TPA_inf: insulin-like prohormone-1

Overview
NameTPA_inf: insulin-like prohormone-1 (DAA33923.1)
Smed IDSMED30008848
Length (bp)620
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of TPA_inf: insulin-like prohormone-1 (SMED30008848) t-SNE clustered cells

Violin plots show distribution of expression levels for TPA_inf: insulin-like prohormone-1 (SMED30008848) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30008848

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 19

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
cephalic gangliaSMED30008848SMESG000080685.1 BK007034smed_ncbi_20200123PMID:22252538
Miller et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
cephalic gangliaSMED30008848SMESG000080685.1 BK007034smed_ncbi_20200123PMID:22252538
Miller et al., 2012
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
cephalic gangliaSMED30008848SMESG000080685.1 BK007034smed_ncbi_20200123PMID:22252538
Miller et al., 2012
whole organism asexual adult fluorescence in situ hybridization evidence
cephalic gangliaSMED30008848SMESG000080685.1 BK007034smed_ncbi_20200123PMID:22252538
Miller et al., 2012
whole organism adult hermaphrodite fluorescence in situ hybridization evidence
ventral nerve cordSMED30008848SMESG000080685.1 BK007034smed_ncbi_20200123PMID:22252538
Miller et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
ventral nerve cordSMED30008848SMESG000080685.1 BK007034smed_ncbi_20200123PMID:22252538
Miller et al., 2012
whole organism adult hermaphrodite fluorescence in situ hybridization evidence
ventral nerve cordSMED30008848SMESG000080685.1 BK007034smed_ncbi_20200123PMID:22252538
Miller et al., 2012
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
testisSMED30008848SMESG000080685.1 BK007034smed_ncbi_20200123PMID:22252538
Miller et al., 2012
whole organism adult hermaphrodite fluorescence in situ hybridization evidence
testisSMED30008848SMESG000080685.1 BK007034smed_ncbi_20200123PMID:22252538
Miller et al., 2012
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
spermatocyteSMED30008848SMESG000080685.1 BK007034smed_ncbi_20200123PMID:22252538
Miller et al., 2012
whole organism adult hermaphrodite fluorescence in situ hybridization evidence
spermatidSMED30008848SMESG000080685.1 BK007034smed_ncbi_20200123PMID:22252538
Miller et al., 2012
whole organism adult hermaphrodite fluorescence in situ hybridization evidence
head regionSMED30008848SMESG000080685.1 SmedASXL_025561SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
prepharyngeal regionSMED30008848SMESG000080685.1 dd_Smed_v6_13874_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30008848SMESG000080685.1 OX_Smed_1.0.19959ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
cephalic gangliaSMED30008848SMESG000080685.1 BK007034smed_ncbi_20200123PMID:20967238
Collins JJ et al., 2010
whole organism asexual adult colorimetric in situ hybridization evidence
cephalic gangliaSMED30008848SMESG000080685.1 BK007034smed_ncbi_20200123PMID:20967238
Collins JJ et al., 2010
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
ventral nerve cordSMED30008848SMESG000080685.1 BK007034smed_ncbi_20200123PMID:20967238
Collins JJ et al., 2010
whole organism asexual adult colorimetric in situ hybridization evidence
ventral nerve cordSMED30008848SMESG000080685.1 BK007034smed_ncbi_20200123PMID:20967238
Collins JJ et al., 2010
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
testisSMED30008848SMESG000080685.1 BK007034smed_ncbi_20200123PMID:20967238
Collins JJ et al., 2010
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of TPA_inf: insulin-like prohormone-1 vs. TrEMBL
Match: E3CTK9 (Insulin-like prohormone-1 OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 281.952 bits (720), Expect = 9.091e-95
Identity = 137/138 (99.28%), Postives = 137/138 (99.28%), Query Frame = 3
Query:  168 MSKMYFAFYLVVLYIQFYSGEIFKYELYNQSQADLERNLEVRFCQHRLLKAITTLCNNVNINYLRHFFANRTNIMHPIYKYVIRPELLSMASIGRYYSPESINCNAYKKSLVDECCCKSCTMLNLFKYCPSDDEARSL 581
            M KMYFAFYLVVLYIQFYSGEIFKYELYNQSQADLERNLEVRFCQHRLLKAITTLCNNVNINYLRHFFANRTNIMHPIYKYVIRPELLSMASIGRYYSPESINCNAYKKSLVDECCCKSCTMLNLFKYCPSDDEARSL
Sbjct:    1 MLKMYFAFYLVVLYIQFYSGEIFKYELYNQSQADLERNLEVRFCQHRLLKAITTLCNNVNINYLRHFFANRTNIMHPIYKYVIRPELLSMASIGRYYSPESINCNAYKKSLVDECCCKSCTMLNLFKYCPSDDEARSL 138          
BLAST of TPA_inf: insulin-like prohormone-1 vs. Planmine SMEST
Match: SMESG000080685.1 (SMESG000080685.1)

