Aspartyl aminopeptidase

Overview
NameAspartyl aminopeptidase
Smed IDSMED30008823
Uniprot Best hitAspartyl aminopeptidase OS=Homo sapiens OX=9606 GN=DNPEP PE=1 SV=1 (E=2.64482e-142)
Length (bp)1533
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Aspartyl aminopeptidase (SMED30008823) t-SNE clustered cells

Violin plots show distribution of expression levels for Aspartyl aminopeptidase (SMED30008823) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Aspartyl aminopeptidase (SMED30008823) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Aspartyl aminopeptidase (SMED30008823) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30008823

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
epidermal cellSMED30008823SMESG000011865.1 dd_Smed_v4_1052_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30008823SMESG000011865.1 dd_Smed_v4_1052_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30008823SMESG000011865.1 dd_Smed_v4_1052_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Aspartyl aminopeptidase vs. Ensembl Human
Match: DNPEP (aspartyl aminopeptidase [Source:HGNC Symbol;Acc:HGNC:2981])

HSP 1 Score: 355.525 bits (911), Expect = 4.771e-143
Identity = 175/333 (52.55%), Postives = 243/333 (72.97%), Query Frame = 2
Query:  500 SDRYKHMLVNLRRPIARVPTLAVHLDRSVNESFAPNKESHLSPVLCTTIGEQINKTSDQKDSPKTSL--HHPIVLMEAIAEELKVKVEDIVDIELCLADSQPAAIGGIHQEFMFAPRLDNLFNCFASIQALTESLE---SISLDTNIRVVSLYDNEEIGSQSAQGAQSAFTELVLRRVVNAICEYIPTPSCSQYERAIANSLLVSADQAHAVHPNYEEKHERQHRPLPHQGIVLKVNSNQRYASNAMTTSIIREVANKSDVPLQEFVIRQDMVCGSTIGPIISANMGLATVDIGGPQLSMHSCREMADVSSVEQAVRLFKGFFDLYPDLSYRV 1483
            S R +  LV++ RPI R+P LA+HL R++NE+F PN E HL P+L T I E++ K + +   P  ++   H  VLM  +   L +  +DIV++ELCLAD+QPA +GG + EF+FAPRLDNL +CF ++QAL +S     S++ + ++R+V+LYDNEE+GS+SAQGAQS  TELVLRR+ +A C++ PT     +E AI  S ++SAD AHAVHPNY +KHE  HRPL H+G V+KVNS QRYASNA++ ++IREVANK  VPLQ+ ++R D  CG+TIGPI+++ +GL  +D+G PQL+MHS REMA  + V Q + LFKGFF+L+P LS+ +
Sbjct:  157 SGRLEQQLVHVERPILRIPHLAIHLQRNINENFGPNTEMHLVPILATAIQEELEKGTPEP-GPLNAVDERHHSVLMSLLCAHLGLSPKDIVEMELCLADTQPAVLGGAYDEFIFAPRLDNLHSCFCALQALIDSCAGPGSLATEPHVRMVTLYDNEEVGSESAQGAQSLLTELVLRRI-SASCQH-PT----AFEEAIPKSFMISADMAHAVHPNYLDKHEENHRPLFHKGPVIKVNSKQRYASNAVSEALIREVANKVKVPLQDLMVRNDTPCGTTIGPILASRLGLRVLDLGSPQLAMHSIREMACTTGVLQTLTLFKGFFELFPSLSHNL 482          

HSP 2 Score: 173.711 bits (439), Expect = 4.771e-143
Identity = 73/126 (57.94%), Postives = 99/126 (78.57%), Query Frame = 3
Query:   54 AKNLIKFIDKSPTPFHAVATVKEMLLKSGFKEIHEQDQWTLRPNDLVFVTKNHSTIIALAIGGNYKPGNGFSMVGAHTDSPCLRLKPNSEQISSTYLKLGVETYGGGLWYTWFDRDLTVAGRCIVR 431
            AK L+KF+++SP+PFHAVA  +  LL++GF E+ E ++W ++P    F+T+N STIIA A+GG Y PGNGFS++GAHTDSPCLR+K  S +    + ++GVETYGGG+W TWFDRDLT+AGR IV+
Sbjct:   28 AKELLKFVNRSPSPFHAVAECRNRLLQAGFSELKETEKWNIKPESKYFMTRNSSTIIAFAVGGQYVPGNGFSLIGAHTDSPCLRVKRRSRRSQVGFQQVGVETYGGGIWSTWFDRDLTLAGRVIVK 153          
BLAST of Aspartyl aminopeptidase vs. Ensembl Human
Match: DNPEP (aspartyl aminopeptidase [Source:HGNC Symbol;Acc:HGNC:2981])

HSP 1 Score: 355.525 bits (911), Expect = 6.174e-143
Identity = 175/333 (52.55%), Postives = 243/333 (72.97%), Query Frame = 2
Query:  500 SDRYKHMLVNLRRPIARVPTLAVHLDRSVNESFAPNKESHLSPVLCTTIGEQINKTSDQKDSPKTSL--HHPIVLMEAIAEELKVKVEDIVDIELCLADSQPAAIGGIHQEFMFAPRLDNLFNCFASIQALTESLE---SISLDTNIRVVSLYDNEEIGSQSAQGAQSAFTELVLRRVVNAICEYIPTPSCSQYERAIANSLLVSADQAHAVHPNYEEKHERQHRPLPHQGIVLKVNSNQRYASNAMTTSIIREVANKSDVPLQEFVIRQDMVCGSTIGPIISANMGLATVDIGGPQLSMHSCREMADVSSVEQAVRLFKGFFDLYPDLSYRV 1483
            S R +  LV++ RPI R+P LA+HL R++NE+F PN E HL P+L T I E++ K + +   P  ++   H  VLM  +   L +  +DIV++ELCLAD+QPA +GG + EF+FAPRLDNL +CF ++QAL +S     S++ + ++R+V+LYDNEE+GS+SAQGAQS  TELVLRR+ +A C++ PT     +E AI  S ++SAD AHAVHPNY +KHE  HRPL H+G V+KVNS QRYASNA++ ++IREVANK  VPLQ+ ++R D  CG+TIGPI+++ +GL  +D+G PQL+MHS REMA  + V Q + LFKGFF+L+P LS+ +
Sbjct:  165 SGRLEQQLVHVERPILRIPHLAIHLQRNINENFGPNTEMHLVPILATAIQEELEKGTPEP-GPLNAVDERHHSVLMSLLCAHLGLSPKDIVEMELCLADTQPAVLGGAYDEFIFAPRLDNLHSCFCALQALIDSCAGPGSLATEPHVRMVTLYDNEEVGSESAQGAQSLLTELVLRRI-SASCQH-PT----AFEEAIPKSFMISADMAHAVHPNYLDKHEENHRPLFHKGPVIKVNSKQRYASNAVSEALIREVANKVKVPLQDLMVRNDTPCGTTIGPILASRLGLRVLDLGSPQLAMHSIREMACTTGVLQTLTLFKGFFELFPSLSHNL 490          

HSP 2 Score: 173.711 bits (439), Expect = 6.174e-143
Identity = 73/126 (57.94%), Postives = 99/126 (78.57%), Query Frame = 3
Query:   54 AKNLIKFIDKSPTPFHAVATVKEMLLKSGFKEIHEQDQWTLRPNDLVFVTKNHSTIIALAIGGNYKPGNGFSMVGAHTDSPCLRLKPNSEQISSTYLKLGVETYGGGLWYTWFDRDLTVAGRCIVR 431
            AK L+KF+++SP+PFHAVA  +  LL++GF E+ E ++W ++P    F+T+N STIIA A+GG Y PGNGFS++GAHTDSPCLR+K  S +    + ++GVETYGGG+W TWFDRDLT+AGR IV+
Sbjct:   36 AKELLKFVNRSPSPFHAVAECRNRLLQAGFSELKETEKWNIKPESKYFMTRNSSTIIAFAVGGQYVPGNGFSLIGAHTDSPCLRVKRRSRRSQVGFQQVGVETYGGGIWSTWFDRDLTLAGRVIVK 161          
BLAST of Aspartyl aminopeptidase vs. Ensembl Human
Match: DNPEP (aspartyl aminopeptidase [Source:HGNC Symbol;Acc:HGNC:2981])

