Serine/threonine-protein kinase Nek7

Overview
NameSerine/threonine-protein kinase Nek7
Smed IDSMED30008837
Length (bp)1392
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Serine/threonine-protein kinase Nek7 (SMED30008837) t-SNE clustered cells

Violin plots show distribution of expression levels for Serine/threonine-protein kinase Nek7 (SMED30008837) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Serine/threonine-protein kinase Nek7 (SMED30008837) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Serine/threonine-protein kinase Nek7 (SMED30008837) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30008837

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30008837SMESG000055481.1 SmedASXL_014170SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
head regionSMED30008837SMESG000055481.1 dd_Smed_v6_9041_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30008837SMESG000071649.1 SMESG000055481.1 OX_Smed_1.0.08132ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30008837SMESG000055481.1 dd_Smed_v4_9041_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Serine/threonine-protein kinase Nek7 vs. Ensembl Human
Match: NEK7 (NIMA related kinase 7 [Source:HGNC Symbol;Acc:HGNC:13386])

HSP 1 Score: 419.083 bits (1076), Expect = 1.504e-145
Identity = 194/276 (70.29%), Postives = 234/276 (84.78%), Query Frame = 2
Query:  128 AFSNLSKFKIQKKIGRGQFSTVYQACCLEINDKIIALKKVKIFEMMDAKTRRDCIKEIDLLKKLDHPHIIKLISSFIEDNELIIVLELADAGDLSRMIKHFNKQKRLIPERTIWKYFVQICSALEYMHSQRIMHRDIKPANVFITSKGEVKLGDFGLGRFFSTQTSNVHSLVGTPYYMSPERILETGYDMKSDIWSLGCVLYEMAALQSPFYGESLTLAILCQRIEESDYPPLPTRIYSSELRGLVDRCIQTDPNSRPNISHIYHVAKNMHEKTRS 955
             ++ L+ F+I+KKIGRGQFS VY+A CL ++   +ALKKV+IF++MDAK R DCIKEIDLLK+L+HP++IK  +SFIEDNEL IVLELADAGDLSRMIKHF KQKRLIPERT+WKYFVQ+CSALE+MHS+R+MHRDIKPANVFIT+ G VKLGD GLGRFFS++T+  HSLVGTPYYMSPERI E GY+ KSDIWSLGC+LYEMAALQSPFYG+ + L  LC++IE+ DYPPLP+  YS ELR LV+ CI  DP  RP+++++Y VAK MH  T S
Sbjct:   27 GYNTLANFRIEKKIGRGQFSEVYRAACL-LDGVPVALKKVQIFDLMDAKARADCIKEIDLLKQLNHPNVIKYYASFIEDNELNIVLELADAGDLSRMIKHFKKQKRLIPERTVWKYFVQLCSALEHMHSRRVMHRDIKPANVFITATGVVKLGDLGLGRFFSSKTTAAHSLVGTPYYMSPERIHENGYNFKSDIWSLGCLLYEMAALQSPFYGDKMNLYSLCKKIEQCDYPPLPSDHYSEELRQLVNMCINPDPEKRPDVTYVYDVAKRMHACTAS 301          
BLAST of Serine/threonine-protein kinase Nek7 vs. Ensembl Human
Match: NEK7 (NIMA related kinase 7 [Source:HGNC Symbol;Acc:HGNC:13386])

HSP 1 Score: 419.083 bits (1076), Expect = 1.504e-145
Identity = 194/276 (70.29%), Postives = 234/276 (84.78%), Query Frame = 2
Query:  128 AFSNLSKFKIQKKIGRGQFSTVYQACCLEINDKIIALKKVKIFEMMDAKTRRDCIKEIDLLKKLDHPHIIKLISSFIEDNELIIVLELADAGDLSRMIKHFNKQKRLIPERTIWKYFVQICSALEYMHSQRIMHRDIKPANVFITSKGEVKLGDFGLGRFFSTQTSNVHSLVGTPYYMSPERILETGYDMKSDIWSLGCVLYEMAALQSPFYGESLTLAILCQRIEESDYPPLPTRIYSSELRGLVDRCIQTDPNSRPNISHIYHVAKNMHEKTRS 955
             ++ L+ F+I+KKIGRGQFS VY+A CL ++   +ALKKV+IF++MDAK R DCIKEIDLLK+L+HP++IK  +SFIEDNEL IVLELADAGDLSRMIKHF KQKRLIPERT+WKYFVQ+CSALE+MHS+R+MHRDIKPANVFIT+ G VKLGD GLGRFFS++T+  HSLVGTPYYMSPERI E GY+ KSDIWSLGC+LYEMAALQSPFYG+ + L  LC++IE+ DYPPLP+  YS ELR LV+ CI  DP  RP+++++Y VAK MH  T S
Sbjct:   27 GYNTLANFRIEKKIGRGQFSEVYRAACL-LDGVPVALKKVQIFDLMDAKARADCIKEIDLLKQLNHPNVIKYYASFIEDNELNIVLELADAGDLSRMIKHFKKQKRLIPERTVWKYFVQLCSALEHMHSRRVMHRDIKPANVFITATGVVKLGDLGLGRFFSSKTTAAHSLVGTPYYMSPERIHENGYNFKSDIWSLGCLLYEMAALQSPFYGDKMNLYSLCKKIEQCDYPPLPSDHYSEELRQLVNMCINPDPEKRPDVTYVYDVAKRMHACTAS 301          
BLAST of Serine/threonine-protein kinase Nek7 vs. Ensembl Human
Match: NEK6 (NIMA related kinase 6 [Source:HGNC Symbol;Acc:HGNC:7749])

HSP 1 Score: 409.838 bits (1052), Expect = 1.148e-141
Identity = 191/268 (71.27%), Postives = 230/268 (85.82%), Query Frame = 2
Query:  137 NLSKFKIQKKIGRGQFSTVYQACCLEINDKIIALKKVKIFEMMDAKTRRDCIKEIDLLKKLDHPHIIKLISSFIEDNELIIVLELADAGDLSRMIKHFNKQKRLIPERTIWKYFVQICSALEYMHSQRIMHRDIKPANVFITSKGEVKLGDFGLGRFFSTQTSNVHSLVGTPYYMSPERILETGYDMKSDIWSLGCVLYEMAALQSPFYGESLTLAILCQRIEESDYPPLPTRIYSSELRGLVDRCIQTDPNSRPNISHIYHVAKNMH 940
            +L+ F+I+KKIGRGQFS VY+A CL ++ K +ALKKV+IFEMMDAK R+DC+KEI LLK+L+HP+IIK + SFIEDNEL IVLELADAGDLS+MIK+F KQKRLIPERT+WKYFVQ+CSA+E+MHS+R+MHRDIKPANVFIT+ G VKLGD GLGRFFS++T+  HSLVGTPYYMSPERI E GY+ KSDIWSLGC+LYEMAALQSPFYG+ + L  LCQ+IE+ DYPPLP   YS +LR LV  CI  DP+ RP+I +++ VAK MH
Sbjct:   41 SLADFQIEKKIGRGQFSEVYKATCL-LDRKTVALKKVQIFEMMDAKARQDCVKEIGLLKQLNHPNIIKYLDSFIEDNELNIVLELADAGDLSQMIKYFKKQKRLIPERTVWKYFVQLCSAVEHMHSRRVMHRDIKPANVFITATGVVKLGDLGLGRFFSSETTAAHSLVGTPYYMSPERIHENGYNFKSDIWSLGCLLYEMAALQSPFYGDKMNLFSLCQKIEQCDYPPLPGEHYSEKLRELVSMCICPDPHQRPDIGYVHQVAKQMH 307          
BLAST of Serine/threonine-protein kinase Nek7 vs. Ensembl Human
Match: NEK6 (NIMA related kinase 6 [Source:HGNC Symbol;Acc:HGNC:7749])

HSP 1 Score: 409.838 bits (1052), Expect = 1.148e-141
Identity = 191/268 (71.27%), Postives = 230/268 (85.82%), Query Frame = 2
Query:  137 NLSKFKIQKKIGRGQFSTVYQACCLEINDKIIALKKVKIFEMMDAKTRRDCIKEIDLLKKLDHPHIIKLISSFIEDNELIIVLELADAGDLSRMIKHFNKQKRLIPERTIWKYFVQICSALEYMHSQRIMHRDIKPANVFITSKGEVKLGDFGLGRFFSTQTSNVHSLVGTPYYMSPERILETGYDMKSDIWSLGCVLYEMAALQSPFYGESLTLAILCQRIEESDYPPLPTRIYSSELRGLVDRCIQTDPNSRPNISHIYHVAKNMH 940
            +L+ F+I+KKIGRGQFS VY+A CL ++ K +ALKKV+IFEMMDAK R+DC+KEI LLK+L+HP+IIK + SFIEDNEL IVLELADAGDLS+MIK+F KQKRLIPERT+WKYFVQ+CSA+E+MHS+R+MHRDIKPANVFIT+ G VKLGD GLGRFFS++T+  HSLVGTPYYMSPERI E GY+ KSDIWSLGC+LYEMAALQSPFYG+ + L  LCQ+IE+ DYPPLP   YS +LR LV  CI  DP+ RP+I +++ VAK MH
Sbjct:   41 SLADFQIEKKIGRGQFSEVYKATCL-LDRKTVALKKVQIFEMMDAKARQDCVKEIGLLKQLNHPNIIKYLDSFIEDNELNIVLELADAGDLSQMIKYFKKQKRLIPERTVWKYFVQLCSAVEHMHSRRVMHRDIKPANVFITATGVVKLGDLGLGRFFSSETTAAHSLVGTPYYMSPERIHENGYNFKSDIWSLGCLLYEMAALQSPFYGDKMNLFSLCQKIEQCDYPPLPGEHYSEKLRELVSMCICPDPHQRPDIGYVHQVAKQMH 307          
BLAST of Serine/threonine-protein kinase Nek7 vs. Ensembl Human
Match: NEK6 (NIMA related kinase 6 [Source:HGNC Symbol;Acc:HGNC:7749])

HSP 1 Score: 409.838 bits (1052), Expect = 1.148e-141
Identity = 191/268 (71.27%), Postives = 230/268 (85.82%), Query Frame = 2
Query:  137 NLSKFKIQKKIGRGQFSTVYQACCLEINDKIIALKKVKIFEMMDAKTRRDCIKEIDLLKKLDHPHIIKLISSFIEDNELIIVLELADAGDLSRMIKHFNKQKRLIPERTIWKYFVQICSALEYMHSQRIMHRDIKPANVFITSKGEVKLGDFGLGRFFSTQTSNVHSLVGTPYYMSPERILETGYDMKSDIWSLGCVLYEMAALQSPFYGESLTLAILCQRIEESDYPPLPTRIYSSELRGLVDRCIQTDPNSRPNISHIYHVAKNMH 940
            +L+ F+I+KKIGRGQFS VY+A CL ++ K +ALKKV+IFEMMDAK R+DC+KEI LLK+L+HP+IIK + SFIEDNEL IVLELADAGDLS+MIK+F KQKRLIPERT+WKYFVQ+CSA+E+MHS+R+MHRDIKPANVFIT+ G VKLGD GLGRFFS++T+  HSLVGTPYYMSPERI E GY+ KSDIWSLGC+LYEMAALQSPFYG+ + L  LCQ+IE+ DYPPLP   YS +LR LV  CI  DP+ RP+I +++ VAK MH
Sbjct:   41 SLADFQIEKKIGRGQFSEVYKATCL-LDRKTVALKKVQIFEMMDAKARQDCVKEIGLLKQLNHPNIIKYLDSFIEDNELNIVLELADAGDLSQMIKYFKKQKRLIPERTVWKYFVQLCSAVEHMHSRRVMHRDIKPANVFITATGVVKLGDLGLGRFFSSETTAAHSLVGTPYYMSPERIHENGYNFKSDIWSLGCLLYEMAALQSPFYGDKMNLFSLCQKIEQCDYPPLPGEHYSEKLRELVSMCICPDPHQRPDIGYVHQVAKQMH 307          
BLAST of Serine/threonine-protein kinase Nek7 vs. Ensembl Celegans
Match: nekl-3 (Serine/threonine-protein kinase nekl-3 [Source:UniProtKB/Swiss-Prot;Acc:G5EFM9])

HSP 1 Score: 367.081 bits (941), Expect = 1.938e-125
Identity = 170/268 (63.43%), Postives = 218/268 (81.34%), Query Frame = 2
Query:  137 NLSKFKIQKKIGRGQFSTVYQACCLEINDKIIALKKVKIFEMMDAKTRRDCIKEIDLLKKLDHPHIIKLISSFIEDNELIIVLELADAGDLSRMIKHFNKQKRLIPERTIWKYFVQICSALEYMHSQRIMHRDIKPANVFITSKGEVKLGDFGLGRFFSTQTSNVHSLVGTPYYMSPERILETGYDMKSDIWSLGCVLYEMAALQSPFYGESLTLAILCQRIEESDYPPLPTRIYSSELRGLVDRCIQTDPNSRPNISHIYHVAKNMH 940
            +L  F I+KKIG+GQFS V++A C  + D  +ALKK+++FEM+D K R+DC+KEIDLLK+L+H ++I+  +SFI++N+L IVLELA+AGD+SRMIKHF K  RLIPE+TIWKYFVQ+  AL +MHS+RIMHRDIKPANVFIT  G VKLGD GLGRFFS++T+  HSLVGTPYYMSPERI E+GY+ KSD+WS GC+LYEMAALQSPFYG+ + L  LC++IE  +YPPLP  IYS++LR LV RCI  + + RP  S +  VA++M+
Sbjct:   19 SLELFIIEKKIGKGQFSEVFRAQCTWV-DLHVALKKIQVFEMVDQKARQDCLKEIDLLKQLNHVNVIRYYASFIDNNQLNIVLELAEAGDMSRMIKHFKKGGRLIPEKTIWKYFVQLARALAHMHSKRIMHRDIKPANVFITGNGIVKLGDLGLGRFFSSKTTAAHSLVGTPYYMSPERIQESGYNFKSDLWSTGCLLYEMAALQSPFYGDKMNLYSLCKKIENCEYPPLPADIYSTQLRDLVSRCILPEASKRPETSEVLQVAEHMN 285          
BLAST of Serine/threonine-protein kinase Nek7 vs. Ensembl Celegans
Match: nekl-3 (Serine/threonine-protein kinase nekl-3 [Source:UniProtKB/Swiss-Prot;Acc:G5EFM9])

HSP 1 Score: 367.081 bits (941), Expect = 1.938e-125
Identity = 170/268 (63.43%), Postives = 218/268 (81.34%), Query Frame = 2
Query:  137 NLSKFKIQKKIGRGQFSTVYQACCLEINDKIIALKKVKIFEMMDAKTRRDCIKEIDLLKKLDHPHIIKLISSFIEDNELIIVLELADAGDLSRMIKHFNKQKRLIPERTIWKYFVQICSALEYMHSQRIMHRDIKPANVFITSKGEVKLGDFGLGRFFSTQTSNVHSLVGTPYYMSPERILETGYDMKSDIWSLGCVLYEMAALQSPFYGESLTLAILCQRIEESDYPPLPTRIYSSELRGLVDRCIQTDPNSRPNISHIYHVAKNMH 940
            +L  F I+KKIG+GQFS V++A C  + D  +ALKK+++FEM+D K R+DC+KEIDLLK+L+H ++I+  +SFI++N+L IVLELA+AGD+SRMIKHF K  RLIPE+TIWKYFVQ+  AL +MHS+RIMHRDIKPANVFIT  G VKLGD GLGRFFS++T+  HSLVGTPYYMSPERI E+GY+ KSD+WS GC+LYEMAALQSPFYG+ + L  LC++IE  +YPPLP  IYS++LR LV RCI  + + RP  S +  VA++M+
Sbjct:   19 SLELFIIEKKIGKGQFSEVFRAQCTWV-DLHVALKKIQVFEMVDQKARQDCLKEIDLLKQLNHVNVIRYYASFIDNNQLNIVLELAEAGDMSRMIKHFKKGGRLIPEKTIWKYFVQLARALAHMHSKRIMHRDIKPANVFITGNGIVKLGDLGLGRFFSSKTTAAHSLVGTPYYMSPERIQESGYNFKSDLWSTGCLLYEMAALQSPFYGDKMNLYSLCKKIENCEYPPLPADIYSTQLRDLVSRCILPEASKRPETSEVLQVAEHMN 285          
BLAST of Serine/threonine-protein kinase Nek7 vs. Ensembl Celegans
Match: nekl-1 (NEK (NEver in mitosis Kinase) Like [Source:UniProtKB/TrEMBL;Acc:A0A061AD48])

HSP 1 Score: 176.022 bits (445), Expect = 1.765e-47
Identity = 94/279 (33.69%), Postives = 162/279 (58.06%), Query Frame = 2
Query:  128 AFSNLSKFKIQKKIGRGQFSTVYQACCLEINDKIIALKKVKIFEMMDAKTRRDCIKEIDLLKKLDHPHIIKLISSFIEDNELIIVLELADAGDLSRMIKHFNKQKRLIPERTIWKYFVQICSALEYMHSQRIMHRDIKPANVFITSKGEVKLGDFGLGRFFSTQT--SNVHSLVGTPYYMSPERILETGYDMKSDIWSLGCVLYEMAALQSPFYGESLTLAILCQRIEESDYPPLPTRIYSSELRGLVDRCIQTDPNSRPNISHIYHV---AKNMHEKT 949
            A S  ++++  + +G+G F +       E +  ++ +K++ ++++ D+  RR  + E+ LL +++HP+II    SF E+  L+I +E AD G L++M+   ++ + L+ E  I    +Q+CSA+ Y+H   ++HRD+K ANVF+T    VK+GDFG+ +   T+T      ++VGTPYY+SPE      Y+ KSD+W+LGC+LYEM  L+  F G++  L  L   I    Y P+    YS+E++ ++   +Q DP  RP+      +   ++N H  T
Sbjct:  126 ATSAQNRYERIRTVGKGAFGSAVLYRRRE-DSSLVIIKEINMYDL-DSSQRRLALNEVSLLSRIEHPNIIAYYDSFEEEGVLMIEMEYADGGTLAQML---SRTQNLLDEEQIGDMMIQMCSAVAYLHENSVLHRDLKTANVFLTRDSFVKIGDFGISKIMGTETLAQGAKTVVGTPYYISPEMCSGVSYNEKSDMWALGCILYEMCCLKKAFEGDN--LPALVNSIMTCAYTPVKGP-YSAEMKMVIRELLQLDPQKRPSAPQALKMLRPSENRHRHT 396          
BLAST of Serine/threonine-protein kinase Nek7 vs. Ensembl Celegans
Match: nekl-1 (NEK (NEver in mitosis Kinase) Like [Source:UniProtKB/TrEMBL;Acc:A0A061AD48])

HSP 1 Score: 176.022 bits (445), Expect = 2.011e-47
Identity = 94/279 (33.69%), Postives = 162/279 (58.06%), Query Frame = 2
Query:  128 AFSNLSKFKIQKKIGRGQFSTVYQACCLEINDKIIALKKVKIFEMMDAKTRRDCIKEIDLLKKLDHPHIIKLISSFIEDNELIIVLELADAGDLSRMIKHFNKQKRLIPERTIWKYFVQICSALEYMHSQRIMHRDIKPANVFITSKGEVKLGDFGLGRFFSTQT--SNVHSLVGTPYYMSPERILETGYDMKSDIWSLGCVLYEMAALQSPFYGESLTLAILCQRIEESDYPPLPTRIYSSELRGLVDRCIQTDPNSRPNISHIYHV---AKNMHEKT 949
            A S  ++++  + +G+G F +       E +  ++ +K++ ++++ D+  RR  + E+ LL +++HP+II    SF E+  L+I +E AD G L++M+   ++ + L+ E  I    +Q+CSA+ Y+H   ++HRD+K ANVF+T    VK+GDFG+ +   T+T      ++VGTPYY+SPE      Y+ KSD+W+LGC+LYEM  L+  F G++  L  L   I    Y P+    YS+E++ ++   +Q DP  RP+      +   ++N H  T
Sbjct:  164 ATSAQNRYERIRTVGKGAFGSAVLYRRRE-DSSLVIIKEINMYDL-DSSQRRLALNEVSLLSRIEHPNIIAYYDSFEEEGVLMIEMEYADGGTLAQML---SRTQNLLDEEQIGDMMIQMCSAVAYLHENSVLHRDLKTANVFLTRDSFVKIGDFGISKIMGTETLAQGAKTVVGTPYYISPEMCSGVSYNEKSDMWALGCILYEMCCLKKAFEGDN--LPALVNSIMTCAYTPVKGP-YSAEMKMVIRELLQLDPQKRPSAPQALKMLRPSENRHRHT 434          
BLAST of Serine/threonine-protein kinase Nek7 vs. Ensembl Celegans
Match: nekl-2 (Serine/threonine-protein kinase nekl-2 [Source:UniProtKB/Swiss-Prot;Acc:O01775])