HSP 1 Score: 134.806 bits (338), Expect = 3.003e-41
Identity = 64/64 (100.00%), Postives = 64/64 (100.00%), Query Frame = 3
Query:  390 MHPIYKYVIRPELLSMASIGRYYSPESINCNAYKKSLVDECCCKSCTMLNLFKYCPSDDEARSL 581
            MHPIYKYVIRPELLSMASIGRYYSPESINCNAYKKSLVDECCCKSCTMLNLFKYCPSDDEARSL
Sbjct:    1 MHPIYKYVIRPELLSMASIGRYYSPESINCNAYKKSLVDECCCKSCTMLNLFKYCPSDDEARSL 64          
The following BLAST results are available for this feature:
BLAST of TPA_inf: insulin-like prohormone-1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TPA_inf: insulin-like prohormone-1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TPA_inf: insulin-like prohormone-1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TPA_inf: insulin-like prohormone-1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TPA_inf: insulin-like prohormone-1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TPA_inf: insulin-like prohormone-1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TPA_inf: insulin-like prohormone-1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TPA_inf: insulin-like prohormone-1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 1
Match NameE-valueIdentityDescription
E3CTK99.091e-9599.28Insulin-like prohormone-1 OS=Schmidtea mediterrane... [more]
back to top
BLAST of TPA_inf: insulin-like prohormone-1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TPA_inf: insulin-like prohormone-1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TPA_inf: insulin-like prohormone-1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TPA_inf: insulin-like prohormone-1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TPA_inf: insulin-like prohormone-1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TPA_inf: insulin-like prohormone-1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000080685.13.003e-41100.00SMESG000080685.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30008848
GenBankDAA33923.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30008848 ID=SMED30008848|Name=TPA_inf: insulin-like prohormone-1|organism=Schmidtea mediterranea sexual|type=transcript|length=620bp
ATTTTGAGTAAAAACAATAATTATAAATTTTCGGAGAAAAAATTCAAAAT
AAAACATCCGAAAATGTCCAATAGCGATTGAATTTCAAATACTTGTGTAT
TTCCGTTACAGGTCATTTATTTCATTATAAAAAGAATTTGTATATGTAAC
CTTATCAGAAAGAAAAAATGTCGAAAATGTATTTTGCCTTTTACTTAGTT
GTATTATATATACAGTTTTATTCTGGAGAAATATTCAAATATGAACTCTA
CAATCAATCTCAAGCTGATCTCGAAAGAAATCTCGAAGTCCGATTTTGTC
AACATAGACTTCTGAAAGCCATTACTACTCTTTGTAATAATGTTAACATT
AATTATCTAAGACACTTTTTCGCCAATCGAACTAACATAATGCACCCGAT
TTACAAATACGTAATCAGACCCGAATTATTGTCAATGGCAAGTATTGGTA
GATATTATTCCCCGGAAAGTATTAACTGTAATGCATATAAAAAGTCTTTA
GTTGATGAGTGCTGCTGCAAAAGTTGTACAATGCTGAATTTGTTCAAGTA
CTGTCCTTCAGATGACGAAGCTCGTTCTTTGAAATTCATAAAATAATTCA
CATTCAATAAAACGTTTTGC
back to top

protein sequence of SMED30008848-orf-1

>SMED30008848-orf-1 ID=SMED30008848-orf-1|Name=SMED30008848-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=143bp
MSKMYFAFYLVVLYIQFYSGEIFKYELYNQSQADLERNLEVRFCQHRLLK
AITTLCNNVNINYLRHFFANRTNIMHPIYKYVIRPELLSMASIGRYYSPE
SINCNAYKKSLVDECCCKSCTMLNLFKYCPSDDEARSLKFIK*
back to top
Aliases
The feature 'TPA_inf: insulin-like prohormone-1' has the following synonyms
Synonym
ilp-1
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000044cephalic ganglia
PLANA:0000097ventral nerve cord
PLANA:0000208testis
PLANA:0000221spermatocyte
PLANA:0000222spermatid
PLANA:0000418head
PLANA:0000419prepharyngeal region
Vocabulary: INTERPRO
TermDefinition
IPR036438Insulin-like_sf
IPR016179Insulin-like
IPR022353Insulin_CS
Vocabulary: molecular function
TermDefinition
GO:0005179hormone activity
Vocabulary: cellular component
TermDefinition
GO:0005576extracellular region
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:1.10.100.10coord: 87..135
e-value: 1.6E-5
score: 26.7
IPR022353Insulin, conserved sitePROSITEPS00262INSULINcoord: 115..129
IPR036438Insulin-like superfamilySUPERFAMILYSSF56994Insulin-likecoord: 38..129