HSP 1 Score: 355.525 bits (911), Expect = 6.438e-143
Identity = 175/333 (52.55%), Postives = 243/333 (72.97%), Query Frame = 2
Query:  500 SDRYKHMLVNLRRPIARVPTLAVHLDRSVNESFAPNKESHLSPVLCTTIGEQINKTSDQKDSPKTSL--HHPIVLMEAIAEELKVKVEDIVDIELCLADSQPAAIGGIHQEFMFAPRLDNLFNCFASIQALTESLE---SISLDTNIRVVSLYDNEEIGSQSAQGAQSAFTELVLRRVVNAICEYIPTPSCSQYERAIANSLLVSADQAHAVHPNYEEKHERQHRPLPHQGIVLKVNSNQRYASNAMTTSIIREVANKSDVPLQEFVIRQDMVCGSTIGPIISANMGLATVDIGGPQLSMHSCREMADVSSVEQAVRLFKGFFDLYPDLSYRV 1483
            S R +  LV++ RPI R+P LA+HL R++NE+F PN E HL P+L T I E++ K + +   P  ++   H  VLM  +   L +  +DIV++ELCLAD+QPA +GG + EF+FAPRLDNL +CF ++QAL +S     S++ + ++R+V+LYDNEE+GS+SAQGAQS  TELVLRR+ +A C++ PT     +E AI  S ++SAD AHAVHPNY +KHE  HRPL H+G V+KVNS QRYASNA++ ++IREVANK  VPLQ+ ++R D  CG+TIGPI+++ +GL  +D+G PQL+MHS REMA  + V Q + LFKGFF+L+P LS+ +
Sbjct:  143 SGRLEQQLVHVERPILRIPHLAIHLQRNINENFGPNTEMHLVPILATAIQEELEKGTPEP-GPLNAVDERHHSVLMSLLCAHLGLSPKDIVEMELCLADTQPAVLGGAYDEFIFAPRLDNLHSCFCALQALIDSCAGPGSLATEPHVRMVTLYDNEEVGSESAQGAQSLLTELVLRRI-SASCQH-PT----AFEEAIPKSFMISADMAHAVHPNYLDKHEENHRPLFHKGPVIKVNSKQRYASNAVSEALIREVANKVKVPLQDLMVRNDTPCGTTIGPILASRLGLRVLDLGSPQLAMHSIREMACTTGVLQTLTLFKGFFELFPSLSHNL 468          

HSP 2 Score: 173.711 bits (439), Expect = 6.438e-143
Identity = 73/126 (57.94%), Postives = 99/126 (78.57%), Query Frame = 3
Query:   54 AKNLIKFIDKSPTPFHAVATVKEMLLKSGFKEIHEQDQWTLRPNDLVFVTKNHSTIIALAIGGNYKPGNGFSMVGAHTDSPCLRLKPNSEQISSTYLKLGVETYGGGLWYTWFDRDLTVAGRCIVR 431
            AK L+KF+++SP+PFHAVA  +  LL++GF E+ E ++W ++P    F+T+N STIIA A+GG Y PGNGFS++GAHTDSPCLR+K  S +    + ++GVETYGGG+W TWFDRDLT+AGR IV+
Sbjct:   14 AKELLKFVNRSPSPFHAVAECRNRLLQAGFSELKETEKWNIKPESKYFMTRNSSTIIAFAVGGQYVPGNGFSLIGAHTDSPCLRVKRRSRRSQVGFQQVGVETYGGGIWSTWFDRDLTLAGRVIVK 139          
BLAST of Aspartyl aminopeptidase vs. Ensembl Human
Match: DNPEP (aspartyl aminopeptidase [Source:HGNC Symbol;Acc:HGNC:2981])

HSP 1 Score: 354.755 bits (909), Expect = 2.879e-126
Identity = 175/333 (52.55%), Postives = 243/333 (72.97%), Query Frame = 2
Query:  500 SDRYKHMLVNLRRPIARVPTLAVHLDRSVNESFAPNKESHLSPVLCTTIGEQINKTSDQKDSPKTSL--HHPIVLMEAIAEELKVKVEDIVDIELCLADSQPAAIGGIHQEFMFAPRLDNLFNCFASIQALTESLE---SISLDTNIRVVSLYDNEEIGSQSAQGAQSAFTELVLRRVVNAICEYIPTPSCSQYERAIANSLLVSADQAHAVHPNYEEKHERQHRPLPHQGIVLKVNSNQRYASNAMTTSIIREVANKSDVPLQEFVIRQDMVCGSTIGPIISANMGLATVDIGGPQLSMHSCREMADVSSVEQAVRLFKGFFDLYPDLSYRV 1483
            S R +  LV++ RPI R+P LA+HL R++NE+F PN E HL P+L T I E++ K + +   P  ++   H  VLM  +   L +  +DIV++ELCLAD+QPA +GG + EF+FAPRLDNL +CF ++QAL +S     S++ + ++R+V+LYDNEE+GS+SAQGAQS  TELVLRR+ +A C++ PT     +E AI  S ++SAD AHAVHPNY +KHE  HRPL H+G V+KVNS QRYASNA++ ++IREVANK  VPLQ+ ++R D  CG+TIGPI+++ +GL  +D+G PQL+MHS REMA  + V Q + LFKGFF+L+P LS+ +
Sbjct:   82 SGRLEQQLVHVERPILRIPHLAIHLQRNINENFGPNTEMHLVPILATAIQEELEKGTPEP-GPLNAVDERHHSVLMSLLCAHLGLSPKDIVEMELCLADTQPAVLGGAYDEFIFAPRLDNLHSCFCALQALIDSCAGPGSLATEPHVRMVTLYDNEEVGSESAQGAQSLLTELVLRRI-SASCQH-PT----AFEEAIPKSFMISADMAHAVHPNYLDKHEENHRPLFHKGPVIKVNSKQRYASNAVSEALIREVANKVKVPLQDLMVRNDTPCGTTIGPILASRLGLRVLDLGSPQLAMHSIREMACTTGVLQTLTLFKGFFELFPSLSHNL 407          

HSP 2 Score: 119.013 bits (297), Expect = 2.879e-126
Identity = 51/78 (65.38%), Postives = 64/78 (82.05%), Query Frame = 3
Query:  198 VTKNHSTIIALAIGGNYKPGNGFSMVGAHTDSPCLRLKPNSEQISSTYLKLGVETYGGGLWYTWFDRDLTVAGRCIVR 431
            +T+N STIIA A+GG Y PGNGFS++GAHTDSPCLR+K  S +    + ++GVETYGGG+W TWFDRDLT+AGR IV+
Sbjct:    1 MTRNSSTIIAFAVGGQYVPGNGFSLIGAHTDSPCLRVKRRSRRSQVGFQQVGVETYGGGIWSTWFDRDLTLAGRVIVK 78          
BLAST of Aspartyl aminopeptidase vs. Ensembl Human
Match: DNPEP (aspartyl aminopeptidase [Source:HGNC Symbol;Acc:HGNC:2981])