HSP 1 Score: 162.925 bits (411), Expect = 9.206e-46
Identity = 96/261 (36.78%), Postives = 148/261 (56.70%), Query Frame = 2
Query:  167 IGRGQFSTVYQACCLEINDKIIALKKVKIFEM--MDAKTRRDCIKEIDLLKKLDHPHIIKLISSFIEDNELIIVLELADAGDLSRMIKHFNKQKRL--------IPERTIWKYFVQICSALEYMHSQRIMHRDIKPANVFITSKGEV-KLGDFGLGRFFSTQTSNVHSLVGTPYYMSPERILETGYDMKSDIWSLGCVLYEMAALQSPFYGESLTLAILCQRIEESDYPPLPTRIYSSELRGLVDRCIQTDPNSRPNISHI 916
            +GRG F   +   C   ND       +K+     M  K       E++LLKK+ HP II  I SFI DN+L IV++ A+ G L R+I   N Q+ +         PE+T+  YF QI  AL +MH + I+HRD+KP N+ +  +  V KL DFG+ +   T+++   +++GTP Y+SPE      Y+ KSD+WSLGCVLYE+  L+  F GE+L   ++  +I  S   PL   + S++++ LV+  ++T  + RP++S +
Sbjct:   10 VGRGAFGVCW--LCRGKNDASHQKVIIKLINTHGMTEKEENSIQSEVNLLKKVQHPLIIGYIDSFIMDNQLGIVMQYAEGGTLERLI---NDQRAIKDSNMREYFPEKTVLDYFTQILIALNHMHQKNIVHRDLKPQNILMNRRKTVLKLSDFGISKELGTKSA-ASTVIGTPNYLSPEICESRPYNQKSDMWSLGCVLYELLQLERAFDGENLPAIVM--KITRSKQNPLGDHV-SNDVKMLVENLLKTHTDKRPDVSQL 261          
BLAST of Serine/threonine-protein kinase Nek7 vs. Ensembl Fly
Match: niki (gene:FBgn0045980 transcript:FBtr0084737)

HSP 1 Score: 179.104 bits (453), Expect = 1.390e-48
Identity = 100/266 (37.59%), Postives = 158/266 (59.40%), Query Frame = 2
Query:  128 AFSNLSKFKIQKKIGRGQF--STVYQACCLEINDKIIALKKVKIFEMMDAKTRRDCIKEIDLLKKLDHPHIIKLISSFIEDNELIIVLELADAGDLSRMIKHFNKQKRL-IPERTIWKYFVQICSALEYMHSQRIMHRDIKPANVFITSKGEVKLGDFGLGRFFSTQTSNVHSLVGTPYYMSPERILETGYDMKSDIWSLGCVLYEMAALQSPFYGESLTLAILCQRIEESDYPPLPTRIYSSELRGLVDRCIQTDPNSRPNISHI 916
            A   L+ ++  + +G+G F  + +Y+    + +   I  K++ + E+     R   + E+D+  KL HP+I+  + SFI+DN L+I +E AD G L+++I    +Q +L  PER I   F QI SA+ YMHS+ I+HRD+K ANVF+  +G VK+GDFG+ +  +T+  +  +++GTPYY SPE      YD KSDIW+LGC+L EM  L+  F   +L+   L  +I   +Y P+P+  Y+S LR L+   +Q +   RP  S +
Sbjct:   98 AGPELANYEKVRVVGQGSFGIAILYRR---KSDGHQIVFKQINLSEL-SPPGRDLAMNEVDVFSKLHHPNIVSYLGSFIKDNTLLIEMEYADGGTLAQIIAE--RQGKLHFPERYIIAVFEQISSAINYMHSENILHRDLKTANVFLNRRGIVKIGDFGISKIMNTKI-HAQTVLGTPYYFSPEMCEGKEYDNKSDIWALGCILGEMCCLKKTFAASNLSE--LVTKIMAGNYTPVPSG-YTSGLRSLMSNLLQVEAPRRPTASEV 353          
BLAST of Serine/threonine-protein kinase Nek7 vs. Ensembl Fly
Match: Nek2 (gene:FBgn0029970 transcript:FBtr0071142)

HSP 1 Score: 172.94 bits (437), Expect = 9.611e-47
Identity = 97/282 (34.40%), Postives = 156/282 (55.32%), Query Frame = 2
Query:  137 NLSKFKIQKKIGRGQFSTVYQACCLEINDK----IIALKKVKIFEMMDAKTRRDCIKEIDLLKKLDHPHIIKLISSFI--EDNELIIVLELADAGDLSRMIKHFNKQKRLIPERTIWKYFVQICSALEYMHSQ----RIMHRDIKPANVFITSKGEVKLGDFGLGRFFSTQTSNVHSLVGTPYYMSPERILETGYDMKSDIWSLGCVLYEMAALQSPFYGESLTLAILCQRIEESDYPPLPTRIYSSELRGLVDRCIQTDPNSRPNISHIYH---VAKNMHE 943
             L  +++   +G G F T     C ++ DK    + A K +   E+ +AK     + EI +L++L HP+I++     +  E   + IV+E    GDL+++++    Q++   E  IW+   Q+C AL+  H++     I+HRDIKPAN+F+ + G  KLGDFGL R      S   S VGTP+YMSPE +    YD KSD+W++GC++YEM AL+ PF G +     L ++I + ++  +P  IYS++L+ ++   +  D   RP I  I     V +N+ E
Sbjct:   15 TLQDYEVLAVMGNGSFGT-----CYKVRDKSTGELFAWKGMNYDELDEAKCD-ALVSEISVLRQLQHPNIVQYYHHLVNREAKSVYIVMECCAGGDLAQIVQRARSQRQRFEEPYIWRVLFQLCRALQVCHNKIPNGTILHRDIKPANIFLDAAGNAKLGDFGLARMLRRDQSFAASFVGTPHYMSPELVKGRKYDRKSDVWAVGCLVYEMCALRPPFRGRAFDQ--LSEKIAQGEFSRIPA-IYSTDLQEIIAFMLAVDHEQRPGIEVIIRHPLVVRNISE 287          
BLAST of Serine/threonine-protein kinase Nek7 vs. Ensembl Fly
Match: fu (gene:FBgn0001079 transcript:FBtr0074602)

HSP 1 Score: 147.132 bits (370), Expect = 1.216e-37
Identity = 86/253 (33.99%), Postives = 135/253 (53.36%), Query Frame = 2
Query:  140 LSKFKIQKKIGRGQFSTVYQACCLEINDKIIALKKVKIFEMMDAKTRRDCIKEIDLLKKLDHPHIIKLISSFIEDNELIIVLELADAGDLSRMIKHFNKQKRLIPERTIWKYFVQICSALEYMHSQRIMHRDIKPANVFITSKGEVKLGDFGLGRFFSTQTSNVHSLVGTPYYMSPERILETGYDMKSDIWSLGCVLYEMAALQSPFYGESLTLAILCQRIEESDYPPLPTRIYSSELRGLVDRCIQTDPNSR 898
            ++++ +   +G+G F  VY+A   + + K++A+K +        K  ++  +E D+  +L HPH+I++I SF    +L +V E A   DL R +  +N      P R +  + V   SAL Y+HS RI+HRD+KP NV +      KL DFGL R  +  T  + S+ GTP YM+PE + E  YD  +D+WSLGC+ YE  A Q PF   S+   +   + E+  +P       +SE R  +   ++ DP  R
Sbjct:    1 MNRYAVSSMVGQGSFGCVYKATRKD-DSKVVAIKVISK-RGRATKELKNLRRECDIQARLKHPHVIEMIESFESKTDLFVVTEFA-LMDLHRYLS-YNGAMGEEPARRVTGHLV---SALYYLHSNRILHRDLKPQNVLLDKNMHAKLCDFGLARNMTLGTHVLTSIKGTPLYMAPELLAEQPYDHHADMWSLGCIAYESMAGQPPFCASSILHLVKMIKHEDVKWP----STLTSECRSFLQGLLEKDPGLR 242          
BLAST of Serine/threonine-protein kinase Nek7 vs. Ensembl Fly
Match: GckIII (gene:FBgn0266465 transcript:FBtr0083399)

HSP 1 Score: 145.591 bits (366), Expect = 1.643e-37
Identity = 82/252 (32.54%), Postives = 140/252 (55.56%), Query Frame = 2
Query:  149 FKIQKKIGRGQFSTVYQACCLEINDKIIALKKVKIFEMMDAKTRRDCIK-EIDLLKKLDHPHIIKLISSFIEDNELIIVLELADAGDLSRMIKHFNKQKRLIPERTIWKYFVQICSALEYMHSQRIMHRDIKPANVFITSKGEVKLGDFGLGRFFSTQTSNVHSLVGTPYYMSPERILETGYDMKSDIWSLGCVLYEMAALQSPFYGESLTLAILCQRIEESDYPPLPTRIYSSELRGLVDRCIQTDPNSRP 901
            F  Q++IG+G F  V++     I+++   +  +KI ++ +A+   D I+ EI +L + D P++ K   SF++  +L I++E    G    ++K  +       E  I     ++   L+Y+HS+R +HRDIK ANV ++ +G+VKL DFG+    +  TS  ++ VGTP++M+PE I ++ YD K+DIWSLG    E+A  + P   E   + +L   +   + PP  T  Y+   +  V+ C+  DP +RP
Sbjct:   13 FTKQERIGKGSFGEVFKG----IDNRTQQVVAIKIIDLEEAEDEIDDIQQEIMVLSQCDSPYVTKYYGSFLKGTKLWIIMEYLGGGSALDLMKAGS-----FEEMHIGIILREVLKGLDYLHSERKLHRDIKAANVLLSEQGDVKLADFGVAGQLTNTTSKRNTFVGTPFWMAPEVIKQSQYDAKADIWSLGITAIELAKGEPP-NSELHPMRVLF--LIPKNNPPQLTGSYTKSFKDFVEACLNKDPENRP 252          
BLAST of Serine/threonine-protein kinase Nek7 vs. Ensembl Fly
Match: Aduk (gene:FBgn0037679 transcript:FBtr0082056)

HSP 1 Score: 135.961 bits (341), Expect = 8.706e-35
Identity = 86/267 (32.21%), Postives = 146/267 (54.68%), Query Frame = 2
Query:  140 LSKFKIQKKIGRGQFSTVYQACCLEINDKIIALKKVKIFEM--MDAKTRRDCIKEIDLLKKLDHPHIIKLISSFIEDNELIIVLELADAGDLSRMIKHFNKQKRLIPERTIWKYFVQICSALEYMHSQRIMHRDIKPANVFITSKGE---VKLGDFGLGRFFSTQTSNVHSLVGTPYYMSPERILETGYDMKSDIWSLGCVLYEMAALQSPFYGESLTLAILCQRIEESDYPPLP--TRIYSSELRGLVDRCIQTDPNSRPNISHIY 919
            ++ F+I +K+G G ++TVY+A     + K      +K  EM  +   +R + I EI LL++L H +I+ L   F +D  + IVLE  +AG+LS  I+     K+ +PE T   +  Q+ +A++YM +  + H D+KP N+ +T       +K+ DFG  +       N   L G+P YM+PE + +  YD K+D+WS+G +LYE    ++P+   S T+  L  RI +++   LP   RI S+E   L+ R +  +P +R + +  +
Sbjct:    6 ITDFEILEKLGAGSYATVYKA----RHKKQRTYHAIKYVEMSTLSQTSRENLITEIRLLRELKHKYIVTLQDFFWDDKNIYIVLEYCNAGNLSAFIR----TKKALPESTCRYFLRQLAAAVQYMRANDVSHFDLKPQNLLLTRGANNVSLKVADFGFAQHLKLGEIN-QQLKGSPLYMAPEIVRKHQYDAKADLWSIGVILYECLFGKAPY--SSRTIEELLLRIRKAEAITLPPNARI-SNECHDLLRRLLAHEPTARISFADFF 260          
BLAST of Serine/threonine-protein kinase Nek7 vs. Ensembl Zebrafish
Match: nek7 (NIMA-related kinase 7 [Source:ZFIN;Acc:ZDB-GENE-040801-136])

HSP 1 Score: 408.683 bits (1049), Expect = 9.106e-142
Identity = 187/273 (68.50%), Postives = 235/273 (86.08%), Query Frame = 2
Query:  128 AFSNLSKFKIQKKIGRGQFSTVYQACCLEINDKIIALKKVKIFEMMDAKTRRDCIKEIDLLKKLDHPHIIKLISSFIEDNELIIVLELADAGDLSRMIKHFNKQKRLIPERTIWKYFVQICSALEYMHSQRIMHRDIKPANVFITSKGEVKLGDFGLGRFFSTQTSNVHSLVGTPYYMSPERILETGYDMKSDIWSLGCVLYEMAALQSPFYGESLTLAILCQRIEESDYPPLPTRIYSSELRGLVDRCIQTDPNSRPNISHIYHVAKNMHEK 946
             +++L+ F I+KKIGRGQFS VY+A  + ++  I+ALKK++IF++MDAK R+DCIKEIDLLK+L+HP++IK  +SFIE+NEL IVLELADAGDLS+MI+HF KQ+RLIPE+T+WKYFVQ+CSALE+MHS+RIMHRDIKPANVFIT+ G VKLGD GLGRFFS++T+  HSLVGTPYYMSPERI E GY+ KSDIWSLGC+LYEMAALQSPFYG+ + L  LC++IE+ DYPPLP+  YS ELR LVD CI  DP  RP+I+++Y +AK+MH +
Sbjct:   23 GYNSLANFAIEKKIGRGQFSEVYRATYV-LDHTIVALKKIQIFDLMDAKARQDCIKEIDLLKQLNHPNVIKYHASFIEENELNIVLELADAGDLSQMIRHFKKQRRLIPEKTVWKYFVQLCSALEHMHSRRIMHRDIKPANVFITATGVVKLGDLGLGRFFSSKTTAAHSLVGTPYYMSPERIHENGYNFKSDIWSLGCLLYEMAALQSPFYGDKMNLYSLCKKIEQCDYPPLPSDHYSQELRKLVDMCINPDPEKRPDITYVYSMAKHMHGR 294          
BLAST of Serine/threonine-protein kinase Nek7 vs. Ensembl Zebrafish
Match: nek6 (NIMA-related kinase 6 [Source:ZFIN;Acc:ZDB-GENE-040724-133])

HSP 1 Score: 391.734 bits (1005), Expect = 1.653e-135
Identity = 182/269 (67.66%), Postives = 221/269 (82.16%), Query Frame = 2
Query:  149 FKIQKKIGRGQFSTVYQACCLEINDKIIALKKVKIFEMMDAKTRRDCIKEIDLLKKLDHPHIIKLISSFIEDNELIIVLELADAGDLSRMIKHFNKQKRLIPERTIWKYFVQICSALEYMHSQRIMHRDIKPANVFITSKGEVKLGDFGLGRFFSTQTSNVHSLVGTPYYMSPERILETGYDMKSDIWSLGCVLYEMAALQSPFYGESLTLAILCQRIEESDYPPLPTRIYSSELRGLVDRCIQTDPNSRPNISHIYHVAKNMHEKTRS 955
            F I+KKIGRGQFS VY+A CL +N++ +ALKKV+IFEMMDAK R+DC+KEIDLLK+L+HP++IK + SFI +NEL IVLELA AGDLS+MI HF K++RLIPERTIWKYFVQ+CSALE+MHS+R+MHRDIKPANVFIT+ GEVKLGD GLGRFFS++T+  HSLVGTPYYMSPERI E GY+ KSDIWSLGC+LYEMAAL SPFY + + L  LC +IE+ +YPPLPT  YS + R LV  CI  +P+ RP+IS +   +  M   T S
Sbjct:    2 FLIEKKIGRGQFSEVYRATCL-LNNQKVALKKVQIFEMMDAKARQDCVKEIDLLKQLNHPNVIKYLDSFIANNELNIVLELASAGDLSQMIMHFKKKRRLIPERTIWKYFVQLCSALEHMHSRRVMHRDIKPANVFITASGEVKLGDLGLGRFFSSKTTAAHSLVGTPYYMSPERIHENGYNFKSDIWSLGCLLYEMAALHSPFYSDKMNLLSLCHKIEQCEYPPLPTEHYSQKFRDLVSMCINPEPDQRPDISFVLQFSTQMKLWTTS 269          
BLAST of Serine/threonine-protein kinase Nek7 vs. Ensembl Zebrafish
Match: nek6 (NIMA-related kinase 6 [Source:ZFIN;Acc:ZDB-GENE-040724-133])

HSP 1 Score: 319.316 bits (817), Expect = 3.598e-107
Identity = 158/274 (57.66%), Postives = 193/274 (70.44%), Query Frame = 2
Query:  134 SNLSKFKIQKKIGRGQFSTVYQACCLEINDKIIALKKVKIFEMMDAKTRRDCIKEIDLLKKLDHPHIIKLISSFIEDNELIIVLELADAGDLSRMIKHFNKQKRLIPERTIWKYFVQICSALEYMHSQRIMHRDIKPANVFITSKGEVKLGDFGLGRFFSTQTSNVHSLVGTPYYMSPERILETGYDMKSDIWSLGCVLYEMAALQSPFYGESLTLAILCQRIEESDYPPLPTRIYSSELRGLVDRCIQTDPNSRPNISHIYHVAKNMHEKTRS 955
            SNLS F I+KKIGRGQFS VY+A CL +N++ +ALKKV+IFEMMDAK R+DC+KEIDLLK+L+HP++IK + SFI +NEL IVLELA AGDLS+MI HF K++RLIPERTIWKYFVQ+CSALE+MHS+R+MHR                                    VGTPYYMSPERI E GY+ KSDIWSLGC+LYEMAAL SPFY + + L  LC +IE+ +YPPLPT  YS + R LV  CI  +P+ RP+IS +   +  M   T S
Sbjct:   18 SNLSNFLIEKKIGRGQFSEVYRATCL-LNNQKVALKKVQIFEMMDAKARQDCVKEIDLLKQLNHPNVIKYLDSFIANNELNIVLELASAGDLSQMIMHFKKKRRLIPERTIWKYFVQLCSALEHMHSRRVMHR------------------------------------VGTPYYMSPERIHENGYNFKSDIWSLGCLLYEMAALHSPFYSDKMNLLSLCHKIEQCEYPPLPTEHYSQKFRDLVSMCINPEPDQRPDISFVLQFSTQMKLWTTS 254          
BLAST of Serine/threonine-protein kinase Nek7 vs. Ensembl Zebrafish
Match: nek1 (NIMA-related kinase 1 [Source:ZFIN;Acc:ZDB-GENE-040730-1])

HSP 1 Score: 180.644 bits (457), Expect = 4.773e-53
Identity = 98/259 (37.84%), Postives = 151/259 (58.30%), Query Frame = 2
Query:  140 LSKFKIQKKIGRGQFSTVYQACCLEINDKIIALKKVKIFEMMDAKTRRDCIKEIDLLKKLDHPHIIKLISSFIEDNELIIVLELADAGDLSRMIKHFNKQKRLIPERTIWKYFVQICSALEYMHSQRIMHRDIKPANVFITSKGEVKLGDFGLGRFFSTQTSNVHSLVGTPYYMSPERILETGYDMKSDIWSLGCVLYEMAALQSPFYGESLTLAILCQRIEESDYPPLPTRIYSSELRGLVDRCIQTDPNSRPNISHI 916
            + K++  KKIG G F           + +   +K++ I  M + K R++  KE+ +L  + HP+I++   SF E   L IV++  + GDL + I   N++  L PE  I  +FVQIC AL+++H ++I+HRDIK  N+F+T  G V+LGDFG+ R  ++      + +GTPYY+SPE      Y+ KSDIW+LGCVLYEM  L+  F  E+  +  L  +I    YPP+    YS +LR L+ +  + +P  RP++S I
Sbjct:    1 MDKYERLKKIGEGSFGKAILVKS-RTDGRQYVIKEIGISRMSN-KERQESRKEVAVLANMSHPNIVQYKESFEESGCLYIVMDYCEGGDLFKKIN--NQRGSLFPEEQILDWFVQICLALKHVHDRKILHRDIKSQNIFLTKDGTVQLGDFGIARVLNSTVELARTCIGTPYYLSPEICENKPYNNKSDIWALGCVLYEMCTLKHAF--EAGNMKNLVLKIIRGSYPPVSIH-YSPDLRSLLAQLFKRNPRERPSVSTI 252          
BLAST of Serine/threonine-protein kinase Nek7 vs. Ensembl Zebrafish
Match: CABZ01040556.1 (NIMA related kinase 3 [Source:NCBI gene;Acc:100536894])

