            I + ++GMTC SCV TIE ++ ++ G+  +KV+L  +     ++P++ +P+ + +AI++MGFDA L
Sbjct:   10 ITITVEGMTCISCVRTIEQQIGKVNGVHHIKVSLEEKSATVIYNPKLQTPKTLQEAIDDMGFDALL 75          
BLAST of Copper-transporting ATPase 1 vs. TrEMBL
Match: A0A2C9KDW4 (Uncharacterized protein OS=Biomphalaria glabrata OX=6526 GN=106066430 PE=3 SV=1)

HSP 1 Score: 903.279 bits (2333), Expect = 0.000e+0
Identity = 522/986 (52.94%), Postives = 679/986 (68.86%), Query Frame = 1
Query:  265 NKNKETDNTKELFKCHMRIQGMTCSSCVHTIENQVLKLKGVKSALINLLSTIGEVTYDPDLIMASDIADTINDMGFDAEIFQFKEHTKDIIEVMIQGMTCSSCVYTIESKLAQMQGILSVKVALTTEKGKFKFDPQIISPRDILDAIEEMGFDAKLAPK---KTNKYNDHVGESIKKWKHSFLISLIFGVPTMIVMMVFMYGF----SHRMQVIHLKNGINVTV--------MVSNAP--IXXXXXXXXXXXXXXXXXPVQFYGARYFYVQAYKSIKHGSANMDVLVVMATSVSYIYSFIVILVSMILRQDSSPQTFFETTPMLIVFLSLGRWLEHIAKGKTSEALSKLLSLQAFEATIIVNDN-----QERKISXXXXXXXXXXXXXPGEKIPIDGRVVSGKSRCDESLITGESMSVEKIPGSDVIGGTLNISGMLIIRATLVGEDSALNQIVKLVEEAQTSKAPIQELADKVAGLFVPGVIICSMFTLLIWIAIGYTNPNLLPGH--SSINTDNTELIWKYAFQLAITVLSVACPCSLGLATPTAVMVGTGVGAINGILIKGGVPLEKMHQLDVIVFDKTGTITTGKPSVTNFVMCVENVTSQIRNCILLMLGAAESSSEHPIGKAILQYVRETCDINEMPQVVHSKSVSGFGLECSLKLQSDMF--VPDSEIDNVLVKINDFQENN-LTENL----KETSVKWRKI----NEPVEVVLYLGNRNMMKENHISIPDKLDELMSRDEDNGRTVVLMAIDKVLLAMISIADQVKKEAALVVYTLEKMGVEVFLLTGDNHKTATAIAKEIGIRNVFAEVLPSHKVAKIQQIQNMSKYKRSWLFSCCSKPSKLTNVAMVGDGINDSPALAQADVGIAIGTGTDVAVEAADVVLIRNSLLDVIAAMKLSKDTVRRIRQNFVAATMYNLIGIPIAAGALMPIGVVFMPWMASVAMAASSICVVCXXXXXXXXXXPNEDQLANQEFKNHLE 3117
            N  K  D+ ++  KC++ I GMTC+SCV TIE  V K++GV   L++L++   EVTYDP  ++ S +A+ + D+GF A + + +   +   E+ I GMTCSSCV  IES++ +  GILS  VAL TE GKF FD ++  PRDI++AI+ +GF+AKL      + ++Y DH  E IK+W+ SFL SLIFG P+MI+MMVFM+G     SH M         N T         M  + P  ++ PGL   NLL+FL ++PVQF+G RYFYVQAYK +KH S NMDVLVVMAT++SY+YS  V++ +M+ +++SSP TFFETTPML+VF+SLGRWLEHIAKGKTSEAL+KL+SLQ  +A ++  D       E+ IS+DLV++GD++KV PG KIP+D +V+ G+S CDESLITGESM VEK  GS VIGG++N +GML++ AT VG D+ L+QIVKLVEEAQTSKAPIQ LADK+AG+FVP V I S+ TL++W+ IGYT+  LL  +     N   +E+I++ AF  AITVLS+ACPC+LGLATPTAVMVGTGVGA NGILIKGG PLE  H+L VIVFDKTGTIT G P V+   M V++ T       L + G AE+SSEHPI  AIL+YV+ET     + +V    +V G G++C +     +   +  SE++N   + N F   N L +NL    +ET+     I        E  + +GNR  M+ N + + D +D++M+  E  G T VL AID V++ M+++AD VK EA L VY L++MG++V LLTGDN KTA AIAK++GI  VFAEVLPSHKV KI+Q+Q                 +K   VAMVGDG+NDSPALAQADVGIAIGTGTDVAVEAAD+VLI+N LLDV AA+KLSK TVRRI  NF++A +YNL+GIPIAAG L PIG+   PWMAS AMA SS+ VV  SLLLK ++KP ++ L  QE+    E
Sbjct:  348 NATKAFDD-EDYEKCYLNISGMTCASCVATIEKNVGKMEGVHKILVSLMAQRAEVTYDPAYVLPSQVANKVEDLGFSASVAEGEAVGRGTCELTILGMTCSSCVNRIESEMKKKNGILSASVALATETGKFTFDSELTGPRDIIEAIKSLGFEAKLRTDDDMRASRY-DH-REEIKRWRTSFLWSLIFGGPSMIIMMVFMFGIPSQDSHDMTYNASDPHSNHTAEKPWSHEKMDGHYPQKMIIPGLDWLNLLMFLLATPVQFFGGRYFYVQAYKVLKHRSTNMDVLVVMATTISYLYSLAVLIAAMVQKEESSPMTFFETTPMLMVFISLGRWLEHIAKGKTSEALAKLISLQPADAVLVQVDKNFQILSEKVISLDLVQRGDILKVTPGGKIPVDAKVIFGQSACDESLITGESMPVEKSIGSPVIGGSINQNGMLLVEATYVGADTTLSQIVKLVEEAQTSKAPIQNLADKIAGIFVPVVSILSLVTLIVWVIIGYTDIKLLEKNYDPRTNIPKSEIIFEKAFLYAITVLSIACPCALGLATPTAVMVGTGVGATNGILIKGGEPLELTHKLKVIVFDKTGTITHGVPRVSRVSMFVKDKTCSFVK-FLAIAGTAETSSEHPIASAILKYVKETLLTESLGKVSEFSAVPGCGIKCKVSHLESILSGINLSEVNN---RKNKFGSQNILIDNLLYGIQETANLILDIPLGAESSQEFEVLIGNREWMQRNGLVVIDTMDQVMTEHEMQGHTAVLCAIDGVIVGMLAVADTVKSEAHLAVYELKRMGLDVILLTGDNLKTAKAIAKQVGITRVFAEVLPSHKVKKIKQLQ-----------------AKGVKVAMVGDGVNDSPALAQADVGIAIGTGTDVAVEAADIVLIKNDLLDVYAAIKLSKLTVRRIHINFISACIYNLLGIPIAAGMLTPIGIELRPWMASAAMALSSVSVVAASLLLKTFRKPRKETLLTQEYYKSYE 1309          

HSP 2 Score: 119.783 bits (299), Expect = 2.415e-23
Identity = 66/226 (29.20%), Postives = 116/226 (51.33%), Query Frame = 1
Query:   85 IKEVNDKNQLKIIEDFFQFNDNIKTVVIDYEKNLVRICCHNDNCTYLTLCEAIENLGF--LINKNKETDNTKELFKCHMRIQGMTCSSCVHTIENQVLKLKGVKSALINLLSTIGEVTYDPDLIMASDIADTINDMGFDAEIFQ-FKEHTKDIIEVMIQGMTCSSCVYTIESKLAQMQGILSVKVALTTEKGKFKFDPQIISPRDILDAIEEMGFDAKLAPKKTNK 753
            I  ++D + +  +++  Q    + +  + +E     +       +   L EA    G+  ++   +E     E  +  + ++GMTC SCV  IE  + K+ G+KS  ++L +    +   P +I     A+ I+DMGFDA +        K ++++ ++GMTC SCV  IES ++   GIL++KV+LT +     F+P +  P  I   IE+MGFDA ++P  T+K
Sbjct:   11 IARLHDYSSVTDLKNLLQQQTGVYSAEVSFETKRAAVQYSPLQTSPPVLAEAAAKNGYPAMVKAIEEAQPFMEEMEVMVSVEGMTCMSCVRNIEGNISKVPGIKSISVSLENKNARLVIVPSIITPEAAAEAIDDMGFDANVISPSSSGDKAVVDIHVEGMTCQSCVKNIESNMSSKSGILNIKVSLTNKSAHVTFNPCVTVPLKIAQQIEDMGFDASVSPSNTDK 236          

HSP 3 Score: 99.7525 bits (247), Expect = 2.882e-17
Identity = 63/205 (30.73%), Postives = 107/205 (52.20%), Query Frame = 1
Query:  151 IKTVVIDYEKNLVRICCHNDNCTYLTLCEAIENLGFLINK-NKETDNTKELFKCHMRIQGMTCSSCVHTIENQVLKLKGVKSALINLLSTIGEVTYDPDLIMASDIADTINDMGFDAEI----------FQFKEHTKDI-IEVM-IQGMTCSSCVYTIESKLAQMQGILSVKVALTTEKGKFKFDPQIISPRDILDAIEEMGFDA 726
            IK++ +  E    R+       T     EAI+++GF  N  +  +   K +   H  ++GMTC SCV  IE+ +    G+ +  ++L +    VT++P + +   IA  I DMGFDA +                 KD+  +V+ I+GMTC SCV  IE  + +   ++S+KV+L ++ G  ++ P +ISP  + + I++MGF+A
Sbjct:  113 IKSISVSLENKNARLVIVPSIITPEAAAEAIDDMGFDANVISPSSSGDKAVVDIH--VEGMTCQSCVKNIESNMSSKSGILNIKVSLTNKSAHVTFNPCVTVPLKIAQQIEDMGFDASVSPSNTDKSVLVSSSGSVKDVRTKVLNIRGMTCQSCVNNIEGVIGKHPSVVSIKVSLASQTGTIQYYPSLISPEKLCELIDDMGFEA 315          
BLAST of Copper-transporting ATPase 1 vs. TrEMBL
Match: A0A2C9KE23 (Uncharacterized protein OS=Biomphalaria glabrata OX=6526 GN=106066430 PE=3 SV=1)

HSP 1 Score: 902.508 bits (2331), Expect = 0.000e+0
Identity = 523/992 (52.72%), Postives = 680/992 (68.55%), Query Frame = 1
Query:  265 NKNKETDNTKELFKCHMRIQGMTCSSCVHTIENQVLKLKGVKSALINLLSTIGEVTYDPDLIMASDIADTINDMGFDAEIFQFKEHTKDIIEVMIQGMTCSSCVYTIESKLAQMQGILSVKVALTTEKGKFKFDPQIISPRDILDAIEEMGFDAKLAPK---KTNKYNDHVGESIKKWKHSFLISLIFGVPTMIVMMVFMYGF----SHRMQVIHLKNGINVTV--------MVSNAP--IXXXXXXXXXXXXXXXXXPVQFYGARYFYVQAYKSIKHGSANMDVLVVMATSVSYIYSFIVILVSMILRQDSSPQTFFETTPMLIVFLSLGRWLEHIAKGKTSEALSKLLSLQAFEATIIVNDN-----QERKISXXXXXXXXXXXXXPGEKIPIDGRVVSGKSRCDESLITGESMSVEKIPGSDVIGGTLNISGMLIIRATLVGEDSALNQIVKLVEEAQTSKAPIQELADKVAGLFVPGVIICSMFTLLIWIAIGYTNPNLLPGHSSI--------NTDNTELIWKYAFQLAITVLSVACPCSLGLATPTAVMVGTGVGAINGILIKGGVPLEKMHQLDVIVFDKTGTITTGKPSVTNFVMCVENVTSQIRNCILLMLGAAESSSEHPIGKAILQYVRETCDINEMPQVVHSKSVSGFGLECSLKLQSDMF--VPDSEIDNVLVKINDFQENN-LTENL----KETSVKWRKI----NEPVEVVLYLGNRNMMKENHISIPDKLDELMSRDEDNGRTVVLMAIDKVLLAMISIADQVKKEAALVVYTLEKMGVEVFLLTGDNHKTATAIAKEIGIRNVFAEVLPSHKVAKIQQIQNMSKYKRSWLFSCCSKPSKLTNVAMVGDGINDSPALAQADVGIAIGTGTDVAVEAADVVLIRNSLLDVIAAMKLSKDTVRRIRQNFVAATMYNLIGIPIAAGALMPIGVVFMPWMASVAMAASSICVVCXXXXXXXXXXPNEDQLANQEFKNHLE 3117
            N  K  D+ ++  KC++ I GMTC+SCV TIE  V K++GV   L++L++   EVTYDP  ++ S +A+ + D+GF A + + +   +   E+ I GMTCSSCV  IES++ +  GILS  VAL TE GKF FD ++  PRDI++AI+ +GF+AKL      + ++Y DH  E IK+W+ SFL SLIFG P+MI+MMVFM+G     SH M         N T         M  + P  ++ PGL   NLL+FL ++PVQF+G RYFYVQAYK +KH S NMDVLVVMAT++SY+YS  V++ +M+ +++SSP TFFETTPML+VF+SLGRWLEHIAKGKTSEAL+KL+SLQ  +A ++  D       E+ IS+DLV++GD++KV PG KIP+D +V+ G+S CDESLITGESM VEK  GS VIGG++N +GML++ AT VG D+ L+QIVKLVEEAQTSKAPIQ LADK+AG+FVP V I S+ TL++W+ IGYT+  LL  +  I        N   +E+I++ AF  AITVLS+ACPC+LGLATPTAVMVGTGVGA NGILIKGG PLE  H+L VIVFDKTGTIT G P V+   M V++ T       L + G AE+SSEHPI  AIL+YV+ET     + +V    +V G G++C +     +   +  SE++N   + N F   N L +NL    +ET+     I        E  + +GNR  M+ N + + D +D++M+  E  G T VL AID V++ M+++AD VK EA L VY L++MG++V LLTGDN KTA AIAK++GI  VFAEVLPSHKV KI+Q+Q                 +K   VAMVGDG+NDSPALAQADVGIAIGTGTDVAVEAAD+VLI+N LLDV AA+KLSK TVRRI  NF++A +YNL+GIPIAAG L PIG+   PWMAS AMA SS+ VV  SLLLK ++KP ++ L  QE+    E
Sbjct:  348 NATKAFDD-EDYEKCYLNISGMTCASCVATIEKNVGKMEGVHKILVSLMAQRAEVTYDPAYVLPSQVANKVEDLGFSASVAEGEAVGRGTCELTILGMTCSSCVNRIESEMKKKNGILSASVALATETGKFTFDSELTGPRDIIEAIKSLGFEAKLRTDDDMRASRY-DH-REEIKRWRTSFLWSLIFGGPSMIIMMVFMFGIPSQDSHDMTYNASDPHSNHTAEKPWSHEKMDGHYPQKMIIPGLDWLNLLMFLLATPVQFFGGRYFYVQAYKVLKHRSTNMDVLVVMATTISYLYSLAVLIAAMVQKEESSPMTFFETTPMLMVFISLGRWLEHIAKGKTSEALAKLISLQPADAVLVQVDKNFQILSEKVISLDLVQRGDILKVTPGGKIPVDAKVIFGQSACDESLITGESMPVEKSIGSPVIGGSINQNGMLLVEATYVGADTTLSQIVKLVEEAQTSKAPIQNLADKIAGIFVPVVSILSLVTLIVWVIIGYTDIKLLEKNYDIQNSTSPRTNIPKSEIIFEKAFLYAITVLSIACPCALGLATPTAVMVGTGVGATNGILIKGGEPLELTHKLKVIVFDKTGTITHGVPRVSRVSMFVKDKTCSFVK-FLAIAGTAETSSEHPIASAILKYVKETLLTESLGKVSEFSAVPGCGIKCKVSHLESILSGINLSEVNN---RKNKFGSQNILIDNLLYGIQETANLILDIPLGAESSQEFEVLIGNREWMQRNGLVVIDTMDQVMTEHEMQGHTAVLCAIDGVIVGMLAVADTVKSEAHLAVYELKRMGLDVILLTGDNLKTAKAIAKQVGITRVFAEVLPSHKVKKIKQLQ-----------------AKGVKVAMVGDGVNDSPALAQADVGIAIGTGTDVAVEAADIVLIKNDLLDVYAAIKLSKLTVRRIHINFISACIYNLLGIPIAAGMLTPIGIELRPWMASAAMALSSVSVVAASLLLKTFRKPRKETLLTQEYYKSYE 1315          

HSP 2 Score: 119.783 bits (299), Expect = 2.506e-23
Identity = 66/226 (29.20%), Postives = 116/226 (51.33%), Query Frame = 1
Query:   85 IKEVNDKNQLKIIEDFFQFNDNIKTVVIDYEKNLVRICCHNDNCTYLTLCEAIENLGF--LINKNKETDNTKELFKCHMRIQGMTCSSCVHTIENQVLKLKGVKSALINLLSTIGEVTYDPDLIMASDIADTINDMGFDAEIFQ-FKEHTKDIIEVMIQGMTCSSCVYTIESKLAQMQGILSVKVALTTEKGKFKFDPQIISPRDILDAIEEMGFDAKLAPKKTNK 753
            I  ++D + +  +++  Q    + +  + +E     +       +   L EA    G+  ++   +E     E  +  + ++GMTC SCV  IE  + K+ G+KS  ++L +    +   P +I     A+ I+DMGFDA +        K ++++ ++GMTC SCV  IES ++   GIL++KV+LT +     F+P +  P  I   IE+MGFDA ++P  T+K
Sbjct:   11 IARLHDYSSVTDLKNLLQQQTGVYSAEVSFETKRAAVQYSPLQTSPPVLAEAAAKNGYPAMVKAIEEAQPFMEEMEVMVSVEGMTCMSCVRNIEGNISKVPGIKSISVSLENKNARLVIVPSIITPEAAAEAIDDMGFDANVISPSSSGDKAVVDIHVEGMTCQSCVKNIESNMSSKSGILNIKVSLTNKSAHVTFNPCVTVPLKIAQQIEDMGFDASVSPSNTDK 236          

HSP 3 Score: 99.7525 bits (247), Expect = 2.815e-17
Identity = 63/205 (30.73%), Postives = 107/205 (52.20%), Query Frame = 1
Query:  151 IKTVVIDYEKNLVRICCHNDNCTYLTLCEAIENLGFLINK-NKETDNTKELFKCHMRIQGMTCSSCVHTIENQVLKLKGVKSALINLLSTIGEVTYDPDLIMASDIADTINDMGFDAEI----------FQFKEHTKDI-IEVM-IQGMTCSSCVYTIESKLAQMQGILSVKVALTTEKGKFKFDPQIISPRDILDAIEEMGFDA 726
            IK++ +  E    R+       T     EAI+++GF  N  +  +   K +   H  ++GMTC SCV  IE+ +    G+ +  ++L +    VT++P + +   IA  I DMGFDA +                 KD+  +V+ I+GMTC SCV  IE  + +   ++S+KV+L ++ G  ++ P +ISP  + + I++MGF+A
Sbjct:  113 IKSISVSLENKNARLVIVPSIITPEAAAEAIDDMGFDANVISPSSSGDKAVVDIH--VEGMTCQSCVKNIESNMSSKSGILNIKVSLTNKSAHVTFNPCVTVPLKIAQQIEDMGFDASVSPSNTDKSVLVSSSGSVKDVRTKVLNIRGMTCQSCVNNIEGVIGKHPSVVSIKVSLASQTGTIQYYPSLISPEKLCELIDDMGFEA 315          
BLAST of Copper-transporting ATPase 1 vs. TrEMBL
Match: A0A2C9KDZ0 (Uncharacterized protein OS=Biomphalaria glabrata OX=6526 GN=106066430 PE=3 SV=1)

HSP 1 Score: 902.508 bits (2331), Expect = 0.000e+0
Identity = 523/992 (52.72%), Postives = 680/992 (68.55%), Query Frame = 1
Query:  265 NKNKETDNTKELFKCHMRIQGMTCSSCVHTIENQVLKLKGVKSALINLLSTIGEVTYDPDLIMASDIADTINDMGFDAEIFQFKEHTKDIIEVMIQGMTCSSCVYTIESKLAQMQGILSVKVALTTEKGKFKFDPQIISPRDILDAIEEMGFDAKLAPK---KTNKYNDHVGESIKKWKHSFLISLIFGVPTMIVMMVFMYGF----SHRMQVIHLKNGINVTV--------MVSNAP--IXXXXXXXXXXXXXXXXXPVQFYGARYFYVQAYKSIKHGSANMDVLVVMATSVSYIYSFIVILVSMILRQDSSPQTFFETTPMLIVFLSLGRWLEHIAKGKTSEALSKLLSLQAFEATIIVNDN-----QERKISXXXXXXXXXXXXXPGEKIPIDGRVVSGKSRCDESLITGESMSVEKIPGSDVIGGTLNISGMLIIRATLVGEDSALNQIVKLVEEAQTSKAPIQELADKVAGLFVPGVIICSMFTLLIWIAIGYTNPNLLPGHSSI--------NTDNTELIWKYAFQLAITVLSVACPCSLGLATPTAVMVGTGVGAINGILIKGGVPLEKMHQLDVIVFDKTGTITTGKPSVTNFVMCVENVTSQIRNCILLMLGAAESSSEHPIGKAILQYVRETCDINEMPQVVHSKSVSGFGLECSLKLQSDMF--VPDSEIDNVLVKINDFQENN-LTENL----KETSVKWRKI----NEPVEVVLYLGNRNMMKENHISIPDKLDELMSRDEDNGRTVVLMAIDKVLLAMISIADQVKKEAALVVYTLEKMGVEVFLLTGDNHKTATAIAKEIGIRNVFAEVLPSHKVAKIQQIQNMSKYKRSWLFSCCSKPSKLTNVAMVGDGINDSPALAQADVGIAIGTGTDVAVEAADVVLIRNSLLDVIAAMKLSKDTVRRIRQNFVAATMYNLIGIPIAAGALMPIGVVFMPWMASVAMAASSICVVCXXXXXXXXXXPNEDQLANQEFKNHLE 3117
            N  K  D+ ++  KC++ I GMTC+SCV TIE  V K++GV   L++L++   EVTYDP  ++ S +A+ + D+GF A + + +   +   E+ I GMTCSSCV  IES++ +  GILS  VAL TE GKF FD ++  PRDI++AI+ +GF+AKL      + ++Y DH  E IK+W+ SFL SLIFG P+MI+MMVFM+G     SH M         N T         M  + P  ++ PGL   NLL+FL ++PVQF+G RYFYVQAYK +KH S NMDVLVVMAT++SY+YS  V++ +M+ +++SSP TFFETTPML+VF+SLGRWLEHIAKGKTSEAL+KL+SLQ  +A ++  D       E+ IS+DLV++GD++KV PG KIP+D +V+ G+S CDESLITGESM VEK  GS VIGG++N +GML++ AT VG D+ L+QIVKLVEEAQTSKAPIQ LADK+AG+FVP V I S+ TL++W+ IGYT+  LL  +  I        N   +E+I++ AF  AITVLS+ACPC+LGLATPTAVMVGTGVGA NGILIKGG PLE  H+L VIVFDKTGTIT G P V+   M V++ T       L + G AE+SSEHPI  AIL+YV+ET     + +V    +V G G++C +     +   +  SE++N   + N F   N L +NL    +ET+     I        E  + +GNR  M+ N + + D +D++M+  E  G T VL AID V++ M+++AD VK EA L VY L++MG++V LLTGDN KTA AIAK++GI  VFAEVLPSHKV KI+Q+Q                 +K   VAMVGDG+NDSPALAQADVGIAIGTGTDVAVEAAD+VLI+N LLDV AA+KLSK TVRRI  NF++A +YNL+GIPIAAG L PIG+   PWMAS AMA SS+ VV  SLLLK ++KP ++ L  QE+    E
Sbjct:  323 NATKAFDD-EDYEKCYLNISGMTCASCVATIEKNVGKMEGVHKILVSLMAQRAEVTYDPAYVLPSQVANKVEDLGFSASVAEGEAVGRGTCELTILGMTCSSCVNRIESEMKKKNGILSASVALATETGKFTFDSELTGPRDIIEAIKSLGFEAKLRTDDDMRASRY-DH-REEIKRWRTSFLWSLIFGGPSMIIMMVFMFGIPSQDSHDMTYNASDPHSNHTAEKPWSHEKMDGHYPQKMIIPGLDWLNLLMFLLATPVQFFGGRYFYVQAYKVLKHRSTNMDVLVVMATTISYLYSLAVLIAAMVQKEESSPMTFFETTPMLMVFISLGRWLEHIAKGKTSEALAKLISLQPADAVLVQVDKNFQILSEKVISLDLVQRGDILKVTPGGKIPVDAKVIFGQSACDESLITGESMPVEKSIGSPVIGGSINQNGMLLVEATYVGADTTLSQIVKLVEEAQTSKAPIQNLADKIAGIFVPVVSILSLVTLIVWVIIGYTDIKLLEKNYDIQNSTSPRTNIPKSEIIFEKAFLYAITVLSIACPCALGLATPTAVMVGTGVGATNGILIKGGEPLELTHKLKVIVFDKTGTITHGVPRVSRVSMFVKDKTCSFVK-FLAIAGTAETSSEHPIASAILKYVKETLLTESLGKVSEFSAVPGCGIKCKVSHLESILSGINLSEVNN---RKNKFGSQNILIDNLLYGIQETANLILDIPLGAESSQEFEVLIGNREWMQRNGLVVIDTMDQVMTEHEMQGHTAVLCAIDGVIVGMLAVADTVKSEAHLAVYELKRMGLDVILLTGDNLKTAKAIAKQVGITRVFAEVLPSHKVKKIKQLQ-----------------AKGVKVAMVGDGVNDSPALAQADVGIAIGTGTDVAVEAADIVLIKNDLLDVYAAIKLSKLTVRRIHINFISACIYNLLGIPIAAGMLTPIGIELRPWMASAAMALSSVSVVAASLLLKTFRKPRKETLLTQEYYKSYE 1290          