HSP 1 Score: 173.711 bits (439), Expect = 5.815e-82
Identity = 73/126 (57.94%), Postives = 99/126 (78.57%), Query Frame = 3
Query:   54 AKNLIKFIDKSPTPFHAVATVKEMLLKSGFKEIHEQDQWTLRPNDLVFVTKNHSTIIALAIGGNYKPGNGFSMVGAHTDSPCLRLKPNSEQISSTYLKLGVETYGGGLWYTWFDRDLTVAGRCIVR 431
            AK L+KF+++SP+PFHAVA  +  LL++GF E+ E ++W ++P    F+T+N STIIA A+GG Y PGNGFS++GAHTDSPCLR+K  S +    + ++GVETYGGG+W TWFDRDLT+AGR IV+
Sbjct:   36 AKELLKFVNRSPSPFHAVAECRNRLLQAGFSELKETEKWNIKPESKYFMTRNSSTIIAFAVGGQYVPGNGFSLIGAHTDSPCLRVKRRSRRSQVGFQQVGVETYGGGIWSTWFDRDLTLAGRVIVK 161          

HSP 2 Score: 152.14 bits (383), Expect = 5.815e-82
Identity = 87/208 (41.83%), Postives = 125/208 (60.10%), Query Frame = 2
Query:  500 SDRYKHMLVNLRRPIARVPTLAVHLDRSVNESFAPNKESHLSPVLCTTIGEQINKTSDQKDSPKTSLHHPIVLMEAIAEELKVKVEDIVDIELCLADSQPAAIGGIHQEFMFAPRLDNLFNCFASIQALTESLE---SISLDTNIRVVSLYDNEEIGSQSAQGAQSAFTELVLRRVVNAICEYIPTPSCSQYERAIANSLLVSADQAH 1114
            S R +  LV++ RPI R+P LA+HL R++NE+F PN E HL P+L T I E++     +K +P+    + +VL                              GG + EF+FAPRLDNL +CF ++QAL +S     S++ + ++R+V+LYDNEE+GS+SAQGAQS  TELVLRR ++A C++ PT     +E AI  S ++SAD AH
Sbjct:  165 SGRLEQQLVHVERPILRIPHLAIHLQRNINENFGPNTEMHLVPILATAIQEEL-----EKGTPEPGPLNAVVL------------------------------GGAYDEFIFAPRLDNLHSCFCALQALIDSCAGPGSLATEPHVRMVTLYDNEEVGSESAQGAQSLLTELVLRR-ISASCQH-PT----AFEEAIPKSFMISADMAH 331          
BLAST of Aspartyl aminopeptidase vs. Ensembl Celegans
Match: dnpp-1 (Aspartyl aminopeptidase [Source:UniProtKB/Swiss-Prot;Acc:Q19087])

HSP 1 Score: 263.462 bits (672), Expect = 4.060e-112
Identity = 148/329 (44.98%), Postives = 207/329 (62.92%), Query Frame = 2
Query:  500 SDRYKHMLVNLRRPIARVPTLAVHL--DRSVNESFAPNKESHLSPVLCTTIGEQINKTSDQKDS----PK--TSLHHPIVLMEAIAEELKVKVEDIVDIELCLADSQPAAIGGIHQEFMFAPRLDNLFNCFASIQALTESL--ESISLDTNIRVVSLYDNEEIGSQSAQGAQSAFTELVLRRVVNAICEYIPTPSCSQYERAIANSLLVSADQAHAVHPNYEEKHERQHRPLPHQGIVLKVNSNQRYASNAMTTSIIREVANKSDVPLQEFVIRQDMVCGSTIGPIISANMGLATVDIGGPQLSMHSCREMADVSSVEQAVRLFKGFFD 1456
             ++ +H L+++++P+  +P LA+HL  DR+   +F PN E+ L P+L T     IN     + +    P+  T+ HHP  L   IA+E   + EDIVD++L L D+  AAI G+  EF+   RLDN    + +I  L ESL  ES   D  IR+ + +DNEE+GS SA GA S+FTE VLRR+           S + +E AI  S+L+SADQAHA HPNY  KHE  HRP  H G+V+KVN NQRYA+ + T + +++VA ++ VPLQ  V+R D  CGST+GPI++  +GL TVD+G PQL+MHS RE AD SS+ QA  L+  F++
Sbjct:  143 GEKLQHKLIDVKKPVLFIPNLAIHLETDRT---TFKPNTETELRPILETFAAAGINAPQKPESTGFADPRNITNNHHPQFL-GLIAKEAGCQPEDIVDLDLYLYDTNKAAIVGMEDEFISGARLDNQVGTYTAISGLLESLTGESFKNDPQIRIAACFDNEEVGSDSAMGASSSFTEFVLRRLSAG-------GSTTAFEEAIGKSMLISADQAHATHPNYSAKHEENHRPAFHGGVVVKVNVNQRYATTSTTHAALKQVAFEAQVPLQVVVVRNDSPCGSTVGPILATKLGLQTVDVGCPQLAMHSIREFADTSSIYQATTLYSTFYE 460          

HSP 2 Score: 161.77 bits (408), Expect = 4.060e-112
Identity = 71/126 (56.35%), Postives = 94/126 (74.60%), Query Frame = 3
Query:   54 AKNLIKFIDKSPTPFHAVATVKEMLLKSGFKEIHEQDQWTLRPNDLVFVTKNHSTIIALAIGGNYKPGNGFSMVGAHTDSPCLRLKPNSEQISSTYLKLGVETYGGGLWYTWFDRDLTVAGRCIVR 431
            A+  I +++K+ TPFHA   VK+ LL++GF E+ E   W ++P    FVTKN S I+A A+GG+YKPG+GFS+V  HTDSPCLR+KP S Q S  +L++GV TYGGG+W TWFDRDL+VAG  IV+
Sbjct:   16 AQEFINYLNKAVTPFHATQEVKDRLLQAGFTELPESGHWDIQPTSKYFVTKNRSAILAFAVGGSYKPGSGFSIVVGHTDSPCLRVKPISHQKSDKFLQVGVSTYGGGIWRTWFDRDLSVAGLVIVK 141          
BLAST of Aspartyl aminopeptidase vs. Ensembl Celegans
Match: dnpp-1 (Aspartyl aminopeptidase [Source:UniProtKB/Swiss-Prot;Acc:Q19087])

HSP 1 Score: 263.077 bits (671), Expect = 5.038e-112
Identity = 148/329 (44.98%), Postives = 207/329 (62.92%), Query Frame = 2
Query:  500 SDRYKHMLVNLRRPIARVPTLAVHL--DRSVNESFAPNKESHLSPVLCTTIGEQINKTSDQKDS----PK--TSLHHPIVLMEAIAEELKVKVEDIVDIELCLADSQPAAIGGIHQEFMFAPRLDNLFNCFASIQALTESL--ESISLDTNIRVVSLYDNEEIGSQSAQGAQSAFTELVLRRVVNAICEYIPTPSCSQYERAIANSLLVSADQAHAVHPNYEEKHERQHRPLPHQGIVLKVNSNQRYASNAMTTSIIREVANKSDVPLQEFVIRQDMVCGSTIGPIISANMGLATVDIGGPQLSMHSCREMADVSSVEQAVRLFKGFFD 1456
             ++ +H L+++++P+  +P LA+HL  DR+   +F PN E+ L P+L T     IN     + +    P+  T+ HHP  L   IA+E   + EDIVD++L L D+  AAI G+  EF+   RLDN    + +I  L ESL  ES   D  IR+ + +DNEE+GS SA GA S+FTE VLRR+           S + +E AI  S+L+SADQAHA HPNY  KHE  HRP  H G+V+KVN NQRYA+ + T + +++VA ++ VPLQ  V+R D  CGST+GPI++  +GL TVD+G PQL+MHS RE AD SS+ QA  L+  F++
Sbjct:  180 GEKLQHKLIDVKKPVLFIPNLAIHLETDRT---TFKPNTETELRPILETFAAAGINAPQKPESTGFADPRNITNNHHPQFL-GLIAKEAGCQPEDIVDLDLYLYDTNKAAIVGMEDEFISGARLDNQVGTYTAISGLLESLTGESFKNDPQIRIAACFDNEEVGSDSAMGASSSFTEFVLRRLSAG-------GSTTAFEEAIGKSMLISADQAHATHPNYSAKHEENHRPAFHGGVVVKVNVNQRYATTSTTHAALKQVAFEAQVPLQVVVVRNDSPCGSTVGPILATKLGLQTVDVGCPQLAMHSIREFADTSSIYQATTLYSTFYE 497          