HSP 1 Score: 164.081 bits (414), Expect = 2.874e-45
Identity = 94/273 (34.43%), Postives = 149/273 (54.58%), Query Frame = 2
Query:  140 LSKFKIQKKIGRGQFSTVYQACCLEINDKIIALKKVKI--FEMMDAKTRRDCIKEIDLLKKLDHPHIIKLISSFIEDNELIIVLELADAGDLSRMIKHFNKQKRLIPERTIWKYFVQICSALEYMHSQRIMHRDIKPANVFITSKGEVKLGDFGLGRFFSTQTSNVHSLVGTPYYMSPERILETGYDMKSDIWSLGCVLYEMAALQSPFYGESLTLAILCQRIEESDYPPLPTRIYSSELRGLVDRCIQTDPNSRPNISHI---YHVAKNMHE 943
            + ++ + + IG G F        +   +K   +K++++   E    K+R + +    LL K+ HP+I+    SF  D  L IV+E    GDL + I+  N+   L  E  I K+F Q+C   +++H +R++HRD+K  N+F+T  G VK+GDFG     ++  +   + VGTPYY+SPE      Y+ KSD+WSLGCVLYE+  LQ PF   S    IL  ++    Y PLP+  +  EL  L+    +T+P  RP+I  I   + V++ +H+
Sbjct:    1 MDQYSVVRVIGEGSFGRALLVQPIH-EEKHYVMKEIRLPKAESGMKKSRSEAV----LLSKMKHPNIVAFRDSFEADGHLYIVMEFCSGGDLMQRIRQQNR--LLFSEEQILKWFAQMCLGTKHIHDKRVLHRDLKSKNIFLTDSGTVKVGDFGSACSLNSAKAYAQTYVGTPYYVSPEIWDNKPYNNKSDVWSLGCVLYELCTLQHPFQARSWKSLIL--QVCRGSYAPLPSH-FPYELHYLIKHMFKTNPKDRPSIHTILSSHRVSRLLHK 263          
BLAST of Serine/threonine-protein kinase Nek7 vs. Ensembl Xenopus
Match: nek6 (NIMA-related kinase 6 [Source:NCBI gene;Acc:448328])

HSP 1 Score: 415.616 bits (1067), Expect = 1.560e-144
Identity = 195/273 (71.43%), Postives = 233/273 (85.35%), Query Frame = 2
Query:  137 NLSKFKIQKKIGRGQFSTVYQACCLEINDKIIALKKVKIFEMMDAKTRRDCIKEIDLLKKLDHPHIIKLISSFIEDNELIIVLELADAGDLSRMIKHFNKQKRLIPERTIWKYFVQICSALEYMHSQRIMHRDIKPANVFITSKGEVKLGDFGLGRFFSTQTSNVHSLVGTPYYMSPERILETGYDMKSDIWSLGCVLYEMAALQSPFYGESLTLAILCQRIEESDYPPLPTRIYSSELRGLVDRCIQTDPNSRPNISHIYHVAKNMHEKTRS 955
            NL+ FKI+KKIGRGQFS VY+A C  ++ K +ALKKV+IFEMMDAK R+DCIKEIDLLK+L+HP++IK + SFIEDNEL IVLELADAGDLS+MIK+F KQKRLIPERT+WKYFVQ+CSA+E+MHS+RIMHRDIKPANVFIT+ G VKLGD GLGRFFS++T+  HSLVGTPYYMSPERI E GY+ KSDIWSLGC+LYEMAALQSPFYG+ ++L  LCQ+IE+ DYPPLP   YS +LR LV  CI  DP+ RP+I +++ +AK MH  T S
Sbjct:   12 NLADFKIEKKIGRGQFSEVYRATC-HLDRKPVALKKVQIFEMMDAKARQDCIKEIDLLKQLNHPNVIKYLDSFIEDNELNIVLELADAGDLSQMIKYFKKQKRLIPERTVWKYFVQLCSAVEHMHSRRIMHRDIKPANVFITATGVVKLGDLGLGRFFSSKTTAAHSLVGTPYYMSPERIHENGYNFKSDIWSLGCLLYEMAALQSPFYGDKMSLFSLCQKIEQCDYPPLPKEHYSEKLRELVSMCIYPDPDQRPDIGYVHQIAKQMHVWTSS 283          
BLAST of Serine/threonine-protein kinase Nek7 vs. Ensembl Xenopus
Match: nek6 (NIMA-related kinase 6 [Source:NCBI gene;Acc:448328])

HSP 1 Score: 415.616 bits (1067), Expect = 2.067e-144
Identity = 195/273 (71.43%), Postives = 233/273 (85.35%), Query Frame = 2
Query:  137 NLSKFKIQKKIGRGQFSTVYQACCLEINDKIIALKKVKIFEMMDAKTRRDCIKEIDLLKKLDHPHIIKLISSFIEDNELIIVLELADAGDLSRMIKHFNKQKRLIPERTIWKYFVQICSALEYMHSQRIMHRDIKPANVFITSKGEVKLGDFGLGRFFSTQTSNVHSLVGTPYYMSPERILETGYDMKSDIWSLGCVLYEMAALQSPFYGESLTLAILCQRIEESDYPPLPTRIYSSELRGLVDRCIQTDPNSRPNISHIYHVAKNMHEKTRS 955
            NL+ FKI+KKIGRGQFS VY+A C  ++ K +ALKKV+IFEMMDAK R+DCIKEIDLLK+L+HP++IK + SFIEDNEL IVLELADAGDLS+MIK+F KQKRLIPERT+WKYFVQ+CSA+E+MHS+RIMHRDIKPANVFIT+ G VKLGD GLGRFFS++T+  HSLVGTPYYMSPERI E GY+ KSDIWSLGC+LYEMAALQSPFYG+ ++L  LCQ+IE+ DYPPLP   YS +LR LV  CI  DP+ RP+I +++ +AK MH  T S
Sbjct:   15 NLADFKIEKKIGRGQFSEVYRATC-HLDRKPVALKKVQIFEMMDAKARQDCIKEIDLLKQLNHPNVIKYLDSFIEDNELNIVLELADAGDLSQMIKYFKKQKRLIPERTVWKYFVQLCSAVEHMHSRRIMHRDIKPANVFITATGVVKLGDLGLGRFFSSKTTAAHSLVGTPYYMSPERIHENGYNFKSDIWSLGCLLYEMAALQSPFYGDKMSLFSLCQKIEQCDYPPLPKEHYSEKLRELVSMCIYPDPDQRPDIGYVHQIAKQMHVWTSS 286          
BLAST of Serine/threonine-protein kinase Nek7 vs. Ensembl Xenopus
Match: nek6 (NIMA-related kinase 6 [Source:NCBI gene;Acc:448328])

HSP 1 Score: 415.616 bits (1067), Expect = 2.572e-144
Identity = 195/273 (71.43%), Postives = 233/273 (85.35%), Query Frame = 2
Query:  137 NLSKFKIQKKIGRGQFSTVYQACCLEINDKIIALKKVKIFEMMDAKTRRDCIKEIDLLKKLDHPHIIKLISSFIEDNELIIVLELADAGDLSRMIKHFNKQKRLIPERTIWKYFVQICSALEYMHSQRIMHRDIKPANVFITSKGEVKLGDFGLGRFFSTQTSNVHSLVGTPYYMSPERILETGYDMKSDIWSLGCVLYEMAALQSPFYGESLTLAILCQRIEESDYPPLPTRIYSSELRGLVDRCIQTDPNSRPNISHIYHVAKNMHEKTRS 955
            NL+ FKI+KKIGRGQFS VY+A C  ++ K +ALKKV+IFEMMDAK R+DCIKEIDLLK+L+HP++IK + SFIEDNEL IVLELADAGDLS+MIK+F KQKRLIPERT+WKYFVQ+CSA+E+MHS+RIMHRDIKPANVFIT+ G VKLGD GLGRFFS++T+  HSLVGTPYYMSPERI E GY+ KSDIWSLGC+LYEMAALQSPFYG+ ++L  LCQ+IE+ DYPPLP   YS +LR LV  CI  DP+ RP+I +++ +AK MH  T S
Sbjct:   19 NLADFKIEKKIGRGQFSEVYRATC-HLDRKPVALKKVQIFEMMDAKARQDCIKEIDLLKQLNHPNVIKYLDSFIEDNELNIVLELADAGDLSQMIKYFKKQKRLIPERTVWKYFVQLCSAVEHMHSRRIMHRDIKPANVFITATGVVKLGDLGLGRFFSSKTTAAHSLVGTPYYMSPERIHENGYNFKSDIWSLGCLLYEMAALQSPFYGDKMSLFSLCQKIEQCDYPPLPKEHYSEKLRELVSMCIYPDPDQRPDIGYVHQIAKQMHVWTSS 290          
BLAST of Serine/threonine-protein kinase Nek7 vs. Ensembl Xenopus
Match: nek6 (NIMA-related kinase 6 [Source:NCBI gene;Acc:448328])

HSP 1 Score: 416.001 bits (1068), Expect = 3.517e-144
Identity = 195/273 (71.43%), Postives = 233/273 (85.35%), Query Frame = 2
Query:  137 NLSKFKIQKKIGRGQFSTVYQACCLEINDKIIALKKVKIFEMMDAKTRRDCIKEIDLLKKLDHPHIIKLISSFIEDNELIIVLELADAGDLSRMIKHFNKQKRLIPERTIWKYFVQICSALEYMHSQRIMHRDIKPANVFITSKGEVKLGDFGLGRFFSTQTSNVHSLVGTPYYMSPERILETGYDMKSDIWSLGCVLYEMAALQSPFYGESLTLAILCQRIEESDYPPLPTRIYSSELRGLVDRCIQTDPNSRPNISHIYHVAKNMHEKTRS 955
            NL+ FKI+KKIGRGQFS VY+A C  ++ K +ALKKV+IFEMMDAK R+DCIKEIDLLK+L+HP++IK + SFIEDNEL IVLELADAGDLS+MIK+F KQKRLIPERT+WKYFVQ+CSA+E+MHS+RIMHRDIKPANVFIT+ G VKLGD GLGRFFS++T+  HSLVGTPYYMSPERI E GY+ KSDIWSLGC+LYEMAALQSPFYG+ ++L  LCQ+IE+ DYPPLP   YS +LR LV  CI  DP+ RP+I +++ +AK MH  T S
Sbjct:   38 NLADFKIEKKIGRGQFSEVYRATC-HLDRKPVALKKVQIFEMMDAKARQDCIKEIDLLKQLNHPNVIKYLDSFIEDNELNIVLELADAGDLSQMIKYFKKQKRLIPERTVWKYFVQLCSAVEHMHSRRIMHRDIKPANVFITATGVVKLGDLGLGRFFSSKTTAAHSLVGTPYYMSPERIHENGYNFKSDIWSLGCLLYEMAALQSPFYGDKMSLFSLCQKIEQCDYPPLPKEHYSEKLRELVSMCIYPDPDQRPDIGYVHQIAKQMHVWTSS 309          
BLAST of Serine/threonine-protein kinase Nek7 vs. Ensembl Xenopus
Match: nek6 (NIMA-related kinase 6 [Source:NCBI gene;Acc:448328])

HSP 1 Score: 415.616 bits (1067), Expect = 3.520e-144
Identity = 195/273 (71.43%), Postives = 233/273 (85.35%), Query Frame = 2
Query:  137 NLSKFKIQKKIGRGQFSTVYQACCLEINDKIIALKKVKIFEMMDAKTRRDCIKEIDLLKKLDHPHIIKLISSFIEDNELIIVLELADAGDLSRMIKHFNKQKRLIPERTIWKYFVQICSALEYMHSQRIMHRDIKPANVFITSKGEVKLGDFGLGRFFSTQTSNVHSLVGTPYYMSPERILETGYDMKSDIWSLGCVLYEMAALQSPFYGESLTLAILCQRIEESDYPPLPTRIYSSELRGLVDRCIQTDPNSRPNISHIYHVAKNMHEKTRS 955
            NL+ FKI+KKIGRGQFS VY+A C  ++ K +ALKKV+IFEMMDAK R+DCIKEIDLLK+L+HP++IK + SFIEDNEL IVLELADAGDLS+MIK+F KQKRLIPERT+WKYFVQ+CSA+E+MHS+RIMHRDIKPANVFIT+ G VKLGD GLGRFFS++T+  HSLVGTPYYMSPERI E GY+ KSDIWSLGC+LYEMAALQSPFYG+ ++L  LCQ+IE+ DYPPLP   YS +LR LV  CI  DP+ RP+I +++ +AK MH  T S
Sbjct:   26 NLADFKIEKKIGRGQFSEVYRATC-HLDRKPVALKKVQIFEMMDAKARQDCIKEIDLLKQLNHPNVIKYLDSFIEDNELNIVLELADAGDLSQMIKYFKKQKRLIPERTVWKYFVQLCSAVEHMHSRRIMHRDIKPANVFITATGVVKLGDLGLGRFFSSKTTAAHSLVGTPYYMSPERIHENGYNFKSDIWSLGCLLYEMAALQSPFYGDKMSLFSLCQKIEQCDYPPLPKEHYSEKLRELVSMCIYPDPDQRPDIGYVHQIAKQMHVWTSS 297          
BLAST of Serine/threonine-protein kinase Nek7 vs. Ensembl Mouse
Match: Nek7 (NIMA (never in mitosis gene a)-related expressed kinase 7 [Source:MGI Symbol;Acc:MGI:1890645])

HSP 1 Score: 417.157 bits (1071), Expect = 7.120e-145
Identity = 194/276 (70.29%), Postives = 234/276 (84.78%), Query Frame = 2
Query:  128 AFSNLSKFKIQKKIGRGQFSTVYQACCLEINDKIIALKKVKIFEMMDAKTRRDCIKEIDLLKKLDHPHIIKLISSFIEDNELIIVLELADAGDLSRMIKHFNKQKRLIPERTIWKYFVQICSALEYMHSQRIMHRDIKPANVFITSKGEVKLGDFGLGRFFSTQTSNVHSLVGTPYYMSPERILETGYDMKSDIWSLGCVLYEMAALQSPFYGESLTLAILCQRIEESDYPPLPTRIYSSELRGLVDRCIQTDPNSRPNISHIYHVAKNMHEKTRS 955
             ++ L+ F+I+KKIGRGQFS VY+A CL ++   +ALKKV+IF++MDAK R DCIKEIDLLK+L+HP++IK  +SFIEDNEL IVLELADAGDLSRMIKHF KQKRLIPERT+WKYFVQ+CSAL++MHS+R+MHRDIKPANVFIT+ G VKLGD GLGRFFS++T+  HSLVGTPYYMSPERI E GY+ KSDIWSLGC+LYEMAALQSPFYG+ + L  LC++IE+ DYPPLP+  YS ELR LV+ CI  DP  RP+I+++Y VAK MH  T S
Sbjct:   27 GYNTLANFRIEKKIGRGQFSEVYRASCL-LDGVPVALKKVQIFDLMDAKARADCIKEIDLLKQLNHPNVIKYYASFIEDNELNIVLELADAGDLSRMIKHFKKQKRLIPERTVWKYFVQLCSALDHMHSRRVMHRDIKPANVFITATGVVKLGDLGLGRFFSSKTTAAHSLVGTPYYMSPERIHENGYNFKSDIWSLGCLLYEMAALQSPFYGDKMNLYSLCKKIEQCDYPPLPSDHYSEELRQLVNICINPDPEKRPDIAYVYDVAKRMHACTAS 301          
BLAST of Serine/threonine-protein kinase Nek7 vs. Ensembl Mouse
Match: Nek7 (NIMA (never in mitosis gene a)-related expressed kinase 7 [Source:MGI Symbol;Acc:MGI:1890645])

HSP 1 Score: 417.157 bits (1071), Expect = 7.120e-145
Identity = 194/276 (70.29%), Postives = 234/276 (84.78%), Query Frame = 2
Query:  128 AFSNLSKFKIQKKIGRGQFSTVYQACCLEINDKIIALKKVKIFEMMDAKTRRDCIKEIDLLKKLDHPHIIKLISSFIEDNELIIVLELADAGDLSRMIKHFNKQKRLIPERTIWKYFVQICSALEYMHSQRIMHRDIKPANVFITSKGEVKLGDFGLGRFFSTQTSNVHSLVGTPYYMSPERILETGYDMKSDIWSLGCVLYEMAALQSPFYGESLTLAILCQRIEESDYPPLPTRIYSSELRGLVDRCIQTDPNSRPNISHIYHVAKNMHEKTRS 955
             ++ L+ F+I+KKIGRGQFS VY+A CL ++   +ALKKV+IF++MDAK R DCIKEIDLLK+L+HP++IK  +SFIEDNEL IVLELADAGDLSRMIKHF KQKRLIPERT+WKYFVQ+CSAL++MHS+R+MHRDIKPANVFIT+ G VKLGD GLGRFFS++T+  HSLVGTPYYMSPERI E GY+ KSDIWSLGC+LYEMAALQSPFYG+ + L  LC++IE+ DYPPLP+  YS ELR LV+ CI  DP  RP+I+++Y VAK MH  T S
Sbjct:   27 GYNTLANFRIEKKIGRGQFSEVYRASCL-LDGVPVALKKVQIFDLMDAKARADCIKEIDLLKQLNHPNVIKYYASFIEDNELNIVLELADAGDLSRMIKHFKKQKRLIPERTVWKYFVQLCSALDHMHSRRVMHRDIKPANVFITATGVVKLGDLGLGRFFSSKTTAAHSLVGTPYYMSPERIHENGYNFKSDIWSLGCLLYEMAALQSPFYGDKMNLYSLCKKIEQCDYPPLPSDHYSEELRQLVNICINPDPEKRPDIAYVYDVAKRMHACTAS 301          
BLAST of Serine/threonine-protein kinase Nek7 vs. Ensembl Mouse
Match: Nek6 (NIMA (never in mitosis gene a)-related expressed kinase 6 [Source:MGI Symbol;Acc:MGI:1891638])

HSP 1 Score: 409.068 bits (1050), Expect = 1.483e-141
Identity = 192/273 (70.33%), Postives = 232/273 (84.98%), Query Frame = 2
Query:  137 NLSKFKIQKKIGRGQFSTVYQACCLEINDKIIALKKVKIFEMMDAKTRRDCIKEIDLLKKLDHPHIIKLISSFIEDNELIIVLELADAGDLSRMIKHFNKQKRLIPERTIWKYFVQICSALEYMHSQRIMHRDIKPANVFITSKGEVKLGDFGLGRFFSTQTSNVHSLVGTPYYMSPERILETGYDMKSDIWSLGCVLYEMAALQSPFYGESLTLAILCQRIEESDYPPLPTRIYSSELRGLVDRCIQTDPNSRPNISHIYHVAKNMHEKTRS 955
            +L+ F+I+KKIGRGQFS VY+A CL ++ K +ALKKV+IFEMMDAK R+DC+KEI LLK+L+HP+IIK + SFIEDNEL IVLELADAGDLS+MIK+F KQKRLIPERT+WKYFVQ+CSA+E+MHS+R+MHRDIKPANVFIT+ G VKLGD GLGRFFS++T+  HSLVGTPYYMSPERI E GY+ KSDIWSLGC+LYEMAALQSPFYG+ + L  LCQ+IE+ DYPPLP   YS +LR LV  CI  DP+ RP+I +++ VA+ MH  T S
Sbjct:   41 SLADFQIEKKIGRGQFSEVYKATCL-LDRKTVALKKVQIFEMMDAKARQDCVKEIGLLKQLNHPNIIKYLDSFIEDNELNIVLELADAGDLSQMIKYFKKQKRLIPERTVWKYFVQLCSAVEHMHSRRVMHRDIKPANVFITATGIVKLGDLGLGRFFSSETTAAHSLVGTPYYMSPERIHENGYNFKSDIWSLGCLLYEMAALQSPFYGDKMNLFSLCQKIEQCDYPPLPGEHYSEKLRELVSMCIYPDPDHRPDIVYVHQVARQMHVWTSS 312          
BLAST of Serine/threonine-protein kinase Nek7 vs. Ensembl Mouse
Match: Nek6 (NIMA (never in mitosis gene a)-related expressed kinase 6 [Source:MGI Symbol;Acc:MGI:1891638])