HSP 2 Score: 117.472 bits (293), Expect = 1.126e-22
Identity = 62/178 (34.83%), Postives = 99/178 (55.62%), Query Frame = 1
Query:  229 LCEAIENLGF--LINKNKETDNTKELFKCHMRIQGMTCSSCVHTIENQVLKLKGVKSALINLLSTIGEVTYDPDLIMASDIADTINDMGFDAEIFQ-FKEHTKDIIEVMIQGMTCSSCVYTIESKLAQMQGILSVKVALTTEKGKFKFDPQIISPRDILDAIEEMGFDAKLAPKKTNK 753
            L EA    G+  ++   +E     E  +  + ++GMTC SCV  IE  + K+ G+KS  ++L +    +   P +I     A+ I+DMGFDA +        K ++++ ++GMTC SCV  IES ++   GIL++KV+LT +     F+P +  P  I   IE+MGFDA ++P  T+K
Sbjct:   34 LAEAAAKNGYPAMVKAIEEAQPFMEEMEVMVSVEGMTCMSCVRNIEGNISKVPGIKSISVSLENKNARLVIVPSIITPEAAAEAIDDMGFDANVISPSSSGDKAVVDIHVEGMTCQSCVKNIESNMSSKSGILNIKVSLTNKSAHVTFNPCVTVPLKIAQQIEDMGFDASVSPSNTDK 211          

HSP 3 Score: 100.138 bits (248), Expect = 2.653e-17
Identity = 63/205 (30.73%), Postives = 107/205 (52.20%), Query Frame = 1
Query:  151 IKTVVIDYEKNLVRICCHNDNCTYLTLCEAIENLGFLINK-NKETDNTKELFKCHMRIQGMTCSSCVHTIENQVLKLKGVKSALINLLSTIGEVTYDPDLIMASDIADTINDMGFDAEI----------FQFKEHTKDI-IEVM-IQGMTCSSCVYTIESKLAQMQGILSVKVALTTEKGKFKFDPQIISPRDILDAIEEMGFDA 726
            IK++ +  E    R+       T     EAI+++GF  N  +  +   K +   H  ++GMTC SCV  IE+ +    G+ +  ++L +    VT++P + +   IA  I DMGFDA +                 KD+  +V+ I+GMTC SCV  IE  + +   ++S+KV+L ++ G  ++ P +ISP  + + I++MGF+A
Sbjct:   88 IKSISVSLENKNARLVIVPSIITPEAAAEAIDDMGFDANVISPSSSGDKAVVDIH--VEGMTCQSCVKNIESNMSSKSGILNIKVSLTNKSAHVTFNPCVTVPLKIAQQIEDMGFDASVSPSNTDKSVLVSSSGSVKDVRTKVLNIRGMTCQSCVNNIEGVIGKHPSVVSIKVSLASQTGTIQYYPSLISPEKLCELIDDMGFEA 290          
BLAST of Copper-transporting ATPase 1 vs. TrEMBL
Match: A0A2C9KDX7 (Uncharacterized protein OS=Biomphalaria glabrata OX=6526 GN=106066430 PE=3 SV=1)

HSP 1 Score: 902.123 bits (2330), Expect = 0.000e+0
Identity = 523/992 (52.72%), Postives = 680/992 (68.55%), Query Frame = 1
Query:  265 NKNKETDNTKELFKCHMRIQGMTCSSCVHTIENQVLKLKGVKSALINLLSTIGEVTYDPDLIMASDIADTINDMGFDAEIFQFKEHTKDIIEVMIQGMTCSSCVYTIESKLAQMQGILSVKVALTTEKGKFKFDPQIISPRDILDAIEEMGFDAKLAPK---KTNKYNDHVGESIKKWKHSFLISLIFGVPTMIVMMVFMYGF----SHRMQVIHLKNGINVTV--------MVSNAP--IXXXXXXXXXXXXXXXXXPVQFYGARYFYVQAYKSIKHGSANMDVLVVMATSVSYIYSFIVILVSMILRQDSSPQTFFETTPMLIVFLSLGRWLEHIAKGKTSEALSKLLSLQAFEATIIVNDN-----QERKISXXXXXXXXXXXXXPGEKIPIDGRVVSGKSRCDESLITGESMSVEKIPGSDVIGGTLNISGMLIIRATLVGEDSALNQIVKLVEEAQTSKAPIQELADKVAGLFVPGVIICSMFTLLIWIAIGYTNPNLLPGHSSI--------NTDNTELIWKYAFQLAITVLSVACPCSLGLATPTAVMVGTGVGAINGILIKGGVPLEKMHQLDVIVFDKTGTITTGKPSVTNFVMCVENVTSQIRNCILLMLGAAESSSEHPIGKAILQYVRETCDINEMPQVVHSKSVSGFGLECSLKLQSDMF--VPDSEIDNVLVKINDFQENN-LTENL----KETSVKWRKI----NEPVEVVLYLGNRNMMKENHISIPDKLDELMSRDEDNGRTVVLMAIDKVLLAMISIADQVKKEAALVVYTLEKMGVEVFLLTGDNHKTATAIAKEIGIRNVFAEVLPSHKVAKIQQIQNMSKYKRSWLFSCCSKPSKLTNVAMVGDGINDSPALAQADVGIAIGTGTDVAVEAADVVLIRNSLLDVIAAMKLSKDTVRRIRQNFVAATMYNLIGIPIAAGALMPIGVVFMPWMASVAMAASSICVVCXXXXXXXXXXPNEDQLANQEFKNHLE 3117
            N  K  D+ ++  KC++ I GMTC+SCV TIE  V K++GV   L++L++   EVTYDP  ++ S +A+ + D+GF A + + +   +   E+ I GMTCSSCV  IES++ +  GILS  VAL TE GKF FD ++  PRDI++AI+ +GF+AKL      + ++Y DH  E IK+W+ SFL SLIFG P+MI+MMVFM+G     SH M         N T         M  + P  ++ PGL   NLL+FL ++PVQF+G RYFYVQAYK +KH S NMDVLVVMAT++SY+YS  V++ +M+ +++SSP TFFETTPML+VF+SLGRWLEHIAKGKTSEAL+KL+SLQ  +A ++  D       E+ IS+DLV++GD++KV PG KIP+D +V+ G+S CDESLITGESM VEK  GS VIGG++N +GML++ AT VG D+ L+QIVKLVEEAQTSKAPIQ LADK+AG+FVP V I S+ TL++W+ IGYT+  LL  +  I        N   +E+I++ AF  AITVLS+ACPC+LGLATPTAVMVGTGVGA NGILIKGG PLE  H+L VIVFDKTGTIT G P V+   M V++ T       L + G AE+SSEHPI  AIL+YV+ET     + +V    +V G G++C +     +   +  SE++N   + N F   N L +NL    +ET+     I        E  + +GNR  M+ N + + D +D++M+  E  G T VL AID V++ M+++AD VK EA L VY L++MG++V LLTGDN KTA AIAK++GI  VFAEVLPSHKV KI+Q+Q                 +K   VAMVGDG+NDSPALAQADVGIAIGTGTDVAVEAAD+VLI+N LLDV AA+KLSK TVRRI  NF++A +YNL+GIPIAAG L PIG+   PWMAS AMA SS+ VV  SLLLK ++KP ++ L  QE+    E
Sbjct:  278 NATKAFDD-EDYEKCYLNISGMTCASCVATIEKNVGKMEGVHKILVSLMAQRAEVTYDPAYVLPSQVANKVEDLGFSASVAEGEAVGRGTCELTILGMTCSSCVNRIESEMKKKNGILSASVALATETGKFTFDSELTGPRDIIEAIKSLGFEAKLRTDDDMRASRY-DH-REEIKRWRTSFLWSLIFGGPSMIIMMVFMFGIPSQDSHDMTYNASDPHSNHTAEKPWSHEKMDGHYPQKMIIPGLDWLNLLMFLLATPVQFFGGRYFYVQAYKVLKHRSTNMDVLVVMATTISYLYSLAVLIAAMVQKEESSPMTFFETTPMLMVFISLGRWLEHIAKGKTSEALAKLISLQPADAVLVQVDKNFQILSEKVISLDLVQRGDILKVTPGGKIPVDAKVIFGQSACDESLITGESMPVEKSIGSPVIGGSINQNGMLLVEATYVGADTTLSQIVKLVEEAQTSKAPIQNLADKIAGIFVPVVSILSLVTLIVWVIIGYTDIKLLEKNYDIQNSTSPRTNIPKSEIIFEKAFLYAITVLSIACPCALGLATPTAVMVGTGVGATNGILIKGGEPLELTHKLKVIVFDKTGTITHGVPRVSRVSMFVKDKTCSFVK-FLAIAGTAETSSEHPIASAILKYVKETLLTESLGKVSEFSAVPGCGIKCKVSHLESILSGINLSEVNN---RKNKFGSQNILIDNLLYGIQETANLILDIPLGAESSQEFEVLIGNREWMQRNGLVVIDTMDQVMTEHEMQGHTAVLCAIDGVIVGMLAVADTVKSEAHLAVYELKRMGLDVILLTGDNLKTAKAIAKQVGITRVFAEVLPSHKVKKIKQLQ-----------------AKGVKVAMVGDGVNDSPALAQADVGIAIGTGTDVAVEAADIVLIKNDLLDVYAAIKLSKLTVRRIHINFISACIYNLLGIPIAAGMLTPIGIELRPWMASAAMALSSVSVVAASLLLKTFRKPRKETLLTQEYYKSYE 1245          

HSP 2 Score: 115.931 bits (289), Expect = 3.221e-22
Identity = 57/154 (37.01%), Postives = 90/154 (58.44%), Query Frame = 1
Query:  295 ELFKCHMRIQGMTCSSCVHTIENQVLKLKGVKSALINLLSTIGEVTYDPDLIMASDIADTINDMGFDAEIFQ-FKEHTKDIIEVMIQGMTCSSCVYTIESKLAQMQGILSVKVALTTEKGKFKFDPQIISPRDILDAIEEMGFDAKLAPKKTNK 753
            E  +  + ++GMTC SCV  IE  + K+ G+KS  ++L +    +   P +I     A+ I+DMGFDA +        K ++++ ++GMTC SCV  IES ++   GIL++KV+LT +     F+P +  P  I   IE+MGFDA ++P  T+K
Sbjct:   13 EEMEVMVSVEGMTCMSCVRNIEGNISKVPGIKSISVSLENKNARLVIVPSIITPEAAAEAIDDMGFDANVISPSSSGDKAVVDIHVEGMTCQSCVKNIESNMSSKSGILNIKVSLTNKSAHVTFNPCVTVPLKIAQQIEDMGFDASVSPSNTDK 166          

HSP 3 Score: 99.7525 bits (247), Expect = 3.284e-17
Identity = 63/205 (30.73%), Postives = 107/205 (52.20%), Query Frame = 1
Query:  151 IKTVVIDYEKNLVRICCHNDNCTYLTLCEAIENLGFLINK-NKETDNTKELFKCHMRIQGMTCSSCVHTIENQVLKLKGVKSALINLLSTIGEVTYDPDLIMASDIADTINDMGFDAEI----------FQFKEHTKDI-IEVM-IQGMTCSSCVYTIESKLAQMQGILSVKVALTTEKGKFKFDPQIISPRDILDAIEEMGFDA 726
            IK++ +  E    R+       T     EAI+++GF  N  +  +   K +   H  ++GMTC SCV  IE+ +    G+ +  ++L +    VT++P + +   IA  I DMGFDA +                 KD+  +V+ I+GMTC SCV  IE  + +   ++S+KV+L ++ G  ++ P +ISP  + + I++MGF+A
Sbjct:   43 IKSISVSLENKNARLVIVPSIITPEAAAEAIDDMGFDANVISPSSSGDKAVVDIH--VEGMTCQSCVKNIESNMSSKSGILNIKVSLTNKSAHVTFNPCVTVPLKIAQQIEDMGFDASVSPSNTDKSVLVSSSGSVKDVRTKVLNIRGMTCQSCVNNIEGVIGKHPSVVSIKVSLASQTGTIQYYPSLISPEKLCELIDDMGFEA 245          
BLAST of Copper-transporting ATPase 1 vs. TrEMBL
Match: A0A0L8GFT7 (Uncharacterized protein OS=Octopus bimaculoides OX=37653 GN=OCBIM_22034798mg PE=3 SV=1)

HSP 1 Score: 880.167 bits (2273), Expect = 0.000e+0
Identity = 535/1074 (49.81%), Postives = 705/1074 (65.64%), Query Frame = 1
Query:  109 QLKIIEDFFQFNDNIKTVVIDYEKNLVRICCHNDNCTYLTLCEAIENLGFLINKNKETDNTK------------------------------ELFKCHMRIQGMTCSSCVHTIENQVLKLKGVKSALINLLSTIGEVTYDPDLIMASDIADTINDMGFDAEIFQFKEHTKDIIEVMIQGMTCSSCVYTIESKLAQMQGILSVKVALTTEKGKFKFDPQIISPRDILDAIEEMGFDAKLAPKKTNK--YNDHVGESIKKWKHSFLISLIFGVPTMIVMMVFMYGFSHRMQVIHLKNGINVT-------------VMVSNAPIXXXXXXXXXXXXXXXXXPVQFYGARYFYVQAYKSIKHGSANMDVLVVMATSVSYIYSFIVILVSMILRQDSSPQTFFETTPMLIVFLSLGRWLEHIAKGKTSEALSKLLSLQAFEATIIV----NDNQERKISXXXXXXXXXXXXXPGEKIPIDGRVVSGKSRCDESLITGESMSVEKIPGSDVIGGTLNISGMLIIRATLVGEDSALNQIVKLVEEAQTSKAPIQELADKVAGLFVPGVIICSMFTLLIWIAIGYTNPNLLPGHSSINTDNT----ELIWKYAFQLAITVLSVACPCSLGLATPTAVMVGTGVGAINGILIKGGVPLEKMHQLDVIVFDKTGTITTGKPSVTNFVMCVE-NVTSQIRNCILLMLGAAESSSEHPIGKAILQYVRETCDINEMPQVVHSKSVSGFGLECSL-KLQSDMFVPDSE---------------IDNVLVKINDFQENNLTENLKETSVKWRKINEPVEVVLYLGNRNMMKENHISIPDKLDELMSRDEDNGRTVVLMAIDKVLLAMISIADQVKKEAALVVYTLEKMGVEVFLLTGDNHKTATAIAKEIGIRNVFAEVLPSHKVAKIQQIQNMSKYKRSWLFSCCSKPSKLTNVAMVGDGINDSPALAQADVGIAIGTGTDVAVEAADVVLIRNSLLDVIAAMKLSKDTVRRIRQNFVAATMYNLIGIPIAAGALMPIGVVFMPWMASVAMAASSICVVCXXXXXXXXXXPNEDQLANQE-FKNHLE 3117
            Q+KI E     + ++K++V+  + N   I  + D  +   LC AI+++GF  +  +E +                                 E  KC   + GMTC+SCV  IEN + K++GVK+ L+ L+S   EV YDP  I++S I + I+ +GF A + + +   +  +E++I GMTCSSCV+ IES L + +GI+S  VAL T KG F+F+ +    RDI+ AIEE+GF A LA +  NK    DH  E I++W+ SF  SL+FG+P M++MM FM+       +    N  NVT             +MV N       LSLENLLLF+ ++ VQ  GARYFYVQAY+S+KH SANMDVLV +A S+SY+YS +V++V++ LR+ SSP TFFETTPML++F+SLGRWLEHIAKGKTSEA++KLLSLQA EA ++     N  +E  I+VDLV++GD++KVLPGEKIP+D +V+ G S CDESLITGESM V K PG+ +IGG+LN  GML+I AT VG D+ L+QIVKLVEEAQ SKAPIQ+LADK+AG FVP V+  S+ TL+IWI IGY +  L+    S   D      ELI++YAFQ AITVLS+ACPC+LGLATPTAVMVGTGVGA NGILIKGG PLE  H++  IVFDKTGTIT G P V      VE +V S ++  +L + G AE+SSEHPI  AI++Y ++T     + QV    +V G GL C + +++S +   D E               IDN+L      +++ + E+++       +  +     +++GNR  M+ N + I  K++  M   E+ G TVVL AID  L+AM+++AD VK +A L V TL+ MG+EV LLTGDN KTA AIAK++GI  VFAEVLPSHKV KI+Q+Q  +K                  VAMVGDG+NDSPALAQADVGIAIGTGTDVAVEAAD+VLI+NSL+DV+AA+KLSK TVRRIR NF AA++YNL+GIPIAAG  MP+G+   PWMAS AMA SS+ VV LSLLLKL++KP +++L   E F+ H E
Sbjct:  351 QMKISE-----HSSVKSIVVSLKDNNAVIEYYPDTTSPSELCNAIDDMGFEASVAEEKNRNSMVKSPETNVAIDVGSSVVHFSSNDDALENIEYEKCFFVVTGMTCASCVALIENNISKVEGVKNVLVALMSQKAEVKYDPAYILSSQIGNKISALGFGATLLESESLGQSAVEIIITGMTCSSCVHLIESSLLKKKGIVSANVALATSKGVFEFNNETTGARDIIQAIEELGFQATLATESDNKAARYDHRME-IRRWRSSFFWSLLFGLPAMVIMMYFMFSMPAHDNLPPAGNATNVTTVAPGTFKTHRKQLMVCNG------LSLENLLLFILATAVQLLGARYFYVQAYRSLKHKSANMDVLVCLAISISYMYSTVVVIVAIALREPSSPVTFFETTPMLVLFISLGRWLEHIAKGKTSEAIAKLLSLQASEALLVYMKDGNIIKEETINVDLVQRGDILKVLPGEKIPVDAKVIEGLSSCDESLITGESMPVSKKPGASLIGGSLNQHGMLLIEATHVGTDTTLSQIVKLVEEAQVSKAPIQQLADKIAGYFVPMVVCVSLLTLIIWIIIGYHDIKLI--DKSFKEDGPLTKHELIFQYAFQYAITVLSIACPCALGLATPTAVMVGTGVGATNGILIKGGEPLELTHKVKNIVFDKTGTITHGIPRVARICTFVESHVCSFVK--LLAIAGTAETSSEHPIAAAIVKYAKQTLKTEILGQVTDFLAVPGCGLRCKVSRVESLLSSIDIEGVHNRRNMAGSQRVKIDNIL----GLEDSPIIESMEAVGATASQTYD-----VFIGNREWMRRNGLEITHKINNSMEEHEEQGHTVVLCAIDDELMAMLAVADTVKSDAHLAVSTLKDMGLEVILLTGDNQKTARAIAKQVGITTVFAEVLPSHKVKKIKQLQKSNK-----------------KVAMVGDGVNDSPALAQADVGIAIGTGTDVAVEAADIVLIQNSLIDVVAAIKLSKMTVRRIRINFFAASIYNLLGIPIAAGVFMPVGLSLRPWMASAAMALSSVTVVSLSLLLKLFRKPTKNELLTPEYFRRHCE 1382          

HSP 2 Score: 108.612 bits (270), Expect = 6.151e-20
Identity = 63/208 (30.29%), Postives = 108/208 (51.92%), Query Frame = 1
Query:  151 IKTVVIDYEKNLVRICCHNDNCTYLTLCEAIENLGFLINKNKETDNTKELFKCHMRIQGMTCSSCVHTIENQVLKLKGVKSALINLLSTIGEVTYDPDLIMASDIADTINDMGFDAEIFQFKEHTKDIIEVM-------------IQGMTCSSCVYTIESKLAQMQGILSVKVALTTEKGKFKFDPQIISPRDILDAIEEMGFDAKLA 735
            + +V    +K+L  + C N   + L + EA+E +G  +N  K       L +  ++I GMTC SCV TIE+++ K  GV    ++L      + YD  +     + + I+DMGF+A + +      D  E+              I+GM+C+SCV  IE+ +++  GI  + V+L       K++P+ +SP  I +AI +MGFDA+++
Sbjct:  114 VNSVEFSKDKDLT-VYCQNSKISGLQISEALEAIGIEVNMKKMNQTQSFLSETIIQIDGMTCQSCVRTIESELSKFPGVDFISVSLEEKRAIIRYDQQVTNPQALRNKIDDMGFEAALTESDSSDVDFDEIAKRNVPAENLCIINIKGMSCNSCVTIIENTISEKAGINKITVSLENNNALVKYNPEKLSPETIAEAISDMGFDAEVS 320          

HSP 3 Score: 97.8265 bits (242), Expect = 1.276e-16
Identity = 50/150 (33.33%), Postives = 87/150 (58.00%), Query Frame = 1
Query:  307 CHMRIQGMTCSSCVHTIENQVLKLKGVKSALINLLSTIGEVTYDPDLIMASDIADTINDMGFDAEIFQFKEHTK----DIIEVMIQGMTCSSCVYTIESKLAQMQGILSVKVALTTEKGKFKFDPQIISPRDILDAIEEMGFDAKLAPKK 744
            C + I+GM+C+SCV  IEN + +  G+    ++L +    V Y+P+ +    IA+ I+DMGFDAE+ +            + + I+GMTC SC  TI+ K+++   + S+ V+L       ++ P   SP ++ +AI++MGF+A +A +K
Sbjct:  254 CIINIKGMSCNSCVTIIENTISEKAGINKITVSLENNNALVKYNPEKLSPETIAEAISDMGFDAEVSKGDNPAAFNLIATVVINIKGMTCKSCQSTIQMKISEHSSVKSIVVSLKDNNAVIEYYPDTTSPSELCNAIDDMGFEASVAEEK 403          

HSP 4 Score: 92.0485 bits (227), Expect = 6.522e-15
Identity = 67/252 (26.59%), Postives = 119/252 (47.22%), Query Frame = 1
Query:   79 ILIKEVNDKNQLKIIEDFFQFNDNIKTVVIDYEKNLVRICCHNDNCTYLTLCEAIENLGF--LINKNKETDNTKELFKCHMRIQGMTCSSCVHTIENQVLKLKGVKSALINLLSTIGEVTYDPDLIMASDIADTINDMGFDAEIFQFKEHTK------------------------DIIE--------VMIQGMTCSSCVYTIESKLAQMQGILSVKVALTTEKGKFKFDPQIISPRDILDAIEEMGFDAKL 732
            I IK ++  + + IIE+       I  + +  E N   +  + +  +  T+ EAI ++GF   ++K         +    + I+GMTC SC  TI+ ++ +   VKS +++L      + Y PD    S++ + I+DMGF+A + + K                            D +E         ++ GMTC+SCV  IE+ +++++G+ +V VAL ++K + K+DP  I    I + I  +GF A L
Sbjct:  256 INIKGMSCNSCVTIIENTISEKAGINKITVSLENNNALVKYNPEKLSPETIAEAISDMGFDAEVSKGDNPAAFNLIATVVINIKGMTCKSCQSTIQMKISEHSSVKSIVVSLKDNNAVIEYYPDTTSPSELCNAIDDMGFEASVAEEKNRNSMVKSPETNVAIDVGSSVVHFSSNDDALENIEYEKCFFVVTGMTCASCVALIENNISKVEGVKNVLVALMSQKAEVKYDPAYILSSQIGNKISALGFGATL 507          
BLAST of Copper-transporting ATPase 1 vs. Ensembl Cavefish
Match: atp7a (ATPase copper transporting alpha [Source:NCBI gene;Acc:103038584])