HSP 2 Score: 161.77 bits (408), Expect = 5.038e-112
Identity = 71/126 (56.35%), Postives = 94/126 (74.60%), Query Frame = 3
Query:   54 AKNLIKFIDKSPTPFHAVATVKEMLLKSGFKEIHEQDQWTLRPNDLVFVTKNHSTIIALAIGGNYKPGNGFSMVGAHTDSPCLRLKPNSEQISSTYLKLGVETYGGGLWYTWFDRDLTVAGRCIVR 431
            A+  I +++K+ TPFHA   VK+ LL++GF E+ E   W ++P    FVTKN S I+A A+GG+YKPG+GFS+V  HTDSPCLR+KP S Q S  +L++GV TYGGG+W TWFDRDL+VAG  IV+
Sbjct:   53 AQEFINYLNKAVTPFHATQEVKDRLLQAGFTELPESGHWDIQPTSKYFVTKNRSAILAFAVGGSYKPGSGFSIVVGHTDSPCLRVKPISHQKSDKFLQVGVSTYGGGIWRTWFDRDLSVAGLVIVK 178          
BLAST of Aspartyl aminopeptidase vs. Ensembl Zebrafish
Match: dnpep (aspartyl aminopeptidase [Source:ZFIN;Acc:ZDB-GENE-040426-852])

HSP 1 Score: 329.717 bits (844), Expect = 3.197e-134
Identity = 154/321 (47.98%), Postives = 227/321 (70.72%), Query Frame = 2
Query:  521 LVNLRRPIARVPTLAVHLDRSVNESFAPNKESHLSPVLCTTIGEQINKTS----DQKDSPKTSLHHPIVLMEAIAEELKVKVEDIVDIELCLADSQPAAIGGIHQEFMFAPRLDNLFNCFASIQALTESL--ESISLDTNIRVVSLYDNEEIGSQSAQGAQSAFTELVLRRVVNAICEYIPTPSCSQYERAIANSLLVSADQAHAVHPNYEEKHERQHRPLPHQGIVLKVNSNQRYASNAMTTSIIREVANKSDVPLQEFVIRQDMVCGSTIGPIISANMGLATVDIGGPQLSMHSCREMADVSSVEQAVRLFKGFFDLYP 1465
            LV++ RPI R+P LA+HL R +N+SF PNKE+HL+P+L T + E++   S    D  ++   +  H   L++ +   L V+  D++D ELCL D+QP A+GG ++EF+F+PRLDNL +CF ++ AL +S   +S++ D N+R+V+LYDNEE+GS+SAQGA S  TEL+L+R+ ++        + + ++ A+  S ++SAD AHA HPNY+EKHE  HRP  H+G V+K NSNQRYA+ A+T +++RE+A K  VPLQ+ ++R D  CG+TIGPI++A +G+A +D+G PQL+MHS REM   S V Q   LFKGFF+ +P
Sbjct:  151 LVHVPRPILRIPHLAIHLQRDINDSFGPNKENHLAPLLATAVQEELETGSASSGDASNATCVAEKHQPALIQMLCGLLSVESNDLLDFELCLVDTQPGALGGAYEEFIFSPRLDNLHSCFCALTALVDSSTPDSLAKDPNVRMVTLYDNEEVGSESAQGAHSNLTELILQRLASS------RDNLTAFQEAVPLSYMISADMAHAAHPNYQEKHEENHRPAFHKGPVIKFNSNQRYATTAVTAAVLREIAGKVGVPLQDVMVRNDSPCGTTIGPILAARLGMAVLDLGAPQLAMHSIREMCCTSGVLQTTTLFKGFFENFP 465          

HSP 2 Score: 169.859 bits (429), Expect = 3.197e-134
Identity = 72/126 (57.14%), Postives = 96/126 (76.19%), Query Frame = 3
Query:   54 AKNLIKFIDKSPTPFHAVATVKEMLLKSGFKEIHEQDQWTLRPNDLVFVTKNHSTIIALAIGGNYKPGNGFSMVGAHTDSPCLRLKPNSEQISSTYLKLGVETYGGGLWYTWFDRDLTVAGRCIVR 431
            AK  + F++K  +P+H V   K  LLK+GF E+ E + W ++P    FVT+N+STIIA A+GG YKPGNGFSM+GAHTDSPCLR+KP S++    +L++GVE YGGG+W TWFDRDLT+AGR +V+
Sbjct:   17 AKEFLNFVNKGVSPYHVVEECKSRLLKAGFTELKEAEHWDIKPASKYFVTRNYSTIIAFAVGGLYKPGNGFSMIGAHTDSPCLRVKPRSKKTKLGFLQVGVECYGGGIWNTWFDRDLTIAGRVMVK 142          
BLAST of Aspartyl aminopeptidase vs. Ensembl Zebrafish
Match: dnpep (aspartyl aminopeptidase [Source:ZFIN;Acc:ZDB-GENE-040426-852])

HSP 1 Score: 329.331 bits (843), Expect = 3.592e-134
Identity = 154/321 (47.98%), Postives = 227/321 (70.72%), Query Frame = 2
Query:  521 LVNLRRPIARVPTLAVHLDRSVNESFAPNKESHLSPVLCTTIGEQINKTS----DQKDSPKTSLHHPIVLMEAIAEELKVKVEDIVDIELCLADSQPAAIGGIHQEFMFAPRLDNLFNCFASIQALTESL--ESISLDTNIRVVSLYDNEEIGSQSAQGAQSAFTELVLRRVVNAICEYIPTPSCSQYERAIANSLLVSADQAHAVHPNYEEKHERQHRPLPHQGIVLKVNSNQRYASNAMTTSIIREVANKSDVPLQEFVIRQDMVCGSTIGPIISANMGLATVDIGGPQLSMHSCREMADVSSVEQAVRLFKGFFDLYP 1465
            LV++ RPI R+P LA+HL R +N+SF PNKE+HL+P+L T + E++   S    D  ++   +  H   L++ +   L V+  D++D ELCL D+QP A+GG ++EF+F+PRLDNL +CF ++ AL +S   +S++ D N+R+V+LYDNEE+GS+SAQGA S  TEL+L+R+ ++        + + ++ A+  S ++SAD AHA HPNY+EKHE  HRP  H+G V+K NSNQRYA+ A+T +++RE+A K  VPLQ+ ++R D  CG+TIGPI++A +G+A +D+G PQL+MHS REM   S V Q   LFKGFF+ +P
Sbjct:  146 LVHVPRPILRIPHLAIHLQRDINDSFGPNKENHLAPLLATAVQEELETGSASSGDASNATCVAEKHQPALIQMLCGLLSVESNDLLDFELCLVDTQPGALGGAYEEFIFSPRLDNLHSCFCALTALVDSSTPDSLAKDPNVRMVTLYDNEEVGSESAQGAHSNLTELILQRLASS------RDNLTAFQEAVPLSYMISADMAHAAHPNYQEKHEENHRPAFHKGPVIKFNSNQRYATTAVTAAVLREIAGKVGVPLQDVMVRNDSPCGTTIGPILAARLGMAVLDLGAPQLAMHSIREMCCTSGVLQTTTLFKGFFENFP 460          