HSP 1 Score: 409.068 bits (1050), Expect = 1.483e-141
Identity = 192/273 (70.33%), Postives = 232/273 (84.98%), Query Frame = 2
Query:  137 NLSKFKIQKKIGRGQFSTVYQACCLEINDKIIALKKVKIFEMMDAKTRRDCIKEIDLLKKLDHPHIIKLISSFIEDNELIIVLELADAGDLSRMIKHFNKQKRLIPERTIWKYFVQICSALEYMHSQRIMHRDIKPANVFITSKGEVKLGDFGLGRFFSTQTSNVHSLVGTPYYMSPERILETGYDMKSDIWSLGCVLYEMAALQSPFYGESLTLAILCQRIEESDYPPLPTRIYSSELRGLVDRCIQTDPNSRPNISHIYHVAKNMHEKTRS 955
            +L+ F+I+KKIGRGQFS VY+A CL ++ K +ALKKV+IFEMMDAK R+DC+KEI LLK+L+HP+IIK + SFIEDNEL IVLELADAGDLS+MIK+F KQKRLIPERT+WKYFVQ+CSA+E+MHS+R+MHRDIKPANVFIT+ G VKLGD GLGRFFS++T+  HSLVGTPYYMSPERI E GY+ KSDIWSLGC+LYEMAALQSPFYG+ + L  LCQ+IE+ DYPPLP   YS +LR LV  CI  DP+ RP+I +++ VA+ MH  T S
Sbjct:   41 SLADFQIEKKIGRGQFSEVYKATCL-LDRKTVALKKVQIFEMMDAKARQDCVKEIGLLKQLNHPNIIKYLDSFIEDNELNIVLELADAGDLSQMIKYFKKQKRLIPERTVWKYFVQLCSAVEHMHSRRVMHRDIKPANVFITATGIVKLGDLGLGRFFSSETTAAHSLVGTPYYMSPERIHENGYNFKSDIWSLGCLLYEMAALQSPFYGDKMNLFSLCQKIEQCDYPPLPGEHYSEKLRELVSMCIYPDPDHRPDIVYVHQVARQMHVWTSS 312          
BLAST of Serine/threonine-protein kinase Nek7 vs. Ensembl Mouse
Match: Nek6 (NIMA (never in mitosis gene a)-related expressed kinase 6 [Source:MGI Symbol;Acc:MGI:1891638])

HSP 1 Score: 407.912 bits (1047), Expect = 3.029e-141
Identity = 192/274 (70.07%), Postives = 231/274 (84.31%), Query Frame = 2
Query:  134 SNLSKFKIQKKIGRGQFSTVYQACCLEINDKIIALKKVKIFEMMDAKTRRDCIKEIDLLKKLDHPHIIKLISSFIEDNELIIVLELADAGDLSRMIKHFNKQKRLIPERTIWKYFVQICSALEYMHSQRIMHRDIKPANVFITSKGEVKLGDFGLGRFFSTQTSNVHSLVGTPYYMSPERILETGYDMKSDIWSLGCVLYEMAALQSPFYGESLTLAILCQRIEESDYPPLPTRIYSSELRGLVDRCIQTDPNSRPNISHIYHVAKNMHEKTRS 955
            S  + F+I+KKIGRGQFS VY+A CL ++ K +ALKKV+IFEMMDAK R+DC+KEI LLK+L+HP+IIK + SFIEDNEL IVLELADAGDLS+MIK+F KQKRLIPERT+WKYFVQ+CSA+E+MHS+R+MHRDIKPANVFIT+ G VKLGD GLGRFFS++T+  HSLVGTPYYMSPERI E GY+ KSDIWSLGC+LYEMAALQSPFYG+ + L  LCQ+IE+ DYPPLP   YS +LR LV  CI  DP+ RP+I +++ VA+ MH  T S
Sbjct:   29 SRPTDFQIEKKIGRGQFSEVYKATCL-LDRKTVALKKVQIFEMMDAKARQDCVKEIGLLKQLNHPNIIKYLDSFIEDNELNIVLELADAGDLSQMIKYFKKQKRLIPERTVWKYFVQLCSAVEHMHSRRVMHRDIKPANVFITATGIVKLGDLGLGRFFSSETTAAHSLVGTPYYMSPERIHENGYNFKSDIWSLGCLLYEMAALQSPFYGDKMNLFSLCQKIEQCDYPPLPGEHYSEKLRELVSMCIYPDPDHRPDIVYVHQVARQMHVWTSS 301          
BLAST of Serine/threonine-protein kinase Nek7 vs. UniProt/SwissProt
Match: sp|Q8TDX7|NEK7_HUMAN (Serine/threonine-protein kinase Nek7 OS=Homo sapiens OX=9606 GN=NEK7 PE=1 SV=1)

HSP 1 Score: 419.083 bits (1076), Expect = 7.221e-145
Identity = 194/276 (70.29%), Postives = 234/276 (84.78%), Query Frame = 2
Query:  128 AFSNLSKFKIQKKIGRGQFSTVYQACCLEINDKIIALKKVKIFEMMDAKTRRDCIKEIDLLKKLDHPHIIKLISSFIEDNELIIVLELADAGDLSRMIKHFNKQKRLIPERTIWKYFVQICSALEYMHSQRIMHRDIKPANVFITSKGEVKLGDFGLGRFFSTQTSNVHSLVGTPYYMSPERILETGYDMKSDIWSLGCVLYEMAALQSPFYGESLTLAILCQRIEESDYPPLPTRIYSSELRGLVDRCIQTDPNSRPNISHIYHVAKNMHEKTRS 955
             ++ L+ F+I+KKIGRGQFS VY+A CL ++   +ALKKV+IF++MDAK R DCIKEIDLLK+L+HP++IK  +SFIEDNEL IVLELADAGDLSRMIKHF KQKRLIPERT+WKYFVQ+CSALE+MHS+R+MHRDIKPANVFIT+ G VKLGD GLGRFFS++T+  HSLVGTPYYMSPERI E GY+ KSDIWSLGC+LYEMAALQSPFYG+ + L  LC++IE+ DYPPLP+  YS ELR LV+ CI  DP  RP+++++Y VAK MH  T S
Sbjct:   27 GYNTLANFRIEKKIGRGQFSEVYRAACL-LDGVPVALKKVQIFDLMDAKARADCIKEIDLLKQLNHPNVIKYYASFIEDNELNIVLELADAGDLSRMIKHFKKQKRLIPERTVWKYFVQLCSALEHMHSRRVMHRDIKPANVFITATGVVKLGDLGLGRFFSSKTTAAHSLVGTPYYMSPERIHENGYNFKSDIWSLGCLLYEMAALQSPFYGDKMNLYSLCKKIEQCDYPPLPSDHYSEELRQLVNMCINPDPEKRPDVTYVYDVAKRMHACTAS 301          
BLAST of Serine/threonine-protein kinase Nek7 vs. UniProt/SwissProt
Match: sp|Q9ES74|NEK7_MOUSE (Serine/threonine-protein kinase Nek7 OS=Mus musculus OX=10090 GN=Nek7 PE=1 SV=1)

HSP 1 Score: 417.157 bits (1071), Expect = 4.981e-144
Identity = 194/276 (70.29%), Postives = 234/276 (84.78%), Query Frame = 2
Query:  128 AFSNLSKFKIQKKIGRGQFSTVYQACCLEINDKIIALKKVKIFEMMDAKTRRDCIKEIDLLKKLDHPHIIKLISSFIEDNELIIVLELADAGDLSRMIKHFNKQKRLIPERTIWKYFVQICSALEYMHSQRIMHRDIKPANVFITSKGEVKLGDFGLGRFFSTQTSNVHSLVGTPYYMSPERILETGYDMKSDIWSLGCVLYEMAALQSPFYGESLTLAILCQRIEESDYPPLPTRIYSSELRGLVDRCIQTDPNSRPNISHIYHVAKNMHEKTRS 955
             ++ L+ F+I+KKIGRGQFS VY+A CL ++   +ALKKV+IF++MDAK R DCIKEIDLLK+L+HP++IK  +SFIEDNEL IVLELADAGDLSRMIKHF KQKRLIPERT+WKYFVQ+CSAL++MHS+R+MHRDIKPANVFIT+ G VKLGD GLGRFFS++T+  HSLVGTPYYMSPERI E GY+ KSDIWSLGC+LYEMAALQSPFYG+ + L  LC++IE+ DYPPLP+  YS ELR LV+ CI  DP  RP+I+++Y VAK MH  T S
Sbjct:   27 GYNTLANFRIEKKIGRGQFSEVYRASCL-LDGVPVALKKVQIFDLMDAKARADCIKEIDLLKQLNHPNVIKYYASFIEDNELNIVLELADAGDLSRMIKHFKKQKRLIPERTVWKYFVQLCSALDHMHSRRVMHRDIKPANVFITATGVVKLGDLGLGRFFSSKTTAAHSLVGTPYYMSPERIHENGYNFKSDIWSLGCLLYEMAALQSPFYGDKMNLYSLCKKIEQCDYPPLPSDHYSEELRQLVNICINPDPEKRPDIAYVYDVAKRMHACTAS 301          
BLAST of Serine/threonine-protein kinase Nek7 vs. UniProt/SwissProt
Match: sp|D3ZBE5|NEK7_RAT (Serine/threonine-protein kinase Nek7 OS=Rattus norvegicus OX=10116 GN=Nek7 PE=2 SV=1)

HSP 1 Score: 416.772 bits (1070), Expect = 6.760e-144
Identity = 194/276 (70.29%), Postives = 234/276 (84.78%), Query Frame = 2
Query:  128 AFSNLSKFKIQKKIGRGQFSTVYQACCLEINDKIIALKKVKIFEMMDAKTRRDCIKEIDLLKKLDHPHIIKLISSFIEDNELIIVLELADAGDLSRMIKHFNKQKRLIPERTIWKYFVQICSALEYMHSQRIMHRDIKPANVFITSKGEVKLGDFGLGRFFSTQTSNVHSLVGTPYYMSPERILETGYDMKSDIWSLGCVLYEMAALQSPFYGESLTLAILCQRIEESDYPPLPTRIYSSELRGLVDRCIQTDPNSRPNISHIYHVAKNMHEKTRS 955
             ++ L+ F+I+KKIGRGQFS VY+A CL ++   +ALKKV+IF++MDAK R DCIKEIDLLK+L+HP++IK  +SFIEDNEL IVLELADAGDLSRMIKHF KQKRLIPERT+WKYFVQ+CSAL++MHS+R+MHRDIKPANVFIT+ G VKLGD GLGRFFS++T+  HSLVGTPYYMSPERI E GY+ KSDIWSLGC+LYEMAALQSPFYG+ + L  LC++IE+ DYPPLP+  YS ELR LV+ CI  DP  RP+I+++Y VAK MH  T S
Sbjct:   27 GYNTLANFRIEKKIGRGQFSEVYRASCL-LDGVPVALKKVQIFDLMDAKARADCIKEIDLLKQLNHPNVIKYYASFIEDNELNIVLELADAGDLSRMIKHFKKQKRLIPERTVWKYFVQLCSALDHMHSRRVMHRDIKPANVFITATGVVKLGDLGLGRFFSSKTTAAHSLVGTPYYMSPERIHENGYNFKSDIWSLGCLLYEMAALQSPFYGDKMNLYSLCKKIEQCDYPPLPSDHYSEELRQLVNICINPDPEKRPDIAYVYDVAKRMHACTAS 301          
BLAST of Serine/threonine-protein kinase Nek7 vs. UniProt/SwissProt
Match: sp|P59895|NEK6_RAT (Serine/threonine-protein kinase Nek6 OS=Rattus norvegicus OX=10116 GN=Nek6 PE=1 SV=1)

HSP 1 Score: 412.535 bits (1059), Expect = 4.249e-142
Identity = 194/273 (71.06%), Postives = 232/273 (84.98%), Query Frame = 2
Query:  137 NLSKFKIQKKIGRGQFSTVYQACCLEINDKIIALKKVKIFEMMDAKTRRDCIKEIDLLKKLDHPHIIKLISSFIEDNELIIVLELADAGDLSRMIKHFNKQKRLIPERTIWKYFVQICSALEYMHSQRIMHRDIKPANVFITSKGEVKLGDFGLGRFFSTQTSNVHSLVGTPYYMSPERILETGYDMKSDIWSLGCVLYEMAALQSPFYGESLTLAILCQRIEESDYPPLPTRIYSSELRGLVDRCIQTDPNSRPNISHIYHVAKNMHEKTRS 955
            +L+ F+I+KKIGRGQFS VY+A CL ++ K +ALKKV+IFEMMDAK R+DC+KEI LLK+L+HP+IIK + SFIEDNEL IVLELADAGDLS+MIK+F KQKRLIPERT+WKYFVQ+CSA+E+MHS+R+MHRDIKPANVFIT+ G VKLGD GLGRFFS++T+  HSLVGTPYYMSPERI E GY+ KSDIWSLGC+LYEMAALQSPFYG+ + L  LCQ+IE+ DYPPLP   YS +LR LV  CI  DPN RP+I +++ VAK MH  T S
Sbjct:   41 SLADFQIEKKIGRGQFSEVYKATCL-LDRKTVALKKVQIFEMMDAKARQDCVKEIGLLKQLNHPNIIKYLDSFIEDNELNIVLELADAGDLSQMIKYFKKQKRLIPERTVWKYFVQLCSAVEHMHSRRVMHRDIKPANVFITATGIVKLGDLGLGRFFSSETTAAHSLVGTPYYMSPERIHENGYNFKSDIWSLGCLLYEMAALQSPFYGDKMNLFSLCQKIEQCDYPPLPGEHYSEKLRELVSMCIYPDPNHRPDIEYVHQVAKQMHVWTSS 312          
BLAST of Serine/threonine-protein kinase Nek7 vs. UniProt/SwissProt
Match: sp|A2BD05|NEK6_PIG (Serine/threonine-protein kinase Nek6 OS=Sus scrofa OX=9823 GN=NEK6 PE=3 SV=1)

HSP 1 Score: 412.149 bits (1058), Expect = 6.361e-142
Identity = 193/273 (70.70%), Postives = 232/273 (84.98%), Query Frame = 2
Query:  137 NLSKFKIQKKIGRGQFSTVYQACCLEINDKIIALKKVKIFEMMDAKTRRDCIKEIDLLKKLDHPHIIKLISSFIEDNELIIVLELADAGDLSRMIKHFNKQKRLIPERTIWKYFVQICSALEYMHSQRIMHRDIKPANVFITSKGEVKLGDFGLGRFFSTQTSNVHSLVGTPYYMSPERILETGYDMKSDIWSLGCVLYEMAALQSPFYGESLTLAILCQRIEESDYPPLPTRIYSSELRGLVDRCIQTDPNSRPNISHIYHVAKNMHEKTRS 955
            +L+ F+I+KKIGRGQFS VY+A CL ++ K +ALKKV+IFEMMDAK R+DC+KEI LLK+L+HP+IIK + SFIEDNEL IVLELADAGDLS+MIK+F KQKRLIPERT+WKYFVQ+CSA+E+MHS+R+MHRDIKPANVFIT+ G VKLGD GLGRFFS++T+  HSLVGTPYYMSPERI E GY+ KSDIWSLGC+LYEMAALQSPFYG+ + L  LCQ+IE+ DYPPLP   YS +LR LV  CI  DPN RP+I +++ VA+ MH  T S
Sbjct:   41 SLADFQIEKKIGRGQFSEVYKATCL-LDRKTVALKKVQIFEMMDAKARQDCVKEIGLLKQLNHPNIIKYLDSFIEDNELNIVLELADAGDLSQMIKYFKKQKRLIPERTVWKYFVQLCSAVEHMHSRRVMHRDIKPANVFITATGIVKLGDLGLGRFFSSETTAAHSLVGTPYYMSPERIHENGYNFKSDIWSLGCLLYEMAALQSPFYGDKMNLFSLCQKIEQCDYPPLPGEHYSEKLRELVSMCIYPDPNQRPDIGYVHQVARQMHVWTSS 312          
BLAST of Serine/threonine-protein kinase Nek7 vs. TrEMBL
Match: A0A267DU22 (Protein kinase domain-containing protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig032178g2 PE=3 SV=1)

HSP 1 Score: 424.476 bits (1090), Expect = 9.739e-145
Identity = 196/272 (72.06%), Postives = 238/272 (87.50%), Query Frame = 2
Query:  131 FSNLSKFKIQKKIGRGQFSTVYQACCLEINDKIIALKKVKIFEMMDAKTRRDCIKEIDLLKKLDHPHIIKLISSFIEDNELIIVLELADAGDLSRMIKHFNKQKRLIPERTIWKYFVQICSALEYMHSQRIMHRDIKPANVFITSKGEVKLGDFGLGRFFSTQTSNVHSLVGTPYYMSPERILETGYDMKSDIWSLGCVLYEMAALQSPFYGESLTLAILCQRIEESDYPPLPTRIYSSELRGLVDRCIQTDPNSRPNISHIYHVAKNMHEK 946
            + +L KF I KKIG+GQFS V++A C E +  +IALKKV+IFEMMDAK R+DCIKEIDLLK+LDHP++I+ ++SFIE+NEL IVLELADAGDLSRMI+HF KQ+RLIPERTIWKYFVQICS L++MHS+RIMHRDIKPANVFIT+ G+VKLGD GLGRFFS++T+N HSLVGTPYYMSPERI ETGY+ KSD+WSLGC+LYEMAALQSPFYGE + L  LC++IE+ DYPPLP  IYS+ELR LV   I ++P++RP+ISH+Y VA++MH K
Sbjct:   11 YGSLDKFNIDKKIGKGQFSEVWRAICKE-DGCVIALKKVQIFEMMDAKARQDCIKEIDLLKQLDHPNVIRYLASFIENNELNIVLELADAGDLSRMIRHFKKQQRLIPERTIWKYFVQICSGLDHMHSKRIMHRDIKPANVFITATGQVKLGDLGLGRFFSSKTTNAHSLVGTPYYMSPERIHETGYNFKSDMWSLGCLLYEMAALQSPFYGEQMNLYSLCKKIEQCDYPPLPADIYSNELRELVVTMISSNPDARPDISHVYQVAQDMHAK 281          
BLAST of Serine/threonine-protein kinase Nek7 vs. TrEMBL
Match: A0A267EEI4 (Protein kinase domain-containing protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig024690g2 PE=3 SV=1)

HSP 1 Score: 424.476 bits (1090), Expect = 1.063e-144
Identity = 196/272 (72.06%), Postives = 238/272 (87.50%), Query Frame = 2
Query:  131 FSNLSKFKIQKKIGRGQFSTVYQACCLEINDKIIALKKVKIFEMMDAKTRRDCIKEIDLLKKLDHPHIIKLISSFIEDNELIIVLELADAGDLSRMIKHFNKQKRLIPERTIWKYFVQICSALEYMHSQRIMHRDIKPANVFITSKGEVKLGDFGLGRFFSTQTSNVHSLVGTPYYMSPERILETGYDMKSDIWSLGCVLYEMAALQSPFYGESLTLAILCQRIEESDYPPLPTRIYSSELRGLVDRCIQTDPNSRPNISHIYHVAKNMHEK 946
            + +L KF I KKIG+GQFS V++A C E +  +IALKKV+IFEMMDAK R+DCIKEIDLLK+LDHP++I+ ++SFIE+NEL IVLELADAGDLSRMI+HF KQ+RLIPERTIWKYFVQICS L++MHS+RIMHRDIKPANVFIT+ G+VKLGD GLGRFFS++T+N HSLVGTPYYMSPERI ETGY+ KSD+WSLGC+LYEMAALQSPFYGE + L  LC++IE+ DYPPLP  IYS+ELR LV   I ++P++RP+ISH+Y VA++MH K
Sbjct:   11 YGSLDKFNIDKKIGKGQFSEVWRAICKE-DGCVIALKKVQIFEMMDAKARQDCIKEIDLLKQLDHPNVIRYLASFIENNELNIVLELADAGDLSRMIRHFKKQQRLIPERTIWKYFVQICSGLDHMHSKRIMHRDIKPANVFITATGQVKLGDLGLGRFFSSKTTNAHSLVGTPYYMSPERIHETGYNFKSDMWSLGCLLYEMAALQSPFYGEQMNLYSLCKKIEQCDYPPLPADIYSNELRELVVTMISSNPDARPDISHVYQVAQDMHAK 281          
BLAST of Serine/threonine-protein kinase Nek7 vs. TrEMBL
Match: A0A267H6D4 (Protein kinase domain-containing protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig033112g2 PE=3 SV=1)

HSP 1 Score: 424.091 bits (1089), Expect = 1.227e-143
Identity = 195/288 (67.71%), Postives = 245/288 (85.07%), Query Frame = 2
Query:   83 PMQVDRQNDQDYQLEAFSNLSKFKIQKKIGRGQFSTVYQACCLEINDKIIALKKVKIFEMMDAKTRRDCIKEIDLLKKLDHPHIIKLISSFIEDNELIIVLELADAGDLSRMIKHFNKQKRLIPERTIWKYFVQICSALEYMHSQRIMHRDIKPANVFITSKGEVKLGDFGLGRFFSTQTSNVHSLVGTPYYMSPERILETGYDMKSDIWSLGCVLYEMAALQSPFYGESLTLAILCQRIEESDYPPLPTRIYSSELRGLVDRCIQTDPNSRPNISHIYHVAKNMHEK 946
            P+Q+ ++N        +S L+  +I+K+IG+GQFS VY+A C+ ++ +++ALKKV+IFEMMDAK R+DCIKEIDLLK+LDHP++I+ ++SFIE+NEL IVLELADAGDLSRMIKHF KQ+RLIPE+TIWKYFVQICS L++MHS+RIMHRDIKPANVFIT+ G+VKLGD GLGRFFS++T+N HSLVGTPYYMSPERI E GY+ KSD+WSLGC+LYEMAALQSPFYG+ + L  LC++IE+ DYPPLP  IYSSELR LV   IQ  P++RP+IS++Y VA+ MH K
Sbjct:   61 PVQLPQEN-------PYSALANLQIEKRIGKGQFSVVYKAHCI-VDGRVVALKKVQIFEMMDAKARQDCIKEIDLLKQLDHPNVIRYLASFIENNELNIVLELADAGDLSRMIKHFKKQQRLIPEKTIWKYFVQICSGLDHMHSKRIMHRDIKPANVFITASGQVKLGDLGLGRFFSSKTTNAHSLVGTPYYMSPERIHENGYNFKSDLWSLGCLLYEMAALQSPFYGDKMNLYSLCKKIEQCDYPPLPADIYSSELRDLVSAMIQPSPDARPDISYVYEVAQRMHAK 340          
BLAST of Serine/threonine-protein kinase Nek7 vs. TrEMBL
Match: A0A267DHE5 (Protein kinase domain-containing protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig032735g1 PE=3 SV=1)