HSP 1 Score: 826.624 bits (2134), Expect = 0.000e+0
Identity = 459/944 (48.62%), Postives = 621/944 (65.78%), Query Frame = 1
Query:  250 LGFLINKNKETDNTKEL-----FKCHMRIQGMTCSSCVHTIENQVLKLKGVKSALINLLSTIGEVTYDPDLIMASDIADTINDMGFDAEIFQFKEHTKDIIEVMIQGMTCSSCVYTIESKLAQMQGILSVKVALTTEKGKFKFDPQIISPRDILDAIEEMGFDAKLAPK-KTNKYNDHVGESIKKWKHSFLISLIFGVPTMIVMMVFMYGFSHRMQVIHLKNGINVTVMVSNAPIXXXXXXXXXXXXXXXXX-----PVQFYGARYFYVQAYKSIKHGSANMDVLVVMATSVSYIYSFIVILVSMILRQDSSPQTFFETTPMLIVFLSLGRWLEHIAKGKTSEALSKLLSLQAFEATIIVNDN------QERKISXXXXXXXXXXXXXPGEKIPIDGRVVSGKSRCDESLITGESMSVEKIPGSDVIGGTLNISGMLIIRATLVGEDSALNQIVKLVEEAQTSKAPIQELADKVAGLFVPGVIICSMFTLLIWIAIGYTNPNLL----PGHSSINTDNTELIWKYAFQLAITVLSVACPCSLGLATPTAVMVGTGVGAINGILIKGGVPLEKMHQLDVIVFDKTGTITTGKPSVTNFVMCVENVTSQIRNCILLMLGAAESSSEHPIGKAILQYVRETCDINEMPQVVHSKSVSGFGLEC------SLKLQSDMFVPDSEIDNVLVKINDFQENNLTENLKETSVKWRKINEPVEVVLYLGNRNMMKENHISIPDKLDELMSRDEDNGRTVVLMAIDKVLLAMISIADQVKKEAALVVYTLEKMGVEVFLLTGDNHKTATAIAKEIGIRNVFAEVLPSHKVAKIQQIQNMSKYKRSWLFSCCSKPSKLTNVAMVGDGINDSPALAQADVGIAIGTGTDVAVEAADVVLIRNSLLDVIAAMKLSKDTVRRIRQNFVAATMYNLIGIPIAAGALMPIGVVFMPWMA 3000
            L  +  K KE ++  E       KC ++I GMTC+SCV  IE  +    G+ S L+ L+++  EV Y+P ++    IA+ I ++GF A + +  + +   +E++I+GMTC+SCV+ IES L + +GI+   VAL T K   K+DP++  PRDI+  IE +GF+A L  K ++  + DH  E I++WK SFLISL+F VP M  MM++M    H + + H  N       + ++ +      L  L +    S     PVQF G R+FY QAYK++KH SANMDVL+V+ATS+++ YS ++++V+MI +   +P TFF+T PML VF+SLGRWLE IAK KTSEALSKL+SLQA EAT++  +        E ++ V+LV++GD+VKV+PG K P+DGRV+ G S  DESLITGE+M V K PGS VI G++N +G L+IRAT VG D+ L+QIVKLVEEAQTSKAPIQ+ AD+++G FVP ++  S+ TLL WIAIG+ N  L+    PG+   +    E I ++AFQ +ITVL +ACPCSLGLATPTAVMVGTGVGA NGILIKGG PLE  H++  +VFDKTGTIT G P V    + VE      R+ +L ++G AE++SEHP+G AI ++ ++      +      ++V G G+ C      +L  + D    +++ + +LV+I+D + ++    L         +      VL +GNR  M+ N + I   +DE M+  E  GRT VL+A+D  L AM++IAD VK EA L V+TL  MG+EV L+TGDN KTA AIA ++GIR VFAEVLPSHKVAK++Q+Q   K                  VAMVGDG+NDSPALA ADVGIAIGTGTDVA+EAADVVLIRN LLDV+A++ LSK TV+RIR NFV A +YNL+GIPIAAG  MPIG+V  PWM 
Sbjct:  466 LSTIKEKEKELESDTEAGLNTHSKCFIQIGGMTCASCVANIERNLKNEHGIHSVLVALMASKAEVRYNPAVMDPLKIAECIRELGFTASVMENYDGSDGALELVIRGMTCASCVHKIESSLMKQKGIVYASVALATNKAHVKYDPEVTGPRDIIRLIENLGFEALLVKKDRSGSHLDHSIE-IQQWKKSFLISLVFCVPVM-GMMIYMMVVDHMIVMSHHHNATREDRQMYHSHMFLERQLLPGLSIMNLLSFLFCVPVQFIGGRHFYAQAYKALKHWSANMDVLIVLATSIAFTYSLVILMVAMIEKAKVNPITFFDTPPMLFVFISLGRWLEQIAKSKTSEALSKLMSLQATEATVVTLNGDTMAVLSEEQVDVELVQRGDIVKVVPGGKFPVDGRVIEGHSMADESLITGEAMPVTKKPGSTVIAGSINQNGSLLIRATHVGTDTTLSQIVKLVEEAQTSKAPIQQFADRISGYFVPFIVAVSVLTLLAWIAIGFVNFRLVEMYFPGYDK-SVSQAEAIIRFAFQASITVLCIACPCSLGLATPTAVMVGTGVGAQNGILIKGGEPLEMAHRIQSVVFDKTGTITYGAPKVVQVKILVEG-NRMPRSKLLAIVGTAENNSEHPLGAAITRFCKQELGTEMLGTCTDFQAVPGCGIRCHVSNTENLVKREDSDGEENQRNAILVQISDPRASSNAHPLIMDPEPLTLVQSASYTVL-IGNREWMRRNALHIRPDVDEAMTEHERRGRTAVLVAVDGELCAMVAIADTVKPEAELAVHTLTSMGLEVVLMTGDNSKTARAIAAQVGIRKVFAEVLPSHKVAKVEQLQQAGK-----------------RVAMVGDGVNDSPALAMADVGIAIGTGTDVAIEAADVVLIRNDLLDVVASIDLSKKTVKRIRINFVFALIYNLVGIPIAAGVFMPIGLVLQPWMG 1387          

HSP 2 Score: 90.8929 bits (224), Expect = 5.948e-18
Identity = 48/158 (30.38%), Postives = 86/158 (54.43%), Query Frame = 1
Query:  319 IQGMTCSSCVHTIENQVLKLKGVKSALINLLSTIGEVTYDPDLIMASDIADTINDM----------GFDAEI----------FQFKEHTKDIIEVMIQGMTCSSCVYTIESKLAQMQGILSVKVALTTEKGKFKFDPQIISPRDILDAIEEMGFDAKL 732
            + GM C+SCV  I++ + K++GV S  ++L      + ++P ++  + +   I  +          G DA +             ++     +++ I+GMTC+SCV +IE  ++Q +G+ S +V+L   +G F+FDP + +P ++  AIEEMGFDA L
Sbjct:  285 VSGMHCNSCVVNIQDNIGKVRGVSSVQVSLEKRQAVIQHNPSIVTVAALQRAIEALPPGKFKTQLDGQDATLPSSLSELSLLQLSEQPLASTVQIHIEGMTCNSCVQSIEGTISQRKGVRSAQVSLANHQGTFEFDPLLTAPEELRAAIEEMGFDAFL 442          

HSP 3 Score: 68.1662 bits (165), Expect = 5.114e-11
Identity = 39/133 (29.32%), Postives = 68/133 (51.13%), Query Frame = 1
Query:  313 MRIQGMTCSSCVHTIENQVLKLKGVKSALINLLSTIGEVTYDPDLIMASDIADTINDMGFDAEIFQFKEHTKDIIEVMIQGMT-CSS-CVYTIESKLAQMQGILSVKVALTTEKGKFKFDPQIISPRDILDAI 705
            + ++GMTC SCV TIE Q+  L GV    ++L      V +DP       +AD I DMGF++++      T    E  +   T CS+       ++LAQ++G++  + ++  +     F P ++SP  + +A+
Sbjct:   13 LTVEGMTCGSCVQTIEQQIGGLSGVIHIEVSLEQKNATVIFDPASHSPESLADAIEDMGFESDVTNASPTTPVQTETRVYPTTGCSAEAQRQAHTQLAQLKGVVETQESIEGKGLAVTFIPTVVSPERVREAV 145          

HSP 4 Score: 62.3882 bits (150), Expect = 3.253e-9
Identity = 25/64 (39.06%), Postives = 42/64 (65.62%), Query Frame = 1
Query:  535 IEVMIQGMTCSSCVYTIESKLAQMQGILSVKVALTTEKGKFKFDPQIISPRDILDAIEEMGFDA 726
            + + ++GMTC SCV TIE ++  + G++ ++V+L  +     FDP   SP  + DAIE+MGF++
Sbjct:   11 VTLTVEGMTCGSCVQTIEQQIGGLSGVIHIEVSLEQKNATVIFDPASHSPESLADAIEDMGFES 74          

HSP 5 Score: 55.4546 bits (132), Expect = 3.670e-7
Identity = 42/179 (23.46%), Postives = 85/179 (47.49%), Query Frame = 1
Query:  226 TLCEAIENLGFLINKNKETDNTKELFKCHMRIQGMT-CSS-CVHTIENQVLKLKGVKSALINLLSTIGEVTYDPDLIMASDIADTINDMGFDAEIFQFKEHTK-----DIIEVMIQGMTCSSCVYTIESKLAQMQGILSVKVALTTEKGKFKFDPQIISPRDILDAIEEMGFDAKLAPK 741
            +L +AIE++GF  +    +  T    +   R+   T CS+        Q+ +LKGV     ++      VT+ P ++    + + ++ +         +   +     +++++ I GM C SC  TIE K+ +++G+  +KV L +++    + P +I+  DI++ I   GF A +  K
Sbjct:   62 SLADAIEDMGFESDVTNASPTTP--VQTETRVYPTTGCSAEAQRQAHTQLAQLKGVVETQESIEGKGLAVTFIPTVVSPERVREAVSCLVPQPASTSERSTGRGSGNVEVVKMRIDGMVCLSCTTTIEGKIGKLKGVEKIKVGLESQEATVLYLPYLITVEDIVNQIGVAGFKASVKSK 238          
BLAST of Copper-transporting ATPase 1 vs. Ensembl Cavefish
Match: atp7b (ATPase copper transporting beta [Source:ZFIN;Acc:ZDB-GENE-061220-5])

HSP 1 Score: 536.569 bits (1381), Expect = 1.060e-170
Identity = 305/597 (51.09%), Postives = 403/597 (67.50%), Query Frame = 1
Query: 1228 KGKTSEALSKLLSLQAFEATIIV--NDNQ---ERKISXXXXXXXXXXXXXPGEKIPIDGRVVSGKSRCDESLITGESMSVEKIPGSDVIGGTLNISGMLIIRATLVGEDSALNQIVKLVEEAQTSKAPIQELADKVAGLFVPGVIICSMFTLLIWIAIGYTNPNLLPGHSSINTDNTELIWKYAFQLAITVLSVACPCSLGLATPTAVMVGTGVGAINGILIKGGVPLEKMHQLDVIVFDKTGTITTGKPSVTNFVMCVENVTSQIRNCILLMLGAAESSSEHPIGKAILQYVRETCDINEMPQVVHS-KSVSGFGLECSLKLQSDMFVPDSEIDNVLVKINDFQENNLTENLKETSVKWRKINEPVEVVLYLGNRNMMKENHISIPDKLDELMSRDEDNGRTVVLMAIDKVLLAMISIADQVKKEAALVVYTLEKMGVEVFLLTGDNHKTATAIAKEIGIRNVFAEVLPSHKVAKIQQIQNMSKYKRSWLFSCCSKPSKLTNVAMVGDGINDSPALAQADVGIAIGTGTDVAVEAADVVLIRNSLLDVIAAMKLSKDTVRRIRQNFVAATMYNLIGIPIAAGALMPIGVVFMPWMA 3000
            + KTSEAL+KL+SLQA +ATI+   +DN    E ++SV LV++GD+VKV PG K P+DG+V+ G S  DESLITGE M V K PGS VI G++N  G L++ AT VG D+ L+QIV+LVEEAQTSKAPIQ+LADK++G FVP +++ S+ TL      GY            N   T++I ++AFQ +ITVLS+ACPCSLGLATPTAVMVGTGVGA NGILIKGG PLE  H++  ++FDKTGTIT G P VT  ++  +     +R  +L ++G AE+SSEHP+G    Q ++     +E+    H  ++V G G+ C                    K+++ +E  L +N  E          P    + +GNR  M+ N I +   +DE MS  E  G+T +L+AID VL AM++IAD VK+E+AL V+TL +MG++V ++TGDN +TA AIA ++GIR VFAEVLPSHKVAK+Q++Q                 +K   VAMVGDG+NDSPALA+AD+GIAIGTGTDVA+EAADVVLIRN LLDV+A+++LSK TV+RIR NF+ A +YNL+GIPIAAG  MP+G+V  PWM 
Sbjct:  647 QSKTSEALAKLMSLQAVDATIVTLGHDNSIISEEQVSVQLVQRGDVVKVAPGGKFPVDGKVIEGSSMADESLITGEPMPVRKKPGSCVIAGSINAHGALLVEATHVGADTTLSQIVRLVEEAQTSKAPIQQLADKLSGYFVPFIVVVSVATL------GYDT----------NIPRTDVIVRFAFQASITVLSIACPCSLGLATPTAVMVGTGVGAQNGILIKGGEPLEMAHKIKAVMFDKTGTITNGVPRVTRVLVLWDQARLPLRK-VLAVVGTAEASSEHPLGNGSCQTLQ-----SELLGHCHDFQAVPGCGISC--------------------KVSNIEE--LLQNSSEA-------EGPPTYSVLIGNRQWMQRNAIQVTADVDEAMSSHETKGQTAILVAIDGVLCAMLAIADTVKEESALAVHTLSRMGIDVLMITGDNRRTAKAIATQVGIRKVFAEVLPSHKVAKVQELQ-----------------AKGLKVAMVGDGVNDSPALARADLGIAIGTGTDVAIEAADVVLIRNDLLDVVASIELSKKTVQRIRINFMFALIYNLLGIPIAAGVFMPVGLVLQPWMG 1175          

HSP 2 Score: 157.147 bits (396), Expect = 2.414e-38
Identity = 78/188 (41.49%), Postives = 117/188 (62.23%), Query Frame = 1
Query:  304 KCHMRIQGMTCSSCVHTIENQVLKLKGV--KSALINLLSTIGEVTYDPDLIMASDIADTINDMGFDAEIFQFKEHTKDIIEVMIQGMTCSSCVYTIESKLAQMQGILSVKVALTTEKGKFKFDPQIISPRDILDAIEEMGFDAKLAPKKTNKYNDHVG--ESIKKWKHSFLISLIFGVPTMIVMMVFM 855
            KC + + GMTC+SCV  IE  +LK KGV  KS L+ L++   E+ YDP+ +  + I   I+ +GF A + +       ++++ + GMTC+SCV+ IESKL + +GIL   V+L T K   KFDP ++  RDI+  +E +GF A L      + N+ +G  E I++WKHSFLISL+ G+P M +M+  M
Sbjct:  422 KCFVCVTGMTCASCVSNIERTLLKHKGVWIKSVLVALMAGKAEIKYDPEDLDPAQIVKLISGLGFGASLVEEGAINDGVLDLSVTGMTCASCVHNIESKLCRSKGILEATVSLATSKAHVKFDPDVVGVRDIIRIVEGLGFGASLIKSDDLRKNNDLGHQEEIRQWKHSFLISLVCGIPVMGLMIYMM 609          

HSP 3 Score: 85.8853 bits (211), Expect = 1.792e-16
Identity = 59/199 (29.65%), Postives = 92/199 (46.23%), Query Frame = 1
Query:  274 KETDNTKELFKCHMRIQGMTCSSCVHTIENQVLKLKGVKSALINLLSTIGEVTYDPDLIMASDIADTINDMGFDAEIFQFK--EHT----------------------------------KDIIE--------VMIQGMTCSSCVYTIESKLAQMQGIL--SVKVALTTEKGKFKFDPQIISPRDILDAIEEMGFDAKL 732
            +  ++ + L K  + I+GMTC+SCV +IE  + +  GV S  + L    G +T+D  L  ++++ D I DMGF+A + Q +   HT                                  + I+         V + GMTC+SCV  IE  L + +G+   SV VAL   K + K+DP+ + P  I+  I  +GF A L
Sbjct:  292 RSQNSVESLQKVTIGIKGMTCNSCVQSIEGLISQKHGVHSITVYLKEEKGVITFDSSLTTSTELRDAIEDMGFEAFLKQGRVCSHTFFSYSIFCLLILSVYFKKEMDRLNSKVDSNLPWQRSILHLAPFQKCFVCVTGMTCASCVSNIERTLLKHKGVWIKSVLVALMAGKAEIKYDPEDLDPAQIVKLISGLGFGASL 490          

HSP 4 Score: 83.9593 bits (206), Expect = 8.544e-16
Identity = 51/168 (30.36%), Postives = 83/168 (49.40%), Query Frame = 1
Query:  286 NTKELFKCHMRIQGMTCSSCVHTIENQVLKLKGVKSALINLLSTIGEVTYDPDLIMASDIADTINDM---GFDAEIFQ----FKEHTKDIIE------------VMIQGMTCSSCVYTIESKLAQMQGILSVKVALTTEKGKFKFDPQIISPRDILDAIEEMGFDAKL 732
            +T +  +  + ++GM C SCV  I   +  + GV+S L+ L S   ++ YDP L+    +   +  +    F   + +     K  T   I             + I+GMTC+SCV +IE  ++Q  G+ S+ V L  EKG   FD  + +  ++ DAIE+MGF+A L
Sbjct:  201 HTPDWLEVRLGVEGMHCGSCVKNITENLSGMLGVQSVLVYLESKTLDLKYDPSLVTLDTVKGVLESLPPGNFKVTLPESGSFHKPRTNGSIRSQNSVESLQKVTIGIKGMTCNSCVQSIEGLISQKHGVHSITVYLKEEKGVITFDSSLTTSTELRDAIEDMGFEAFL 368          

HSP 5 Score: 75.8702 bits (185), Expect = 2.032e-13
Identity = 44/173 (25.43%), Postives = 84/173 (48.55%), Query Frame = 1
Query:  286 NTKELFKCHMRIQGMTCSSCVHTIENQVLKLKGVKSALI-NLLSTIGEVTYDPDLIMASDIADTINDMGF------DAEIFQ--FKEHTKDIIEVMIQGMTCSSCVYTIESKLAQMQGILSVKVALTTEKGKFKFDPQIISPRDILDAIEEMGFDA----KLAPKKTNKYNDH 765
            N+    +  + I G T   CV  +++ +  L GV +  +    S +  + + P  +   +I   I  MG+      +A + Q       + ++ + ++GMTC SCV TIE ++  +QG+L ++V+L+ ++    F+ + + P ++   IEEMGF+A     L P    +   H
Sbjct:   29 NSGHPSRLSLLISGPTSPDCVQGLQSWLSALSGVTAVSVPQSGSGLAWIDFHPSTVTTREILQEIQGMGYGVNEVSNAGVSQPALPRLEESLVRISVEGMTCHSCVRTIEGRIGALQGVLGIQVSLSEKEAVIWFNNETVKPDELRKHIEEMGFEAFVKDPLVPHLATQAGPH 201          
BLAST of Copper-transporting ATPase 1 vs. Ensembl Cavefish
Match: atp2c1 (ATPase secretory pathway Ca2+ transporting 1 [Source:ZFIN;Acc:ZDB-GENE-060503-615])

HSP 1 Score: 80.8777 bits (198), Expect = 5.968e-15
Identity = 59/168 (35.12%), Postives = 90/168 (53.57%), Query Frame = 1
Query: 2446 LLAMISIADQVKKEAALVVYTLEKMGVEVFLLTGDNHKTATAIAKEIGIRNVFAEVLPSHKVAKIQQIQNMSK-YKRSWLFSCCSKPSKL----------TNVAMVGDGINDSPALAQADVGIAIG-TGTDVAVEAADVVLIRNSLLDVIAAMKLSKDTVRRIRQNFV 2913
             L ++ I D  +      V TL   GV V ++TGD+ +TA AIA  +G+    ++ L   +V  +  IQ +S+   R  +F   S   KL            VAM GDG+ND+ AL  AD+G+A+G TGTDV  EAAD++L+ +    +++A++  K     I+ NFV
Sbjct:  516 FLGLVGIIDPPRAGVKDAVSTLISSGVAVKMITGDSQETAVAIASRLGLYTKGSQCLSGEEV-DVMDIQQLSQIVSRIVVFYRASPRHKLKIVKSLQNIGAVVAMTGDGVNDAVALKAADIGVAMGQTGTDVCKEAADMILVDDDFQTILSAIEEGKGIYNNIK-NFV 681          
BLAST of Copper-transporting ATPase 1 vs. Ensembl Cavefish
Match: atp2a1l (sarcoplasmic/endoplasmic reticulum calcium ATPase 1 [Source:NCBI gene;Acc:103039228])

HSP 1 Score: 79.337 bits (194), Expect = 1.684e-14
Identity = 50/172 (29.07%), Postives = 90/172 (52.33%), Query Frame = 1
Query: 2437 DKVLLAMISIADQVKKEAALVVYTLEKMGVEVFLLTGDNHKTATAIAKEIGIRNVFAEVLPSHKVAKIQQIQNMSKYKRSWLFS--CC------SKPSKLTN--------VAMVGDGINDSPALAQADVGIAIGTGTDVAVEAADVVLIRNSLLDVIAAMKLSKDTVRRIRQ 2904
            D   +  + + D  +KE    +      G+ V ++TGDN  TA AI + IGI N   +V  + +    ++  ++ + ++S   +  CC      S  SK+           AM GDG+ND+PAL +A++GIA+G+GT VA  A+++VL  ++   ++AA++  +     ++Q
Sbjct:  587 DLTFVGCVGMLDPPRKEVTGSIELCRAAGIRVIMITGDNKGTAVAICRRIGIFNEDEDV--TGRAYTGREFDDLPRTEQSEAVTRACCFARVEPSHKSKIVEFLQGYDEITAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASEMVLADDNFSSIVAAVEEGRAIYNNMKQ 756          
BLAST of Copper-transporting ATPase 1 vs. Ensembl Cavefish
Match: atp2a1l (sarcoplasmic/endoplasmic reticulum calcium ATPase 1 [Source:NCBI gene;Acc:103039228])

HSP 1 Score: 79.337 bits (194), Expect = 1.694e-14
Identity = 50/172 (29.07%), Postives = 90/172 (52.33%), Query Frame = 1
Query: 2437 DKVLLAMISIADQVKKEAALVVYTLEKMGVEVFLLTGDNHKTATAIAKEIGIRNVFAEVLPSHKVAKIQQIQNMSKYKRSWLFS--CC------SKPSKLTN--------VAMVGDGINDSPALAQADVGIAIGTGTDVAVEAADVVLIRNSLLDVIAAMKLSKDTVRRIRQ 2904
            D   +  + + D  +KE    +      G+ V ++TGDN  TA AI + IGI N   +V  + +    ++  ++ + ++S   +  CC      S  SK+           AM GDG+ND+PAL +A++GIA+G+GT VA  A+++VL  ++   ++AA++  +     ++Q
Sbjct:  581 DLTFVGCVGMLDPPRKEVTGSIELCRAAGIRVIMITGDNKGTAVAICRRIGIFNEDEDV--TGRAYTGREFDDLPRTEQSEAVTRACCFARVEPSHKSKIVEFLQGYDEITAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASEMVLADDNFSSIVAAVEEGRAIYNNMKQ 750          
BLAST of Copper-transporting ATPase 1 vs. Ensembl Sea Lamprey
Match: atp7b (ATPase copper transporting beta [Source:ZFIN;Acc:ZDB-GENE-061220-5])

HSP 1 Score: 636.336 bits (1640), Expect = 0.000e+0
Identity = 350/782 (44.76%), Postives = 504/782 (64.45%), Query Frame = 1
Query:  706 EEMGFDAKLAPK--KTNKYNDHVGESIKKWKHSFLISLIFGVPTMIVMMVFMYGFSHRMQVIHLKN-----GINVTVMVSNAPIXXXXXXXXXXXXXXXXXPVQFYGARYFYVQAYKSIKHGSANMDVLVVMATSVSYIYSFIVILVSMILRQDSSPQTFFETTPMLIVFLSLGRWLEHIAKGKTSEALSKLLSLQAFEATIIV--NDN---QERKISXXXXXXXXXXXXXPGEKIPIDGRVVSGKSRCDESLITGESMSVEKIPGSDVIGGTLNISGMLIIRATLVGEDSALNQIVKLVEEAQTSKAPIQELADKVAGLFVPGVIICSMFTLLIWIAIGYTN--------PNLLPGHSSINTDNTELIWKYAFQLAITVLSVACPCSLGLATPTAVMVGTGVGAINGILIKGGVPLEKMHQLDVIVFDKTGTITTGKPSVTNFVMCVENVTSQIRNCILLMLGAAESSSEHPIGKAILQYVRETCDINEMPQVVHSKSVSGFGLECSLKLQSDMFVPDSEIDNVLVKINDFQENNLTENLKETSVKWRKI--------------NEPVEVVLYLGNRNMMKENHISIPDKLDELMSRDEDNGRTVVLMAIDKVLLAMISIADQVKKEAALVVYTLEKMGVEVFLLTGDNHKTATAIAKEIGIRNVFAEVLPSHKVAKIQQIQNMSKYKRSWLFSCCSKPSKLTNVAMVGDGINDSPALAQADVGIAIGTGTDVAVEAADVVLIRNSLLDVIAAMKLSKDTVRRIRQNFVAATMYNLIGIPI 2949
            + MG+ A L  +  +   + +H  E I++W+++FL++L+FG+P M  +MV+M     + +  +L N     G++   +V  A                  +PVQF G R+FY +AYKS+K+ +ANMDVL+V+ATS++Y+YS +++LV+M  R   SP TFF+T PML VF++LGRWLEH+AKGKTSEAL+KL+SLQA EAT++    DN    E ++ V+L+++GD ++V+PG + P+DGRV++G S  DES+ITGE M V K PGS VI G++N  G L++ AT VG D+ L QIV+LVEEAQTSKAPIQ+LAD+++G FVP V++ S  TL+ WI +G+ +        P+  P     +  + E++ ++AFQ AITVLS+ACPC+LGLATPTAVMVGTGVGA NGILIKGG PLE  H++  +VFDKTGT+T G P V  F +         R  +  ++G AE+SSEHP+G AI ++ ++      +      ++V GFG+ C +          S +D  L  +++ +EN   +N   ++   R                +E     + +GNR  M  + + +   +   M++ E+ G T VL+A+D  L  M++IAD VK+EAALVV TL  MG+ V LLTGDN +TA AIA ++G+R  +AEVLP+ KV +++++Q                      VAMVGDG+NDSPALAQADVGIAIG+GTDVA+ AAD+VLIR++LLDV+++++LSK TV RIR NF+ A +YNL+G+PI
Sbjct:    1 QRMGYTAALVKQECRGTSHLEHTDE-IRQWRNAFLLNLLFGIPVM-ALMVYMIVMDSQKKHNYLMNHMVLPGLSTINLVFFA----------------LCTPVQFVGGRHFYARAYKSVKYRAANMDVLIVLATSIAYVYSVVILLVAMAERAPRSPLTFFDTPPMLFVFITLGRWLEHLAKGKTSEALAKLMSLQAAEATLVTLGPDNSLVSEEQVEVELLQRGDALRVVPGARFPVDGRVIAGTSMADESIITGEVMPVSKGPGSLVIAGSINQMGSLLVEATHVGADTTLAQIVRLVEEAQTSKAPIQQLADRLSGYFVPTVVLLSTLTLVTWIVVGFADFAVVQKYFPDFDP-----SLPHGEVVLRFAFQAAITVLSIACPCALGLATPTAVMVGTGVGAQNGILIKGGEPLEMAHKIKAVVFDKTGTLTHGMPRVLRFALFGNRARVSPRR-LTAIVGTAEASSEHPLGVAITKHCKQELSTERLGSCQAFQAVPGFGISCEV----------SNVDAALNAVDEDEENE--KNASPSAPANRSAPHIIMDGDESTATRHELQRYAVLIGNREWMGRSGVEVAPAVHAAMAQHEEQGHTAVLVAVDGQLCGMLAIADAVKEEAALVVRTLTAMGLHVILLTGDNRRTARAIAAQVGVRTAYAEVLPADKVREVERLQRQG-----------------LRVAMVGDGVNDSPALAQADVGIAIGSGTDVAIAAADIVLIRSNLLDVVSSIELSKKTVLRIRINFIFALVYNLLGLPI 729          
BLAST of Copper-transporting ATPase 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002230.1 (pep scaffold:Pmarinus_7.0:GL493059:69:4752:-1 gene:ENSPMAG00000002031.1 transcript:ENSPMAT00000002230.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 207.994 bits (528), Expect = 2.489e-62
Identity = 107/171 (62.57%), Postives = 130/171 (76.02%), Query Frame = 1
Query: 2446 LLAMISIADQVKKEAALVVYTLEKMGVEVFLLTGDNHKTATAIAKEIGIRNVFAEVLPSHKVAKIQQIQNMSKYKRSWLFSCCSKPSKLTNVAMVGDGINDSPALAQADVGIAIGTGTDVAVEAADVVLIRNSLLDVIAAMKLSKDTVRRIRQNFVAATMYNLIGIPIAAG 2958
            L  M++IAD VK EAAL V TL  MG++V L+TGDN KTA AIA ++GIR VFAEVLPSHKVAK++Q+Q   +                  VAMVGDG+NDSPALA++DVGIA+GTGTDVA+EAAD+VLIRN LLDV+A++ LSK TVRRI  NFV A +YN++GIPIAAG
Sbjct:    6 LCGMLAIADTVKPEAALAVRTLADMGLQVVLMTGDNRKTAQAIAAQVGIRRVFAEVLPSHKVAKVEQLQESGQ-----------------TVAMVGDGVNDSPALARSDVGIALGTGTDVAIEAADIVLIRNDLLDVVASIHLSKKTVRRIHINFVFALIYNVVGIPIAAG 159          
BLAST of Copper-transporting ATPase 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010051.1 (pep scaffold:Pmarinus_7.0:GL484878:2955:5956:-1 gene:ENSPMAG00000009092.1 transcript:ENSPMAT00000010051.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 72.7886 bits (177), Expect = 1.779e-13
Identity = 44/167 (26.35%), Postives = 74/167 (44.31%), Query Frame = 1
Query:  319 IQGMTCSSCVHTIENQVLKLKGVKSALINLLSTIGEVTYDPDLIMASDIADTINDMGFDAEIFQFKEHTKDI-----------------------------IEVMIQGMTCSSCVYTIESKLAQMQGILSVKVALTTEKGKFKFDPQIISPRDILDAIEEMGFDAKL 732
            ++GM C SCV  IE+ V +L  V S  ++L  +  ++ Y+P L+  +D+   I  +        F   + D+                             + + + GMTC+SCV  +E  LA+  G+ SV V+L        +D  + SP  +  A+E+MG+ A L
Sbjct:  240 VEGMHCKSCVDNIESHVGELAAVYSIEVSLSESKADIRYNPTLLGPADLKQAIESLPPGNLSVSFGLRSTDLPSPNVYQSLLSRCAKGAVEEPVPRADNPTVVLRVTGMTCASCVQNVEGGLAKRAGVRSVSVSLGDGTATVSYDRGVTSPEILQGAVEDMGYGATL 406          