HSP 2 Score: 169.859 bits (429), Expect = 3.592e-134
Identity = 72/126 (57.14%), Postives = 96/126 (76.19%), Query Frame = 3
Query:   54 AKNLIKFIDKSPTPFHAVATVKEMLLKSGFKEIHEQDQWTLRPNDLVFVTKNHSTIIALAIGGNYKPGNGFSMVGAHTDSPCLRLKPNSEQISSTYLKLGVETYGGGLWYTWFDRDLTVAGRCIVR 431
            AK  + F++K  +P+H V   K  LLK+GF E+ E + W ++P    FVT+N+STIIA A+GG YKPGNGFSM+GAHTDSPCLR+KP S++    +L++GVE YGGG+W TWFDRDLT+AGR +V+
Sbjct:   12 AKEFLNFVNKGVSPYHVVEECKSRLLKAGFTELKEAEHWDIKPASKYFVTRNYSTIIAFAVGGLYKPGNGFSMIGAHTDSPCLRVKPRSKKTKLGFLQVGVECYGGGIWNTWFDRDLTIAGRVMVK 137          
BLAST of Aspartyl aminopeptidase vs. Ensembl Zebrafish
Match: dnpep (aspartyl aminopeptidase [Source:ZFIN;Acc:ZDB-GENE-040426-852])

HSP 1 Score: 319.316 bits (817), Expect = 3.792e-131
Identity = 151/325 (46.46%), Postives = 226/325 (69.54%), Query Frame = 2
Query:  521 LVNLRRPIARVPTLAVHLDRSVNESFAPNKESHLSPVLCTTIGEQINKTS----DQKDSPKTSLHHPIVLMEAIAEELKVKVEDIVDIELCLADSQPAAIGGIHQEFMFAPRLDNLFNCFASIQALTESL--ESISLDTNIRVVSLYDNEEIGSQSAQGAQSAFTELVLRRVVNAICEYIPTPSCSQYERAIANSLLVSADQAHAVHPNYEEKHERQHRPLPHQGIVLKVNSNQRYASNAMTTSIIREVANKSDVPLQEFVIRQDMVCGSTIGPIISANMGLATVDIGGPQLSMHSCREMADVSSVEQAVRLFK-----GFFDLY 1462
            LV++ RPI R+P LA+HL R +N+SF PNKE+HL+P+L T + E++   S    D  ++   +  H   L++ +   L V+  D++D ELCL D+QP A+GG ++EF+F+PRLDNL +CF ++ AL +S   +S++ D N+R+V+LYDNEE+GS+SAQGA S  TEL+L+R+ ++        + + ++ A+  S ++SAD AHA HPNY+EKHE  HRP  H+G V+K NSNQRYA+ A+T +++RE+A K  VPLQ+ ++R D  CG+TIGPI++A +G+A +D+G PQL+MHS REM   S V Q   LFK     G+++ +
Sbjct:  146 LVHVPRPILRIPHLAIHLQRDINDSFGPNKENHLAPLLATAVQEELETGSASSGDASNATCVAEKHQPALIQMLCGLLSVEPNDLLDFELCLVDTQPGALGGAYEEFIFSPRLDNLHSCFCALTALVDSSTPDSLAKDPNVRMVTLYDNEEVGSESAQGAHSNLTELILQRLASS------RDNLTAFQEAVPLSYMISADMAHAAHPNYQEKHEENHRPAFHKGPVIKFNSNQRYATTAVTAAVLREIAGKVGVPLQDVMVRNDSPCGTTIGPILAARLGMAVLDLGAPQLAMHSIREMCCTSGVLQTTTLFKVKSHFGYYEYF 464          

HSP 2 Score: 169.859 bits (429), Expect = 3.792e-131
Identity = 72/126 (57.14%), Postives = 96/126 (76.19%), Query Frame = 3
Query:   54 AKNLIKFIDKSPTPFHAVATVKEMLLKSGFKEIHEQDQWTLRPNDLVFVTKNHSTIIALAIGGNYKPGNGFSMVGAHTDSPCLRLKPNSEQISSTYLKLGVETYGGGLWYTWFDRDLTVAGRCIVR 431
            AK  + F++K  +P+H V   K  LLK+GF E+ E + W ++P    FVT+N+STIIA A+GG YKPGNGFSM+GAHTDSPCLR+KP S++    +L++GVE YGGG+W TWFDRDLT+AGR +V+
Sbjct:   12 AKEFLNFVNKGVSPYHVVEECKSRLLKAGFTELKEAEHWDIKPASKYFVTRNYSTIIAFAVGGLYKPGNGFSMIGAHTDSPCLRVKPRSKKTKLGFLQVGVECYGGGIWNTWFDRDLTIAGRVMVK 137          
BLAST of Aspartyl aminopeptidase vs. Ensembl Zebrafish
Match: dnpep (aspartyl aminopeptidase [Source:ZFIN;Acc:ZDB-GENE-040426-852])

HSP 1 Score: 305.834 bits (782), Expect = 3.843e-127
Identity = 146/325 (44.92%), Postives = 223/325 (68.62%), Query Frame = 2
Query:  521 LVNLRRPIARVPTLAVHLDRSVNESFAPNKESHLSPVLCTTIGEQINKTS----DQKDSPKTSLHHPIVLMEAIAEELKVKVEDIVDIELCLADSQPAAIGGIHQEFMFAPRLDNLFNCFASIQALTESL--ESISLDTNIRVVSLYDNEEIGSQSAQGAQSAFTELVLRRVVNAICEYIPTPSCSQYERAIANSLLVSADQAHAVHPNYEEKHERQHRPLPHQGIVLKVNSNQRYASNAMTTSIIREVANKSDVPLQEFVIRQDMVCGSTIGPIISANMGLATVDIGGPQLSMHSCREMADVSSVEQAVRLFK-----GFFDLY 1462
            LV++ RPI R+P LA+HL R +N+SF PNKE+HL+P+L T + E++   S    D  ++   +  H   L++ +   L V+  D++D ELCL D+QP A+GG ++EF+F+PRLDNL +CF ++ AL +S   +S++ D N+R+V+LYDNEE+GS+SAQGA S  TEL+L+R+ ++        + + ++ A+  S ++SAD AHA HPNY+ +H      +P+QG V+K NSNQRYA+ A+T +++RE+A K  VPLQ+ ++R D  CG+TIGPI++A +G+A +D+G PQL+MHS REM   S V Q   LFK     G+++ +
Sbjct:  146 LVHVPRPILRIPHLAIHLQRDINDSFGPNKENHLAPLLATAVQEELETGSASSGDASNATCVAEKHQPALIQMLCGLLSVEPNDLLDFELCLVDTQPGALGGAYEEFIFSPRLDNLHSCFCALTALVDSSTPDSLAKDPNVRMVTLYDNEEVGSESAQGAHSNLTELILQRLASS------RDNLTAFQEAVPLSYMISADMAHAAHPNYQSQHHFLSHCVPNQGPVIKFNSNQRYATTAVTAAVLREIAGKVGVPLQDVMVRNDSPCGTTIGPILAARLGMAVLDLGAPQLAMHSIREMCCTSGVLQTTTLFKVKSHFGYYEYF 464          