HSP 1 Score: 423.705 bits (1088), Expect = 1.464e-143
Identity = 195/288 (67.71%), Postives = 245/288 (85.07%), Query Frame = 2
Query:   83 PMQVDRQNDQDYQLEAFSNLSKFKIQKKIGRGQFSTVYQACCLEINDKIIALKKVKIFEMMDAKTRRDCIKEIDLLKKLDHPHIIKLISSFIEDNELIIVLELADAGDLSRMIKHFNKQKRLIPERTIWKYFVQICSALEYMHSQRIMHRDIKPANVFITSKGEVKLGDFGLGRFFSTQTSNVHSLVGTPYYMSPERILETGYDMKSDIWSLGCVLYEMAALQSPFYGESLTLAILCQRIEESDYPPLPTRIYSSELRGLVDRCIQTDPNSRPNISHIYHVAKNMHEK 946
            P+Q+ ++N        +S L+  +I+K+IG+GQFS VY+A C+ ++ +++ALKKV+IFEMMDAK R+DCIKEIDLLK+LDHP++I+ ++SFIE+NEL IVLELADAGDLSRMIKHF KQ+RLIPE+TIWKYFVQICS L++MHS+RIMHRDIKPANVFIT+ G+VKLGD GLGRFFS++T+N HSLVGTPYYMSPERI E GY+ KSD+WSLGC+LYEMAALQSPFYG+ + L  LC++IE+ DYPPLP  IYSSELR LV   IQ  P++RP+IS++Y VA+ MH K
Sbjct:   62 PVQLPQEN-------PYSALANLQIEKRIGKGQFSVVYKAHCI-VDGRVVALKKVQIFEMMDAKARQDCIKEIDLLKQLDHPNVIRYLASFIENNELNIVLELADAGDLSRMIKHFKKQQRLIPEKTIWKYFVQICSGLDHMHSKRIMHRDIKPANVFITASGQVKLGDLGLGRFFSSKTTNAHSLVGTPYYMSPERIHENGYNFKSDLWSLGCLLYEMAALQSPFYGDKMNLYSLCKKIEQCDYPPLPADIYSSELRDLVSAMIQPSPDARPDISYVYEVAQRMHAK 341          
BLAST of Serine/threonine-protein kinase Nek7 vs. TrEMBL
Match: A0A1S3JQK3 (serine/threonine-protein kinase Nek7 isoform X1 OS=Lingula unguis OX=7574 GN=LOC106175288 PE=3 SV=1)

HSP 1 Score: 421.779 bits (1083), Expect = 1.899e-143
Identity = 198/277 (71.48%), Postives = 236/277 (85.20%), Query Frame = 2
Query:  110 QDYQLEAFSNLSKFKIQKKIGRGQFSTVYQACCLEINDKIIALKKVKIFEMMDAKTRRDCIKEIDLLKKLDHPHIIKLISSFIEDNELIIVLELADAGDLSRMIKHFNKQKRLIPERTIWKYFVQICSALEYMHSQRIMHRDIKPANVFITSKGEVKLGDFGLGRFFSTQTSNVHSLVGTPYYMSPERILETGYDMKSDIWSLGCVLYEMAALQSPFYGESLTLAILCQRIEESDYPPLPTRIYSSELRGLVDRCIQTDPNSRPNISHIYHVAKNMH 940
            Q +Q + +S L  F+I+KK+GRGQFS VY+A   +IN+  +ALKKV+IFEMMDAK R+DCIKEIDLLK+L+HP++IK ++SFIEDNEL IVLELADAGDLSRMIKHF KQ RLIPERTIWKYF+QICS+LE+MHS+RIMHRDIKPANVFIT++G VKLGD GLGRFFS++T+  HSLVGTPYYMSPERI E GY+ KSDIWSLGC+LYEMAALQSPFYG+ + L  LC++IE+ DYPPLP+  YS ELR LV  CI  DP  RP+I++IY VAK MH
Sbjct:   15 QQHQDDIYSRLVNFEIEKKVGRGQFSVVYRAVN-KINNIPVALKKVQIFEMMDAKARQDCIKEIDLLKQLNHPNVIKYLASFIEDNELNIVLELADAGDLSRMIKHFKKQDRLIPERTIWKYFIQICSSLEHMHSKRIMHRDIKPANVFITAQGVVKLGDLGLGRFFSSKTTAAHSLVGTPYYMSPERIHENGYNFKSDIWSLGCLLYEMAALQSPFYGDKMNLYSLCKKIEQCDYPPLPSDHYSEELRNLVAVCINPDPEQRPDITYIYEVAKKMH 290          
BLAST of Serine/threonine-protein kinase Nek7 vs. Ensembl Cavefish
Match: nek7 (NIMA related kinase 7 [Source:NCBI gene;Acc:103046491])

HSP 1 Score: 419.083 bits (1076), Expect = 1.155e-145
Identity = 193/274 (70.44%), Postives = 236/274 (86.13%), Query Frame = 2
Query:  128 AFSNLSKFKIQKKIGRGQFSTVYQACCLEINDKIIALKKVKIFEMMDAKTRRDCIKEIDLLKKLDHPHIIKLISSFIEDNELIIVLELADAGDLSRMIKHFNKQKRLIPERTIWKYFVQICSALEYMHSQRIMHRDIKPANVFITSKGEVKLGDFGLGRFFSTQTSNVHSLVGTPYYMSPERILETGYDMKSDIWSLGCVLYEMAALQSPFYGESLTLAILCQRIEESDYPPLPTRIYSSELRGLVDRCIQTDPNSRPNISHIYHVAKNMHEKT 949
             +S LS F+I+KKIGRGQFS VY+A  L IN+  +ALKK++IF++MDAK R+DCIKEIDLLK+L+HP++IK  +SFIE+NEL IVLELADAGDLSRMIKHF KQ+RLIPE+T+WKYFVQ+CSALE+MHS+R+MHRDIKPANVFIT+ G VKLGD GLGRFFS++T+  HSLVGTPYYMSPERI E GY+ KSDIWSLGC+LYEMAALQSPFYG+ + L  LC++IE+ DYPPLP+  YS ELR LVD CI  DP  RP+I+++Y++AK+MH  T
Sbjct:   33 GYSTLSNFQIEKKIGRGQFSEVYRARYL-INNTAVALKKIQIFDLMDAKARQDCIKEIDLLKQLNHPNVIKYHASFIEENELNIVLELADAGDLSRMIKHFKKQRRLIPEKTVWKYFVQLCSALEHMHSRRVMHRDIKPANVFITATGVVKLGDLGLGRFFSSKTTAAHSLVGTPYYMSPERIHENGYNFKSDIWSLGCLLYEMAALQSPFYGDKMNLYSLCKKIEQCDYPPLPSDHYSEELRKLVDMCINPDPERRPDIAYVYNIAKHMHALT 305          
BLAST of Serine/threonine-protein kinase Nek7 vs. Ensembl Cavefish
Match: nek6 (NIMA-related kinase 6 [Source:ZFIN;Acc:ZDB-GENE-040724-133])

HSP 1 Score: 396.741 bits (1018), Expect = 5.081e-137
Identity = 188/274 (68.61%), Postives = 227/274 (82.85%), Query Frame = 2
Query:  134 SNLSKFKIQKKIGRGQFSTVYQACCLEINDKIIALKKVKIFEMMDAKTRRDCIKEIDLLKKLDHPHIIKLISSFIEDNELIIVLELADAGDLSRMIKHFNKQKRLIPERTIWKYFVQICSALEYMHSQRIMHRDIKPANVFITSKGEVKLGDFGLGRFFSTQTSNVHSLVGTPYYMSPERILETGYDMKSDIWSLGCVLYEMAALQSPFYGESLTLAILCQRIEESDYPPLPTRIYSSELRGLVDRCIQTDPNSRPNISHIYHVAKNMHEKTRS 955
            S LS F+I+KKIGRGQFS VY+A  L + ++ +ALKKV+IFEMMDAK+R+DCIKEIDLLK+L+HP++IK + SFIEDNEL IVLELADAGDLS MIK+F K++RLIPERTIWKYFVQ+CSA+E+MHS+R+MHRDIKPANVFIT+ G VKLGD GLGRFFS++T+ VHSLVGTPYYMSPERI E GY+ KSDIWSLGC+LYEMAALQSPFY + + L  LCQ+IE+ DYPPLP   +S +LR LV  CI  D + RP+I  +   +K M   T S
Sbjct:   26 SALSNFRIEKKIGRGQFSEVYRATYL-LENQQVALKKVQIFEMMDAKSRQDCIKEIDLLKQLNHPNVIKYLDSFIEDNELNIVLELADAGDLSHMIKYFKKKRRLIPERTIWKYFVQLCSAVEHMHSRRVMHRDIKPANVFITATGVVKLGDLGLGRFFSSKTTVVHSLVGTPYYMSPERIHENGYNFKSDIWSLGCLLYEMAALQSPFYSDQMNLLSLCQKIEQCDYPPLPPEHFSEKLRSLVSMCINPDADERPDIVFVLQFSKQMQLWTAS 298          
BLAST of Serine/threonine-protein kinase Nek7 vs. Ensembl Cavefish
Match: nek7 (NIMA related kinase 7 [Source:NCBI gene;Acc:103046491])

HSP 1 Score: 370.548 bits (950), Expect = 5.872e-127
Identity = 176/274 (64.23%), Postives = 216/274 (78.83%), Query Frame = 2
Query:  128 AFSNLSKFKIQKKIGRGQFSTVYQACCLEINDKIIALKKVKIFEMMDAKTRRDCIKEIDLLKKLDHPHIIKLISSFIEDNELIIVLELADAGDLSRMIKHFNKQKRLIPERTIWKYFVQICSALEYMHSQRIMHRDIKPANVFITSKGEVKLGDFGLGRFFSTQTSNVHSLVGTPYYMSPERILETGYDMKSDIWSLGCVLYEMAALQSPFYGESLTLAILCQRIEESDYPPLPTRIYSSELRGLVDRCIQTDPNSRPNISHIYHVAKNMHEKT 949
             +S LS F+I+KKIGRGQFS VY+A  L IN+  +ALKK++                     +L+HP++IK  +SFIE+NEL IVLELADAGDLSRMIKHF KQ+RLIPE+T+WKYFVQ+CSALE+MHS+R+MHRDIKPANVFIT+ G VKLGD GLGRFFS++T+  HSLVGTPYYMSPERI E GY+ KSDIWSLGC+LYEMAALQSPFYG+ + L  LC++IE+ DYPPLP+  YS ELR LVD CI  DP  RP+I+++Y++AK+MH  T
Sbjct:   33 GYSTLSNFQIEKKIGRGQFSEVYRARYL-INNTAVALKKIQ---------------------QLNHPNVIKYHASFIEENELNIVLELADAGDLSRMIKHFKKQRRLIPEKTVWKYFVQLCSALEHMHSRRVMHRDIKPANVFITATGVVKLGDLGLGRFFSSKTTAAHSLVGTPYYMSPERIHENGYNFKSDIWSLGCLLYEMAALQSPFYGDKMNLYSLCKKIEQCDYPPLPSDHYSEELRKLVDMCINPDPERRPDIAYVYNIAKHMHALT 284          
BLAST of Serine/threonine-protein kinase Nek7 vs. Ensembl Cavefish
Match: nek6 (NIMA-related kinase 6 [Source:ZFIN;Acc:ZDB-GENE-040724-133])

HSP 1 Score: 319.316 bits (817), Expect = 2.781e-107
Identity = 159/272 (58.46%), Postives = 194/272 (71.32%), Query Frame = 2
Query:  140 LSKFKIQKKIGRGQFSTVYQACCLEINDKIIALKKVKIFEMMDAKTRRDCIKEIDLLKKLDHPHIIKLISSFIEDNELIIVLELADAGDLSRMIKHFNKQKRLIPERTIWKYFVQICSALEYMHSQRIMHRDIKPANVFITSKGEVKLGDFGLGRFFSTQTSNVHSLVGTPYYMSPERILETGYDMKSDIWSLGCVLYEMAALQSPFYGESLTLAILCQRIEESDYPPLPTRIYSSELRGLVDRCIQTDPNSRPNISHIYHVAKNMHEKTRS 955
            LS F+I+KKIGRGQFS VY+A  L + ++ +ALKKV+IFEMMDAK+R+DCIKEIDLLK+L+HP++IK + SFIEDNEL IVLELADAGDLS MIK+F K++RLIPERTIWKYFVQ+CSA+E+MHS+R+MHR                                    VGTPYYMSPERI E GY+ KSDIWSLGC+LYEMAALQSPFY + + L  LCQ+IE+ DYPPLP   +S +LR LV  CI  D + RP+I  +   +K M   T S
Sbjct:   17 LSNFRIEKKIGRGQFSEVYRATYL-LENQQVALKKVQIFEMMDAKSRQDCIKEIDLLKQLNHPNVIKYLDSFIEDNELNIVLELADAGDLSHMIKYFKKKRRLIPERTIWKYFVQLCSAVEHMHSRRVMHR------------------------------------VGTPYYMSPERIHENGYNFKSDIWSLGCLLYEMAALQSPFYSDQMNLLSLCQKIEQCDYPPLPPEHFSEKLRSLVSMCINPDADERPDIVFVLQFSKQMQLWTAS 251          
BLAST of Serine/threonine-protein kinase Nek7 vs. Ensembl Cavefish
Match: nek6 (NIMA-related kinase 6 [Source:ZFIN;Acc:ZDB-GENE-040724-133])

HSP 1 Score: 317.39 bits (812), Expect = 2.518e-106
Identity = 163/274 (59.49%), Postives = 196/274 (71.53%), Query Frame = 2
Query:  134 SNLSKFKIQKKIGRGQFSTVYQACCLEINDKIIALKKVKIFEMMDAKTRRDCIKEIDLLKKLDHPHIIKLISSFIEDNELIIVLELADAGDLSRMIKHFNKQKRLIPERTIWKYFVQICSALEYMHSQRIMHRDIKPANVFITSKGEVKLGDFGLGRFFSTQTSNVHSLVGTPYYMSPERILETGYDMKSDIWSLGCVLYEMAALQSPFYGESLTLAILCQRIEESDYPPLPTRIYSSELRGLVDRCIQTDPNSRPNISHIYHVAKNMHEKTRS 955
            S LS F+I+KKIGRGQFS VY+A  L + ++ +ALKKV+IFEMMDAK+R+DCIKEIDLLK+L+HP++IK + SFIEDNEL IVLELADAGDLS MIK  + Q       T+W                      IKPANVFIT+ G VKLGD GLGRFFS++T+ VHSLVGTPYYMSPERI E GY+ KSDIWSLGC+LYEMAALQSPFY + + L  LCQ+IE+ DYPPLP   +S +LR LV  CI  D + RP+I  +   +K M   T S
Sbjct:   25 SALSNFRIEKKIGRGQFSEVYRATYL-LENQQVALKKVQIFEMMDAKSRQDCIKEIDLLKQLNHPNVIKYLDSFIEDNELNIVLELADAGDLSHMIKLPSVQT------TVWH---------------------IKPANVFITATGVVKLGDLGLGRFFSSKTTVVHSLVGTPYYMSPERIHENGYNFKSDIWSLGCLLYEMAALQSPFYSDQMNLLSLCQKIEQCDYPPLPPEHFSEKLRSLVSMCINPDADERPDIVFVLQFSKQMQLWTAS 270          
BLAST of Serine/threonine-protein kinase Nek7 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007414.1 (pep scaffold:Pmarinus_7.0:GL476981:230882:244405:1 gene:ENSPMAG00000006689.1 transcript:ENSPMAT00000007414.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 168.318 bits (425), Expect = 1.067e-48
Identity = 93/258 (36.05%), Postives = 145/258 (56.20%), Query Frame = 2
Query:  140 LSKFKIQKKIGRGQFSTVYQACCLEINDKIIALKKVKIFEMMDAKTRRDCIKEIDLLKKLDHPHIIKLISSFIEDNELIIVLELADAGDLSRMIKHFNKQKR-LIPERTIWKYFVQICSALEYMHSQRIMHRDIKPANVFITSKGEVKLGDFGLGRFFSTQTSNVHSLVGTPYYMSPERILETGYDMKSDIWSLGCVLYEMAALQSPFYGESLTLAILCQRIEESDYPPLPTRIYSSELRGLVDRCIQTDPNSRPNIS 910
            + ++ +  +IG G F         + +  +  +K++ I   M  K R +  KE+ +L  + HP+I+    SF E   L IV++  + GDL    K  N QK  L  E  I  + VQ+C AL+++H ++I+HRDIK  N+F+T  G V+LGDFG+ R  ++ T    + +GTPYY+SPE      Y+ KSD+W+LGCVLYEM  L+  F  E+  +  L  +I    +PP+    YSSELR  +   ++ DP +RP ++
Sbjct:    1 MERYTMVSQIGEGSFGKAMLVKS-KADGHLYVIKEINI-SRMSPKERDEARKEVCVLANMRHPNIVSYKESFEERGNLYIVMDYCEGGDL---FKRINAQKGVLFSEDQILDWLVQLCLALKHVHDRKILHRDIKSQNIFLTKAGIVQLGDFGIARVLNSTTELARTCIGTPYYLSPEICENKPYNHKSDMWALGCVLYEMCTLRHAF--EAGNMKNLVLKIIRGSFPPVSAH-YSSELRSTLSGLLRRDPRARPPVA 250          
BLAST of Serine/threonine-protein kinase Nek7 vs. Ensembl Sea Lamprey
Match: nek2 (NIMA-related kinase 2 [Source:ZFIN;Acc:ZDB-GENE-040426-752])

HSP 1 Score: 160.614 bits (405), Expect = 1.160e-44
Identity = 85/232 (36.64%), Postives = 132/232 (56.90%), Query Frame = 2
Query:  242 KVKIFEMMDAKTRRDCIKEIDLLKKLDHPHIIKLISSFIE--DNELIIVLELADAGDLSRMIKHFNKQKRLIPERTIWKYFVQICSALEYMH-----SQRIMHRDIKPANVFITSKGEVKLGDFGLGRFFSTQTSNVHSLVGTPYYMSPERILETGYDMKSDIWSLGCVLYEMAALQSPFYGESLTLAILCQRIEESDYPPLPTRIYSSELRGLVDRCIQTDPNSRPNISHI 916
            KV  +  M    ++  + E++LL++L HP+I++     I+  +  L IV+E  + GDL+ +I    + +R + E  + +   Q+  AL   H      + ++HRD+KPANVF+ ++  VKLGDFGL R     TS   + VGTPYYMSPE+     Y+ KSDIWSLGC+LYE+ AL  PF   ++    L ++I+E  +  +P R YS EL  ++ + +      RP+I  I
Sbjct:    6 KVLDYGTMSEPEKQMLVSEVNLLRELKHPNIVRYFDRIIDRSNTTLYIVMEYCECGDLASLISRCRRDRRFLEEEFVLRVLAQLVLALRECHRRTAGGRTVLHRDLKPANVFLDARHNVKLGDFGLARILQHDTSFAKTFVGTPYYMSPEQFSRMSYNEKSDIWSLGCLLYELCALVPPF--TAMNQKQLAEKIKEGKFRRIPYR-YSDELNEIISKMLNLKDYLRPSIEQI 234          
BLAST of Serine/threonine-protein kinase Nek7 vs. Ensembl Sea Lamprey
Match: NEK9 (NIMA related kinase 9 [Source:HGNC Symbol;Acc:HGNC:18591])