HSP 2 Score: 70.4774 bits (171), Expect = 9.758e-13
Identity = 45/185 (24.32%), Postives = 88/185 (47.57%), Query Frame = 1
Query:  229 LCEAIENLGF--LINKNKETDNTKELFKCHMRIQGMTCSSCVHTIENQVLKLKGVKSALINLLSTIGEVTYDPDLIMASDIADTINDMGFDAEIFQF---KEHTKDI------------------IEVMIQGMTCSSCVYTIESKLAQMQGILSVKVALTTEKGKFKFDPQIISPRDILDAIEEM 714
            +C+ IE+ G+   +   +       L    + ++GM   +C   +E+ + KL GV+    +L S    + Y   LI AS++   I  +GF A + +    +E ++ +                  I + ++GM C SCV  IES + ++  + S++V+L+  K   +++P ++ P D+  AIE +
Sbjct:  114 ICQKIEDFGYRATLQAGRRQPGLATLV---VTVEGMKRQTCARRVESALAKLPGVEHVEASLASREVRIGYKSHLINASELRRQIEALGFAALLPKSPLKREKSRALPADPQSSAPPSEAIESATITLGVEGMHCKSCVDNIESHVGELAAVYSIEVSLSESKADIRYNPTLLGPADLKQAIESL 295          

HSP 3 Score: 56.225 bits (134), Expect = 3.437e-8
Identity = 36/135 (26.67%), Postives = 55/135 (40.74%), Query Frame = 1
Query:  313 MRIQGMTCSSCVHTIENQVLKLKGVKSALINLLSTIGEVTYDPDLIMASDIADTINDMGFDA-----------------------------------EIFQFKEHTKDIIEVMIQGMTCSSCVYTIESKLAQMQG 612
            +R+ GMTC+SCV  +E  + K  GV+S  ++L      V+YD  +     +   + DMG+ A                                   E    +E  K ++ V   GMTC+SCV  IE+ L +  G
Sbjct:  343 LRVTGMTCASCVQNVEGGLAKRAGVRSVSVSLGDGTATVSYDRGVTSPEILQGAVEDMGYGATLTGNIPLSLSPVTFPPSLTVNLDLYVELPPKPSGEREDAREPEKCLLRVT--GMTCASCVANIENNLKKKDG 475          

HSP 4 Score: 51.6026 bits (122), Expect = 9.271e-7
Identity = 46/190 (24.21%), Postives = 89/190 (46.84%), Query Frame = 1
Query:  226 TLCEAIENLGFLINKNKETDNTK---ELFKCHMRIQGMTCSSCVH--TIENQVLKLKGVKSA-LINLLSTIGE-------VTYDPDLIMASDIADTINDMGFDAEIFQFKEHTK-DIIEVMIQGMTCSSCVYTIESKLAQMQGILSVKVALTTEKGKFKFDPQIISPRDILDAIEEMGFDAKLAPKKTNK 753
            +L EA+E  GF  + +   D ++   +     + + G T S+ +   ++ +    L+GV +  ++   S   E       VT+ P+L  A+ I   I D G+ A +   +       + V ++GM   +C   +ES LA++ G+  V+ +L + + +  +   +I+  ++   IE +GF A L PK   K
Sbjct:   22 SLLEAVERAGFEASLDLGGDGSRFPADTESVEILVTGATPSAELRGRSLADLAASLRGVTATDVVRSPSEEAEDARRKMNVTFLPELTGANVICQKIEDFGYRATLQAGRRQPGLATLVVTVEGMKRQTCARRVESALAKLPGVEHVEASLASREVRIGYKSHLINASELRRQIEALGF-AALLPKSPLK 210          
BLAST of Copper-transporting ATPase 1 vs. Ensembl Sea Lamprey
Match: atp2c1 (ATPase secretory pathway Ca2+ transporting 1 [Source:ZFIN;Acc:ZDB-GENE-060503-615])

HSP 1 Score: 68.1662 bits (165), Expect = 5.835e-12
Identity = 54/171 (31.58%), Postives = 89/171 (52.05%), Query Frame = 1
Query: 2446 LLAMISIADQ----VKKEAALVVYTLEKMGVEVFLLTGDNHKTATAIAKEIGIRNVFAEVLPSHKVAKIQQIQNMSKYKRSWLFSCCSKPSKLT----------NVAMVGDGINDSPALAQADVGIAIG-TGTDVAVEAADVVLIRNSLLDVIAAMKLSKDTVRRIRQNFV 2913
             L ++ I D     V+K  A++V +    GV V ++TGD+ +TA AIA  +G+ +       S +   ++  Q     ++  +F   S   KL            V M GDG+ND+ AL  AD+G+A+G +GTDV  EAAD++L+ +    +++A++  K     I+ NFV
Sbjct:   75 FLGLVGIIDPPRPGVRKSVAILVSS----GVSVKMVTGDSMETAVAIANRLGLSSNGGGAAISGEEDLMETTQLSQIIRKVSVFYRASPRHKLKIVKALQKNGEVVGMTGDGVNDAVALRAADIGVAMGRSGTDVCKEAADMILVDDDFYTIMSAIEEGKGIFYNIK-NFV 240          
BLAST of Copper-transporting ATPase 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010373.1 (pep scaffold:Pmarinus_7.0:GL481096:3909:20014:1 gene:ENSPMAG00000009373.1 transcript:ENSPMAT00000010373.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 68.5514 bits (166), Expect = 7.456e-12
Identity = 48/180 (26.67%), Postives = 80/180 (44.44%), Query Frame = 1
Query: 2458 ISIADQVKKEAALVVYTLEKMGVEVFLLTGDNHKTATAIAKEIGI-------------------------------RNVFAEVLPSHKVAKIQQIQNMSKYKRSWLFSCCSKPSKLTNVAMVGDGINDSPALAQADVGIAIGTGTDVAVEAADVVLIRNSLLDVIAAMKLSKDTVRRIRQ 2904
            + + D  +KE +  +    + G+ V    GDN  TA AI + IGI                                  FA V PSHK   ++ +Q+  +                   AM GDG+ND+PAL +A++GIA+G+GT VA  A+++VL  ++   ++AA++  +     ++Q
Sbjct:  447 VGMLDPPRKEVSSSIILCREAGIRVI---GDNKGTAVAICRRIGIFGEDEDVKDKAYTGREFDDLPLEEQRLACQRARCFARVEPSHKSKIVEFLQSCDEI-----------------TAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASEMVLADDNFSSIVAAVEEGRAIYNNMKQ 606          
BLAST of Copper-transporting ATPase 1 vs. Ensembl Yeast
Match: CCC2 (Cu(+2)-transporting P-type ATPase; required for export of copper from the cytosol into an extracytosolic compartment; similar to human proteins involved in Menkes and Wilsons diseases; protein abundance increases in response to DNA replication stress; affects TBSV model (+)RNA virus replication by regulating copper metabolism; human homologs ATP7A and ATP7B both complement yeast null mutant [Source:SGD;Acc:S000002678])

HSP 1 Score: 426.017 bits (1094), Expect = 5.598e-132
Identity = 318/981 (32.42%), Postives = 514/981 (52.40%), Query Frame = 1
Query:  202 HNDNCTYLTLCEAIENLGFLINKNKETD----NTKELFKCHMRIQGMTCSSCVHTIENQVLKLKGVKSALINLLSTIGEVTYDPDLIMASDIADTINDMGFDAEIFQFKEHTKDIIE-VMIQGMTC-----SSCVYTIESKLAQMQ---GILSVKVALTTEKGKFKFDPQIISPRDILDAIEEMGFDAKLAPKKTNKYNDHV---GESIKKWKHSFLISLIFGV-------------PTMIVMMVFMYGFSHRMQVIHLKNGINVTVMVSNAPIXXXXXXXXXXXXXXXXXPVQFYGARYFYVQAYKSIKHGSANMDVLVVMATSVSYIYSFIVILVSMILRQDSS--PQTFFETTPMLIVFLSLGRWLEHIAKGKTSEALSKLLSLQAFEATII--VNDNQERKISXXXXXXXXXXXXXPGEKIPIDGRVVSGKSRCDESLITGESMSVEKIPGSDVIGGTLNISGMLIIRATLVGEDSALNQIVKLVEEAQTSKAPIQELADKVAGLFVPGVIICSMFTLLIWIAIGYTNPNLLPGHSSINTDNTELIWKYAFQLAITVLSVACPCSLGLATPTAVMVGTGVGAINGILIKGGVPLEKMHQLDVIVFDKTGTITTGKPSVTNFVMCVENVTSQIRNCILLMLGAAESSSEHPIGKAILQYVRETCDINEMPQVVHSKSVSGFGLECSLKLQSDMFVPDSEIDNVLVK--INDFQENNLTENLKETSVKWRKINEPVEVVLYLGNRNMMKENHISIPDKLDELMSRDEDNGRTVVLMAIDKVLLAMISIADQVKKEAALVVYTLEKMGVEVFLLTGDNHKTATAIAKEIGI--RNVFAEVLPSHKVAKIQQIQNMSKYKRSWLFSCCSKPSKLTNVAMVGDGINDSPALAQADVGIAIGTGTDVAVEAADVVLI------RNSLLDVIAAMKLSKDTVRRIRQNFVAATMYNLIGIPIAAGALMPIGVVFMPWMASVAMA 3015
            +++  T  ++ E IE+ GF     ++++    +TKE     + +QGMTC SCV T+  QV  ++GV+S +++L++    V Y+P         + I D GFD+ I        D+ E  +I  +T      S  + +  S+  Q     G+ S++++        K+    +  RD+L  +E  G+   +     N     +    + I+ WK + + S +  +             PT++   +F Y  +  ++ +  ++ + V +                      +S +QF    YFY  A+ S+KHGS  MD LV ++T+ +Y +S   ++ +M     +   P+  F+T+ M+I ++S+G++LE +AK +TS ALSKL+ L     +II  V  N+ ++I ++L++  D+V++ PG KIP DG +  G+S  DESL+TGES+ V K  G  VI G++N  G    R T VGE++ L  I+K+++EAQ SKAPIQ  AD +A +FVPG++I ++ T  IW  I   + N  P   + NT           Q A +V+ VACPC+LGLATPTA+MVGTGVGA NG+LIKGG  LEK + +   VFDKTGT+TTG   V  F+     V +   + +L  + A ES S+HP+ KAI++Y    CD                GL C+  L + +     E + VL K  ++  Q N  T +                  + +GN  ++ E+ +    K    ++ + D G TV  ++++  +  +  I D+VK ++   V  L++ G E +++TGDN+  A  +A+E+GI   NV+++V P+ K   +++IQ+     +               VA+VGDGIND+PALA +D+GIAI TGT++A+EAAD+V++       NSL  +  A+ +S  T +RI+ N   A  YN+  IPIA G L+P G+   P +A +AMA
Sbjct:   46 YDNEVTADSIKEIIEDCGFDCEILRDSEITAISTKEGL---LSVQGMTCGSCVSTVTKQVEGIEGVESVVVSLVTEECHVIYEPSKTTLETAREMIEDCGFDSNIIMDGNGNADMTEKTVILKVTKAFEDESPLILSSVSERFQFLLDLGVKSIEISDDMHTLTIKYCCNELGIRDLLRHLERTGYKFTVFSNLDNTTQLRLLSKEDEIRFWKKNSIKSTLLAIICMLLYMIVPMMWPTIVQDRIFPYKETSFVRGLFYRDILGVIL----------------------ASYIQFSVGFYFYKAAWASLKHGSGTMDTLVCVSTTCAYTFSVFSLVHNMFHPSSTGKLPRIVFDTSIMIISYISIGKYLETLAKSQTSTALSKLIQLTPSVCSIISDVERNETKEIPIELLQVNDIVEIKPGMKIPADGIITRGESEIDESLMTGESILVPKKTGFPVIAGSVNGPGHFYFRTTTVGEETKLANIIKVMKEAQLSKAPIQGYADYLASIFVPGILILAVLTFFIWCFILNISANP-PVAFTANTKADNFF--ICLQTATSVVIVACPCALGLATPTAIMVGTGVGAQNGVLIKGGEVLEKFNSITTFVFDKTGTLTTGFMVVKKFLKDSNWVGNVDEDEVLACIKATESISDHPVSKAIIRY----CD----------------GLNCNKALNAVVL----ESEYVLGKGIVSKCQVNGNTYD------------------ICIGNEALILEDAL----KKSGFINSNVDQGNTVSYVSVNGHVFGLFEINDEVKHDSYATVQYLQRNGYETYMITGDNNSAAKRVAREVGISFENVYSDVSPTGKCDLVKKIQDKEGNNK---------------VAVVGDGINDAPALALSDLGIAISTGTEIAIEAADIVILCGNDLNTNSLRGLANAIDISLKTFKRIKLNLFWALCYNIFMIPIAMGVLIPWGITLPPMLAGLAMA 937          

HSP 2 Score: 93.2041 bits (230), Expect = 1.254e-19
Identity = 53/144 (36.81%), Postives = 85/144 (59.03%), Query Frame = 1
Query:  313 MRIQGMTCSSCVHTIENQVLKLKGVKSALINLLSTIGEVTYDPDLIMASDIADTINDMGFDAEIFQFKE----HTKDIIEVMIQGMTCSSCVYTIESKLAQMQGILSVKVALTTEKGKFKFDPQIISPRDILDAIEEMGFDAKL 732
            + + GMTCS+C +TI  Q+  LKGV    I+L++   +VTYD + + A  I + I D GFD EI +  E     TK+ + + +QGMTC SCV T+  ++  ++G+ SV V+L TE+    ++P   +     + IE+ GFD+ +
Sbjct:    6 LAVHGMTCSACTNTINTQLRALKGVTKCDISLVTNECQVTYDNE-VTADSIKEIIEDCGFDCEILRDSEITAISTKEGL-LSVQGMTCGSCVSTVTKQVEGIEGVESVVVSLVTEECHVIYEPSKTTLETAREMIEDCGFDSNI 147          
BLAST of Copper-transporting ATPase 1 vs. Ensembl Yeast
Match: PCA1 (Cadmium transporting P-type ATPase; may also have a role in copper and iron homeostasis; stabilized by Cd binding, which prevents ubiquitination; S288C and other lab strains contain a G970R mutation which eliminates Cd transport function [Source:SGD;Acc:S000000499])

HSP 1 Score: 266.159 bits (679), Expect = 8.978e-74
Identity = 203/666 (30.48%), Postives = 338/666 (50.75%), Query Frame = 1
Query:  991 VQFYGARYFYVQAYKSIKHGSA-NMDVLVVMATSVSYIYSFIVILVSMILRQDSSPQTFFETTPMLIVFLSLGRWLEHIAKGKTSEALSKLLSLQAFEATIIVNDNQERKISXXXXXXXXXXXXXPGEKIPIDGRVVSGKSRCDESLITGESMSVEKIPGSDVIGGTLNISGMLIIRATLVGEDSALNQIVKLVEEAQTSKAPIQELADKVAGLFVPGVIICSMFTLLIWIAIGYTNPNLLPGHSSINTDNTELIWKYAFQLAITVLSVACPCSLGLATPTAVMVGTGVGAINGILIKGGVPLEKMHQLDVIVFDKTGTITTGKPSVTNFVMCVENVTSQIRNCILLMLGAAESSSEHPIGKAILQYVRETCDINEMPQVVHSKSVSGFGLE----CSLKLQSDMFVPDSEIDNVLVKINDFQENNLTENLKETSVKWRKINEPVEVVLYLGNRNMMKENHISIPDKLDELMSRDEDNGRTVVLMAIDKVLLAMISIADQVKKEAALVVYTLEKMGVEVFLLTGDNHKTATAIAKEIGIR--NVFAEVLPSHKVAKIQQIQNMSKYKRSWLFSCCSKPSKLTNVAMVGDGINDSPALAQADVGIAIGTGTDVAVEAADVVLIRNSLLDVIAAMKLSKDTVRRIRQNFVAATMYNLIGIPIAAGALM 2967
            +QF  A  FY+ A KS+       MD+L+V++TS +YI+S +     ++ R  S+ Q FFET+ +L+  + +GR++  +A+ +  +++S + SLQA  A ++    +E +I++ L++ GD+ KVLP  +IP DG V+SG S  DE+LITGESM V K   S V+ G++N +G L ++ + +  ++ ++ I  +V+EA+ +K  IQ +ADK+A  FVP +I  ++ T  +WIA+G          + I           A   AITVL V+CPC +GLA P   ++ +GV A  G++ K    +E  H    +VFDKTGT+T GK +V +     E V     N   L+LG  E   +HP+  AI  Y++E         V ++K+V+G  +E      LKLQ                                + +W            LG+ N         PD    L     + G +V   +++  + A+ ++ D ++ +A   +  L + G+ + +L+GD+     ++A  +GI   N+ +   P+ K   I+ I               S  SK   V   GDG ND+  L QA +G+ I  G++VA  AADVV+++  L +++  + +S+  + R++ NF+ +  YNL  I +AAGA +
Sbjct:  601 IQFVIAGPFYLNALKSLIFSRLIEMDLLIVLSTSAAYIFSIVSFGYFVVGRPLSTEQ-FFETSSLLVTLIMVGRFVSELARHRAVKSIS-VRSLQASSAILVDKTGKETEINIRLLQYGDIFKVLPDSRIPTDGTVISGSSEVDEALITGESMPVPKKCQSIVVAGSVNGTGTLFVKLSKLPGNNTISTIATMVDEAKLTKPKIQNIADKIASYFVPTIIGITVVTFCVWIAVGIRVEKQSRSDAVIQ----------AIIYAITVLIVSCPCVIGLAVPIVFVIASGVAAKRGVIFKSAESIEVAHNTSHVVFDKTGTLTEGKLTVVH-----ETVRGDRHNSQSLLLGLTE-GIKHPVSMAIASYLKE--KGVSAQNVSNTKAVTGKRVEGTSYSGLKLQGG------------------------------NCRW------------LGHNND--------PDVRKAL-----EQGYSVFCFSVNGSVTAVYALEDSLRADAVSTINLLRQRGISLHILSGDDDGAVRSMAARLGIESSNIRSHATPAEKSEYIKDIVEGRNCDS-------SSQSKRPVVVFCGDGTNDAIGLTQATIGVHINEGSEVAKLAADVVMLKPKLNNILTMITVSQKAMFRVKLNFLWSFTYNLFAILLAAGAFV 1184          
BLAST of Copper-transporting ATPase 1 vs. Ensembl Yeast
Match: PMA1 (Plasma membrane P2-type H+-ATPase; pumps protons out of cell; major regulator of cytoplasmic pH and plasma membrane potential; long-lived protein asymmetrically distributed at plasma membrane between mother cells and buds; accumulates at high levels in mother cells during aging, buds emerge with very low levels of Pma1p, newborn cells have low levels of Pma1p; Hsp30p plays a role in Pma1p regulation; interactions with Std1p appear to propagate [GAR+] [Source:SGD;Acc:S000002976])

HSP 1 Score: 103.605 bits (257), Expect = 6.743e-23
Identity = 144/600 (24.00%), Postives = 255/600 (42.50%), Query Frame = 1
Query: 1210 WLEHIAKGKTSEALSKLLSLQAFEATIIVNDNQERKISXXXXXXXXXXXXXPGEKIPIDGRVVSGKS--RCDESLITGESMSVEKIPGSDVIGGTLNISGMLIIRATLVGEDSALNQIVKLVEEAQTSKAPIQELADKVAGLFVPGVIICSMFTLLIWIAIGYTNPNLLPGHSSINTDNTELIWKYAFQLAITVLSVACPCSLGLATPTAVMVGTGVGAINGILIKGGVPLEKMHQLDVIVFDKTGTITTGKPSVTNFVMCVENVTSQIRNCILLMLGAAESSSEHPIGKAILQYVRETCDINEMPQVVHSKSVSGFGLECSLKLQSDMFVPDSEIDNVLVKINDFQENNLTENLKETSVKWRKINEPVEVVLYLGNRNMMKEN-HISIPDKLDELMSRDEDNGRTVVLMAIDK-----VLLAMISIADQVKKEAALVVYTLEKMGVEVFLLTGDNHKTATAIAKEIGI-----------------------------RNVFAEVLPSHKVAKIQQIQNMSKYKRSWLFSCCSKPSKLTNVAMVGDGINDSPALAQADVGIAIGTGTDVAVEAADVVLIRNSLLDVIAAMKLSKDTVRRI 2898
            +++    G   + L K L+  A    +++ D Q  +I  + V  GD++++  G  IP DGR+V+     + D+S ITGES++V+K  G      +    G   +  T  G+++ + +   LV +A   +    E+ + + G+ +  ++I ++  LL+W A  Y             T+    I +Y   L IT++ V  P  L     T + VG    A    +++    +E +  ++++  DKTGT+T  K S+      VE V+         +  + +      I KA L+ +++       P+   + +          K +   F P    D V  K+    E+   E +    VK      P+ V+  +   + + E+ H +  +K+ EL SR    G   + +A  +      +L ++   D  + + A  V     +G+ V +LTGD    A    +++G+                              + FAEV P HK   ++ +QN     R +L            VAM GDG+ND+P+L +AD GIA+   TD A  AAD+V +   L  +I A+K S+    R+
Sbjct:  159 FVQEFQAGSIVDELKKTLANTA----VVIRDGQLVEIPANEVVPGDILQLEDGTVIPTDGRIVTEDCFLQIDQSAITGESLAVDKHYGDQTFSSSTVKRGEGFMVVTATGDNTFVGRAAALVNKAAGGQGHFTEVLNGI-GIILLVLVIATL--LLVWTACFY------------RTNGIVRILRYT--LGITIIGV--PVGLPAVVTTTMAVGAAYLAKKQAIVQKLSAIESLAGVEILCSDKTGTLTKNKLSLHE-PYTVEGVSPDDLMLTACLAASRKKKGLDAIDKAFLKSLKQ------YPKAKDALT----------KYKVLEFHP---FDPVSKKVTAVVESPEGERI--VCVK----GAPLFVLKTVEEDHPIPEDVHENYENKVAELASR----GFRALGVARKRGEGHWEILGVMPCMDPPRDDTAQTVSEARHLGLRVKMLTGDAVGIAKETCRQLGLGTNIYNAERLGLGGGGDMPGSELADFVENADGFAEVFPQHKYRVVEILQN-----RGYL------------VAMTGDGVNDAPSLKKADTGIAVEGATDAARSAADIVFLAPGLSAIIDALKTSRQIFHRM 688          
BLAST of Copper-transporting ATPase 1 vs. Ensembl Yeast
Match: PMA2 (Plasma membrane H+-ATPase; isoform of Pma1p, involved in pumping protons out of the cell; regulator of cytoplasmic pH and plasma membrane potential [Source:SGD;Acc:S000005957])