HSP 2 Score: 169.859 bits (429), Expect = 3.843e-127
Identity = 72/126 (57.14%), Postives = 96/126 (76.19%), Query Frame = 3
Query:   54 AKNLIKFIDKSPTPFHAVATVKEMLLKSGFKEIHEQDQWTLRPNDLVFVTKNHSTIIALAIGGNYKPGNGFSMVGAHTDSPCLRLKPNSEQISSTYLKLGVETYGGGLWYTWFDRDLTVAGRCIVR 431
            AK  + F++K  +P+H V   K  LLK+GF E+ E + W ++P    FVT+N+STIIA A+GG YKPGNGFSM+GAHTDSPCLR+KP S++    +L++GVE YGGG+W TWFDRDLT+AGR +V+
Sbjct:   12 AKEFLNFVNKGVSPYHVVEECKSRLLKAGFTELKEAEHWDIKPASKYFVTRNYSTIIAFAVGGLYKPGNGFSMIGAHTDSPCLRVKPRSKKTKLGFLQVGVECYGGGIWNTWFDRDLTIAGRVMVK 137          
BLAST of Aspartyl aminopeptidase vs. Ensembl Zebrafish
Match: dnpep (aspartyl aminopeptidase [Source:ZFIN;Acc:ZDB-GENE-040426-852])

HSP 1 Score: 169.474 bits (428), Expect = 5.395e-79
Identity = 72/126 (57.14%), Postives = 96/126 (76.19%), Query Frame = 3
Query:   54 AKNLIKFIDKSPTPFHAVATVKEMLLKSGFKEIHEQDQWTLRPNDLVFVTKNHSTIIALAIGGNYKPGNGFSMVGAHTDSPCLRLKPNSEQISSTYLKLGVETYGGGLWYTWFDRDLTVAGRCIVR 431
            AK  + F++K  +P+H V   K  LLK+GF E+ E + W ++P    FVT+N+STIIA A+GG YKPGNGFSM+GAHTDSPCLR+KP S++    +L++GVE YGGG+W TWFDRDLT+AGR +V+
Sbjct:   17 AKEFLNFVNKGVSPYHVVEECKSRLLKAGFTELKEAEHWDIKPASKYFVTRNYSTIIAFAVGGLYKPGNGFSMIGAHTDSPCLRVKPRSKKTKLGFLQVGVECYGGGIWNTWFDRDLTIAGRVMVK 142          

HSP 2 Score: 145.976 bits (367), Expect = 5.395e-79
Identity = 68/152 (44.74%), Postives = 106/152 (69.74%), Query Frame = 2
Query:  521 LVNLRRPIARVPTLAVHLDRSVNESFAPNKESHLSPVLCTTIGEQINKTS----DQKDSPKTSLHHPIVLMEAIAEELKVKVEDIVDIELCLADSQPAAIGGIHQEFMFAPRLDNLFNCFASIQALTESL--ESISLDTNIRVVSLYDNEEI 958
            LV++ RPI R+P LA+HL R +N+SF PNKE+HL+P+L T + E++   S    D  ++   +  H   L++ +   L V+  D++D ELCL D+QP A+GG ++EF+F+PRLDNL +CF ++ AL +S   +S++ D N+R+V+LYDNEE+
Sbjct:  151 LVHVPRPILRIPHLAIHLQRDINDSFGPNKENHLAPLLATAVQEELETGSASSGDASNATCVAEKHQPALIQMLCGLLSVESNDLLDFELCLVDTQPGALGGAYEEFIFSPRLDNLHSCFCALTALVDSSTPDSLAKDPNVRMVTLYDNEEV 302          
BLAST of Aspartyl aminopeptidase vs. Ensembl Xenopus
Match: dnpep (aspartyl aminopeptidase [Source:NCBI gene;Acc:548780])

HSP 1 Score: 328.946 bits (842), Expect = 4.122e-132
Identity = 164/335 (48.96%), Postives = 231/335 (68.96%), Query Frame = 2
Query:  512 KHMLVNLRRPIARVPTLAVHLDRSVNESFAPNKESHLSPVLCTTIGEQINK-TSDQKDSPKTS--------LHHPIVLMEAIAEELKVKVEDIVDIELCLADSQPAAIGGIHQEFMFAPRLDNLFNCFASIQALTESLES---ISLDTNIRVVSLYDNEEIGSQSAQGAQSAFTELVLRRVVNAICEYIPTPSCSQ-----YERAIANSLLVSADQAHAVHPNYEEKHERQHRPLPHQGIVLKVNSNQRYASNAMTTSIIREVANKSDVPLQEFVIRQDMVCGSTIGPIISANMGLATVDIGGPQLSMHSCREMADVSSVEQAVRLFKGFFDLYP 1465
            +H LV++ RPI R+P LA+HL R+VNESF PN E  L P+L +++ E + K T D   S  ++         HHP++ +  + ++L VK E I+++ELCL D+QPA +GG ++EF+F PRLDNL +C+ ++QAL  S ES   ++ D N+R+++LYDNEE+GS SAQGA+S  TEL+LRR+           SC+Q     +E ++  S ++SAD AHAVHPNY +KHE  HRPL H+G V+KVNSNQRYAS A+T +++RE+A +  VPLQEF++R D  CG+TIGPI++  +GL  +D+G PQL+MHS REM   S V Q   LF+ FF+ YP
Sbjct:  149 QHRLVHIDRPILRIPHLAIHLQRTVNESFGPNTEQQLIPILASSVQESLEKETLDSGISCPSAPGGNNVAERHHPLL-LTLLCDKLGVKPEQILEMELCLTDTQPATLGGAYEEFIFGPRLDNLHSCYCALQALLGSCESPSSLASDPNVRMITLYDNEEVGSGSAQGAESLLTELILRRI-----------SCTQHNLTAFEESVPKSFMISADMAHAVHPNYMDKHEENHRPLFHKGPVIKVNSNQRYASTAVTEAVLREIAGRVGVPLQEFMVRNDAPCGTTIGPILACKLGLRVLDLGCPQLAMHSVREMCCTSGVLQTSTLFQAFFEQYP 471          

HSP 2 Score: 164.081 bits (414), Expect = 4.122e-132
Identity = 69/126 (54.76%), Postives = 96/126 (76.19%), Query Frame = 3
Query:   54 AKNLIKFIDKSPTPFHAVATVKEMLLKSGFKEIHEQDQWTLRPNDLVFVTKNHSTIIALAIGGNYKPGNGFSMVGAHTDSPCLRLKPNSEQISSTYLKLGVETYGGGLWYTWFDRDLTVAGRCIVR 431
            AK  IKF+++  +P+H V   K  LL++GF E+ E + W ++PN   FVT+N+ST++A A+GG+Y+ GNGF+M+GAHTDSPCLR+K  S +    YL++GVE YGGG+W TWFDRDLTVAGR I++
Sbjct:   18 AKEFIKFLNRGVSPYHVVEECKSRLLQAGFLELKEAEHWDIKPNHKYFVTRNYSTLVAFAVGGHYQQGNGFTMIGAHTDSPCLRVKRRSRRGQCGYLQVGVECYGGGIWSTWFDRDLTVAGRVILK 143          
BLAST of Aspartyl aminopeptidase vs. Ensembl Xenopus
Match: dnpep (aspartyl aminopeptidase [Source:NCBI gene;Acc:548780])