HSP 1 Score: 158.688 bits (400), Expect = 2.758e-42
Identity = 91/247 (36.84%), Postives = 136/247 (55.06%), Query Frame = 2
Query:  167 IGRGQFSTVYQACCLEIN--DKIIALKKVKIFEMMDAKTRRDCIKEIDLLKKLDHPHIIKLISSFIEDNELIIVLELADAGDLSRMIKHFNKQKRLIPERTIWKYFVQICSALEYMHSQRIMHRDIKPANVFITSKGEVKLGDFGLGRFFSTQTSNVHSLVGTPYYMSPERILETGYDMKSDIWSLGCVLYEMAALQSPFYGESLTLAILCQRIEESDYPPLPTRIYSSELRGLVDRCIQTDPNSRP 901
            +GRG F    +A     N  + ++  K++ +  + D K RRD   EID+L  L+H +II   + F++ N L+I LE  + G L   I    +     PE+ I  YF Q+ SA+E +H+ +I+HRDIK  N+F+T    +K+GDFG+ +   +++    S VGTPYYMSPE I    Y+ KSDIW++GCVLYE+  L   F  ++     LC  I            YS E++ +V +C+Q D   RP
Sbjct:   42 LGRGAFG---EAALYRRNEDNSLVVWKEIDLTRLSD-KERRDSQNEIDILSLLEHANIISYYNHFLDGNVLLIELEYCNGGTLYEKI--IKQHGAFFPEKDIVWYFYQLVSAVEQIHNFKILHRDIKTLNIFLTKSDLIKVGDFGISKILDSRSQMAESYVGTPYYMSPELIRGDKYNTKSDIWAMGCVLYELLTLTRTF--DATNPLKLCYEIIHGKKQVEIDDQYSKEIKEVVQKCLQQDAEQRP 280          
BLAST of Serine/threonine-protein kinase Nek7 vs. Ensembl Sea Lamprey
Match: STK36 (serine/threonine kinase 36 [Source:HGNC Symbol;Acc:HGNC:17209])

HSP 1 Score: 152.525 bits (384), Expect = 5.134e-40
Identity = 87/261 (33.33%), Postives = 143/261 (54.79%), Query Frame = 2
Query:  140 LSKFKIQKKIGRGQFSTVYQACCLEINDKIIALKKVKIFEMMDAKTRRDCIKEIDLLKKLDHPHIIKLISSFIEDNELIIVLELADAGDLSRMIKHFNKQKRLIPERTIWKYFVQICSALEYMHSQRIMHRDIKPANVFITSKGEVKLGDFGLGRFFSTQTSNVHSLVGTPYYMSPERILETGYDMKSDIWSLGCVLYEMAALQSPFYGESLTLAILCQRIEESDYPPLPTRIYSSELRGLVDRCIQTDPNSRPNISHIYH 922
            + K+ + + IG G F  VY+        +++ALK +      D K  R+  +EID+++ L HP+I++++ SF  D E+++V + A+ G+L ++++        +PE  + +   Q+ SAL Y+HS RI+HRD+KP N+ +   G VKL DFG  R  S  T  + S+ GTP YMSPE + E  YD  +D+WS+GC+LYE+     PFY  S+   +     +   +P    +  SSE R  +   +  +P  R +   + H
Sbjct:    1 MEKYHVLEMIGEGSFGKVYKGR-KRYTGQVVALKFIPKVGRSD-KELRNLRREIDIMRGLQHPNIVQMLDSFETDKEVVVVTDYAE-GELFQILEDDGN----LPEEQVREIACQLVSALYYLHSHRILHRDMKPQNILLGKGGVVKLCDFGFARAMSINTLVLTSIKGTPLYMSPELVEEKPYDHTADLWSMGCILYELFVGTPPFYTNSIFQLVSLIIKDPVKWP----KNMSSEFRNFLQGLLTKEPKLRLSWPALLH 250          
BLAST of Serine/threonine-protein kinase Nek7 vs. Ensembl Sea Lamprey
Match: map3k19 (mitogen-activated protein kinase kinase kinase 19 [Source:ZFIN;Acc:ZDB-GENE-081104-140])

HSP 1 Score: 144.05 bits (362), Expect = 5.738e-40
Identity = 81/262 (30.92%), Postives = 133/262 (50.76%), Query Frame = 2
Query:  161 KKIGRGQFSTVYQACCLEINDKIIALKKVKIFEMMDAKTRRDCIK---------EIDLLKKLDHPHIIKLISSFIEDNELIIVLELADAGDLSRMIKHFNKQKRLIPERTIWKYFVQICSALEYMHSQRIMHRDIKPANVFITSKGEVKLGDFGLGRFFST-----QTSNVHSLVGTPYYMSPERILETGYDMKSDIWSLGCVLYEMAALQSPFYGESLTLAILCQRIEESDYPPLPTRIYSSELRGLVDRCIQTDPNSRPN 904
             ++G+G F TV+    L    K+IA+K++++ +   A   +   K         E++LL  L HP++++ + + +E N   I +E    G ++  ++ F      + E     Y  Q+   L Y+H   +MH D+K +N  IT  G VKL DFG  +  +      +   +HS+ GT Y+M+PE I  TGY  ++D+WSLGC L+EMA  + PF   +   A+L   I     P LP + +S E +  V++C   D   RP+
Sbjct:   19 NRLGKGAFGTVFLG--LTNQGKLIAVKELELRDAQSANGNQGGQKQSELQKLQDEVELLTTLHHPNVVEYLGTEMEGNRFSIFMEFVPGGTVAETVRGFGP----LGESVCRSYIAQMTRGLAYLHGHGVMHGDVKGSNAVITPAGVVKLIDFGCAQRVALALSCHENGGLHSVHGTAYWMAPEVINGTGYARRADVWSLGCTLHEMAVGRPPFADMAPMAALLHIGIRNGIMPGLP-QAFSKEAQEFVEQCFIRDKLKRPS 273          
BLAST of Serine/threonine-protein kinase Nek7 vs. Ensembl Yeast
Match: CDC5 (Polo-like kinase; controls targeting and activation of Rho1p at cell division site via Rho1p guanine nucleotide exchange factors; regulates Spc72p; also functions in adaptation to DNA damage during meiosis; regulates the shape of the nucleus and expansion of the nuclear envelope during mitosis; similar to Xenopus Plx1 and S. pombe Plo1p; human homologs PLK1, PLK3 can each complement yeast cdc5 thermosensitive mutants [Source:SGD;Acc:S000004603])

HSP 1 Score: 145.206 bits (365), Expect = 4.612e-38
Identity = 80/255 (31.37%), Postives = 144/255 (56.47%), Query Frame = 2
Query:  167 IGRGQFSTVYQACCLEIND---KIIALKKVKIFEMMDAKTRRDCIKEIDLLKKLDHPHIIKLISSFIEDNELIIVLELADAGDLSRMIKHFNKQKRLIPERTIWKYFVQICSALEYMHSQRIMHRDIKPANVFITSKGEVKLGDFGLGRFFSTQTSNVHSLVGTPYYMSPERIL--ETGYDMKSDIWSLGCVLYEMAALQSPFYGESLTLAILCQRIEESDYPPLPTRIYSSELRGLVDRCIQTDPNSRPNISHI 916
            +G G F     A C +I D   +I A K V    +   KTR+  + EI + K + HP+I++ I  F +D+ + I+LE+   G L  ++K    +++++ E  +  +  QIC A++YMHS+R++HRD+K  N+F  S   +K+GDFGL    + ++   +++ GTP Y++PE ++   +G+  + DIWSLG +LY +   + PF  ++  +  + +RI+  D+     +  S E + L+   +  DP  RP+++ I
Sbjct:   88 LGEGGF-----ARCFQIKDDSGEIFAAKTVAKASIKSEKTRKKLLSEIQIHKSMSHPNIVQFIDCFEDDSNVYILLEICPNGSLMELLK----RRKVLTEPEVRFFTTQICGAIKYMHSRRVIHRDLKLGNIFFDSNYNLKIGDFGLAAVLANESERKYTICGTPNYIAPEVLMGKHSGHSFEVDIWSLGVMLYALLIGKPPF--QARDVNTIYERIKCRDFSFPRDKPISDEGKILIRDILSLDPIERPSLTEI 331          
BLAST of Serine/threonine-protein kinase Nek7 vs. Ensembl Yeast
Match: KIN3 (Nonessential serine/threonine protein kinase; possible role in DNA damage response; influences tolerance to high levels of ethanol [Source:SGD;Acc:S000000071])

HSP 1 Score: 136.346 bits (342), Expect = 4.547e-36
Identity = 96/335 (28.66%), Postives = 156/335 (46.57%), Query Frame = 2
Query:   98 RQNDQDY----QLEAFSNLSKFKIQKKIGRGQFSTVYQACCLEINDKIIALKKVKIFEMMDAKTRRDCIKEIDLLKKLDHPHIIKLIS-SFIEDNE-LIIVLELADAGDLSRMIKHFNKQKRLIPERTIWKYFVQICSALEYMH---------------------SQRIMHRDIKPANVFIT---------------------------------------SKGEVKLGDFGLGRFFSTQTSNVHSLVGTPYYMSPERILETGYDMKSDIWSLGCVLYEMAALQSPFYGESLTLAILCQRIEESDYPPLPTRIYSSELRGLVDRCIQTDPNSRPN 904
            RQ  Q+Y    Q +     S++++ ++IGRG F +V +   + I  K + ++K   +  M++K R+  I E  +L +L H +I++  +  F E  E L + +E    GDLS+MIKH+ ++ + IPE+ +W    Q+ +AL   H                        ++HRD+KP N+F++                                       S+  VKLGDFGL +   T      + VGTPYYMSPE +++  Y   SDIWSLGCV++EM +L  PF  ++     L  +I+      +P   YS  L  ++   I  +  +RP+
Sbjct:    4 RQFFQEYRSPQQQQGHPPRSEYQVLEEIGRGSFGSVRKV--IHIPTKKLLVRKDIKYGHMNSKERQQLIAECSILSQLKHENIVEFYNWDFDEQKEVLYLYMEYCSRGDLSQMIKHYKQEHKYIPEKIVWGILAQLLTALYKCHYGVELPTLTTIYDRMKPPVKGKNIVIHRDLKPGNIFLSYDDSDYNINEQVDGHEEVNSNYYRDHRVNSGKRGSPMDYSQVVVKLGDFGLAKSLETSIQFATTYVGTPYYMSPEVLMDQPYSPLSDIWSLGCVIFEMCSLHPPF--QAKNYLELQTKIKNGKCDTVP-EYYSRGLNAIIHSMIDVNLRTRPS 333          
BLAST of Serine/threonine-protein kinase Nek7 vs. Ensembl Yeast
Match: STE7 (Signal transducing MAP kinase kinase; involved in pheromone response where it phosphorylates Fus3p; involved in the pseudohyphal/invasive growth pathway where it phosphorylates of Kss1p; phosphorylated by Ste11p; degraded by ubiquitin pathway [Source:SGD;Acc:S000002318])

HSP 1 Score: 137.502 bits (345), Expect = 6.746e-36
Identity = 90/271 (33.21%), Postives = 143/271 (52.77%), Query Frame = 2
Query:  164 KIGRGQFSTVYQACCLEINDKIIALKKVKIFEMMDAKTRRDCIKEIDLLKKLD-HPHIIKLISSFIE---DNELIIVLELADAGDLSRMIKHFNK---------QKRLIPERTIWKYFVQICSALEYMHSQ-RIMHRDIKPANVFITSKGEVKLGDFGLGRFFSTQTSNVHSLVGTPYYMSPERILETGYDMKSDIWSLGCVLYEMAALQSPFYGESLT---LAILCQRIEESDYPPLPT-RIYSSELRGLVDRCIQTDPNSRPNISHIYH 922
            KIG G   TV +A  L + D  I  KK    E  ++      ++E+ ++K +  H +II    ++     +NE+II++E +D G L +++  + +         +K    E TI K    + + L++++ Q +I+HRDIKP+NV I SKG++KL DFG+ +      ++  + VGT  YMSPERI    Y +K D+WSLG ++ E+   + P  G + T   +  L QRI     P LP  RIYS E+   V+RC   +   R +I  + H
Sbjct:  196 KIGAGNSGTVVKA--LHVPDSKIVAKKTIPVEQNNSTIINQLVRELSIVKNVKPHENIITFYGAYYNQHINNEIIILMEYSDCGSLDKILSVYKRFVQRGTVSSKKTWFNELTISKIAYGVLNGLDHLYRQYKIIHRDIKPSNVLINSKGQIKLCDFGVSKKLINSIAD--TFVGTSTYMSPERIQGNVYSIKGDVWSLGLMIIELVTGEFPLGGHNDTPDGILDLLQRIVNEPSPRLPKDRIYSKEMTDFVNRCCIKNERERSSIHELLH 462          
BLAST of Serine/threonine-protein kinase Nek7 vs. Ensembl Yeast
Match: SSK22 (MAP kinase kinase kinase of HOG1 mitogen-activated signaling pathway; functionally redundant with Ssk2p; interacts with and is activated by Ssk1p; phosphorylates Pbs2p; SSK22 has a paralog, SSK2, that arose from the whole genome duplication [Source:SGD;Acc:S000000669])

HSP 1 Score: 129.798 bits (325), Expect = 1.344e-32
Identity = 87/294 (29.59%), Postives = 141/294 (47.96%), Query Frame = 2
Query:  167 IGRGQFSTVYQACCLEINDKIIALKKVKIFEMMDAKTRRDCIKE-IDLLKKLDHPHIIKLISSFIEDNELIIVLELADAGDLSRMIKHFNKQKRLIPERTIWKYFVQICSALEYMHSQRIMHRDIKPANVFITSKGEVKLGDFGLGRF----------------FSTQTSNVHSLVGTPYYMSPERILETGYDMK---SDIWSLGCVLYEMAALQSPFYGESLTLAILCQRIEESDYPPLPTRI-YSSELRGLVDRCIQTDPNSR---------PNISHIYHVAKNMHEKTRSP 958
            IG G F  VY A  LE N +I+A+K++KI +    K     IKE + +L+ L+HP+I++     +  +++ I +E  + G L+ ++ H     R+  E     Y  ++   L Y+H   ++HRDIKP N+ +   G +K  DFG  R                 F  +T +++ ++GTP YM+PE I  +    K    D+W+LGCV+ EMA  + P+       AI+   +     P LP R   ++  R  ++RC+  DP  R         P +  I  +A    EK + P
Sbjct: 1040 IGGGTFGQVYSAINLE-NGEILAVKEIKIHDTTTMKKIFPLIKEEMTVLEMLNHPNIVQYYGVEVHRDKVNIFMEYCEGGSLASLLDH----GRIEDEMVTQVYTFELLEGLAYLHQSGVVHRDIKPENILLDFNGIIKYVDFGTARTVVGSRTRTVRNAAVQDFGVETKSLNEMMGTPMYMAPETISGSAVKGKLGADDVWALGCVVLEMATGRRPWSNLDNEWAIMYH-VAAGRIPQLPNRDEMTAAGRAFLERCLVQDPTMRATAVELLIDPWMIQIREIAFGNSEKDQVP 1327          
BLAST of Serine/threonine-protein kinase Nek7 vs. Ensembl Yeast
Match: CDC28 (Cyclin-dependent kinase (CDK) catalytic subunit; master regulator of mitotic and meiotic cell cycles; alternately associates with G1, S, G2/M phase cyclins, which provide substrate specificity; regulates metabolism, basal transcription, chromosome dynamics, growth and morphogenesis; transcript induction in osmostress involves antisense RNA; human homologs CDK1, CDK2, CDK3 can complement yeast conditional cdc28 mutants; human CDK1, CDK2 can complement yeast cdc28 null mutant [Source:SGD;Acc:S000000364])

HSP 1 Score: 122.479 bits (306), Expect = 3.818e-32
Identity = 75/217 (34.56%), Postives = 116/217 (53.46%), Query Frame = 2
Query:  134 SNLSKFKIQKKIGRGQFSTVYQACCLEIND--KIIALKKVKIFEMMDAKTRRDCIKEIDLLKKLDHPHIIKLISSFIED-NELIIVLELADAGDLSRMIKHFNKQKRLIPERTIWKYFVQICSALEYMHSQRIMHRDIKPANVFITSKGEVKLGDFGLGRFFSTQTSNVHSLVGTPYYMSPERILETG-YDMKSDIWSLGCVLYEMAALQSPFYGES 772
              L+ +K  +K+G G +  VY+A  L      +++ALKK+++ E  D       I+EI LLK+L   +I++L      D ++L +V E  D  DL R ++   K + L  +  + K+ +Q+C  + Y HS RI+HRD+KP N+ I   G +KLGDFGL R F          + T +Y +PE +L    Y    D WS+GC+  EM   +  F G+S
Sbjct:    3 GELANYKRLEKVGEGTYGVVYKALDLRPGQGQRVVALKKIRL-ESEDEGVPSTAIREISLLKELKDDNIVRLYDIVHSDAHKLYLVFEFLDL-DLKRYMEGIPKDQPLGAD-IVKKFMMQLCKGIAYCHSHRILHRDLKPQNLLINKDGNLKLGDFGLARAFGVPLRAYTHEIVTLWYRAPEVLLGGKQYSTGVDTWSIGCIFAEMCNRKPIFSGDS 216          
BLAST of Serine/threonine-protein kinase Nek7 vs. Ensembl Nematostella
Match: EDO34646 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SNS0])

HSP 1 Score: 405.601 bits (1041), Expect = 4.754e-141
Identity = 188/276 (68.12%), Postives = 230/276 (83.33%), Query Frame = 2
Query:  113 DYQLEAFSNLSKFKIQKKIGRGQFSTVYQACCLEINDKIIALKKVKIFEMMDAKTRRDCIKEIDLLKKLDHPHIIKLISSFIEDNELIIVLELADAGDLSRMIKHFNKQKRLIPERTIWKYFVQICSALEYMHSQRIMHRDIKPANVFITSKGEVKLGDFGLGRFFSTQTSNVHSLVGTPYYMSPERILETGYDMKSDIWSLGCVLYEMAALQSPFYGESLTLAILCQRIEESDYPPLPTRIYSSELRGLVDRCIQTDPNSRPNISHIYHVAKNMH 940
            D +   ++ L  F+I+KKIGRGQFS VY+A C   N++I+ALKK++IF+MMDAK R+DCIKEIDLLK+L+HP++IK  +SFIE+NEL IVLELADAGDLSRMIKHF KQKRLIPERT+WKYFVQ+ +ALE+MHS+R+MHRDIKPANVFIT+ G VKLGD GLGRFFS++T+  HSLVGTPYYMSPERI E GY+ KSDIWSLGC+LYEMAALQSPFYG+ + L  LC++IE+ DYPPLP   YS +LR LV  CI   P+ RP+I++I  +A  MH
Sbjct:    9 DDEYAVYNCLGNFEIEKKIGRGQFSVVYKARCTA-NNQIVALKKIQIFDMMDAKARQDCIKEIDLLKQLNHPNVIKYYASFIENNELNIVLELADAGDLSRMIKHFKKQKRLIPERTVWKYFVQLTAALEHMHSRRVMHRDIKPANVFITATGVVKLGDLGLGRFFSSKTTAAHSLVGTPYYMSPERIKENGYNFKSDIWSLGCLLYEMAALQSPFYGDKMNLYSLCKKIEQCDYPPLPAEHYSQQLRHLVSLCINPIPDQRPDITYINEIANEMH 283          
BLAST of Serine/threonine-protein kinase Nek7 vs. Ensembl Nematostella
Match: EDO37069 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SGU2])

HSP 1 Score: 185.652 bits (470), Expect = 1.299e-55
Identity = 100/269 (37.17%), Postives = 158/269 (58.74%), Query Frame = 2
Query:  143 SKFKIQKKIGRGQFSTVYQACCLEINDKIIALKKVKIFEMMDAKTRRDCIKEIDLLKKLDHPHIIKLISSFIEDNELIIVLELADAGDLSRMIKHFNKQKRLIPERTIWKYFVQICSALEYMHSQRIMHRDIKPANVFITSKGEVKLGDFGLGRFFSTQTSNVHSLVGTPYYMSPERILETGYDMKSDIWSLGCVLYEMAALQSPFYGESLTLAILCQRIEESDYPPLPTRIYSSELRGLVDRCIQTDPNSRPNISHI---YHVAKNMH 940
            +++++ +++G G F TV+    L+ N +   LK++ + E+   +T  D ++E  LL KL+HP+I+K + SF++     IV E  + GDL   I  + K  +   E  I  +F+QI  A+++MH  RI+HRD+K  N+F+ +   VKLGDFG+ R     +    +  GTPYYMSPE +   GY+ KSDIWSLG VLYE+  LQ  F G+SL   +   +I E + P L  + YSS+L+    R +  DP  RP+ + I   + +A+N++
Sbjct:    4 NRYRVVRRLGSGSFGTVFLVEDLKANGERKVLKEIYVGELQPDETV-DAMREAKLLSKLNHPNIVKFMDSFMDREYFCIVTEYCEGGDLDDKISAWRKSGKKFDESLILAWFIQIVLAVQHMHEMRILHRDLKTRNIFLKNN-IVKLGDFGISRILMGTSDMATTFTGTPYYMSPEVLKHEGYNHKSDIWSLGVVLYELCNLQHAFQGQSLMGVMY--KIVEGELPALSDK-YSSQLQAFYSRLMDKDPKLRPSANEILKHHFIAENIN 267          
BLAST of Serine/threonine-protein kinase Nek7 vs. Ensembl Nematostella
Match: EDO49822 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RG20])