HSP 1 Score: 101.293 bits (251), Expect = 4.352e-22
Identity = 144/610 (23.61%), Postives = 261/610 (42.79%), Query Frame = 1
Query: 1180 MLIVFLSLGRWLEHIAKGKTSEALSKLLSLQAFEATIIVNDNQERKISXXXXXXXXXXXXXPGEKIPIDGRVVSGKS--RCDESLITGESMSVEKIPGSDVIGGTLNISGMLIIRATLVGEDSALNQIVKLVEEAQTSKAPIQELADKVAGLFVPGVIICSMFTLLIWIAIGYTNPNLLPGHSSINTDNTELIWKYAFQLAITVLSVACPCSLGLATPTAVMVGTGVGAINGILIKGGVPLEKMHQLDVIVFDKTGTITTGKPSVTNFVMCVENVTSQIRNCILLMLGAAESSSEHPIGKAILQYVRETCDINEMPQVVHSKSVSGFGLECSLKLQSDMFVPDSEIDNVLVKINDFQENNLTENLKETSVKWRKINEPVEVVLYLGNRNMMKEN-HISIPDKLDELMSRDEDNGRTVVLMAIDK-----VLLAMISIADQVKKEAALVVYTLEKMGVEVFLLTGDNHKTATAIAKEIGI-----------------------------RNVFAEVLPSHKVAKIQQIQNMSKYKRSWLFSCCSKPSKLTNVAMVGDGINDSPALAQADVGIAIGTGTDVAVEAADVVLIRNSLLDVIAAMKLSKDTVRRI 2898
            +L++  S+G +++    G   + L K L+  A     ++ D Q  +I  + V  G+++++  G   P DGR+V+     + D+S ITGES++ EK  G +V   +   +G   +  T  G+++ + +   LV +A   +    E+ + + G+ +  ++I ++  LL+W A  Y    ++             I +Y   L IT++ V  P  L     T + VG    A    +++    +E +  ++++  DKTGT+T  K S+      VE V+         +  + +      I KA L+       + E P+   + +          K +   F P    D V  K+    E+   E +    VK      P+ V+  +   + + E+ H +  +K+ EL SR    G   + +A  +      +L ++   D  + + A  +     +G+ + +LTGD    A    +++G+                              + FAEV P HK   ++ +QN     R +L            VAM GDG+ND+P+L +AD GIA+   TD A  AAD+V +   L  +I A+K S+    R+
Sbjct:  179 LLLLNASVG-FIQEFQAGSIVDELKKTLANTA----TVIRDGQLIEIPANEVVPGEILQLESGTIAPADGRIVTEDCFLQIDQSAITGESLAAEKHYGDEVFSSSTVKTGEAFMVVTATGDNTFVGRAAALVGQASGVEGHFTEVLNGI-GIILLVLVIATL--LLVWTACFYRTVGIVS------------ILRYT--LGITIIGV--PVGLPAVVTTTMAVGAAYLAKKQAIVQKLSAIESLAGVEILCSDKTGTLTKNKLSLHE-PYTVEGVSPDDLMLTACLAASRKKKGLDAIDKAFLK------SLIEYPKAKDALT----------KYKVLEFHP---FDPVSKKVTAVVESPEGERI--VCVK----GAPLFVLKTVEEDHPIPEDVHENYENKVAELASR----GFRALGVARKRGEGHWEILGVMPCMDPPRDDTAQTINEARNLGLRIKMLTGDAVGIAKETCRQLGLGTNIYNAERLGLGGGGDMPGSELADFVENADGFAEVFPQHKYRVVEILQN-----RGYL------------VAMTGDGVNDAPSLKKADTGIAVEGATDAARSAADIVFLAPGLSAIIDALKTSRQIFHRM 717          
BLAST of Copper-transporting ATPase 1 vs. Ensembl Yeast
Match: ENA5 (Protein with similarity to P-type ATPase sodium pumps; member of the Na+ efflux ATPase family [Source:SGD;Acc:S000002445])

HSP 1 Score: 81.2629 bits (199), Expect = 6.994e-16
Identity = 65/204 (31.86%), Postives = 102/204 (50.00%), Query Frame = 1
Query: 2437 DKVLLAMISIADQVKKEAALVVYTLEKMGVEVFLLTGDNHKTATAIAKEIGIRNV----FAEVLPSHKVAKIQQIQNMSKYKRSWL------FSCCSKPSKLTNV----------AMVGDGINDSPALAQADVGIAIG-TGTDVAVEAADVVLIRNSLLDVIAAMKLSKDTVRRIRQNFVAATMYNLIGIPIAAGALMPIGVVF 2985
            D V L +I I D  + E A  V    + G+ V +LTGD   TA AIA+E+GI       +++ +    V    Q   +S+ +   L       + CS  +K+  +          AM GDG+NDSP+L  A+VGIA+G  G+DV+ EA+D+VL  ++   ++ A++  +     I Q FV      L+   +A    + IG+VF
Sbjct:  638 DLVFLGLIGIYDPPRNETAGAVKKFHQAGINVHMLTGDFVGTAKAIAQEVGILPTNLYHYSQEIVDSMVMTGSQFDGLSEEEVDDLPVLPLVIARCSPQTKVRMIEALHRRKKFCAMTGDGVNDSPSLKMANVGIAMGINGSDVSKEASDIVLSDDNFASILNAVEEGRRMTDNI-QKFV----LQLLAENVAQALYLIIGLVF 836          
BLAST of Copper-transporting ATPase 1 vs. Ensembl Nematostella
Match: EDO47080 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RN63])

HSP 1 Score: 790.415 bits (2040), Expect = 0.000e+0
Identity = 451/1004 (44.92%), Postives = 636/1004 (63.35%), Query Frame = 1
Query:  145 DNIKTVVIDYEKNLVRICCHNDNCTYLTLCEAIENLGF----LIN-----------------------KNKETDNTKELFKCHMRIQGMTCSSCVHTIENQVLKLKGVKSALINLLSTIGEVTYDPDLIMASDIADTINDMGFDAEIFQFKEHTKDIIEVMIQGMTCSSCVYTIESKLAQMQGILSVKVALTTEKGKFKFDPQIISPRDILDAIEEMGFDAKLAPKKTNKYN-DHVGESIKKWKHSFLISLIFGVPTMIVMM--VFMYGFSHRMQVIHLKNGINVTVMVSNAPIXXXXXXXXXXXXXXXXXPVQFYGARYFYVQAYKSIKHGSANMDVLVVMATSVSYIYSFIVILVSMILRQDSSPQTFFETTPMLIVFLSLGRWLEHIAKGKTSEALSKLLSLQAFEATIIV------NDNQERKISXXXXXXXXXXXXXPGEKIPIDGRVVSGKSRCDESLITGESMSVEKIPGSDVIGGTLNISGMLIIRATLVGEDSALNQIVKLVEEAQTSKAPIQELADKVAGLFVPGVIICSMFTLLIWIAIGYTNPNLLPGHSSINTDNT-ELIWKYAFQLAITVLSVACPCSLGLATPTAVMVGTGVGAINGILIKGGVPLEKMHQLDVIVFDKTGTITTGKPSVTNFVMCVENVTSQIRNCILLMLGAAESSSEHPIGKAILQYVRETCDINEMPQVVHSKSVSGFGLECSLKLQSDMFV----------PDSEIDNVLVKINDFQENNLTENLKETSVKWRKINEPVEVVLYLGNRNMMKENHISIPDKLDELMSRDEDNGRTVVLMAIDKVLLAMISIADQVKKEAALVVYTLEKMGVEVFLLTGDNHKTATAIAKEIGIRNVFAEVLPSHKVAKIQQIQNMSKYKRSWLFSCCSKPSKLTNVAMVGDGINDSPALAQADVGIAIGTGTDVAVEAADVVLIRNSLLDVIAAMKLSKDTVRRIRQNFVAATMYNLIGIPIAAGALMPIGVVFMPWMASVAMA 3015
            D +++V +  +    R+    +  T   + EAIE++GF    L N                       K+ E D  +++ K ++ I+GMTC+SCV +IE  + K +GVKS L+ LL+   EV Y+ + I   +I   +  MGF  E+       ++++++ I GMTCSSCV+ IES L +  GIL   VAL T  G+FK+D +I  PRDI++AI+ +GF A LA   ++K   DH   SIKKW+ SFL+SLIFG+P   + +  VF+     R  V+ +  G+++  ++                +FL  +PVQ  G R+FYV AYK++KH S NMDVL+++AT+++Y+YS +V +V+M  +   SP TFF+T PML+VF+SLGRW+EH+AKGKTSEAL+KLLSLQ   A ++          +E  ISVDLV++ D++KV+PG KIP+DGRV+ G S  DESLITGESM V K  G  VIGGT+N +G ++I AT VG+D+ L QIVKLVEEAQTSKAPIQ+ AD ++G FVP VI+ S+ T +IW+ IGY++  ++    +   DN  E I  +AFQ+ ITVL++ACPC+LGLATPTAVMVGTG+GA NGILIKGG PLE  H++  +VFDKTGT+T GKP V    + V      ++  +L + G AE+SSEHP+G AI  Y ++      +      K+  G+GL C++    D+ +           DS   N+++ ++     +  +   ++++   ++ +  +V+  +GNR+ M++N + + D+++E M   E  G T +L+ I   L+ M+++AD VK EA + V TL++MG+ V LLTGDN KTA AIA+++GI+ VFAEVLPSHKV KI+ +Q                 +K    AMVGDGINDSPALAQA VGIAIGTGTDVAVEAAD+VLI++ L+DV AA+ LS+ TVRRI  NF  A +YN+IGIP AAG   P+GVV  PWMAS AMA
Sbjct:  192 DGVQSVKVSLDDKCARLEFAPEKVTPEQMREAIEDMGFDALLLGNVDEFVAVAGQMTGDWGVRFSSRKKHVEQDPLEDVEKIYLHIEGMTCASCVASIERALSKKEGVKSVLVGLLAQKAEVKYNKNRITTDEIVYHVTAMGFGCELMDKTGQGENVVDIRISGMTCSSCVHLIESSLIKRPGILQTSVALATSSGRFKYDTEITGPRDIIEAIKGLGFGAALADSSSSKDKVDHT-LSIKKWRRSFLVSLIFGLPVFAIFISYVFLEEAGKRPHVMVIP-GLSLENLL----------------MFLLCTPVQILGGRHFYVTAYKALKHRSTNMDVLIMLATTIAYVYSIVVCVVAMSEQSSHSPMTFFDTPPMLLVFISLGRWMEHVAKGKTSEALAKLLSLQPATAMLVKLKPGSHQITEETVISVDLVQRADVLKVVPGAKIPVDGRVIEGTSMADESLITGESMPVPKKVGDSVIGGTMNQNGAILIEATHVGQDTTLAQIVKLVEEAQTSKAPIQKFADTLSGYFVPIVILISIATFMIWVIIGYSDITIIRMVYNPKEDNRDEFIIGFAFQIGITVLAIACPCALGLATPTAVMVGTGIGAQNGILIKGGEPLETAHKVTAVVFDKTGTLTHGKPEVVKTALFVSPDICDLQ-LLLAVAGTAENSSEHPLGVAITTYAKKELSTENLGICSGFKAQPGYGLTCTVSGVEDLLLEPNQRQSKTSKDSTQGNLILPVDGSIARDFVKADLDSTIYDCRLGKQYKVL--IGNRDWMQQNGLVVTDEMEEDMVAHETIGHTAILIGIRDSLVGMMAVADTVKNEAQVAVSTLKRMGLRVVLLTGDNKKTAMAIARQVGIQQVFAEVLPSHKVEKIRALQ-----------------AKGFVTAMVGDGINDSPALAQAHVGIAIGTGTDVAVEAADIVLIKSDLMDVAAAIDLSRVTVRRIHLNFAFALLYNMIGIPFAAGVFEPLGVVMKPWMASAAMA 1157          

HSP 2 Score: 101.293 bits (251), Expect = 1.237e-21
Identity = 68/228 (29.82%), Postives = 111/228 (48.68%), Query Frame = 1
Query:  112 LKIIEDFFQFNDNIKTVVIDYEKNLVRICCHNDNCTYLTLCEAIENLGF---------LINKN----------KETDNTKELFKCHMRIQGMTCSSCVHTIENQVLKLKGVKSALINLLSTIGEVTYDPDLIMASDIADTINDMGFDAEIFQFKEHTKDIIEVMI--QGMTCSSCVYTIESKLAQMQGILSVKVALTTEKGKFKFDPQIISPRDILDAIEEMGFDAKL 732
            +K IE        +K + +  E+    +          +L  AI+++GF         ++ K           K  D  +E  +    + GMTC SCV +IE  + K  GV +  ++L      + Y   L     +A+ I D GF  E+   +  + D+  VMI  QGMTC+SCV TIE  ++++ G+ SVKV+L  +  + +F P+ ++P  + +AIE+MGFDA L
Sbjct:   10 VKTIETSMSSTSGVKNIKVSLEEKEAEVTFDPKITNGTSLANAIDDMGFEACLKRVVDILTKQEVAQSKGTSIKNADEREE--EIEFTVHGMTCQSCVKSIEKALSKSTGVLNVKVSLPKESAVIKYRKLLTSPEKLAELIEDAGF--EVVLPRSGSTDVKSVMITVQGMTCNSCVNTIEKNISKLDGVQSVKVSLDDKCARLEFAPEKVTPEQMREAIEDMGFDALL 233          

HSP 3 Score: 100.523 bits (249), Expect = 2.205e-21
Identity = 56/157 (35.67%), Postives = 87/157 (55.41%), Query Frame = 1
Query:  319 IQGMTCSSCVHTIENQVLKLKGVKSALINLLSTIGEVTYDPDLIMASDIADTINDMGFDA------------EIFQFK-------EHTKDIIEVMIQGMTCSSCVYTIESKLAQMQGILSVKVALTTEKGKFKFDPQIISPRDILDAIEEMGFDAKL 732
            ++GMTC+SCV TIE  +    GVK+  ++L     EVT+DP +   + +A+ I+DMGF+A            E+ Q K       +  ++ IE  + GMTC SCV +IE  L++  G+L+VKV+L  E    K+   + SP  + + IE+ GF+  L
Sbjct:    1 MEGMTCNSCVKTIETSMSSTSGVKNIKVSLEEKEAEVTFDPKITNGTSLANAIDDMGFEACLKRVVDILTKQEVAQSKGTSIKNADEREEEIEFTVHGMTCQSCVKSIEKALSKSTGVLNVKVSLPKESAVIKYRKLLTSPEKLAELIEDAGFEVVL 157          
BLAST of Copper-transporting ATPase 1 vs. Ensembl Nematostella
Match: EDO43417 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RYT4])

HSP 1 Score: 205.682 bits (522), Expect = 1.732e-55
Identity = 161/537 (29.98%), Postives = 261/537 (48.60%), Query Frame = 1
Query: 1363 PGEKIPIDGRVVSGKSRCDESLITGESMSVEKIPGSDVIGGTLNISGMLIIRATLVGEDSALNQIVKLVEEAQTSKAPIQELADKVAGLFVPGVIICSMFTLLIWIAIGYTNPNLLPGHSSINTDNTELI-WKYAFQLAITVLSVACPCSLGLATPTAVMVGTGVGAINGILIKGGVPLEKMHQLDVIVFDKTGTITTGKPSVTNFVMCVENVTSQIRNCILLMLGAAESSSEHPIGKAILQYVRETCDINEMPQVVHSKSVSGFGLECSLKLQSDMF-VPDSEIDNVLVKINDFQENNLTENLKETSVKWRKINEPVEVVLYLGNRNMMKENHISIPDKLDELMSRD--------EDNGRTVVLMAIDKVLLAMISIADQVKKEAALVVYTLEKMGVEVFLLTGDNHKTATAIAKEIGIRNVFAEVLPSHKVAKIQQIQNMSKYKRSWLFSCCSKPSKL--TNVAMVGDGINDSPALAQADVGIAIGT-GTDVAVEAADVVLIRNSLLDVIAAMKLSKDTVRRIRQNFVAATMYNL 2934
            PG+ IP+DG VV G++  DES ITGE + VEK   S V  GT++ +G L I+ T    +S ++++ ++V+EAQ+S    +++ +  A  + P V++ S   + I        P +L G + + T   +L  W +    A+ +L VACPC+L + +P AV+      A  G LIK G  LE + +L+V+ FDKTGT+T GK  VT+     E+V       +L +    ES S HPI  AI         +NE    V S             ++S++F +P+                          VK  K++E   +   +  + ++  NH  + D+  E +            +  +TVV ++++  +  M+++AD ++      +  L   G++  ++TGDN +TA A+ + +G+    AE+ PS K+                   CC +   +   +V MVGDG+ND PALA AD+GIA+G  GT +AVEAADV L+ N+L  +   + L K     I QN   + +  L
Sbjct:  206 PGDLIPLDGIVVKGRASVDESSITGECLPVEKKVDSKVFSGTVDQNGYLEIKTTTDSSNSTVSRVAEMVQEAQSSSTRTEQIINHFAKYYTPLVVVTSALVIAI--------PAIL-GVAGVGTYQQDLHEWGHK---ALVLLVVACPCALVMTSPIAVVCSITAAARRGSLIKKGEHLETLAKLEVLAFDKTGTLTEGKFQVTDM----ESVYGVNEREVLRLAAGIESKSSHPIAAAI---------VNEFSGCVGS------------MVKSNVFSIPE--------------------------VKKFKLHEGKGISGIVEGKKVLVGNHSLVTDQCGEKLGSSMTDKYIQWSNESKTVVFVSVNSKVQLMVALADSIRPNTIDALDWLRHHGIQTSMITGDNARTAAAVKESLGLDECTAEMKPSDKLDP---------------HFCCVRRRNVGRVSVGMVGDGVNDGPALAAADLGIAMGAGGTALAVEAADVTLMSNNLAKIPELVSLGKFCRTIITQNIALSVVLKL 664          
BLAST of Copper-transporting ATPase 1 vs. Ensembl Nematostella
Match: EDO28080 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T7H1])

HSP 1 Score: 92.4337 bits (228), Expect = 3.571e-20
Identity = 93/393 (23.66%), Postives = 164/393 (41.73%), Query Frame = 1
Query: 1870 ILIKGGVPLEKMHQLDVIVFDKTGTITTGKPSVTNFVMCVENVTSQIRNCILLMLGAAESSSEHPIGKAILQYVRETCDINEMPQVVHSKSVSGFGLECSLKLQSDMFVPDSEIDNVLVKINDFQENNLTENLKETSVKWRKINEPVEVVLYLGNRNMMKENHISIPDKLDELMSRDEDNGRTVVLMAIDKVLLAMISIADQVKKEAALVVYTLEKMGVEVFLLTGDNHKTATAIAKEIGIRN--VFAEVLPSHKVAKIQQIQNMSKYKRSWLFSCCSKPSKLTNVAMVGDGINDSPALAQADVGIAIGTGTDVAVEAADVVLIRNSLLDVIAAMKLSKDTVRRIRQNFVAATMYNLIGIPIA-AGALMPIGVVFMPWMASVAMAASSICVVC 3039
            + +K    +E++ ++D IVFDKTGTIT+ K S  +F         ++ N  L  + +    S HP+ + I  Y+ +     E  +V     ++G G+E  +                                              EV   +G+ ++     +S+P+        +E + +T V + I+          +Q +K    +   L K   E+ +L+GDN      + +E+   N  +  +  P  K+  I+Q+Q   K                 NV M+GDG+ND+ ALAQ++VGI+I    +V   A D ++  +    +   +  SK+ +R I  +F  + +YNL+G+  A  G L P+       +A++ M  SSI VV 
Sbjct:    1 MYLKNATVIEQLAKVDTIVFDKTGTITSNKKSSVDFY------GEELTNSELKQIKSVIRGSNHPLSRKIYDYLPDF----EKVEVSQFNEITGKGIEAKIG---------------------------------------------EVFFQIGSSSL-----VSVPN--------EESSKQTKVHVRINGNYKGYYFFDNQYRKGVEALFEKLSKH-YELKILSGDNDGEKETL-QELLPENTELIFDRKPEQKLEYIEQLQKQGK-----------------NVMMIGDGLNDAGALAQSNVGISISENVNVFSPACDGIMDASQFSKIGYYLNFSKNAMRTIYMSFGLSLLYNLVGLSFAITGNLSPL-------IAAIIMPLSSITVVS 299          
BLAST of Copper-transporting ATPase 1 vs. Ensembl Nematostella
Match: EDO35616 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SL15])

HSP 1 Score: 75.0998 bits (183), Expect = 1.287e-13
Identity = 57/183 (31.15%), Postives = 89/183 (48.63%), Query Frame = 1
Query: 2449 LAMISIADQVKKEAALVVYTLEKMGVEVFLLTGDNHKTATAIAKEIGIR---------------------------NVFAEVLPSHKVAKIQQIQNMSKYKRSWLFSCCSKPSKLTNVAMVGDGINDSPALAQADVGIAIG-TGTDVAVEAADVVLIRNSLLDVIAAMKLSKDTVRRIRQNFV 2913
            L ++ + D  +      V TL   GV+V ++TGD+ +TA  IA+ +GI                            +VF  V P HKVA ++ +Q                      VAM GDG+ND+ AL +AD+GIA+G +GTDV+ EAA+++L+ +    ++AA++  K     I+ NFV
Sbjct:  530 LGIMGLLDPPRNGVREAVRTLLDSGVQVKMITGDSRETAITIAELLGIHFKGRPTLSGEELEALDGLQLSTIIDQVSVFYRVSPRHKVAIVKALQQHGHV-----------------VAMTGDGVNDAVALKRADIGIAMGKSGTDVSKEAAEMILVDDDFNTIMAAIEEGKGIFYNIK-NFV 694          
BLAST of Copper-transporting ATPase 1 vs. Ensembl Nematostella
Match: EDO36455 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SII2])

HSP 1 Score: 72.0182 bits (175), Expect = 1.347e-12
Identity = 63/225 (28.00%), Postives = 104/225 (46.22%), Query Frame = 1
Query: 2446 LLAMISIADQVKKEAALVVYTLEKMGVEVFLLTGDNHKTATAIAKEIGIRNVFAEV---------LPSHKVAKIQ-----------------QIQNMSKYKRSWLFSCCSKPSKL----------TNVAMVGDGINDSPALAQADVGIAIG-TGTDVAVEAADVVLIRNSLLDVIAAMKLSKDTVRRIRQNFVAATMYNLIG-IP--------IAAGALMPIGVV 2982
             + ++S+ D  +      V      G++VF++TGD+  TA AIA+ +GI +   E          +P  +V K Q                  I ++ K  +  +F+  S   KL            VA+ GDG+NDSPAL +AD+GIA+G +G+DV+ +AAD++L+ ++   ++  ++      R I  N   +  Y L   IP        I AG   P+G +
Sbjct:  621 FVGLMSMIDPPRAAVPDAVAKCRSAGIKVFMVTGDHPITAKAIAQGVGIISEGTETVEDISLRLEIPVEEVDKSQADAIVVHGGELKDMTDKDIDDILKNHKEIVFARTSPQQKLIIVEGCQRNGAIVAVTGDGVNDSPALKKADIGIAMGISGSDVSKQAADMILLDDNFASIVTGVEEG----RLIFDNLKKSIAYTLTSNIPEITPFLMFIVAGIPQPLGTI 841          
BLAST of Copper-transporting ATPase 1 vs. Ensembl Medaka
Match: atp7b (copper-transporting ATPase 2 [Source:NCBI gene;Acc:101171807])

HSP 1 Score: 820.846 bits (2119), Expect = 0.000e+0
Identity = 456/917 (49.73%), Postives = 624/917 (68.05%), Query Frame = 1
Query:  295 ELFKCHMRIQGMTCSSCVHTIENQVLKLKGVKSALINLLSTIGEVTYDPDLIMASDIADTINDMGFDAEIFQ--FKEHTKDIIEVMIQGMTCSSCVYTIESKLAQMQGILSVKVALTTEKGKFKFDPQIISPRDILDAIEEMGFDAKLAPKKTNKYNDHVGESIKKWKHSFLISLIFGVPTMIVMMVFMYGFSHRMQVIHLKNGINVTVMVSNAPIXXXXXXXXXXXXXXXXXPVQFYGARYFYVQAYKSIKHGSANMDVLVVMATSVSYIYSFIVILVSMILRQDSSPQTFFETTPMLIVFLSLGRWLEHIAKGKTSEALSKLLSLQAFEATIIV--NDNQ---ERKISXXXXXXXXXXXXXPGEKIPIDGRVVSGKSRCDESLITGESMSVEKIPGSDVIGGTLNISGMLIIRATLVGEDSALNQIVKLVEEAQTSKAPIQELADKVAGLFVPGVIICSMFTLLIWIAIGYTNPNL----LPGHSSINTDNTELIWKYAFQLAITVLSVACPCSLGLATPTAVMVGTGVGAINGILIKGGVPLEKMHQLDVIVFDKTGTITTGKPSVTNFVMCVENVTSQIRNCILLMLGAAESSSEHPIGKAILQYVRETCDINEMPQVVHSKSVSGFGLECSLKLQSDMFVPDSEIDNVLVKINDFQENNLTENLKETSVKWRKINEP----VEVVLYLGNRNMMKENHISIPDKLDELMSRDEDNGRTVVLMAIDKVLLAMISIADQVKKEAALVVYTLEKMGVEVFLLTGDNHKTATAIAKEIGIRNVFAEVLPSHKVAKIQQIQNMSKYKRSWLFSCCSKPSKLTNVAMVGDGINDSPALAQADVGIAIGTGTDVAVEAADVVLIRNSLLDVIAAMKLSKDTVRRIRQNFVAATMYNLIGIPIAAGALMPIGVVFMPWMA 3000
            E+ KC + + GMTC+SCV  IE  +LK +G+ S L++L++   EV YD  ++ A  +A  I D+GF A++ +    EH K  +++ I GMTC+SCV+ IESKL   +GIL   VAL T K   +FD +I+ PRDI+  I+ +GF+A L  K      DH  E I++W++SFL SL+FG+P M +M+  M      M  +H ++G ++    + AP    GLSL NL+ FL  +PVQ +G RYFY+QAY+S+KH +ANMDVL+V+AT+++Y+YS +V++++M+ R   SP TFF+T PML VF+SLGRWLEH+AK KTSEAL+KL+SLQA +AT++    D+    E ++ V+LV++GD+VK++PG K PIDG+V+ G S  DESLITGE M V K  GS VI G++N  G L++ AT VG ++ L+QIVKLVEEAQTSKAPIQ+ AD+++G FVP ++  S+ TL+ W+ IG+ N  +     PG++  N    E+I ++AFQ +ITVLS+ACPCSLGLATPTAVMVGTGVGA NGILIKGG PLE  H+++V++FDKTGTIT G P VT  ++  E     +R  IL ++G AE+SSEHP+G A+ ++ ++    + M      ++V G G+ C +          S +D++L + +       T+   E+S+   +   P        + +GNR  M+ N + I   +D  MS  E  G+T VL+AID VL AMI+IAD VK E+AL V+TL  MGVEV ++TGDN  TA AIA ++GIR VFAEVLPSHKVAK+Q++Q                  +   VAMVGDGINDSPALA ADVGIAIGTGTDVA+EAAD+VLIRN+LLDV+A+++LSK TVRRIR NFV A +YNL+GIPIAAG  MP+G+V  PWM 
Sbjct:  354 EIKKCFVLVAGMTCTSCVANIEKNILKHRGIVSVLVSLMAGKAEVKYDAGVLSAPAVAQLIQDLGFGAKLIEDHAGEHGK--LDLTITGMTCASCVHKIESKLVATKGILVASVALATRKAHIQFDSEILGPRDIIRIIQSLGFEASLEKKGFKNNVDHT-EEIRQWRNSFLFSLVFGLPVMGLMVYMMV-----MDTLHQEHGGSMPEDQNVAP----GLSLLNLIFFLLCTPVQIFGGRYFYIQAYRSLKHHTANMDVLIVLATTIAYVYSCLVLVIAMVERASQSPVTFFDTPPMLFVFISLGRWLEHVAKRKTSEALAKLMSLQATDATVVTVGPDHSIISEEQVMVELVQRGDVVKIVPGGKFPIDGKVIEGSSMADESLITGEPMPVSKTVGSLVIAGSINAHGSLLVEATHVGAETTLSQIVKLVEEAQTSKAPIQQFADRISGYFVPFIVFVSLATLVAWLVIGFVNFTIVTENFPGYNQ-NISKAEVIIRFAFQASITVLSIACPCSLGLATPTAVMVGTGVGAQNGILIKGGEPLEMAHKINVVMFDKTGTITNGVPQVTRVLVLWETARMPLRQ-ILAVVGTAEASSEHPLGVAVTKHCKDELGSDAMGFCQDFQAVPGCGISCRV----------SNVDHLLQQQSFLLPGATTD---ESSLLAAQEAPPTVGGASYSVLIGNREWMRRNGLHIKADVDAAMSSHETKGQTAVLVAIDGVLCAMIAIADTVKPESALAVHTLNSMGVEVVMVTGDNRCTAKAIAAQVGIRKVFAEVLPSHKVAKVQELQE-----------------RGLRVAMVGDGINDSPALACADVGIAIGTGTDVAIEAADIVLIRNNLLDVVASIELSKKTVRRIRINFVFALIYNLLGIPIAAGVFMPVGLVLQPWMG 1226          