HSP 1 Score: 318.546 bits (815), Expect = 5.920e-129
Identity = 160/328 (48.78%), Postives = 226/328 (68.90%), Query Frame = 2
Query:  512 KHMLVNLRRPIARVPTLAVHLDRSVNESFAPNKESHLSPVLCTTIGEQINK-TSDQKDSPKTS--------LHHPIVLMEAIAEELKVKVEDIVDIELCLADSQPAAIGGIHQEFMFAPRLDNLFNCFASIQALTESLES---ISLDTNIRVVSLYDNEEIGSQSAQGAQSAFTELVLRRVVNAICEYIPTPSCSQ-----YERAIANSLLVSADQAHAVHPNYEEKHERQHRPLPHQGIVLKVNSNQRYASNAMTTSIIREVANKSDVPLQEFVIRQDMVCGSTIGPIISANMGLATVDIGGPQLSMHSCREMADVSSVEQAVRLFK 1444
            +H LV++ RPI R+P LA+HL R+VNESF PN E  L P+L +++ E + K T D   S  ++         HHP++ +  + ++L VK E I+++ELCL D+QPA +GG ++EF+F PRLDNL +C+ ++QAL  S ES   ++ D N+R+++LYDNEE+GS SAQGA+S  TEL+LRR+           SC+Q     +E ++  S ++SAD AHAVHPNY +KHE  HRPL H+G V+KVNSNQRYAS A+T +++RE+A +  VPLQEF++R D  CG+TIGPI++  +GL  +D+G PQL+MHS REM   S V Q   LF+
Sbjct:  147 QHRLVHIDRPILRIPHLAIHLQRTVNESFGPNTEQQLIPILASSVQESLEKETLDSGISCPSAPGGNNVAERHHPLL-LTLLCDKLGVKPEQILEMELCLTDTQPATLGGAYEEFIFGPRLDNLHSCYCALQALLGSCESPSSLASDPNVRMITLYDNEEVGSGSAQGAESLLTELILRRI-----------SCTQHNLTAFEESVPKSFMISADMAHAVHPNYMDKHEENHRPLFHKGPVIKVNSNQRYASTAVTEAVLREIAGRVGVPLQEFMVRNDAPCGTTIGPILACKLGLRVLDLGCPQLAMHSVREMCCTSGVLQTSTLFQ 462          

HSP 2 Score: 164.081 bits (414), Expect = 5.920e-129
Identity = 69/126 (54.76%), Postives = 96/126 (76.19%), Query Frame = 3
Query:   54 AKNLIKFIDKSPTPFHAVATVKEMLLKSGFKEIHEQDQWTLRPNDLVFVTKNHSTIIALAIGGNYKPGNGFSMVGAHTDSPCLRLKPNSEQISSTYLKLGVETYGGGLWYTWFDRDLTVAGRCIVR 431
            AK  IKF+++  +P+H V   K  LL++GF E+ E + W ++PN   FVT+N+ST++A A+GG+Y+ GNGF+M+GAHTDSPCLR+K  S +    YL++GVE YGGG+W TWFDRDLTVAGR I++
Sbjct:   16 AKEFIKFLNRGVSPYHVVEECKSRLLQAGFLELKEAEHWDIKPNHKYFVTRNYSTLVAFAVGGHYQQGNGFTMIGAHTDSPCLRVKRRSRRGQCGYLQVGVECYGGGIWSTWFDRDLTVAGRVILK 141          
BLAST of Aspartyl aminopeptidase vs. Ensembl Xenopus
Match: dnpep (aspartyl aminopeptidase [Source:NCBI gene;Acc:548780])

HSP 1 Score: 293.893 bits (751), Expect = 1.465e-121
Identity = 153/323 (47.37%), Postives = 217/323 (67.18%), Query Frame = 2
Query:  512 KHMLVNLRRPIARVPTLAVHLDRSVNESFAPNKESHLSPVLCTTIGEQINK-TSDQKDS-PKTSLHHPIVLMEAIAEELKVKVEDIVDIELCLADSQPAAIGGIHQEFMFAPRLDNLFNCFASIQALTESLES---ISLDTNIRVVSLYDNEEIGSQSAQGAQSAFTELVLRRVVNAICEYIPTPSCSQ-----YERAIANSLLVSADQAHAVHPNYEEKHERQHRPLPHQ--GIVLKVNSNQRYASNAMTTSIIREVANKSDVPLQEFVIRQDMVCGSTIGPIISANMGLATVDIGGPQLSMHSCREMADVSSVEQAVRLFK 1444
            +H LV++ RPI R+P LA+HL R+VNESF PN E  L P+L +++ E + K T D   S P    HHP++ +  + ++L VK E I+++ELCL D+QPA +GG ++EF+F PRLDNL +C+ ++QAL  S ES   ++ D N+R+++LYDNEE+GS SAQGA+S  TEL+LRR+           SC+Q     +E ++  S ++SAD AHA HP         + PLP+   G V+KVNSNQRYAS A+T +++RE+A +  VPLQEF++R D  CG+TIGPI++  +GL  +D+G PQL+MHS REM   S V Q   LF+
Sbjct:  143 QHRLVHIDRPILRIPHLAIHLQRTVNESFGPNTEQQLIPILASSVQESLEKETLDSGISCPSAERHHPLL-LTLLCDKLGVKPEQILEMELCLTDTQPATLGGAYEEFIFGPRLDNLHSCYCALQALLGSCESPSSLASDPNVRMITLYDNEEVGSGSAQGAESLLTELILRRI-----------SCTQHNLTAFEESVPKSFMISADMAHACHPCL-------NHPLPNSSPGPVIKVNSNQRYASTAVTEAVLREIAGRVGVPLQEFMVRNDAPCGTTIGPILACKLGLRVLDLGCPQLAMHSVREMCCTSGVLQTSTLFQ 446          

HSP 2 Score: 164.081 bits (414), Expect = 1.465e-121
Identity = 69/126 (54.76%), Postives = 96/126 (76.19%), Query Frame = 3
Query:   54 AKNLIKFIDKSPTPFHAVATVKEMLLKSGFKEIHEQDQWTLRPNDLVFVTKNHSTIIALAIGGNYKPGNGFSMVGAHTDSPCLRLKPNSEQISSTYLKLGVETYGGGLWYTWFDRDLTVAGRCIVR 431
            AK  IKF+++  +P+H V   K  LL++GF E+ E + W ++PN   FVT+N+ST++A A+GG+Y+ GNGF+M+GAHTDSPCLR+K  S +    YL++GVE YGGG+W TWFDRDLTVAGR I++
Sbjct:   12 AKEFIKFLNRGVSPYHVVEECKSRLLQAGFLELKEAEHWDIKPNHKYFVTRNYSTLVAFAVGGHYQQGNGFTMIGAHTDSPCLRVKRRSRRGQCGYLQVGVECYGGGIWSTWFDRDLTVAGRVILK 137          
BLAST of Aspartyl aminopeptidase vs. Ensembl Mouse
Match: Dnpep (aspartyl aminopeptidase [Source:MGI Symbol;Acc:MGI:1278328])

HSP 1 Score: 342.043 bits (876), Expect = 1.681e-137
Identity = 166/329 (50.46%), Postives = 232/329 (70.52%), Query Frame = 2
Query:  500 SDRYKHMLVNLRRPIARVPTLAVHLDRSVNESFAPNKESHLSPVLCTTIGEQINK-TSDQKDSPKTSLHHPIVLMEAIAEELKVKVEDIVDIELCLADSQPAAIGGIHQEFMFAPRLDNLFNCFASIQALTESLES---ISLDTNIRVVSLYDNEEIGSQSAQGAQSAFTELVLRRVVNAICEYIPTPSCSQYERAIANSLLVSADQAHAVHPNYEEKHERQHRPLPHQGIVLKVNSNQRYASNAMTTSIIREVANKSDVPLQEFVIRQDMVCGSTIGPIISANMGLATVDIGGPQLSMHSCREMADVSSVEQAVRLFKGFFDLYPDLS 1474
            S R +  LV++ RPI R+P LA+HL R++NE+F PN E HL P+L T + E++ K T +      T   H  VLM  +   L +  + I+++ELCLAD+QPA +GG ++EF+FAPRLDNL +CF ++QAL +S  S   ++ D ++R+V+LYDNEE+GS+SAQGAQS  TEL+LRR+  +          + +E AI  S ++SAD AHAVHPNY +KHE  HRPL H+G V+KVNS QRYASNA++ S+IREVA +  VPLQ+ ++R D  CG+TIGPI+++ +GL  +D+G PQL+MHS RE A  + V Q + LFKGFF+L+P +S
Sbjct:  145 SGRLEQRLVHIERPILRIPHLAIHLQRNINENFGPNTEIHLVPILATAVQEELEKGTPEPGPLGATDERHHSVLMSLLCTHLGLSPDSIMEMELCLADTQPAVLGGAYEEFIFAPRLDNLHSCFCALQALIDSCASPASLARDPHVRMVTLYDNEEVGSESAQGAQSLLTELILRRISAS------PQRLTAFEEAIPKSFMISADMAHAVHPNYSDKHEENHRPLFHKGPVIKVNSKQRYASNAVSESMIREVAGQVGVPLQDLMVRNDSPCGTTIGPILASRLGLRVLDLGSPQLAMHSIRETACTTGVLQTLTLFKGFFELFPSVS 467          