HSP 1 Score: 177.948 bits (450), Expect = 1.566e-52
Identity = 98/254 (38.58%), Postives = 150/254 (59.06%), Query Frame = 2
Query:  161 KKIGRGQFSTVYQACCLEIND-KIIALKKVKIFEMMDAKTRRDCIKEIDLLKKLDHPHIIKLISSFIEDNELIIVLELADAGDLSRMIKHFNKQKRL-IPERTIWKYFVQICSALEYMHSQRIMHRDIKPANVFITSKGEVKLGDFGLGRFFSTQTSNVHSLVGTPYYMSPERILETGYDMKSDIWSLGCVLYEMAALQSPFYGESLTLAILCQRIEESDYPPLPTRIYSSELRGLVDRCIQTDPNSRPNISHI 916
            KKIG G F         + ND K   +K++ I  M   + R +  KE+ +L +L HP+I+    SF E   L IV++  D GDL + I   N Q+ +   E  +  +FVQIC  L+++H ++I+HRDIK  N+F+T  G +K+GDFG+ R   +      + +GTPYY+SPE +    Y+ KSDIWSLGCVLYEM  L+  F  E+  +  L  +I    YPP+P R YS+++R LV + ++ +P+ RP+++ +
Sbjct:    8 KKIGEGSFGKA--LLVKKRNDGKHYVIKEINICRM-KPREREESRKEVKVLSQLKHPNIVSYQESFEESGNLYIVMDYCDGGDLYKKI---NGQRGIAFSEDQVMDWFVQICLGLKHVHDRKILHRDIKSQNIFLTRHGIIKMGDFGIARVLHSTVELARTCIGTPYYLSPEIVENRPYNNKSDIWSLGCVLYEMLTLKHAF--EAGNMKNLVLKIIRGSYPPIPLR-YSADIRMLVAQLLKRNPHDRPSVNTV 252          
BLAST of Serine/threonine-protein kinase Nek7 vs. Ensembl Nematostella
Match: EDO37413 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFU9])

HSP 1 Score: 173.326 bits (438), Expect = 1.101e-50
Identity = 94/269 (34.94%), Postives = 158/269 (58.74%), Query Frame = 2
Query:  140 LSKFKIQKKIGRGQFSTVYQACCLEI----NDKIIALKKVKIFEMMDAKTRRDCIKEIDLLKKLDHPHIIKLISSFIE--DNELIIVLELADAGDLSRMIKHFNKQKRLIPERTIWKYFVQICSALEYMHSQR----IMHRDIKPANVFITSKGEVKLGDFGLGRFFSTQTSNVHSLVGTPYYMSPERILETGYDMKSDIWSLGCVLYEMAALQSPFYGESLTLAILCQRIEESDYPPLPTRIYSSELRGLVDRCIQTDPNSRPNISHI 916
            L  ++  ++IG G +       C +I    ++K++  K++   +M + + ++  + E++LL++L HPHI++     I+  +  + IV+E  + GDL  +IK   ++KR   E  +WK   Q+  A++  H ++    ++HRD+KPANVF+ +   VKLGDFGL R  S  TS   + VGTPYYMSPE++ +  Y+ KSDIWSLGC++YE+ AL  PF   ++    L  +I+   + P+P+  YSS L  L++  +Q +   RP+I  +
Sbjct:    6 LHDYEELERIGSGSY-----GICKKIRRKKDNKVLVWKELDYGQMSETE-KQMLVSEVNLLRELKHPHIVRYYDRIIDRTNTTIYIVMEFCENGDLGALIKKHKREKRYTAEDLVWKLLYQLVLAVQECHRRKDGGHVLHRDLKPANVFLDANMNVKLGDFGLARVLSHDTSFAKTFVGTPYYMSPEQVNKRSYNEKSDIWSLGCLMYELCALSPPF--TAMDQIRLEAKIKVGRFHPIPSH-YSSSLSQLINSMLQVNDEMRPSIDEL 265          
BLAST of Serine/threonine-protein kinase Nek7 vs. Ensembl Nematostella
Match: EDO49690 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RG02])

HSP 1 Score: 161.77 bits (408), Expect = 2.057e-46
Identity = 95/264 (35.98%), Postives = 150/264 (56.82%), Query Frame = 2
Query:  137 NLSKFKIQKKIGRGQFSTVYQACCLEINDKIIALKKVKIFEMMDAKTRRDCIKEIDLLKKLDHPHIIKLISSFIEDNE-LIIVLELADAGDL-SRMIKHFNKQKRLIP--ERTIWKYFVQICSALEYMHSQRIMHRDIKPANVFITSKGEVKLGDFGLGRFFSTQTSNVHSLVGTPYYMSPERILETGYDMKSDIWSLGCVLYEMAALQSPFYGESLTLAILCQRIEESDYPPLPTRIYSSELRGLVDRCIQTDPNSRPNISHI 916
            +L ++ I K IG+G +  V+ +   + + K   LKKV + +    + R+    E  LL +L HP+I+    SF +D   L I +   + GDL SR+     K ++ IP  E  I ++FVQI  AL+YMH + I+HRD+K  N+F+T    +K+GD G+ R   + +    +L+GTPYYMSPE      Y+ KSD+W+LGC LYEM  L+  F  + ++   L  +I +   PPLP + YS++L  ++   +  DP+ RP+ S +
Sbjct:    2 SLDRYTIGKCIGKGSYGEVFLSKH-KKDKKQYVLKKVDL-QKASVRERKAAELEAKLLSQLRHPNIVSYRESFQDDTGFLYIAMNFCEGGDLYSRL-----KAQKGIPLDENQIVEWFVQIAMALQYMHEKHILHRDLKTQNIFLTKSKIIKVGDLGIARVLESSSDMATTLIGTPYYMSPELFSNKPYNHKSDVWALGCCLYEMCTLRHAFNAKDMS--SLVYKILKGKTPPLPKQ-YSTDLCSIIKSMLDQDPDKRPSASRL 255          
BLAST of Serine/threonine-protein kinase Nek7 vs. Ensembl Medaka
Match: nek6 (NIMA related kinase 6 [Source:NCBI gene;Acc:101173323])

HSP 1 Score: 403.675 bits (1036), Expect = 1.129e-139
Identity = 188/273 (68.86%), Postives = 232/273 (84.98%), Query Frame = 2
Query:  137 NLSKFKIQKKIGRGQFSTVYQACCLEINDKIIALKKVKIFEMMDAKTRRDCIKEIDLLKKLDHPHIIKLISSFIEDNELIIVLELADAGDLSRMIKHFNKQKRLIPERTIWKYFVQICSALEYMHSQRIMHRDIKPANVFITSKGEVKLGDFGLGRFFSTQTSNVHSLVGTPYYMSPERILETGYDMKSDIWSLGCVLYEMAALQSPFYGESLTLAILCQRIEESDYPPLPTRIYSSELRGLVDRCIQTDPNSRPNISHIYHVAKNMHEKTRS 955
            +++ F++++KIGRGQFS VY+A  L ++ + +ALKKV+IFEMMDAK R+DCIKEIDLLK+L+HP+IIK + SFIEDNEL IVLELADAGDLS+MIK+F K++RLIPERTIWKYFVQ+CSALE+MHS+R+MHRDIKPANVFIT+ GEVKLGD GLGRFFS++T+  HSLVGTPYYMSPERI E GY+ KSDIWSLGC+LYEMAALQSPFYG+ + L  LC++IE+ DYPPLP   YS +LR LV  CI ++P+ RP+I  +  +A  MH KT S
Sbjct:   37 SMANFRVERKIGRGQFSEVYRAVRL-LDRQSVALKKVQIFEMMDAKARQDCIKEIDLLKQLNHPNIIKYLDSFIEDNELNIVLELADAGDLSQMIKYFKKKRRLIPERTIWKYFVQLCSALEHMHSRRVMHRDIKPANVFITATGEVKLGDLGLGRFFSSKTTAAHSLVGTPYYMSPERIHENGYNFKSDIWSLGCLLYEMAALQSPFYGDKMNLLSLCRKIEQCDYPPLPPDQYSDKLRELVSMCINSEPDQRPDIIFVLQIANQMHVKTSS 308          
BLAST of Serine/threonine-protein kinase Nek7 vs. Ensembl Medaka
Match: nek7 (NIMA related kinase 7 [Source:NCBI gene;Acc:101170580])

HSP 1 Score: 400.208 bits (1027), Expect = 2.837e-138
Identity = 181/275 (65.82%), Postives = 229/275 (83.27%), Query Frame = 2
Query:  131 FSNLSKFKIQKKIGRGQFSTVYQACCLEINDKIIALKKVKIFEMMDAKTRRDCIKEIDLLKKLDHPHIIKLISSFIEDNELIIVLELADAGDLSRMIKHFNKQKRLIPERTIWKYFVQICSALEYMHSQRIMHRDIKPANVFITSKGEVKLGDFGLGRFFSTQTSNVHSLVGTPYYMSPERILETGYDMKSDIWSLGCVLYEMAALQSPFYGESLTLAILCQRIEESDYPPLPTRIYSSELRGLVDRCIQTDPNSRPNISHIYHVAKNMHEKTRS 955
            +S+L+ F+I+KKIG+GQFS VY+A  + +++  +ALKK++IF +MDAK R+DCIKEIDLLK+L+HP++IK  +SFIEDNEL IVLELADAGDLSRMI HF  Q+RLIPE+ +WKYFVQ+C ALE+MHS+R+MHRDIKPANVF+T+ G VKLGD GLGRFFS++T+  HSLVGTPYYMSPER+ E GY+ KSDIWSLGC+LYEMAALQSPFYG+ + L  LC +I++ DYPPLP+  YS ELR LVD CI  DP  RP+I+++Y +AK M   T+ 
Sbjct:   29 YSSLANFQIEKKIGKGQFSEVYRARYI-LDNTPVALKKIQIFNLMDAKARQDCIKEIDLLKQLNHPNVIKYHASFIEDNELNIVLELADAGDLSRMINHFKNQRRLIPEKAVWKYFVQVCRALEHMHSRRVMHRDIKPANVFVTATGVVKLGDLGLGRFFSSKTTAAHSLVGTPYYMSPERLRENGYNFKSDIWSLGCLLYEMAALQSPFYGDKMNLYSLCTKIQQCDYPPLPSDHYSQELRDLVDMCINPDPEKRPDITYVYDIAKKMRNMTQG 302          
BLAST of Serine/threonine-protein kinase Nek7 vs. Ensembl Medaka
Match: ENSORLT00000034147.1 (serine/threonine-protein kinase Nek5 [Source:NCBI gene;Acc:101162253])

HSP 1 Score: 187.963 bits (476), Expect = 4.448e-52
Identity = 105/265 (39.62%), Postives = 156/265 (58.87%), Query Frame = 2
Query:  140 LSKFKIQKKIGRGQFSTVYQA-CCLEINDKIIALKKVKIFEMMDAKTRRDCIKEIDLLKKLDHPHIIKLISSFIEDNELIIVLELADAGDLSRMIKHFNKQKRLIP--ERTIWKYFVQICSALEYMHSQRIMHRDIKPANVFITSKG-EVKLGDFGLGRFFSTQTSNVHSLVGTPYYMSPERILETGYDMKSDIWSLGCVLYEMAALQSPFYGESLT--LAILCQRIEESDYPPLPTRIYSSELRGLVDRCIQTDPNSRPNISHI 916
            ++ +++  +IG G F   +         D    +K++ + + M AK R    KE+ LL ++ HP+I+  ISSF+E   L IV+E  D GDL   +K  N Q R +P  E  I   FVQIC  L+++H ++++HRDIK  N+F+T+ G + KLGDFG+ R  +       + VGTPYY+SPE      Y+ K+D+WSLGCVLYE+  L+ PF G SL   L  +C+      Y P+PTR Y+ ELR LV++  + +P  RP+IS +
Sbjct:    1 MNDYEVLWQIGEGAFGKAFLVRSKTGGGDTQCVIKQINL-QKMSAKERESSRKEVTLLSRMRHPNIVSFISSFLEKGSLFIVMEFCDGGDL---LKKINMQ-RGVPFREEEILDLFVQICLGLKHIHDKKVLHRDIKCQNIFLTNGGMKAKLGDFGIARMLNNSMDLARTCVGTPYYLSPEICESRPYNNKTDVWSLGCVLYELCTLRHPFEGSSLRQLLGKICR----GRYAPVPTR-YTHELRLLVNQLFKVNPRDRPSISSV 255          
BLAST of Serine/threonine-protein kinase Nek7 vs. Ensembl Medaka
Match: ENSORLT00000000545.2 (pep primary_assembly:ASM223467v1:4:1040495:1044496:1 gene:ENSORLG00000000439.2 transcript:ENSORLT00000000545.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 167.548 bits (423), Expect = 1.954e-48
Identity = 101/260 (38.85%), Postives = 148/260 (56.92%), Query Frame = 2
Query:  140 LSKFKIQKKIGRGQFSTVYQACCLEINDKIIALKKVKIFEMMDAKTRRDCIKEIDLLKKLDHPHIIKLISSFIEDNELIIVLELADAGDLSRMIKHFNKQKR-LIPERTIWKYFVQICSALEYMHSQRIMHRDIKPANVFITSKGEVKLGDFGLGRFFSTQTSNVHSLVGTPYYMSPERILETGYDMKSDIWSLGCVLYEMAALQSPFYGESLTLAILCQRIEESDYPPLPTRIYSSELRGLVDRCIQTDPNSRPNISHI 916
            + K++  K+IG G F         E + +   +K++ I   M  K RR+  KE+ +L  + HP+I++   SF E   L IV++  + GDL    K  N QK  L  E  I  +FVQIC AL+++H ++I+HRDIK  N+F+T  G V+LGDFG+ R  +T      + +GTPYY+SPE      Y+ K DIW+LGCVLYEM  L+  F  E+  +  L  +I    YPP+    YS ELR L+ +  + +P  RP++S I
Sbjct:    1 MDKYENVKQIGEGSFGKAILVNSKE-DGRQYVIKEIGI-SGMSTKERRESRKEVSVLANMSHPNIVQYKESF-EGGCLYIVMDYCEGGDL---FKKINSQKGVLFSEDQILDWFVQICLALKHVHGRKILHRDIKSQNIFLTKDGTVQLGDFGIARVLNT-VELARTCIGTPYYLSPEICENKPYNNK-DIWALGCVLYEMCTLKHAF--EAGNMKNLVLKIIRGSYPPVSVH-YSPELRSLLAQLFRRNPRERPSVSSI 249          
BLAST of Serine/threonine-protein kinase Nek7 vs. Ensembl Medaka
Match: nek2 (NIMA related kinase 2 [Source:NCBI gene;Acc:101168418])

HSP 1 Score: 166.007 bits (419), Expect = 5.585e-46
Identity = 90/237 (37.97%), Postives = 140/237 (59.07%), Query Frame = 2
Query:  242 KVKIFEMMDAKTRRDC-----IKEIDLLKKLDHPHIIKLISSFIE--DNELIIVLELADAGDLSRMIKHFNKQKRLIPERTIWKYFVQICSALEYMHSQR-----IMHRDIKPANVFITSKGEVKLGDFGLGRFFSTQTSNVHSLVGTPYYMSPERILETGYDMKSDIWSLGCVLYEMAALQSPFYGESLTLAILCQRIEESDYPPLPTRIYSSELRGLVDRCIQTDPNSRPNISHI 916
            K+ +++ +D  T  +C     + E++LL++L HP+I++     I+  +  L I++E  + GDLS +I    K+++ + E+ I +  VQ+  AL+  H +R     ++HRD+KPAN+F+ +   VKLGDFGL R  +  TS   + VGTPYYMSPE+I    Y+ KSDIWSLGC+LYE+ AL  PF   +     L ++I E  +  +P R YS EL  L+ R +      RP++  I
Sbjct:   32 KILVWKELDYGTMAECEKQMLVSEVNLLRELKHPNIVRYYDRIIDRRNTMLYIIMEYCEGGDLSCLISKCIKERKYLEEQFILRVMVQLSLALKECHRRRDGRATVLHRDLKPANIFLDANQNVKLGDFGLARILNHDTSFAKTFVGTPYYMSPEQINRMSYNEKSDIWSLGCLLYELCALSPPFT--AYNQKELAEKIREGKFRRIPFR-YSEELNSLISRMLNLKDYLRPSVESI 265          
BLAST of Serine/threonine-protein kinase Nek7 vs. Planmine SMEST
Match: SMESG000055481.1 (SMESG000055481.1)

HSP 1 Score: 614.379 bits (1583), Expect = 0.000e+0
Identity = 294/294 (100.00%), Postives = 294/294 (100.00%), Query Frame = 2
Query:   86 MQVDRQNDQDYQLEAFSNLSKFKIQKKIGRGQFSTVYQACCLEINDKIIALKKVKIFEMMDAKTRRDCIKEIDLLKKLDHPHIIKLISSFIEDNELIIVLELADAGDLSRMIKHFNKQKRLIPERTIWKYFVQICSALEYMHSQRIMHRDIKPANVFITSKGEVKLGDFGLGRFFSTQTSNVHSLVGTPYYMSPERILETGYDMKSDIWSLGCVLYEMAALQSPFYGESLTLAILCQRIEESDYPPLPTRIYSSELRGLVDRCIQTDPNSRPNISHIYHVAKNMHEKTRSPDKV 967
            MQVDRQNDQDYQLEAFSNLSKFKIQKKIGRGQFSTVYQACCLEINDKIIALKKVKIFEMMDAKTRRDCIKEIDLLKKLDHPHIIKLISSFIEDNELIIVLELADAGDLSRMIKHFNKQKRLIPERTIWKYFVQICSALEYMHSQRIMHRDIKPANVFITSKGEVKLGDFGLGRFFSTQTSNVHSLVGTPYYMSPERILETGYDMKSDIWSLGCVLYEMAALQSPFYGESLTLAILCQRIEESDYPPLPTRIYSSELRGLVDRCIQTDPNSRPNISHIYHVAKNMHEKTRSPDKV
Sbjct:    1 MQVDRQNDQDYQLEAFSNLSKFKIQKKIGRGQFSTVYQACCLEINDKIIALKKVKIFEMMDAKTRRDCIKEIDLLKKLDHPHIIKLISSFIEDNELIIVLELADAGDLSRMIKHFNKQKRLIPERTIWKYFVQICSALEYMHSQRIMHRDIKPANVFITSKGEVKLGDFGLGRFFSTQTSNVHSLVGTPYYMSPERILETGYDMKSDIWSLGCVLYEMAALQSPFYGESLTLAILCQRIEESDYPPLPTRIYSSELRGLVDRCIQTDPNSRPNISHIYHVAKNMHEKTRSPDKV 294          
BLAST of Serine/threonine-protein kinase Nek7 vs. Planmine SMEST
Match: SMESG000020466.1 (SMESG000020466.1)

HSP 1 Score: 205.297 bits (521), Expect = 1.997e-57
Identity = 111/262 (42.37%), Postives = 164/262 (62.60%), Query Frame = 2
Query:  131 FSNLSKFKIQKKIGRGQFSTVYQACCLEINDKIIALKKVKIFEMMDAKTRRDCIKEIDLLKKLDHPHIIKLISSFIEDNELIIVLELADAGDLSRMIKHFNKQKRLIPERTIWKYFVQICSALEYMHSQRIMHRDIKPANVFITSKGEVKLGDFGLGRFFSTQTSNVHSLVGTPYYMSPERILETGYDMKSDIWSLGCVLYEMAALQSPFYGESLTLAILCQRIEESDYPPLPTRIYSSELRGLVDRCIQTDPNSRPNISHI 916
             S++S FK   KIG+G F   +     +I+ K   LK++ +++M + K R +  KE+ LL K++HP+I+   +SF E     I++E  + GDL R IK  N    L  E  +  YF+QIC AL+++H QRI+HRDIKP N+F+T    VKLGDFG+ +   + T+   + VGTP+Y SPE      Y+ KSDIWSLGC+LYE+ +L   FYG+ +T  IL  RI++ +Y P+P+ ++S+ LR LVD   +  P+ RPNI+ I
Sbjct:    1 MSSISDFKRLNKIGQGAFGIAWLVES-KIDCKKYVLKEIGLYKMHE-KERFEARKEVSLLSKMNHPNIVTYYNSFEEVGCFHILMEYCEGGDLYRKIKTQNGV--LFKEDQVLDYFIQICLALKHIHDQRILHRDIKPQNIFLTKNNSVKLGDFGIAKAMDSTTALTKTQVGTPFYFSPEICEGCPYNNKSDIWSLGCILYELCSLNYAFYGQDIT--ILAMRIKKVNYKPVPS-VFSAPLRALVDNMFRRRPDERPNINTI 255          
BLAST of Serine/threonine-protein kinase Nek7 vs. Planmine SMEST
Match: SMESG000020466.1 (SMESG000020466.1)