HSP 2 Score: 111.694 bits (278), Expect = 2.816e-24
Identity = 57/175 (32.57%), Postives = 91/175 (52.00%), Query Frame = 1
Query:  310 HMRIQGMTCSSCVHTIENQVLKLKGVKSALINLLSTIGEVTYDPDLIMASDIADTINDMGFDAEIFQFKEHTKDII-------------EVMIQGMTCSSCVYTIESKLAQMQGILSVKVALTTEKGKFKFDPQIISPRDILDAIEEMGFDAKLAPKKTNKYNDHVGESIKKWKH 795
             M++ GM C SCV +IE ++ +L GV    ++L     EV + P +I   ++ D I DMGF A +   +  + D+               + I GM+CSSCV +IE +++Q +G+ S+ V+L  EK    FDP +  P  +  AIE+MGFDA L   + +  N     S+  ++ 
Sbjct:  157 QMKVDGMHCRSCVESIERRIRELPGVVQIRVSLEEAKAEVMFQPLVITQQELQDQIEDMGFSATLMLKETSSGDLTFVQRDLNMSIQNTTIWIAGMSCSSCVQSIEGRISQTRGVKSIVVSLKEEKATISFDPGLTEPEQLRAAIEDMGFDASLKEPERSIQNQEKSRSVDFYQQ 331          

HSP 3 Score: 67.0106 bits (162), Expect = 1.026e-10
Identity = 37/138 (26.81%), Postives = 71/138 (51.45%), Query Frame = 1
Query:  337 SSCVHTIENQVLKLKGVKSALINLLSTIGEVTYDPDLIMASDIADTINDMGFDAEIFQFKEHTKDIIEVMIQGMTCSSCVYTIESKLAQMQGILSVKVALTTEKGKFKFDPQIISPRDILDAIEEMGFDAKLAPKKTN 750
            S+ +  +E  +  L GV +    +   + +V YD       +IA  +  +G   E           +++ + GM C SCV +IE ++ ++ G++ ++V+L   K +  F P +I+ +++ D IE+MGF A L  K+T+
Sbjct:   99 STALEAVETTLPALDGVLAVTWLVPDALVQVDYDSSATTTKEIAMQLQALGCTVEA---------AVQMKVDGMHCRSCVESIERRIRELPGVVQIRVSLEEAKAEVMFQPLVITQQELQDQIEDMGFSATLMLKETS 227          

HSP 4 Score: 58.5362 bits (140), Expect = 4.009e-8
Identity = 34/107 (31.78%), Postives = 60/107 (56.07%), Query Frame = 1
Query:  229 LCEAIENLGFLINKNKETDNTKELFKCHMRIQGMTCSSCVHTIENQVLKLKGVKSALINLLSTIGEVTYDPDLIMASDIADTINDMGFDAEIFQ--FK---EHTKDI 534
            + + I++LGF        D+  E  K  + I GMTC+SCVH IE++++  KG+  A + L +    + +D +++   DI   I  +GF+A + +  FK   +HT++I
Sbjct:  410 VAQLIQDLGF--GAKLIEDHAGEHGKLDLTITGMTCASCVHKIESKLVATKGILVASVALATRKAHIQFDSEILGPRDIIRIIQSLGFEASLEKKGFKNNVDHTEEI 514          
BLAST of Copper-transporting ATPase 1 vs. Ensembl Medaka
Match: atp7a (copper-transporting ATPase 1 [Source:NCBI gene;Acc:101164902])

HSP 1 Score: 814.298 bits (2102), Expect = 0.000e+0
Identity = 465/930 (50.00%), Postives = 625/930 (67.20%), Query Frame = 1
Query:  304 KCHMRIQGMTCSSCVHTIENQVLKLKGVKSALINLLSTIGEVTYDPDLIMASDIADTINDMGFDAEIFQFKEHTKDIIEVMIQGMTCSSCVYTIESKLAQMQGILSVKVALTTEKGKFKFDPQIISPRDILDAIEEMGFDAKLAPK-KTNKYNDHVGESIKKWKHSFLISLIFGVPTMIVMMV------FMYGFSHRMQVIHLKNGINVTVMVSNAPIXXXXXXXXXXXXXXXXXPVQFYGARYFYVQAYKSIKHGSANMDVLVVMATSVSYIYSFIVILVSMILRQDSSPQTFFETTPMLIVFLSLGRWLEHIAKGKTSEALSKLLSLQAFEATIIV--NDN---QERKISXXXXXXXXXXXXXPGEKIPIDGRVVSGKSRCDESLITGESMSVEKIPGSDVIGGTLNISGMLIIRATLVGEDSALNQIVKLVEEAQTSKAPIQELADKVAGLFVPGVIICSMFTLLIWIAIGYTNPNLL----PGHSSINTDNTELIWKYAFQLAITVLSVACPCSLGLATPTAVMVGTGVGAINGILIKGGVPLEKMHQLDVIVFDKTGTITTGKPSVTNFVMCVENVTSQIRNCILLMLGAAESSSEHPIGKAILQYVRETCDINEMPQVVHSKSVSGFGLECSLK------LQSDMFVPDSEIDN----VLVKINDFQENNLTENLKETSVKWRKINEPVEVVLYLGNRNMMKENHISIPDKLDELMSRDEDNGRTVVLMAIDKVLLAMISIADQVKKEAALVVYTLEKMGVEVFLLTGDNHKTATAIAKEIGIRNVFAEVLPSHKVAKIQQIQNMSKYKRSWLFSCCSKPSKLTNVAMVGDGINDSPALAQADVGIAIGTGTDVAVEAADVVLIRNSLLDVIAAMKLSKDTVRRIRQNFVAATMYNLIGIPIAAGALMPIGVVFMPWMASVAMA 3015
            KC+++I GMTC+SCV  IE  +    G+   L+ L+++  EV Y+P++I    I + + ++GF A + +  E +   +E++I+GMTC+SCV+ IES L + +GI    VAL T K   KFD +++ PRDI+  IE +GF A L  + ++  + DH  E I++W+ SFLISLIF VP M +M+        M    H    +  +N  + T+ +     LFPGLS+ NLL F+F  PVQF G RYFY+QAYK++KH SANMDVL+V+ATSV++ YS +V++V+M+ R   +P TFF+T PML VF+SLGRWLE IAK KTSEALSKL+SLQA EAT++   +DN    E ++ V+LV++GD+VKV+PG K P+DGRV+ G S  DESLITGE+M V K PGS VI G++N +G L++ AT VG D+ L+QIVKLVEEAQTSKAPIQ+ ADK++G FVP ++  S+ TL++WI IG+ + +L+    PG++  +   +E + ++AFQ +ITVL +ACPCSLGLATPTAVMVGTGVGA NGILIKGG PLE  H++  +VFDKTGTIT G P V      VE     +   +L ++G AE++SEHP+G AI +Y ++      +      ++V G G+ C +        Q D    DSE +N    VLV+I+D + ++ +  L             + VVL +GNR  M+ N + I  ++DE M   E  GRT VL+A++ +L AMI+I+D VK EA L V TL  MG+EV L+TGDN KTA  IA ++GIR VFAEVLPSHKVAK++Q+Q   K                  VAMVGDG+NDSPALA ADVGIAIGTGTDVA+EAADVVLIRN LLDV+ ++ LSK TV+RIR NFV A +YNL+GIPIAAG  +PIG+V  PWM S AMA
Sbjct:  482 KCYIQIGGMTCASCVSNIERNLKNEPGIYFVLVALMASKAEVRYNPEVIDPPKIVECVKELGFTASVMENYEGSNGNLELVIRGMTCASCVHKIESNLMKEKGIEYASVALATNKAHVKFDSEVLGPRDIIKLIENLGFKASLVKRDRSASHLDHSKE-IRQWRKSFLISLIFCVPVMGMMIYMMVMDHHMNASHHHNATVEDRNHYHSTMFLERQ--LFPGLSIMNLLSFIFCVPVQFIGGRYFYIQAYKALKHKSANMDVLIVLATSVAFSYSLVVLIVAMVERAKVNPITFFDTPPMLFVFISLGRWLEQIAKSKTSEALSKLMSLQATEATVVTLGSDNVILSEEQVDVELVQRGDVVKVVPGGKFPVDGRVLEGHSMADESLITGEAMPVTKKPGSTVIAGSINQNGSLLVSATHVGMDTTLSQIVKLVEEAQTSKAPIQQYADKISGYFVPFIVAVSLLTLIVWIIIGFLDFSLVKKYFPGYNE-SISRSETVIRFAFQASITVLCIACPCSLGLATPTAVMVGTGVGAQNGILIKGGEPLEMAHKVQAVVFDKTGTITYGAPKVVQVKTVVEGNKMPLSR-LLAIVGTAENNSEHPLGAAITKYCKQELGTESLGTCTDFQAVPGCGVRCQVSNTETVVKQGD---SDSEDNNHRNSVLVQISDTRTSSSSHPLIMDPQPLSSGPTDLYVVL-IGNREWMRRNFLEITAEIDEAMMEHERRGRTAVLVAVNNMLCAMIAISDTVKPEAELAVQTLTNMGLEVVLMTGDNSKTARVIAAQVGIRKVFAEVLPSHKVAKVEQLQQAGKI-----------------VAMVGDGVNDSPALAMADVGIAIGTGTDVAIEAADVVLIRNDLLDVVGSIDLSKKTVKRIRINFVFALIYNLVGIPIAAGVFLPIGLVLQPWMGSAAMA 1385          

HSP 2 Score: 97.4413 bits (241), Expect = 5.672e-20
Identity = 57/172 (33.14%), Postives = 86/172 (50.00%), Query Frame = 1
Query:  310 HMRIQGMTCSSCVHTIENQVLKLKGVKSALINLLSTIGEVTYDPDLIMASDIADTINDMGFDAEI------------------------FQFKEHTKDIIE-------VMIQGMTCSSCVYTIESKLAQMQGILSVKVALTTEKGKFKFDPQIISPRDILDAIEEMGFDAKL 732
            ++ I+GMTC+SCV +IE  + + KGV SA ++L    G   YDP L    ++ + + DMGFDA +                        F  KE  +   E       + I GMTC+SCV  IE  L    GI  V VAL   K + +++P++I P  I++ ++E+GF A +
Sbjct:  377 NIHIEGMTCNSCVQSIEGMISQRKGVVSAQVSLADHQGIFEYDPLLTSPQELREAVEDMGFDAFLPETNSLLEPNITTSASTAPDQGKEFDPKEAHRGSTEGTHSKCYIQIGGMTCASCVSNIERNLKNEPGIYFVLVALMASKAEVRYNPEVIDPPKIVECVKELGFTASV 548          

HSP 3 Score: 87.8113 bits (216), Expect = 5.668e-17
Identity = 50/167 (29.94%), Postives = 85/167 (50.90%), Query Frame = 1
Query:  319 IQGMTCSSCVHTIENQVLKLKGVKSALINLLSTIGEVTYDPDLIMASDIADTINDM---GFDAE-----------------IFQ---------FKEHTKDIIEVMIQGMTCSSCVYTIESKLAQMQGILSVKVALTTEKGKFKFDPQIISPRDILDAIEEMGFDAKL 732
            ++GM C SCV  I++ +  L GV S  ++L      + YDP  +  S +   I  +    F  E                 + Q         F +     + + I+GMTC+SCV +IE  ++Q +G++S +V+L   +G F++DP + SP+++ +A+E+MGFDA L
Sbjct:  275 VKGMHCRSCVVNIQDNISLLPGVSSVEVSLEKEQATICYDPHKVTVSALQQAIEALPPGNFKVEAPGSTNPVTSARAQPACVTQAKPAALQPCFTQPLVSTVNIHIEGMTCNSCVQSIEGMISQRKGVVSAQVSLADHQGIFEYDPLLTSPQELREAVEDMGFDAFL 441          

HSP 4 Score: 62.3882 bits (150), Expect = 2.918e-9
Identity = 42/173 (24.28%), Postives = 83/173 (47.98%), Query Frame = 1
Query:  226 TLCEAIENLGFLINKNKETDNTKELFKCHMRIQGMTCSSCVHTIENQVLKLKGVKSALINLLSTIGEVTYDPDLIMASDIADTINDMGF-DAEIFQFKEHTKDIIEVMIQGMTCSSCVYTIESKLAQMQGILSVKVALTTEKGKFKFDPQIISPRDILDAIEEMGFDAKLAPK 741
            +L EAIE++GF  +    +  T    +  +        +       ++ + KGV     +       +T+ P LI   +++  +  +   D +  + K+    ++++ I+GMTC SCV TIE K+ ++ GI  +KV L +++    + P +I+ + I++ I   GF A +  K
Sbjct:   61 SLSEAIEDMGFESSFPDGSTATAVSTETQLIPTSALAPAAHQEAREKLSQTKGVLEVCESPSQKDLHITFAPSLISTLELSKVVESLTLADVQTSKMKDDGVALLKLRIEGMTCHSCVTTIEGKIGKLNGIQKIKVVLESKEATIIYLPYLITHQSIVEQIAFAGFKASVKSK 233          

HSP 5 Score: 56.225 bits (134), Expect = 2.104e-7
Identity = 22/66 (33.33%), Postives = 41/66 (62.12%), Query Frame = 1
Query:  535 IEVMIQGMTCSSCVYTIESKLAQMQGILSVKVALTTEKGKFKFDPQIISPRDILDAIEEMGFDAKL 732
            + + ++GMTC SCV +IE ++  + G++ ++V+L  +     FD    SP  + +AIE+MGF++  
Sbjct:   10 VALKVEGMTCGSCVQSIEQRIGSLPGVIHIRVSLEQKTATLIFDQGQQSPESLSEAIEDMGFESSF 75          

HSP 6 Score: 53.5286 bits (127), Expect = 1.421e-6
Identity = 38/152 (25.00%), Postives = 71/152 (46.71%), Query Frame = 1
Query:  313 MRIQGMTCSSCVHTIENQVLKLKGVKSALINLLSTIGEVTYDPDLIMASDIADTINDMGFDAEIFQFKEHTKDIIEVMIQGMTCSSCVYTIES--KLAQMQGILSVKVALTTEKGKFKFDPQIISPRDILDAIEEMGFDAKLAPKKTNKYND 762
            ++++GMTC SCV +IE ++  L GV    ++L      + +D        +++ I DMGF++        T    E  +   +  +     E+  KL+Q +G+L V  + + +     F P +IS  ++   +E +     LA  +T+K  D
Sbjct:   12 LKVEGMTCGSCVQSIEQRIGSLPGVIHIRVSLEQKTATLIFDQGQQSPESLSEAIEDMGFESSFPDGSTATAVSTETQLIPTSALAPAAHQEAREKLSQTKGVLEVCESPSQKDLHITFAPSLISTLELSKVVESL----TLADVQTSKMKD 159          
BLAST of Copper-transporting ATPase 1 vs. Ensembl Medaka
Match: atp7a (copper-transporting ATPase 1 [Source:NCBI gene;Acc:101173428])

HSP 1 Score: 782.711 bits (2020), Expect = 0.000e+0
Identity = 485/1072 (45.24%), Postives = 651/1072 (60.73%), Query Frame = 1
Query:  121 IEDFFQFNDNIKTVVIDYEKNLVRICCHNDNCTYLTLCEAIENL---GFLINKNKETD---------------NTKELFKC---------HMRIQGMTCSSCVHTIENQVLKLKGVKSA----------------------------------------------------LINLLSTIGEVTYDPDLIMASDIADTINDMGFDAEIFQFKEHTKDIIEVMIQGMTCSSCVYTIESKLAQMQGILSVKVALTTEKGKFKFDPQIISPRDILDAIEEMGFDAKLAPK-KTNKYNDHVGESIKKWKHSFLISLIFGVPTMIVMMV------FMYGFSHRMQVIHLKNGINVTVMVSNAPIXXXXXXXXXXXXXXXXXPVQFYGARYFYVQAYKSIKHGSANMDVLVVMATSVSYIYSFIVILVSMILRQDSSPQTFFETTPMLIVFLSLGRWLEHIAKGKTSEALSKLLSLQAFEATIIV--NDN---QERKISXXXXXXXXXXXXXPGEKIPIDGRVVSGKSRCDESLITGESMSVEKIPGSDVIGGTLNISGMLIIRATLVGEDSALNQIVKLVEEAQTSKAPIQELADKVAGLFVPGVIICSMFTLLIWIAIGYTNPNLL----PGH-SSINTDNTELIWKYAFQLAITVLSVACPCSLGLATPTAVMVGTGVGAINGILIKGGVPLEKMHQLDVIVFDKTGTITTGKPSVTNFVMCVENVTSQIRNCILLMLGAAESSSEHPIGKAILQYVRETCDINEMPQVVHSKSVSGFGLECSLK------LQSDMFVPDSEIDN----VLVKINDFQENNLTENLKETSVKWRKINEPVEVVLYLGNRNMMKENHISIPDKLDELMSRDEDNGRTVVLMAI-DKVLLAMISIADQVKKEAALVVYTLEKMGVEVFLLTGDNHKTATAIAKEIGIRNVFAEVLPSHKVAKIQQIQNMSKYKRSWLFSCCSKPSKLTNVAMVGDGINDSPALAQADVGIAIGTGTDVAVEAADVVLIRNSLLDVIAAMKLSKDTVRRIRQNFVAATMYNLIGIPIAAGALMPIGVVFMPWMASVAMA 3015
            I+D       + +V +  EK    IC      T   L +AIE L    F +     T+                   L  C         ++ I+GMTC+SCV +IE  + + KGV SA                                                    L+ L+++  EV Y+P++I    I + + ++GF A + +  E +   +E++++GMTC+SCV+ IES L + +GI    VAL T     KFD +++ PRDI+  IE +GF A L  + ++  + DH  E I++W+ SFLISLIF VP M +M+        M    H    +  +N  + T+ +     LFPGLS+ NLL F+F  PVQF G RYFY+QAYK++KH SANMDVL+V+ATSV++ YS +V++V+M+ R   +P TFF+T PML VF+SLGRWLE IAK KTSEALSKL+SLQA EAT++   +DN    E ++ V+LV++GD+VKV+PG K P+DGRV+ G S  DESLITGE+M V K PGS VI G++N +G L++ AT VG D+ L+QIVKLVEEAQTSKAPIQ+ ADK++G FVP ++  S+ TL++WI IG+ + +L+    PG+  SI+T  TE + ++AFQ +ITVL +ACPC LGLATPTAVMVGTGVGA NGILIKGG PLE  H++  IVFDKTGTIT G P V      VE     +   +L ++G AE++SEHP+G AI +Y ++      +      ++V G G+ C +        Q D    DSE +N    VLV+I+D + ++ +  L             + VVL +GNR  M+ N + I  ++DE M   E  GRT VL+++   +L AMI+I+D VK EA L V TL  MG+EV L+TGDN KTA  IA ++GIR VFAEVLPSHKVAK++Q+Q   K                  VAMVGDG+NDSPALA ADVGIAIGTGTDVA+EAADVVLIRN LLDV+ ++ LSK TV+RIR NFV A +YNL+GIPIAAG  +PIG+V  PWM S AMA
Sbjct:  287 IQDNISLLPGVSSVEVSLEKEQATICYDPHKVTVSALQQAIEALPPGNFKVEAPGSTNPVTSARAQPASVTQAKPAALQPCCTQPLVSTVNIHIEGMTCNSCVQSIEGMISQRKGVVSAQVSLADHQGIFEYDPLLTSPQELREAVEDMGFDAFLPGKSKKSGKGLWIYFVLVALMASKAEVRYNPEVIDPPRIVECVKELGFTASVMENYEGSDRNLELVVRGMTCASCVHKIESNLMKEKGIEYASVALATNIAHIKFDSEVLGPRDIIKLIENLGFKASLVKRDRSASHLDHSKE-IRQWRKSFLISLIFCVPVMGMMIYMMVMDHHMNASHHHNATVEDRNHYHSTMFLERQ--LFPGLSIMNLLSFIFCVPVQFIGGRYFYIQAYKALKHKSANMDVLIVLATSVAFSYSLVVLIVAMVERAKVNPITFFDTPPMLFVFISLGRWLEQIAKSKTSEALSKLMSLQATEATVVALGSDNVILSEEQVDVELVQRGDVVKVVPGGKFPVDGRVLEGHSMADESLITGEAMPVTKKPGSTVIAGSINQNGSLLVSATHVGMDTTLSQIVKLVEEAQTSKAPIQQYADKISGYFVPFIVAVSLLTLIVWIIIGFLDFSLVKKYFPGYDKSIST--TETVIRFAFQTSITVLCIACPCCLGLATPTAVMVGTGVGAQNGILIKGGEPLEMAHKVQAIVFDKTGTITYGAPKVVQVKTVVEGNKMPLSR-LLAIVGTAENNSEHPLGAAITKYCKQELGTESLGTCTDFQAVPGCGVRCQVSNTETVVKQGD---SDSEDNNHWNSVLVQISDTRTSSSSHPLIMDPQPLSSGPTDLYVVL-IGNREWMRRNFLEITAEIDEAMMEHERRGRTAVLVSLCADMLCAMIAISDTVKPEAELAVQTLTNMGLEVVLMTGDNSKTARVIAAQVGIRKVFAEVLPSHKVAKVEQLQQAGKI-----------------VAMVGDGVNDSPALAMADVGIAIGTGTDVAIEAADVVLIRNDLLDVVGSIDLSKKTVKRIRINFVFALIYNLVGIPIAAGVFLPIGLVLQPWMGSAAMA 1331          

HSP 2 Score: 62.003 bits (149), Expect = 4.166e-9
Identity = 31/107 (28.97%), Postives = 60/107 (56.07%), Query Frame = 1
Query:  424 EVTYDPDLIMASDIADTINDMGF-DAEIFQFKEHTKDIIEVMIQGMTCSSCVYTIESKLAQMQGILSVKVALTTEKGKFKFDPQIISPRDILDAIEEMGFDAKLAPK 741
             +T+ P LI   +++  +  +   D +  + K+    ++++ ++GMTC SCV TIE K+ ++ GI  VKV L +++    + P +I+ + I++ I   GF A +  K
Sbjct:  127 HITFAPSLISTLELSKVVESLTLADVQTSKMKDDGVALLKLRVEGMTCHSCVTTIEGKIGKLNGIQKVKVVLESKEATIIYLPYLITHQSIVEQIAFAGFKASVKSK 233          

HSP 3 Score: 56.225 bits (134), Expect = 2.217e-7
Identity = 23/71 (32.39%), Postives = 42/71 (59.15%), Query Frame = 1
Query:  535 IEVMIQGMTCSSCVYTIESKLAQMQGILSVKVALTTEKGKFKFDPQIISPRDILDAIEEMGFDAKLAPKKT 747
            + + ++GMTC SCV +IE ++  + G++ ++V+L  +     FD    SP  + +AIE+MGF++      T
Sbjct:   10 VALKVEGMTCGSCVQSIEQRIGSLPGVIHIRVSLEQKTATLIFDQGQQSPESLSEAIEDMGFESSFPDGST 80          

HSP 4 Score: 53.5286 bits (127), Expect = 1.461e-6
Identity = 39/155 (25.16%), Postives = 73/155 (47.10%), Query Frame = 1
Query:  313 MRIQGMTCSSCVHTIENQVLKLKGVKSALINLLSTIGEVTYDPDLIMASDIADTINDMGFDAEIFQFKE-HTKDIIEVMIQGMTCSSCV----YTIESKLAQMQGILSVKVALTTEKGKFKFDPQIISPRDILDAIEEMGFDAKLAPKKTNKYND 762
            ++++GMTC SCV +IE ++  L GV    ++L      + +D        +++ I DMGF++    F +  T  ++    Q +  S+           KL+Q +G+L V  + + +     F P +IS  ++   +E +     LA  +T+K  D
Sbjct:   12 LKVEGMTCGSCVQSIEQRIGSLPGVIHIRVSLEQKTATLIFDQGQQSPESLSEAIEDMGFES---SFPDGSTATVVSTETQLIPTSALAPAAHQEAREKLSQTKGVLEVCESPSQKDLHITFAPSLISTLELSKVVESL----TLADVQTSKMKD 159          
BLAST of Copper-transporting ATPase 1 vs. Ensembl Medaka
Match: si:dkey-28b4.8 (sarcoplasmic/endoplasmic reticulum calcium ATPase 2-like [Source:NCBI gene;Acc:101159722])

HSP 1 Score: 80.4925 bits (197), Expect = 7.914e-15
Identity = 55/238 (23.11%), Postives = 115/238 (48.32%), Query Frame = 1
Query: 2323 YLGNRNMMKENHISIPDKLDELMSRDEDNGRTVVLMAIDKVLLAMISIADQVKKEAALVVYTLEKMGVEVFLLTGDNHKTATAIAKEIGI------------------RNVFAEVLPSHKVAKIQQIQNMSKYKRSWLFSCCSKPSKLTNV-AMVGDGINDSPALAQADVGIAIGTGTDVAVEAADVVLIRNSLLDVIAAMKLSKDTVRRIRQ---NFVAATMYNLIGIPIAAGALMP 2970
            +   R+ ++   ++  D   ++ S + +N  T V    D   +  + + D  +KE    V    + G+ V ++TGDN  TA +I + +GI                     F E+ P+ +    Q ++  ++ + +           L+++ AM GDG+ND+PAL +A++GIA+G+GT VA  A++++L  ++   ++AA++  +     ++Q     +++ +  ++ I + A   MP
Sbjct:  553 WTSGRDTLRCLAMATRDTPPDINSLNLENSATFVDYETDLTFVGCVGMLDPPRKEVLGAVRMCRQAGIRVIMITGDNKGTALSICRRVGIITEQEEEQGGAGIMGGLTGREFDELPPALQRQACQTVRCFARVEPAHKSRIVEYLQSLSDITAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASEMILADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNIGEVVCIFLTAALGMP 790          
BLAST of Copper-transporting ATPase 1 vs. Ensembl Medaka
Match: si:dkey-28b4.8 (sarcoplasmic/endoplasmic reticulum calcium ATPase 2-like [Source:NCBI gene;Acc:101159722])

HSP 1 Score: 80.4925 bits (197), Expect = 8.007e-15
Identity = 55/238 (23.11%), Postives = 115/238 (48.32%), Query Frame = 1
Query: 2323 YLGNRNMMKENHISIPDKLDELMSRDEDNGRTVVLMAIDKVLLAMISIADQVKKEAALVVYTLEKMGVEVFLLTGDNHKTATAIAKEIGI------------------RNVFAEVLPSHKVAKIQQIQNMSKYKRSWLFSCCSKPSKLTNV-AMVGDGINDSPALAQADVGIAIGTGTDVAVEAADVVLIRNSLLDVIAAMKLSKDTVRRIRQ---NFVAATMYNLIGIPIAAGALMP 2970
            +   R+ ++   ++  D   ++ S + +N  T V    D   +  + + D  +KE    V    + G+ V ++TGDN  TA +I + +GI                     F E+ P+ +    Q ++  ++ + +           L+++ AM GDG+ND+PAL +A++GIA+G+GT VA  A++++L  ++   ++AA++  +     ++Q     +++ +  ++ I + A   MP
Sbjct:  547 WTSGRDTLRCLAMATRDTPPDINSLNLENSATFVDYETDLTFVGCVGMLDPPRKEVLGAVRMCRQAGIRVIMITGDNKGTALSICRRVGIITEQEEEQGGAGIMGGLTGREFDELPPALQRQACQTVRCFARVEPAHKSRIVEYLQSLSDITAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASEMILADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNIGEVVCIFLTAALGMP 784          
BLAST of Copper-transporting ATPase 1 vs. Planmine SMEST
Match: SMESG000058134.1 (SMESG000058134.1)

HSP 1 Score: 2070.82 bits (5364), Expect = 0.000e+0
Identity = 1083/1083 (100.00%), Postives = 1083/1083 (100.00%), Query Frame = 1
Query:   52 MDEEIYHFEILIKEVNDKNQLKIIEDFFQFNDNIKTVVIDYEKNLVRICCHNDNCTYLTLCEAIENLGFLINKNKETDNTKELFKCHMRIQGMTCSSCVHTIENQVLKLKGVKSALINLLSTIGEVTYDPDLIMASDIADTINDMGFDAEIFQFKEHTKDIIEVMIQGMTCSSCVYTIESKLAQMQGILSVKVALTTEKGKFKFDPQIISPRDILDAIEEMGFDAKLAPKKTNKYNDHVGESIKKWKHSFLISLIFGVPTMIVMMVFMYGFSHRMQVIHLKNGINVTVMVSNAPIXXXXXXXXXXXXXXXXXPVQFYGARYFYVQAYKSIKHGSANMDVLVVMATSVSYIYSFIVILVSMILRQDSSPQTFFETTPMLIVFLSLGRWLEHIAKGKTSEALSKLLSLQAFEATIIVNDNQERKISXXXXXXXXXXXXXPGEKIPIDGRVVSGKSRCDESLITGESMSVEKIPGSDVIGGTLNISGMLIIRATLVGEDSALNQIVKLVEEAQTSKAPIQELADKVAGLFVPGVIICSMFTLLIWIAIGYTNPNLLPGHSSINTDNTELIWKYAFQLAITVLSVACPCSLGLATPTAVMVGTGVGAINGILIKGGVPLEKMHQLDVIVFDKTGTITTGKPSVTNFVMCVENVTSQIRNCILLMLGAAESSSEHPIGKAILQYVRETCDINEMPQVVHSKSVSGFGLECSLKLQSDMFVPDSEIDNVLVKINDFQENNLTENLKETSVKWRKINEPVEVVLYLGNRNMMKENHISIPDKLDELMSRDEDNGRTVVLMAIDKVLLAMISIADQVKKEAALVVYTLEKMGVEVFLLTGDNHKTATAIAKEIGIRNVFAEVLPSHKVAKIQQIQNMSKYKRSWLFSCCSKPSKLTNVAMVGDGINDSPALAQADVGIAIGTGTDVAVEAADVVLIRNSLLDVIAAMKLSKDTVRRIRQNFVAATMYNLIGIPIAAGALMPIGVVFMPWMASVAMAASSICVVCXXXXXXXXXXPNEDQLANQEFKNHLECLKYGDMEVGVNLGKDIILPXXXXXXXXXXXXXXXXXXXXXXXXKPNVSDRIALLENFKND 3300
            MDEEIYHFEILIKEVNDKNQLKIIEDFFQFNDNIKTVVIDYEKNLVRICCHNDNCTYLTLCEAIENLGFLINKNKETDNTKELFKCHMRIQGMTCSSCVHTIENQVLKLKGVKSALINLLSTIGEVTYDPDLIMASDIADTINDMGFDAEIFQFKEHTKDIIEVMIQGMTCSSCVYTIESKLAQMQGILSVKVALTTEKGKFKFDPQIISPRDILDAIEEMGFDAKLAPKKTNKYNDHVGESIKKWKHSFLISLIFGVPTMIVMMVFMYGFSHRMQVIHLKNGINVTVMVSNAPILFPGLSLENLLLFLFSSPVQFYGARYFYVQAYKSIKHGSANMDVLVVMATSVSYIYSFIVILVSMILRQDSSPQTFFETTPMLIVFLSLGRWLEHIAKGKTSEALSKLLSLQAFEATIIVNDNQERKISVDLVKKGDLVKVLPGEKIPIDGRVVSGKSRCDESLITGESMSVEKIPGSDVIGGTLNISGMLIIRATLVGEDSALNQIVKLVEEAQTSKAPIQELADKVAGLFVPGVIICSMFTLLIWIAIGYTNPNLLPGHSSINTDNTELIWKYAFQLAITVLSVACPCSLGLATPTAVMVGTGVGAINGILIKGGVPLEKMHQLDVIVFDKTGTITTGKPSVTNFVMCVENVTSQIRNCILLMLGAAESSSEHPIGKAILQYVRETCDINEMPQVVHSKSVSGFGLECSLKLQSDMFVPDSEIDNVLVKINDFQENNLTENLKETSVKWRKINEPVEVVLYLGNRNMMKENHISIPDKLDELMSRDEDNGRTVVLMAIDKVLLAMISIADQVKKEAALVVYTLEKMGVEVFLLTGDNHKTATAIAKEIGIRNVFAEVLPSHKVAKIQQIQNMSKYKRSWLFSCCSKPSKLTNVAMVGDGINDSPALAQADVGIAIGTGTDVAVEAADVVLIRNSLLDVIAAMKLSKDTVRRIRQNFVAATMYNLIGIPIAAGALMPIGVVFMPWMASVAMAASSICVVCLSLLLKLWKKPNEDQLANQEFKNHLECLKYGDMEVGVNLGKDIILPKRKPRRSFRSSISSLWSSMEISKKKPNVSDRIALLENFKND
Sbjct:    1 MDEEIYHFEILIKEVNDKNQLKIIEDFFQFNDNIKTVVIDYEKNLVRICCHNDNCTYLTLCEAIENLGFLINKNKETDNTKELFKCHMRIQGMTCSSCVHTIENQVLKLKGVKSALINLLSTIGEVTYDPDLIMASDIADTINDMGFDAEIFQFKEHTKDIIEVMIQGMTCSSCVYTIESKLAQMQGILSVKVALTTEKGKFKFDPQIISPRDILDAIEEMGFDAKLAPKKTNKYNDHVGESIKKWKHSFLISLIFGVPTMIVMMVFMYGFSHRMQVIHLKNGINVTVMVSNAPILFPGLSLENLLLFLFSSPVQFYGARYFYVQAYKSIKHGSANMDVLVVMATSVSYIYSFIVILVSMILRQDSSPQTFFETTPMLIVFLSLGRWLEHIAKGKTSEALSKLLSLQAFEATIIVNDNQERKISVDLVKKGDLVKVLPGEKIPIDGRVVSGKSRCDESLITGESMSVEKIPGSDVIGGTLNISGMLIIRATLVGEDSALNQIVKLVEEAQTSKAPIQELADKVAGLFVPGVIICSMFTLLIWIAIGYTNPNLLPGHSSINTDNTELIWKYAFQLAITVLSVACPCSLGLATPTAVMVGTGVGAINGILIKGGVPLEKMHQLDVIVFDKTGTITTGKPSVTNFVMCVENVTSQIRNCILLMLGAAESSSEHPIGKAILQYVRETCDINEMPQVVHSKSVSGFGLECSLKLQSDMFVPDSEIDNVLVKINDFQENNLTENLKETSVKWRKINEPVEVVLYLGNRNMMKENHISIPDKLDELMSRDEDNGRTVVLMAIDKVLLAMISIADQVKKEAALVVYTLEKMGVEVFLLTGDNHKTATAIAKEIGIRNVFAEVLPSHKVAKIQQIQNMSKYKRSWLFSCCSKPSKLTNVAMVGDGINDSPALAQADVGIAIGTGTDVAVEAADVVLIRNSLLDVIAAMKLSKDTVRRIRQNFVAATMYNLIGIPIAAGALMPIGVVFMPWMASVAMAASSICVVCLSLLLKLWKKPNEDQLANQEFKNHLECLKYGDMEVGVNLGKDIILPKRKPRRSFRSSISSLWSSMEISKKKPNVSDRIALLENFKND 1083          
BLAST of Copper-transporting ATPase 1 vs. Planmine SMEST
Match: SMESG000039812.1 (SMESG000039812.1)

HSP 1 Score: 1041.57 bits (2692), Expect = 0.000e+0
Identity = 571/1016 (56.20%), Postives = 754/1016 (74.21%), Query Frame = 1
Query:  235 EAIENLGFLI-------NKNKETD----NTKELFKCHMRIQGMTCSSCVHTIENQVLKLKGVKSALINLLSTIGEVTYDPDLIMASDIADTINDMGFDAEIFQFKEHTKDIIEVMIQGMTCSSCVYTIESKLAQMQGILSVKVALTTEKGKFKFDPQIISPRDILDAIEEMGFDAKLAP--KKTNKYNDHVGESIKKWKHSFLISLIFGVPTMIVMMVFMYGFSHRMQVIHLKNGINVTVMVSNAPIXXXXXXXXXXXXXXXXXPVQFYGARYFYVQAYKSIKHGSANMDVLVVMATSVSYIYSFIVILVSMILRQDSSPQTFFETTPMLIVFLSLGRWLEHIAKGKTSEALSKLLSLQAFEATIIVNDNQERKISXXXXXXXXXXXXXPGEKIPIDGRVVSGKSRCDESLITGESMSVEKIPGSDVIGGTLNISGMLIIRATLVGEDSALNQIVKLVEEAQTSKAPIQELADKVAGLFVPGVIICSMFTLLIWIAIGYTNPNLLPGHSSINTDNTELIWKYAFQLAITVLSVACPCSLGLATPTAVMVGTGVGAINGILIKGGVPLEKMHQLDVIVFDKTGTITTGKPSVTNFVMCVENVTSQIRNCILLMLGAAESSSEHPIGKAILQYVRETCDINEMPQVVHSKSVSGFGLECSLKLQSDMFVPDSEIDNV---LVKINDFQE--NNLTENLK-----ETSVKWRKINEPVE------------VVLYLGNRNMMKENHISIPDKLDELMSRDEDNGRTVVLMAIDKVLLAMISIADQVKKEAALVVYTLEKMGVEVFLLTGDNHKTATAIAKEIGIRNVFAEVLPSHKVAKIQQIQNMSKYKRSWLFSCCSKPSKLTNVAMVGDGINDSPALAQADVGIAIGTGTDVAVEAADVVLIRNSLLDVIAAMKLSKDTVRRIRQNFVAATMYNLIGIPIAAGALMPIGVVFMPWMASVAMAASSICVVCXXXXXXXXXXPNEDQLANQEFKNHLECLKYGDMEVGVNLGKDIILP 3177
            E IE+LG+L        N  +++     N +   KC++RI GMTCSSCV+ +E+ +LK++GVKS L+ LL+   E+ YD   +M   +++ + ++GF+AE+ +       ++ V+I+GMTCSSCV  IE+ +++++GI S+ V+L+T KGK ++      PRD++DAI +MGFDA L    +  +   DH+ + IK+W+ SF  SLI G+PTM VMM  M+ F      I  +NG N T+M S  P++  GLS +NL+LF+ ++PVQFYGARYFY+QAY S+KH + NMDVLVVMATS+SYIYS IVI++SM  R+++SP+TFFET+PMLIVFLSLGRWLEHIAKGKTSEAL+KL+SLQA EAT+   +N+ERKI ++LV++ DL+K+LPGEKIP+DG+VV+G S CDESLITGESM +EK  GSDVIGG++N SGMLI++AT VG DSAL QIVKLVEEAQTSKAPIQ+LAD++AG+FVP V+IC++ TL+IW+ +G++ P +LP + +     TE+ W++AFQLAITVLS+ACPCSLGLATPTAVMVGTGVGA+NGILIKGG PLE +H+L+VIVFDKTGTIT G PSVT F++ + N   +  + +L +L AAES+SEHPIGKAI+ + +       +P+V+ S +VSG GL C L L      P +E+      L+ I    E  N L +N+      +  + ++ +  PV             V + +GNRN M+ N I + D++DELMS DE+ GRTV+LMAID  L+AMIS+ADQVK+EAAL VYTL+KM +EV+L+TGDN KTATAIA+++GI  VFAEVLPSHKVAK+QQ+QN ++       S  SK  +   VAMVGDGINDSPALAQ+DVGIAIGTGTDVAVEAADVVLIRNSLLDVIAA++LSK TV+RIRQNF+AAT+YNL+GIPIAAG LMPIG+  MPWMAS AMAASS+ VV LSLLLKLWKKP+E++L   E+ N ++     + ++ V  G D++ P
Sbjct:  310 EEIESLGYLTELPKQNWNSTRQSSAVSLNEESRSKCYLRITGMTCSSCVNKVESHLLKVEGVKSVLVALLAMKCEIIYDSAYVMPFQLSNRVKELGFNAEVIENGNEGIGVVNVLIRGMTCSSCVNHIENHISKIKGIASINVSLSTSKGKVEYFISECGPRDVIDAINDMGFDASLCDHLESNHAAADHINQMIKQWRSSFFFSLICGIPTMFVMMFTMFNFKMVKHTIIHENGSNRTIMRSTVPMVCSGLSADNLILFVLATPVQFYGARYFYIQAYLSLKHKTTNMDVLVVMATSISYIYSVIVIVISMAFRRNTSPKTFFETSPMLIVFLSLGRWLEHIAKGKTSEALTKLMSLQAVEATLYTPENKERKIPINLVQRNDLIKILPGEKIPVDGKVVTGTSTCDESLITGESMPIEKTHGSDVIGGSINKSGMLIVKATHVGSDSALAQIVKLVEEAQTSKAPIQQLADRIAGMFVPSVLICAIITLIIWVIVGFSKPEILPKYVN-ELSVTEITWEHAFQLAITVLSIACPCSLGLATPTAVMVGTGVGAVNGILIKGGEPLENIHKLNVIVFDKTGTITNGSPSVTRFLVLIGNGVREHIDKLLKILAAAESASEHPIGKAIITFSKARISNENLPEVLESSAVSGCGLGCKLNLD-----PKTEVTKFVKNLINIESPSEETNILGQNMNININDDIRITYKDVIFPVRQHMAWTSDLCQTVTVIIGNRNWMQRNGILVDDEVDELMSEDENLGRTVILMAIDNELIAMISVADQVKREAALAVYTLKKMNIEVYLMTGDNSKTATAIARQVGIHYVFAEVLPSHKVAKVQQLQNTNR-------SLTSK--RKMKVAMVGDGINDSPALAQSDVGIAIGTGTDVAVEAADVVLIRNSLLDVIAAIQLSKATVKRIRQNFIAATLYNLLGIPIAAGVLMPIGIEMMPWMASAAMAASSVSVVTLSLLLKLWKKPSEEKLITPEYINFIQSSGLSESQIIVRRGIDLMTP 1310          

HSP 2 Score: 75.0998 bits (183), Expect = 3.272e-13
Identity = 43/143 (30.07%), Postives = 71/143 (49.65%), Query Frame = 1
Query:  343 CVHTIENQVLKLKGVKSALINLLSTIGEVTYDPDLIMASDIADTINDMGFDAEI-------------FQFKEHTKDIIEVMIQGMTCSSCVYTIESKLAQMQGILSVKVALTTEKGKFKFDPQIISPRDILDAIEEMGFDAKL 732
            C+  IEN +  L GV    +NL+  IG + YD        I + I  +G+  E+                 E ++    + I GMTCSSCV  +ES L +++G+ SV VAL   K +  +D   + P  + + ++E+GF+A++
Sbjct:  268 CIFKIENHMRALPGVDKCSVNLIEEIGMIDYDSGKWNVQKIREEIESLGYLTELPKQNWNSTRQSSAVSLNEESRSKCYLRITGMTCSSCVNKVESHLLKVEGVKSVLVALLAMKCEIIYDSAYVMPFQLSNRVKELGFNAEV 410          

HSP 3 Score: 60.077 bits (144), Expect = 1.015e-8
Identity = 45/185 (24.32%), Postives = 81/185 (43.78%), Query Frame = 1
Query:  313 MRIQGMTCSSCVHTIENQVLKLKGVKSALINLLSTIGEVTYDPDLIMASDIADTINDMGFDAEIF-----------------QFKEHTKDII------EVMIQGMTCSSCVYTIESKLAQMQGILSVKVALTTEKGKFKFDPQIISPRDILDAIEEMGFDAKLAPKKTNKYNDHVGESIKKWKHS 798
            +R+ GMTC SCV  IE+ V K +G+ S  + L  +      D  L    D+ + INDMGF++E+                  +++E   + I       ++I+ +    C++ IE+ +  + G+    V L  E G   +D    + + I + IE +G+  +L  +  N        S+ +   S
Sbjct:  160 VRVNGMTCQSCVDNIESTVGKKQGIISIKVFLEKSEAHALVDASL-AGPDVEEMINDMGFNSEMILEIFNDSCAGKPNNVSQKYEELKSNTIYPILSTTIVIKALKSIFCIFKIENHMRALPGVDKCSVNLIEEIGMIDYDSGKWNVQKIREEIESLGYLTELPKQNWNSTRQSSAVSLNEESRS 343          

HSP 4 Score: 60.077 bits (144), Expect = 1.308e-8
Identity = 26/70 (37.14%), Postives = 41/70 (58.57%), Query Frame = 1
Query:  295 ELFKCHMRIQGMTCSSCVHTIENQVLKLKGVKSALINLLSTIGEVTYDPDLIMASDIADTINDMGFDAEI 504
            +L    M++ GMTC SCV  IE  ++K  GV   +++LL     V +D D+    DI++ I++MGFD  +
Sbjct:    2 KLGSARMKVDGMTCMSCVRNIEENLMKFTGVCGIMVSLLQAEATVIFDADIATVEDISNKIDEMGFDVTV 71          

HSP 5 Score: 54.299 bits (129), Expect = 5.985e-7
Identity = 28/82 (34.15%), Postives = 42/82 (51.22%), Query Frame = 1
Query:  547 IQGMTCSSCVYTIESKLAQMQGILSVKVALTTEKGKFKFDPQIISPRDILDAIEEMGFDAKLAPKKTNKYNDHVGESIKKWK 792
            + GMTC SCV  IE  L +  G+  + V+L   +    FD  I +  DI + I+EMGFD  +   + +   D V  S  K++
Sbjct:   10 VDGMTCMSCVRNIEENLMKFTGVCGIMVSLLQAEATVIFDADIATVEDISNKIDEMGFDVTVKSSEVSNVKDKVVRSRIKFE 91          
BLAST of Copper-transporting ATPase 1 vs. Planmine SMEST
Match: SMESG000014734.1 (SMESG000014734.1)

HSP 1 Score: 79.7221 bits (195), Expect = 1.179e-14
Identity = 70/236 (29.66%), Postives = 110/236 (46.61%), Query Frame = 1
Query: 2437 DKVLLAMISIADQVKKEAALVVYTLEKMGVEVFLLTGDNHKTATAIAKEIGI----------------------------RNVFAEVLPSHKVAKIQQIQNMSKYKR-SWLFSCCSKPSKLTNVAMVGDGINDSPALAQADVGIAIG-TGTDVAVEAADVVLIRNSLLDVIAAMKLSKDTVRRIRQNFVAATMYNLIGIPIA-AGALM----PIGVVFMPW-------MASVAMAA 3018
            D   LA++ I D V+ E    +   +K G+ V ++TGDN  TA +IA + GI                            +++  +V PS +V      Q+  KY   S + +    P++   VA+ GDG ND PAL +ADVG A+G  GTDVA EA+D++L  ++   ++ A+   ++    I +        NL+ I +A  GA      P+  V M W       +AS+A+A 
Sbjct:  666 DLTCLAIVGIEDPVRPEVPNAIMKCQKAGITVRMVTGDNVNTARSIATKCGILKPGDDFLVLEGKEFNQRIRSPKTGEVRQDLIDKVWPSLRVLARSSPQD--KYTLVSGIIASHLNPTREV-VAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSISKFLQFQLTVNLVAIVVAFVGACFITDSPLKAVQMLWVNLIMDTLASLALAT 898          
BLAST of Copper-transporting ATPase 1 vs. Planmine SMEST
Match: SMESG000014734.1 (SMESG000014734.1)

HSP 1 Score: 79.337 bits (194), Expect = 1.334e-14
Identity = 70/236 (29.66%), Postives = 110/236 (46.61%), Query Frame = 1
Query: 2437 DKVLLAMISIADQVKKEAALVVYTLEKMGVEVFLLTGDNHKTATAIAKEIGI----------------------------RNVFAEVLPSHKVAKIQQIQNMSKYKR-SWLFSCCSKPSKLTNVAMVGDGINDSPALAQADVGIAIG-TGTDVAVEAADVVLIRNSLLDVIAAMKLSKDTVRRIRQNFVAATMYNLIGIPIA-AGALM----PIGVVFMPW-------MASVAMAA 3018
            D   LA++ I D V+ E    +   +K G+ V ++TGDN  TA +IA + GI                            +++  +V PS +V      Q+  KY   S + +    P++   VA+ GDG ND PAL +ADVG A+G  GTDVA EA+D++L  ++   ++ A+   ++    I +        NL+ I +A  GA      P+  V M W       +AS+A+A 
Sbjct:  666 DLTCLAIVGIEDPVRPEVPNAIMKCQKAGITVRMVTGDNVNTARSIATKCGILKPGDDFLVLEGKEFNQRIRSPKTGEVRQDLIDKVWPSLRVLARSSPQD--KYTLVSGIIASHLNPTREV-VAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSISKFLQFQLTVNLVAIVVAFVGACFITDSPLKAVQMLWVNLIMDTLASLALAT 898          
BLAST of Copper-transporting ATPase 1 vs. Planmine SMEST
Match: SMESG000014734.1 (SMESG000014734.1)