HSP 1 Score: 204.912 bits (520), Expect = 2.349e-57
Identity = 111/262 (42.37%), Postives = 164/262 (62.60%), Query Frame = 2
Query:  131 FSNLSKFKIQKKIGRGQFSTVYQACCLEINDKIIALKKVKIFEMMDAKTRRDCIKEIDLLKKLDHPHIIKLISSFIEDNELIIVLELADAGDLSRMIKHFNKQKRLIPERTIWKYFVQICSALEYMHSQRIMHRDIKPANVFITSKGEVKLGDFGLGRFFSTQTSNVHSLVGTPYYMSPERILETGYDMKSDIWSLGCVLYEMAALQSPFYGESLTLAILCQRIEESDYPPLPTRIYSSELRGLVDRCIQTDPNSRPNISHI 916
             S++S FK   KIG+G F   +     +I+ K   LK++ +++M + K R +  KE+ LL K++HP+I+   +SF E     I++E  + GDL R IK  N    L  E  +  YF+QIC AL+++H QRI+HRDIKP N+F+T    VKLGDFG+ +   + T+   + VGTP+Y SPE      Y+ KSDIWSLGC+LYE+ +L   FYG+ +T  IL  RI++ +Y P+P+ ++S+ LR LVD   +  P+ RPNI+ I
Sbjct:    1 MSSISDFKRLNKIGQGAFGIAWLVES-KIDCKKYVLKEIGLYKMHE-KERFEARKEVSLLSKMNHPNIVTYYNSFEEVGCFHILMEYCEGGDLYRKIKTQNGV--LFKEDQVLDYFIQICLALKHIHDQRILHRDIKPQNIFLTKNNSVKLGDFGIAKAMDSTTALTKTQVGTPFYFSPEICEGCPYNNKSDIWSLGCILYELCSLNYAFYGQDIT--ILAMRIKKVNYKPVPS-VFSAPLRALVDNMFRRRPDERPNINTI 255          
BLAST of Serine/threonine-protein kinase Nek7 vs. Planmine SMEST
Match: SMESG000020466.1 (SMESG000020466.1)

HSP 1 Score: 204.912 bits (520), Expect = 2.540e-57
Identity = 111/262 (42.37%), Postives = 164/262 (62.60%), Query Frame = 2
Query:  131 FSNLSKFKIQKKIGRGQFSTVYQACCLEINDKIIALKKVKIFEMMDAKTRRDCIKEIDLLKKLDHPHIIKLISSFIEDNELIIVLELADAGDLSRMIKHFNKQKRLIPERTIWKYFVQICSALEYMHSQRIMHRDIKPANVFITSKGEVKLGDFGLGRFFSTQTSNVHSLVGTPYYMSPERILETGYDMKSDIWSLGCVLYEMAALQSPFYGESLTLAILCQRIEESDYPPLPTRIYSSELRGLVDRCIQTDPNSRPNISHI 916
             S++S FK   KIG+G F   +     +I+ K   LK++ +++M + K R +  KE+ LL K++HP+I+   +SF E     I++E  + GDL R IK  N    L  E  +  YF+QIC AL+++H QRI+HRDIKP N+F+T    VKLGDFG+ +   + T+   + VGTP+Y SPE      Y+ KSDIWSLGC+LYE+ +L   FYG+ +T  IL  RI++ +Y P+P+ ++S+ LR LVD   +  P+ RPNI+ I
Sbjct:    1 MSSISDFKRLNKIGQGAFGIAWLVES-KIDCKKYVLKEIGLYKMHE-KERFEARKEVSLLSKMNHPNIVTYYNSFEEVGCFHILMEYCEGGDLYRKIKTQNGV--LFKEDQVLDYFIQICLALKHIHDQRILHRDIKPQNIFLTKNNSVKLGDFGIAKAMDSTTALTKTQVGTPFYFSPEICEGCPYNNKSDIWSLGCILYELCSLNYAFYGQDIT--ILAMRIKKVNYKPVPS-VFSAPLRALVDNMFRRRPDERPNINTI 255          
BLAST of Serine/threonine-protein kinase Nek7 vs. Planmine SMEST
Match: SMESG000043302.1 (SMESG000043302.1)

HSP 1 Score: 176.022 bits (445), Expect = 1.559e-48
Identity = 99/289 (34.26%), Postives = 165/289 (57.09%), Query Frame = 2
Query:  128 AFSNLSKFKIQKKI---------GRGQFST--VYQACCLEINDKIIALKKVKIFEMMDAKTRRDCIKEIDLLKKLDHPHIIKLISSFIEDNELIIVLELADAGDLSRMIKHFNKQKRLIPERTIWKYFVQICSALEYMHSQRIMHRDIKPANVFITSKGEVKLGDFGLGRFFSTQTSNVHSLVGTPYYMSPERILETGYDMKSDIWSLGCVLYEMAALQSPFYGESLTLAILCQRIEESDYPPLPTRIYSSELRGLVDRCIQTDPNSRPNISHIYHVAKNMHEKTRSPD 961
            + +NL  F IQ+ I         G+G + T  +Y+    + +D ++ LK++ + ++  A  R+  + E+ +L +LDHP+I+    SF ED  L+I +E AD G L++ + +   Q++ + E+ I + F QI SA+ Y+H  +I+HRD+K  N+F+T +  +K+GDFG+ +  ST     +S++GTPYY+SPE      Y+ KSD+W+LGC+LYEM  L   F G +  L  L  +I +  + P+    YS EL+ L+   ++ +P+ R +   I H    M  KT   D
Sbjct:   44 SINNLISFSIQQTINGFEKIRTVGKGAYGTAVLYRK---KDDDSLVILKEINMHDL-SATERQLAMNEVKVLSQLDHPNIVAYFDSFEEDGVLMIEMEYADNGTLAQFLSN---QEKPLEEKKILEMFFQIVSAIHYIHEHKILHRDLKTVNIFLTKEEIIKIGDFGISKMLSTTHEGANSVIGTPYYISPEMCQGKLYNEKSDVWALGCILYEMTCLHKTFEGSN--LPALVNKILKGQFEPVKGS-YSDELKELISSLLEKNPDDRLSTEVILHHKLPMMMKTFHTD 322          
The following BLAST results are available for this feature:
BLAST of Serine/threonine-protein kinase Nek7 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
NEK71.504e-14570.29NIMA related kinase 7 [Source:HGNC Symbol;Acc:HGNC... [more]
NEK71.504e-14570.29NIMA related kinase 7 [Source:HGNC Symbol;Acc:HGNC... [more]
NEK61.148e-14171.27NIMA related kinase 6 [Source:HGNC Symbol;Acc:HGNC... [more]
NEK61.148e-14171.27NIMA related kinase 6 [Source:HGNC Symbol;Acc:HGNC... [more]
NEK61.148e-14171.27NIMA related kinase 6 [Source:HGNC Symbol;Acc:HGNC... [more]
back to top
BLAST of Serine/threonine-protein kinase Nek7 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nekl-31.938e-12563.43Serine/threonine-protein kinase nekl-3 [Source:Un... [more]
nekl-31.938e-12563.43Serine/threonine-protein kinase nekl-3 [Source:Un... [more]
nekl-11.765e-4733.69NEK (NEver in mitosis Kinase) Like [Source:UniPro... [more]
nekl-12.011e-4733.69NEK (NEver in mitosis Kinase) Like [Source:UniPro... [more]
nekl-29.206e-4636.78Serine/threonine-protein kinase nekl-2 [Source:Un... [more]
back to top
BLAST of Serine/threonine-protein kinase Nek7 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
niki1.390e-4837.59gene:FBgn0045980 transcript:FBtr0084737[more]
Nek29.611e-4734.40gene:FBgn0029970 transcript:FBtr0071142[more]
fu1.216e-3733.99gene:FBgn0001079 transcript:FBtr0074602[more]
GckIII1.643e-3732.54gene:FBgn0266465 transcript:FBtr0083399[more]
Aduk8.706e-3532.21gene:FBgn0037679 transcript:FBtr0082056[more]
back to top
BLAST of Serine/threonine-protein kinase Nek7 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nek79.106e-14268.50NIMA-related kinase 7 [Source:ZFIN;Acc:ZDB-GENE-04... [more]
nek61.653e-13567.66NIMA-related kinase 6 [Source:ZFIN;Acc:ZDB-GENE-04... [more]
nek63.598e-10757.66NIMA-related kinase 6 [Source:ZFIN;Acc:ZDB-GENE-04... [more]
nek14.773e-5337.84NIMA-related kinase 1 [Source:ZFIN;Acc:ZDB-GENE-04... [more]
CABZ01040556.12.874e-4534.43NIMA related kinase 3 [Source:NCBI gene;Acc:100536... [more]
back to top
BLAST of Serine/threonine-protein kinase Nek7 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nek61.560e-14471.43NIMA-related kinase 6 [Source:NCBI gene;Acc:448328... [more]
nek62.067e-14471.43NIMA-related kinase 6 [Source:NCBI gene;Acc:448328... [more]
nek62.572e-14471.43NIMA-related kinase 6 [Source:NCBI gene;Acc:448328... [more]
nek63.517e-14471.43NIMA-related kinase 6 [Source:NCBI gene;Acc:448328... [more]
nek63.520e-14471.43NIMA-related kinase 6 [Source:NCBI gene;Acc:448328... [more]
back to top
BLAST of Serine/threonine-protein kinase Nek7 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Nek77.120e-14570.29NIMA (never in mitosis gene a)-related expressed k... [more]
Nek77.120e-14570.29NIMA (never in mitosis gene a)-related expressed k... [more]
Nek61.483e-14170.33NIMA (never in mitosis gene a)-related expressed k... [more]
Nek61.483e-14170.33NIMA (never in mitosis gene a)-related expressed k... [more]
Nek63.029e-14170.07NIMA (never in mitosis gene a)-related expressed k... [more]
back to top
BLAST of Serine/threonine-protein kinase Nek7 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8TDX7|NEK7_HUMAN7.221e-14570.29Serine/threonine-protein kinase Nek7 OS=Homo sapie... [more]
sp|Q9ES74|NEK7_MOUSE4.981e-14470.29Serine/threonine-protein kinase Nek7 OS=Mus muscul... [more]
sp|D3ZBE5|NEK7_RAT6.760e-14470.29Serine/threonine-protein kinase Nek7 OS=Rattus nor... [more]
sp|P59895|NEK6_RAT4.249e-14271.06Serine/threonine-protein kinase Nek6 OS=Rattus nor... [more]
sp|A2BD05|NEK6_PIG6.361e-14270.70Serine/threonine-protein kinase Nek6 OS=Sus scrofa... [more]
back to top
BLAST of Serine/threonine-protein kinase Nek7 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267DU229.739e-14572.06Protein kinase domain-containing protein (Fragment... [more]
A0A267EEI41.063e-14472.06Protein kinase domain-containing protein (Fragment... [more]
A0A267H6D41.227e-14367.71Protein kinase domain-containing protein (Fragment... [more]
A0A267DHE51.464e-14367.71Protein kinase domain-containing protein (Fragment... [more]
A0A1S3JQK31.899e-14371.48serine/threonine-protein kinase Nek7 isoform X1 OS... [more]
back to top
BLAST of Serine/threonine-protein kinase Nek7 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nek71.155e-14570.44NIMA related kinase 7 [Source:NCBI gene;Acc:103046... [more]
nek65.081e-13768.61NIMA-related kinase 6 [Source:ZFIN;Acc:ZDB-GENE-04... [more]
nek75.872e-12764.23NIMA related kinase 7 [Source:NCBI gene;Acc:103046... [more]
nek62.781e-10758.46NIMA-related kinase 6 [Source:ZFIN;Acc:ZDB-GENE-04... [more]
nek62.518e-10659.49NIMA-related kinase 6 [Source:ZFIN;Acc:ZDB-GENE-04... [more]
back to top
BLAST of Serine/threonine-protein kinase Nek7 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000007414.11.067e-4836.05pep scaffold:Pmarinus_7.0:GL476981:230882:244405:1... [more]
nek21.160e-4436.64NIMA-related kinase 2 [Source:ZFIN;Acc:ZDB-GENE-04... [more]
NEK92.758e-4236.84NIMA related kinase 9 [Source:HGNC Symbol;Acc:HGNC... [more]
STK365.134e-4033.33serine/threonine kinase 36 [Source:HGNC Symbol;Acc... [more]
map3k195.738e-4030.92mitogen-activated protein kinase kinase kinase 19 ... [more]
back to top
BLAST of Serine/threonine-protein kinase Nek7 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
CDC54.612e-3831.37Polo-like kinase; controls targeting and activatio... [more]
KIN34.547e-3628.66Nonessential serine/threonine protein kinase; poss... [more]
STE76.746e-3633.21Signal transducing MAP kinase kinase; involved in ... [more]
SSK221.344e-3229.59MAP kinase kinase kinase of HOG1 mitogen-activated... [more]
CDC283.818e-3234.56Cyclin-dependent kinase (CDK) catalytic subunit; m... [more]
back to top
BLAST of Serine/threonine-protein kinase Nek7 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO346464.754e-14168.12Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO370691.299e-5537.17Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO498221.566e-5238.58Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO374131.101e-5034.94Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO496902.057e-4635.98Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Serine/threonine-protein kinase Nek7 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nek61.129e-13968.86NIMA related kinase 6 [Source:NCBI gene;Acc:101173... [more]
nek72.837e-13865.82NIMA related kinase 7 [Source:NCBI gene;Acc:101170... [more]
ENSORLT00000034147.14.448e-5239.62serine/threonine-protein kinase Nek5 [Source:NCBI ... [more]
ENSORLT00000000545.21.954e-4838.85pep primary_assembly:ASM223467v1:4:1040495:1044496... [more]
nek25.585e-4637.97NIMA related kinase 2 [Source:NCBI gene;Acc:101168... [more]
back to top
BLAST of Serine/threonine-protein kinase Nek7 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000055481.10.000e+0100.00SMESG000055481.1[more]
SMESG000020466.11.997e-5742.37SMESG000020466.1[more]
SMESG000020466.12.349e-5742.37SMESG000020466.1[more]
SMESG000020466.12.540e-5742.37SMESG000020466.1[more]
SMESG000043302.11.559e-4834.26SMESG000043302.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30008837 ID=SMED30008837|Name=Serine/threonine-protein kinase Nek7|organism=Schmidtea mediterranea sexual|type=transcript|length=1392bp
TTTATTTACATAACTACATACTATATTTTATGATAAACTTATTTAAAGAA
ATTTATTTACTGTACCAAATATAATCGACAATCCGATGCAAGTAGATCGT
CAAAATGATCAGGATTATCAACTTGAAGCATTCTCTAATTTATCGAAATT
TAAAATTCAAAAGAAAATTGGCCGTGGACAGTTTAGTACTGTGTACCAAG
CATGCTGCTTGGAAATAAATGATAAAATAATTGCCTTAAAGAAAGTTAAG
ATATTTGAAATGATGGACGCCAAAACTCGGAGGGATTGTATTAAAGAAAT
TGACTTACTTAAAAAATTAGATCATCCACACATTATAAAGTTAATATCTT
CATTTATCGAAGACAATGAGTTGATTATTGTTCTCGAACTGGCAGATGCG
GGAGATTTATCACGAATGATAAAGCATTTCAATAAACAGAAACGACTTAT
TCCAGAACGAACAATCTGGAAGTATTTTGTCCAAATATGCAGTGCACTGG
AATATATGCACTCTCAAAGAATTATGCACCGAGATATTAAACCAGCTAAT
GTATTTATTACATCTAAGGGGGAGGTTAAATTAGGAGATTTCGGTTTAGG
GAGATTTTTCAGCACGCAAACCTCAAATGTCCATTCTTTAGTTGGTACAC
CATATTATATGTCACCAGAGAGGATTCTTGAAACCGGGTATGACATGAAG
TCAGACATTTGGTCATTGGGCTGTGTTTTATATGAAATGGCAGCTTTGCA
ATCGCCATTTTACGGTGAAAGTCTGACTTTAGCTATCCTTTGCCAACGTA
TAGAAGAAAGTGACTATCCACCGCTGCCGACAAGAATATATTCATCTGAA
CTCCGAGGACTTGTTGATAGGTGCATACAAACCGATCCGAATTCTCGACC
TAATATCAGTCACATCTATCATGTCGCCAAAAATATGCACGAAAAAACAA
GATCCCCGGATAAAGTACAAAATCCCGAATCTCCATCTTTGAATTTGCCA
TCAGTTTCTTCTCCTTAACAATTGGTTTTGATGATTTTATATTTTTTTTA
AAATTTTACAAACGATTTTTAATCATTTATTAATATTCTTTTAAATTCTT
TATTAGCGATCAGACATTTTCATTTACATGATATTTATAAGCGATTCTTA
AATGGCTGATGATCTGCAACATTTTTCATGACCTTGATCACAGTAGACCA
AGAACAACGCAAATGCGCATGGCACTCTTGGGTAATCAACATCAATTACA
TAAATGATATAATAAATATTTTTTCAAGTCTTTTTATTAAATTAATCAAA
ATTAAAATTAATTAGAATTGGAAAACAATAAATTTCGTGCTAAAATTAAT
TATTGTCTTTTGATTAAACGGCTAAATGAAGAATAATTCTGG
back to top

protein sequence of SMED30008837-orf-1

>SMED30008837-orf-1 ID=SMED30008837-orf-1|Name=SMED30008837-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=311bp
MQVDRQNDQDYQLEAFSNLSKFKIQKKIGRGQFSTVYQACCLEINDKIIA
LKKVKIFEMMDAKTRRDCIKEIDLLKKLDHPHIIKLISSFIEDNELIIVL
ELADAGDLSRMIKHFNKQKRLIPERTIWKYFVQICSALEYMHSQRIMHRD
IKPANVFITSKGEVKLGDFGLGRFFSTQTSNVHSLVGTPYYMSPERILET
GYDMKSDIWSLGCVLYEMAALQSPFYGESLTLAILCQRIEESDYPPLPTR
IYSSELRGLVDRCIQTDPNSRPNISHIYHVAKNMHEKTRSPDKVQNPESP
SLNLPSVSSP*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR001245Ser-Thr/Tyr_kinase_cat_dom
IPR000719Prot_kinase_dom
IPR008271Ser/Thr_kinase_AS
IPR017441Protein_kinase_ATP_BS
IPR011009Kinase-like_dom_sf
Vocabulary: biological process
TermDefinition
GO:0006468protein phosphorylation
GO:0000910cytokinesis
GO:0007346regulation of mitotic cell cycle
GO:0016310phosphorylation
GO:0032212positive regulation of telomere maintenance via telomerase
GO:0051225spindle assembly
GO:0051973positive regulation of telomerase activity
GO:1904355positive regulation of telomere capping
Vocabulary: molecular function
TermDefinition
GO:0004672protein kinase activity
GO:0005524ATP binding
GO:0000166nucleotide binding
GO:0004674protein serine/threonine kinase activity
GO:0016301kinase activity
GO:0016740transferase activity
GO:0046872metal ion binding
Vocabulary: cellular component
TermDefinition
GO:0000922spindle pole
GO:0005634nucleus
GO:0005654nucleoplasm
GO:0005737cytoplasm
GO:0005815microtubule organizing center
GO:0005856cytoskeleton
GO:0005874microtubule
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001245Serine-threonine/tyrosine-protein kinase, catalytic domainPRINTSPR00109TYRKINASEcoord: 140..158
score: 31.85
coord: 252..274
score: 27.31
coord: 100..113
score: 28.33
coord: 206..228
score: 36.08
IPR000719Protein kinase domainSMARTSM00220serkin_6coord: 22..288
e-value: 4.2E-91
score: 318.6
IPR000719Protein kinase domainPFAMPF00069Pkinasecoord: 22..279
e-value: 8.6E-69
score: 231.8
IPR000719Protein kinase domainPROSITEPS50011PROTEIN_KINASE_DOMcoord: 22..288
score: 50.449
NoneNo IPR availableGENE3DG3DSA:3.30.200.20coord: 22..103
e-value: 7.5E-86
score: 289.1
NoneNo IPR availableGENE3DG3DSA:1.10.510.10coord: 62..271
e-value: 7.5E-86
score: 289.1
NoneNo IPR availablePIRSFPIRSF000654ILKcoord: 1..295
e-value: 5.2E-39
score: 131.8
NoneNo IPR availablePFAMPF12330Haspin_kinasecoord: 34..179
e-value: 7.7E-6
score: 25.1
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 294..310
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 285..310
NoneNo IPR availablePANTHERPTHR43289:SF13SERINE/THREONINE-PROTEIN KINASE NEK6coord: 12..290
NoneNo IPR availablePANTHERPTHR43289FAMILY NOT NAMEDcoord: 12..290
NoneNo IPR availableCDDcd08224STKc_Nek6_7coord: 21..282
e-value: 0.0
score: 501.416
IPR008271Serine/threonine-protein kinase, active sitePROSITEPS00108PROTEIN_KINASE_STcoord: 146..158
IPR017441Protein kinase, ATP binding sitePROSITEPS00107PROTEIN_KINASE_ATPcoord: 28..52
IPR011009Protein kinase-like domain superfamilySUPERFAMILYSSF56112Protein kinase-like (PK-like)coord: 19..287