HSP 1 Score: 79.337 bits (194), Expect = 1.342e-14
Identity = 70/236 (29.66%), Postives = 110/236 (46.61%), Query Frame = 1
Query: 2437 DKVLLAMISIADQVKKEAALVVYTLEKMGVEVFLLTGDNHKTATAIAKEIGI----------------------------RNVFAEVLPSHKVAKIQQIQNMSKYKR-SWLFSCCSKPSKLTNVAMVGDGINDSPALAQADVGIAIG-TGTDVAVEAADVVLIRNSLLDVIAAMKLSKDTVRRIRQNFVAATMYNLIGIPIA-AGALM----PIGVVFMPW-------MASVAMAA 3018
            D   LA++ I D V+ E    +   +K G+ V ++TGDN  TA +IA + GI                            +++  +V PS +V      Q+  KY   S + +    P++   VA+ GDG ND PAL +ADVG A+G  GTDVA EA+D++L  ++   ++ A+   ++    I +        NL+ I +A  GA      P+  V M W       +AS+A+A 
Sbjct:  672 DLTCLAIVGIEDPVRPEVPNAIMKCQKAGITVRMVTGDNVNTARSIATKCGILKPGDDFLVLEGKEFNQRIRSPKTGEVRQDLIDKVWPSLRVLARSSPQD--KYTLVSGIIASHLNPTREV-VAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSISKFLQFQLTVNLVAIVVAFVGACFITDSPLKAVQMLWVNLIMDTLASLALAT 904          
The following BLAST results are available for this feature:
BLAST of Copper-transporting ATPase 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ATP7B3.271e-2448.34ATPase copper transporting beta [Source:HGNC Symbo... [more]
ATP7A1.678e-1949.30ATPase copper transporting alpha [Source:HGNC Symb... [more]
ATP7B3.914e-2448.34ATPase copper transporting beta [Source:HGNC Symbo... [more]
ATP7B3.716e-2445.97ATPase copper transporting beta [Source:HGNC Symbo... [more]
ATP7B6.841e-3143.24ATPase copper transporting beta [Source:HGNC Symbo... [more]
back to top
BLAST of Copper-transporting ATPase 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cua-12.141e-1146.19CU (Copper) ATPase [Source:UniProtKB/TrEMBL;Acc:G... [more]
cua-11.171e-1646.19CU (Copper) ATPase [Source:UniProtKB/TrEMBL;Acc:G... [more]
catp-12.100e-1430.86Cation transporting ATPase [Source:UniProtKB/TrEM... [more]
catp-13.041e-1430.86Cation transporting ATPase [Source:UniProtKB/TrEM... [more]
sca-13.086e-1423.30Calcium-transporting ATPase [Source:UniProtKB/TrE... [more]
back to top
BLAST of Copper-transporting ATPase 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ATP71.355e-1545.51gene:FBgn0030343 transcript:FBtr0334454[more]
ATP71.355e-1545.51gene:FBgn0030343 transcript:FBtr0273257[more]
SPoCk6.088e-1433.53gene:FBgn0052451 transcript:FBtr0078531[more]
SPoCk6.470e-1433.53gene:FBgn0052451 transcript:FBtr0306600[more]
SPoCk6.470e-1433.53gene:FBgn0052451 transcript:FBtr0302134[more]
back to top
BLAST of Copper-transporting ATPase 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
atp7a4.911e-2048.82ATPase copper transporting alpha [Source:ZFIN;Acc:... [more]
atp7b6.174e-1648.46ATPase copper transporting beta [Source:ZFIN;Acc:Z... [more]
atp7a4.769e-2047.89ATPase copper transporting alpha [Source:ZFIN;Acc:... [more]
atp7b2.475e-1547.96ATPase copper transporting beta [Source:ZFIN;Acc:Z... [more]
atp7a5.324e-2046.88ATPase copper transporting alpha [Source:ZFIN;Acc:... [more]
back to top
BLAST of Copper-transporting ATPase 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dhx349.808e-1647.81DEAH-box helicase 34 [Source:Xenbase;Acc:XB-GENE-1... [more]
dhx344.303e-1548.24DEAH-box helicase 34 [Source:Xenbase;Acc:XB-GENE-1... [more]
dhx344.729e-1548.24DEAH-box helicase 34 [Source:Xenbase;Acc:XB-GENE-1... [more]
dhx341.112e-1847.83DEAH-box helicase 34 [Source:Xenbase;Acc:XB-GENE-1... [more]
dhx341.591e-1447.64DEAH-box helicase 34 [Source:Xenbase;Acc:XB-GENE-1... [more]
back to top
BLAST of Copper-transporting ATPase 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Atp7b2.437e-2149.01ATPase, Cu++ transporting, beta polypeptide [Sourc... [more]
Atp7a1.289e-2047.95ATPase, Cu++ transporting, alpha polypeptide [Sour... [more]
Atp7a1.111e-2148.00ATPase, Cu++ transporting, alpha polypeptide [Sour... [more]
Atp7b2.898e-2149.01ATPase, Cu++ transporting, beta polypeptide [Sourc... [more]
Atp2a14.156e-1527.46ATPase, Ca++ transporting, cardiac muscle, fast tw... [more]
back to top
BLAST of Copper-transporting ATPase 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q64446|ATP7B_MOUSE2.027e-2049.01Copper-transporting ATPase 2 OS=Mus musculus OX=10... [more]
sp|Q64430|ATP7A_MOUSE7.772e-2148.00Copper-transporting ATPase 1 OS=Mus musculus OX=10... [more]
sp|Q64535|ATP7B_RAT4.816e-2149.18Copper-transporting ATPase 2 OS=Rattus norvegicus ... [more]
sp|P35670|ATP7B_HUMAN1.571e-2348.34Copper-transporting ATPase 2 OS=Homo sapiens OX=96... [more]
sp|P70705|ATP7A_RAT6.818e-2047.42Copper-transporting ATPase 1 OS=Rattus norvegicus ... [more]
back to top
BLAST of Copper-transporting ATPase 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2C9KDW42.415e-2352.94Uncharacterized protein OS=Biomphalaria glabrata O... [more]
A0A2C9KE232.506e-2352.72Uncharacterized protein OS=Biomphalaria glabrata O... [more]
A0A2C9KDZ01.126e-2252.72Uncharacterized protein OS=Biomphalaria glabrata O... [more]
A0A2C9KDX73.221e-2252.72Uncharacterized protein OS=Biomphalaria glabrata O... [more]
A0A0L8GFT76.151e-2049.81Uncharacterized protein OS=Octopus bimaculoides OX... [more]
back to top
BLAST of Copper-transporting ATPase 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
atp7a5.948e-1848.62ATPase copper transporting alpha [Source:NCBI gene... [more]
atp7b1.060e-17051.09ATPase copper transporting beta [Source:ZFIN;Acc:Z... [more]
atp2c15.968e-1535.12ATPase secretory pathway Ca2+ transporting 1 [Sour... [more]
atp2a1l1.684e-1429.07sarcoplasmic/endoplasmic reticulum calcium ATPase ... [more]
atp2a1l1.694e-1429.07sarcoplasmic/endoplasmic reticulum calcium ATPase ... [more]
back to top
BLAST of Copper-transporting ATPase 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
atp7b0.000e+044.76ATPase copper transporting beta [Source:ZFIN;Acc:Z... [more]
ENSPMAT00000002230.12.489e-6262.57pep scaffold:Pmarinus_7.0:GL493059:69:4752:-1 gene... [more]
ENSPMAT00000010051.11.779e-1326.35pep scaffold:Pmarinus_7.0:GL484878:2955:5956:-1 ge... [more]
atp2c15.835e-1231.58ATPase secretory pathway Ca2+ transporting 1 [Sour... [more]
ENSPMAT00000010373.17.456e-1226.67pep scaffold:Pmarinus_7.0:GL481096:3909:20014:1 ge... [more]
back to top
BLAST of Copper-transporting ATPase 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
CCC25.598e-13232.42Cu(+2)-transporting P-type ATPase; required for ex... [more]
PCA18.978e-7430.48Cadmium transporting P-type ATPase; may also have ... [more]
PMA16.743e-2324.00Plasma membrane P2-type H+-ATPase; pumps protons o... [more]
PMA24.352e-2223.61Plasma membrane H+-ATPase; isoform of Pma1p, invol... [more]
ENA56.994e-1631.86Protein with similarity to P-type ATPase sodium pu... [more]
back to top
BLAST of Copper-transporting ATPase 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO470801.237e-2144.92Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO434171.732e-5529.98Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO280803.571e-2023.66Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO356161.287e-1331.15Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO364551.347e-1228.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Copper-transporting ATPase 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
atp7b2.816e-2449.73copper-transporting ATPase 2 [Source:NCBI gene;Acc... [more]
atp7a5.672e-2050.00copper-transporting ATPase 1 [Source:NCBI gene;Acc... [more]
atp7a4.166e-945.24copper-transporting ATPase 1 [Source:NCBI gene;Acc... [more]
si:dkey-28b4.87.914e-1523.11sarcoplasmic/endoplasmic reticulum calcium ATPase ... [more]
si:dkey-28b4.88.007e-1523.11sarcoplasmic/endoplasmic reticulum calcium ATPase ... [more]
back to top
BLAST of Copper-transporting ATPase 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000058134.10.000e+0100.00SMESG000058134.1[more]
SMESG000039812.13.272e-1356.20SMESG000039812.1[more]
SMESG000014734.11.179e-1429.66SMESG000014734.1[more]
SMESG000014734.11.334e-1429.66SMESG000014734.1[more]
SMESG000014734.11.342e-1429.66SMESG000014734.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30008855 ID=SMED30008855|Name=Copper-transporting ATPase 1|organism=Schmidtea mediterranea sexual|type=transcript|length=3467bp
CCAAAAGTTTAATTATTTTTCCATTATTGAACAATCTTGGAAGTATACTT
TATGGATGAAGAAATATATCATTTTGAAATTCTCATTAAAGAAGTTAATG
ATAAAAACCAATTAAAAATAATTGAGGATTTTTTTCAATTTAATGATAAT
ATTAAGACAGTTGTGATTGATTATGAAAAAAATTTAGTGAGAATTTGTTG
TCACAATGACAATTGTACATATTTGACACTGTGCGAAGCCATTGAAAATT
TGGGTTTTTTGATCAACAAAAATAAAGAAACTGATAATACGAAAGAGCTA
TTTAAATGTCATATGAGAATTCAAGGTATGACGTGCTCATCATGTGTCCA
TACAATCGAAAATCAAGTACTAAAATTGAAAGGAGTAAAGTCGGCTTTAA
TTAATTTGTTATCTACCATTGGTGAAGTTACCTATGATCCAGACCTGATA
ATGGCATCTGACATTGCCGATACAATCAATGATATGGGCTTTGATGCTGA
AATATTCCAATTCAAAGAGCATACAAAAGATATAATAGAAGTTATGATTC
AAGGTATGACATGTTCAAGTTGTGTCTACACAATAGAAAGCAAATTAGCT
CAAATGCAGGGAATACTATCCGTAAAGGTTGCTCTGACAACTGAAAAAGG
AAAATTTAAATTCGATCCCCAAATTATTAGCCCTAGAGATATACTTGATG
CGATTGAAGAAATGGGGTTTGATGCCAAATTAGCGCCGAAGAAAACCAAC
AAATACAACGACCATGTGGGAGAATCAATTAAAAAATGGAAACACTCTTT
TTTGATTTCTTTGATTTTTGGCGTCCCAACTATGATAGTGATGATGGTAT
TTATGTACGGTTTTAGTCACAGAATGCAAGTAATACATTTAAAAAACGGT
ATTAATGTCACTGTAATGGTATCTAATGCACCGATTCTTTTTCCTGGCTT
GTCTTTGGAAAATTTACTTTTATTCCTGTTTTCTTCACCTGTTCAATTTT
ATGGAGCCAGATATTTCTATGTTCAAGCTTATAAATCGATAAAACATGGT
TCTGCAAACATGGATGTGCTTGTAGTCATGGCAACCAGTGTGTCTTACAT
ATATTCCTTTATCGTTATTCTTGTCAGTATGATTTTGAGACAAGATTCAA
GTCCACAGACCTTCTTTGAAACAACTCCAATGTTGATTGTGTTTCTTTCT
CTTGGCAGATGGTTAGAACATATAGCTAAAGGTAAGACATCAGAAGCACT
AAGTAAACTTTTGTCCCTTCAAGCATTTGAAGCGACAATTATAGTGAACG
ATAATCAAGAAAGAAAAATCTCAGTTGATCTAGTAAAAAAGGGAGATCTT
GTCAAGGTGCTTCCCGGAGAAAAGATTCCTATTGATGGTAGAGTGGTATC
TGGTAAATCTCGATGTGATGAATCCCTCATCACAGGTGAATCAATGTCAG
TAGAAAAGATTCCCGGCTCTGATGTTATTGGAGGAACTTTAAATATATCT
GGTATGCTTATAATTAGAGCCACTCTTGTCGGCGAAGATTCTGCCCTCAA
TCAAATCGTAAAACTTGTTGAAGAAGCTCAAACGTCAAAAGCTCCTATTC
AAGAATTGGCGGATAAAGTTGCCGGTTTATTTGTTCCCGGTGTAATAATA
TGTTCTATGTTCACATTACTAATTTGGATTGCCATAGGATACACAAATCC
TAATTTGCTCCCAGGACACTCTTCAATTAATACAGATAATACGGAATTGA
TATGGAAATATGCATTCCAATTAGCTATTACAGTGTTAAGTGTAGCATGT
CCATGTTCTCTAGGCCTTGCTACACCGACTGCTGTAATGGTCGGAACCGG
CGTGGGTGCTATTAATGGCATACTAATTAAGGGAGGAGTTCCTTTGGAGA
AGATGCATCAATTAGATGTAATCGTCTTCGACAAAACTGGAACGATAACT
ACAGGAAAACCTTCAGTTACGAATTTTGTAATGTGTGTTGAAAATGTTAC
CAGTCAAATTCGGAATTGCATTCTTCTAATGCTTGGAGCTGCAGAATCCT
CATCAGAACATCCAATTGGCAAAGCTATATTGCAGTATGTTCGAGAGACA
TGCGATATTAATGAAATGCCTCAGGTGGTCCATTCAAAATCTGTTTCGGG
ATTCGGATTAGAATGTTCATTGAAGCTACAATCAGATATGTTCGTTCCAG
ATTCAGAGATTGACAATGTTTTAGTCAAAATAAATGACTTTCAAGAAAAT
AATTTGACAGAGAACTTGAAAGAGACTTCAGTCAAATGGAGAAAAATCAA
TGAACCAGTGGAAGTGGTTCTATACTTAGGAAATCGAAATATGATGAAAG
AGAACCATATTTCAATTCCAGATAAACTGGATGAGTTAATGTCTAGAGAT
GAAGATAATGGTCGTACAGTAGTATTGATGGCTATCGATAAGGTATTATT
GGCGATGATTTCAATTGCTGATCAAGTTAAAAAAGAAGCAGCTTTAGTTG
TATATACATTAGAGAAAATGGGAGTAGAGGTGTTCCTACTTACAGGAGAT
AATCACAAAACAGCTACTGCCATCGCAAAAGAGATTGGAATTCGGAATGT
ATTTGCTGAGGTACTTCCTTCGCATAAAGTTGCTAAAATTCAACAAATTC
AAAACATGTCGAAATATAAACGATCATGGTTGTTCAGTTGTTGTTCAAAG
CCCTCAAAGTTAACAAATGTAGCTATGGTTGGAGATGGAATCAATGACAG
TCCGGCACTTGCACAAGCTGATGTTGGGATAGCAATTGGAACTGGAACAG
ATGTGGCAGTTGAAGCGGCTGACGTAGTTTTGATTCGTAATTCTTTACTT
GATGTTATTGCTGCCATGAAACTAAGCAAAGACACCGTCAGAAGAATCAG
GCAGAATTTTGTTGCAGCTACTATGTACAATCTTATTGGTATTCCAATTG
CGGCAGGTGCCCTTATGCCGATTGGGGTGGTTTTTATGCCTTGGATGGCA
TCAGTAGCCATGGCTGCAAGCTCAATCTGCGTCGTGTGTTTAAGTCTCCT
TTTGAAGTTATGGAAAAAACCAAATGAAGATCAATTGGCTAATCAGGAAT
TCAAAAACCATTTGGAGTGTTTGAAATATGGAGATATGGAAGTTGGAGTA
AATTTAGGCAAAGACATTATTTTACCCAAACGAAAACCCAGACGATCTTT
CAGAAGCAGTATCAGCAGTTTGTGGTCAAGCATGGAAATATCAAAAAAGA
AACCAAATGTTTCAGATCGAATCGCGTTGCTTGAGAATTTTAAAAACGAT
TAGAATACTTCTAGAACACATCACAAGTTTTGGCATAACTTTTTAACTTT
CCCTTTTCCCCACTCACATATTTTAGCATTTTTAGCATTGTTTTAATGAA
TTTATTATCATTTTACTGCAAAATGGCCGATTTGTCAATGTGATCCATAA
TAATAGTTTTTGATCAG
back to top

protein sequence of SMED30008855-orf-1

>SMED30008855-orf-1 ID=SMED30008855-orf-1|Name=SMED30008855-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1084bp
MDEEIYHFEILIKEVNDKNQLKIIEDFFQFNDNIKTVVIDYEKNLVRICC
HNDNCTYLTLCEAIENLGFLINKNKETDNTKELFKCHMRIQGMTCSSCVH
TIENQVLKLKGVKSALINLLSTIGEVTYDPDLIMASDIADTINDMGFDAE
IFQFKEHTKDIIEVMIQGMTCSSCVYTIESKLAQMQGILSVKVALTTEKG
KFKFDPQIISPRDILDAIEEMGFDAKLAPKKTNKYNDHVGESIKKWKHSF
LISLIFGVPTMIVMMVFMYGFSHRMQVIHLKNGINVTVMVSNAPILFPGL
SLENLLLFLFSSPVQFYGARYFYVQAYKSIKHGSANMDVLVVMATSVSYI
YSFIVILVSMILRQDSSPQTFFETTPMLIVFLSLGRWLEHIAKGKTSEAL
SKLLSLQAFEATIIVNDNQERKISVDLVKKGDLVKVLPGEKIPIDGRVVS
GKSRCDESLITGESMSVEKIPGSDVIGGTLNISGMLIIRATLVGEDSALN
QIVKLVEEAQTSKAPIQELADKVAGLFVPGVIICSMFTLLIWIAIGYTNP
NLLPGHSSINTDNTELIWKYAFQLAITVLSVACPCSLGLATPTAVMVGTG
VGAINGILIKGGVPLEKMHQLDVIVFDKTGTITTGKPSVTNFVMCVENVT
SQIRNCILLMLGAAESSSEHPIGKAILQYVRETCDINEMPQVVHSKSVSG
FGLECSLKLQSDMFVPDSEIDNVLVKINDFQENNLTENLKETSVKWRKIN
EPVEVVLYLGNRNMMKENHISIPDKLDELMSRDEDNGRTVVLMAIDKVLL
AMISIADQVKKEAALVVYTLEKMGVEVFLLTGDNHKTATAIAKEIGIRNV
FAEVLPSHKVAKIQQIQNMSKYKRSWLFSCCSKPSKLTNVAMVGDGINDS
PALAQADVGIAIGTGTDVAVEAADVVLIRNSLLDVIAAMKLSKDTVRRIR
QNFVAATMYNLIGIPIAAGALMPIGVVFMPWMASVAMAASSICVVCLSLL
LKLWKKPNEDQLANQEFKNHLECLKYGDMEVGVNLGKDIILPKRKPRRSF
RSSISSLWSSMEISKKKPNVSDRIALLENFKND*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0098655cation transmembrane transport
GO:0030001metal ion transport
GO:0006810transport
GO:0006811ion transport
GO:0006812cation transport
GO:0006825copper ion transport
GO:0006878cellular copper ion homeostasis
GO:0006882cellular zinc ion homeostasis
GO:0007595lactation
GO:0015677copper ion import
GO:0015680intracellular copper ion transport
GO:0035434copper ion transmembrane transport
GO:0046688response to copper ion
GO:0051208sequestering of calcium ion
GO:0060003copper ion export
GO:0099132ATP hydrolysis coupled cation transmembrane transport
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000044cephalic ganglia
PLANA:0000099neuron
PLANA:0000421tail
PLANA:0002142parenchyma
Vocabulary: INTERPRO
TermDefinition
IPR027256P-typ_ATPase_IB
IPR006122HMA_Cu_ion-bd
IPR001757P_typ_ATPase
IPR036412HAD-like_sf
IPR023298ATPase_P-typ_TM_dom_sf
IPR036163HMA_dom_sf
IPR008250ATPase_P-typ_transduc_dom_A_sf
IPR006121HMA_dom
IPR023214HAD_sf
IPR023299ATPase_P-typ_cyto_dom_N
IPR017969Heavy-metal-associated_CS
IPR018303ATPase_P-typ_P_site
Vocabulary: molecular function
TermDefinition
GO:0046872metal ion binding
GO:0000166nucleotide binding
GO:0004008copper-exporting ATPase activity
GO:0005375copper ion transmembrane transporter activity
GO:0005507copper ion binding
GO:0005524ATP binding
GO:0016787hydrolase activity
GO:0019829cation-transporting ATPase activity
GO:0043682copper-transporting ATPase activity
Vocabulary: cellular component
TermDefinition
GO:0005768endosome
GO:0005770late endosome
GO:0005794Golgi apparatus
GO:0005802trans-Golgi network
GO:0016020membrane
GO:0016021integral component of membrane
GO:0016323basolateral plasma membrane
GO:0031410cytoplasmic vesicle
GO:0032588trans-Golgi network membrane
GO:0048471perinuclear region of cytoplasm
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePRINTSPR00119CATATPASEcoord: 456..470
score: 52.14
coord: 625..639
score: 53.89
coord: 893..912
score: 64.82
coord: 823..833
score: 48.26
coord: 916..928
score: 54.2
NoneNo IPR availablePRINTSPR00942CUATPASEIcoord: 111..134
score: 39.58
coord: 140..160
score: 20.95
coord: 184..205
score: 43.64
coord: 300..320
score: 48.57
coord: 250..271
score: 40.91
coord: 320..345
score: 71.92
coord: 85..110
score: 44.62
NoneNo IPR availablePFAMPF00122E1-E2_ATPasecoord: 407..602
e-value: 7.9E-47
score: 159.1
NoneNo IPR availablePFAMPF00702Hydrolasecoord: 622..907
e-value: 4.6E-44
score: 151.2
NoneNo IPR availableGENE3DG3DSA:2.70.150.20coord: 393..510
e-value: 3.0E-41
score: 142.1
NoneNo IPR availableGENE3DG3DSA:3.30.70.100coord: 159..230
e-value: 2.7E-21
score: 77.7
NoneNo IPR availableGENE3DG3DSA:3.30.70.100coord: 80..151
e-value: 2.7E-21
score: 77.7
NoneNo IPR availableSFLDSFLDS00003Haloacid_Dehalogenasecoord: 607..943
e-value: 0.0
score: 176.4
NoneNo IPR availableSFLDSFLDF00027p-type_atpasecoord: 607..943
e-value: 0.0
score: 176.4
NoneNo IPR availablePANTHERPTHR43520:SF9COPPER-TRANSPORTING ATPASE 2coord: 70..1024
NoneNo IPR availablePANTHERPTHR43520FAMILY NOT NAMEDcoord: 70..1024
NoneNo IPR availableCDDcd02094P-type_ATPase_Cu-likecoord: 248..996
e-value: 0.0
score: 867.948
NoneNo IPR availableTMHMMTMhelixcoord: 979..1001
NoneNo IPR availableTMHMMTMhelixcoord: 587..609
NoneNo IPR availableTMHMMTMhelixcoord: 953..975
NoneNo IPR availableTMHMMTMhelixcoord: 371..388
NoneNo IPR availableTMHMMTMhelixcoord: 523..545
NoneNo IPR availableTMHMMTMhelixcoord: 296..318
NoneNo IPR availableTMHMMTMhelixcoord: 339..361
NoneNo IPR availableTMHMMTMhelixcoord: 249..271
IPR027256P-type ATPase, subfamily IBTIGRFAMTIGR01525TIGR01525coord: 337..1001
e-value: 2.2E-188
score: 625.6
IPR006122Heavy metal-associated domain, copper ion-bindingTIGRFAMTIGR00003TIGR00003coord: 86..149
e-value: 3.2E-11
score: 41.3
coord: 163..225
e-value: 1.2E-11
score: 42.7
IPR001757P-type ATPaseTIGRFAMTIGR01494TIGR01494coord: 378..547
e-value: 1.1E-20
score: 71.5
coord: 778..972
e-value: 9.3E-34
score: 114.6
IPR006121Heavy metal-associated domain, HMAPFAMPF00403HMAcoord: 89..148
e-value: 4.4E-11
score: 43.1
coord: 164..224
e-value: 1.3E-12
score: 47.9
IPR006121Heavy metal-associated domain, HMAPROSITEPS50846HMA_2coord: 161..227
score: 21.8
IPR006121Heavy metal-associated domain, HMAPROSITEPS50846HMA_2coord: 85..151
score: 20.642
IPR006121Heavy metal-associated domain, HMACDDcd00371HMAcoord: 163..226
e-value: 4.84722E-16
score: 71.4829
IPR006121Heavy metal-associated domain, HMACDDcd00371HMAcoord: 88..150
e-value: 1.16666E-14
score: 67.2457
IPR018303P-type ATPase, phosphorylation sitePROSITEPS00154ATPASE_E1_E2coord: 627..633
IPR017969Heavy-metal-associated, conserved sitePROSITEPS01047HMA_1coord: 90..119
IPR017969Heavy-metal-associated, conserved sitePROSITEPS01047HMA_1coord: 166..195
IPR008250P-type ATPase, A domain superfamilySUPERFAMILYSSF81653Calcium ATPase, transduction domain Acoord: 413..506
IPR036412HAD-like superfamilySUPERFAMILYSSF56784HAD-likecoord: 623..996
IPR023298P-type ATPase, transmembrane domain superfamilySUPERFAMILYSSF81665Calcium ATPase, transmembrane domain Mcoord: 378..610
IPR036163Heavy metal-associated domain superfamilySUPERFAMILYSSF55008HMA, heavy metal-associated domaincoord: 81..155
IPR036163Heavy metal-associated domain superfamilySUPERFAMILYSSF55008HMA, heavy metal-associated domaincoord: 162..228
IPR023299P-type ATPase, cytoplasmic domain NSUPERFAMILYSSF81660Metal cation-transporting ATPase, ATP-binding domain Ncoord: 657..810