HSP 2 Score: 168.318 bits (425), Expect = 1.681e-137
Identity = 70/126 (55.56%), Postives = 98/126 (77.78%), Query Frame = 3
Query:   54 AKNLIKFIDKSPTPFHAVATVKEMLLKSGFKEIHEQDQWTLRPNDLVFVTKNHSTIIALAIGGNYKPGNGFSMVGAHTDSPCLRLKPNSEQISSTYLKLGVETYGGGLWYTWFDRDLTVAGRCIVR 431
            A+ L+KF+++SP+PFH VA  +  LL++GF+E+ E + W + P +  F+T+N S+IIA A+GG Y PGNGFS++GAHTDSPCLR+K  S +    Y ++GVETYGGG+W TWFDRDLT+AGR I++
Sbjct:   16 ARELLKFVNRSPSPFHVVAECRSRLLQAGFRELKETEGWDIVPENKYFLTRNSSSIIAFAVGGQYVPGNGFSLIGAHTDSPCLRVKRKSRRSQVGYHQVGVETYGGGIWSTWFDRDLTLAGRVIIK 141          
BLAST of Aspartyl aminopeptidase vs. Ensembl Mouse
Match: Dnpep (aspartyl aminopeptidase [Source:MGI Symbol;Acc:MGI:1278328])

HSP 1 Score: 342.043 bits (876), Expect = 1.681e-137
Identity = 166/329 (50.46%), Postives = 232/329 (70.52%), Query Frame = 2
Query:  500 SDRYKHMLVNLRRPIARVPTLAVHLDRSVNESFAPNKESHLSPVLCTTIGEQINK-TSDQKDSPKTSLHHPIVLMEAIAEELKVKVEDIVDIELCLADSQPAAIGGIHQEFMFAPRLDNLFNCFASIQALTESLES---ISLDTNIRVVSLYDNEEIGSQSAQGAQSAFTELVLRRVVNAICEYIPTPSCSQYERAIANSLLVSADQAHAVHPNYEEKHERQHRPLPHQGIVLKVNSNQRYASNAMTTSIIREVANKSDVPLQEFVIRQDMVCGSTIGPIISANMGLATVDIGGPQLSMHSCREMADVSSVEQAVRLFKGFFDLYPDLS 1474
            S R +  LV++ RPI R+P LA+HL R++NE+F PN E HL P+L T + E++ K T +      T   H  VLM  +   L +  + I+++ELCLAD+QPA +GG ++EF+FAPRLDNL +CF ++QAL +S  S   ++ D ++R+V+LYDNEE+GS+SAQGAQS  TEL+LRR+  +          + +E AI  S ++SAD AHAVHPNY +KHE  HRPL H+G V+KVNS QRYASNA++ S+IREVA +  VPLQ+ ++R D  CG+TIGPI+++ +GL  +D+G PQL+MHS RE A  + V Q + LFKGFF+L+P +S
Sbjct:  145 SGRLEQRLVHIERPILRIPHLAIHLQRNINENFGPNTEIHLVPILATAVQEELEKGTPEPGPLGATDERHHSVLMSLLCTHLGLSPDSIMEMELCLADTQPAVLGGAYEEFIFAPRLDNLHSCFCALQALIDSCASPASLARDPHVRMVTLYDNEEVGSESAQGAQSLLTELILRRISAS------PQRLTAFEEAIPKSFMISADMAHAVHPNYSDKHEENHRPLFHKGPVIKVNSKQRYASNAVSESMIREVAGQVGVPLQDLMVRNDSPCGTTIGPILASRLGLRVLDLGSPQLAMHSIRETACTTGVLQTLTLFKGFFELFPSVS 467          

HSP 2 Score: 168.318 bits (425), Expect = 1.681e-137
Identity = 70/126 (55.56%), Postives = 98/126 (77.78%), Query Frame = 3
Query:   54 AKNLIKFIDKSPTPFHAVATVKEMLLKSGFKEIHEQDQWTLRPNDLVFVTKNHSTIIALAIGGNYKPGNGFSMVGAHTDSPCLRLKPNSEQISSTYLKLGVETYGGGLWYTWFDRDLTVAGRCIVR 431
            A+ L+KF+++SP+PFH VA  +  LL++GF+E+ E + W + P +  F+T+N S+IIA A+GG Y PGNGFS++GAHTDSPCLR+K  S +    Y ++GVETYGGG+W TWFDRDLT+AGR I++
Sbjct:   16 ARELLKFVNRSPSPFHVVAECRSRLLQAGFRELKETEGWDIVPENKYFLTRNSSSIIAFAVGGQYVPGNGFSLIGAHTDSPCLRVKRKSRRSQVGYHQVGVETYGGGIWSTWFDRDLTLAGRVIIK 141          
BLAST of Aspartyl aminopeptidase vs. Ensembl Mouse
Match: Dnpep (aspartyl aminopeptidase [Source:MGI Symbol;Acc:MGI:1278328])

HSP 1 Score: 342.043 bits (876), Expect = 1.681e-137
Identity = 166/329 (50.46%), Postives = 232/329 (70.52%), Query Frame = 2
Query:  500 SDRYKHMLVNLRRPIARVPTLAVHLDRSVNESFAPNKESHLSPVLCTTIGEQINK-TSDQKDSPKTSLHHPIVLMEAIAEELKVKVEDIVDIELCLADSQPAAIGGIHQEFMFAPRLDNLFNCFASIQALTESLES---ISLDTNIRVVSLYDNEEIGSQSAQGAQSAFTELVLRRVVNAICEYIPTPSCSQYERAIANSLLVSADQAHAVHPNYEEKHERQHRPLPHQGIVLKVNSNQRYASNAMTTSIIREVANKSDVPLQEFVIRQDMVCGSTIGPIISANMGLATVDIGGPQLSMHSCREMADVSSVEQAVRLFKGFFDLYPDLS 1474
            S R +  LV++ RPI R+P LA+HL R++NE+F PN E HL P+L T + E++ K T +      T   H  VLM  +   L +  + I+++ELCLAD+QPA +GG ++EF+FAPRLDNL +CF ++QAL +S  S   ++ D ++R+V+LYDNEE+GS+SAQGAQS  TEL+LRR+  +          + +E AI  S ++SAD AHAVHPNY +KHE  HRPL H+G V+KVNS QRYASNA++ S+IREVA +  VPLQ+ ++R D  CG+TIGPI+++ +GL  +D+G PQL+MHS RE A  + V Q + LFKGFF+L+P +S
Sbjct:  145 SGRLEQRLVHIERPILRIPHLAIHLQRNINENFGPNTEIHLVPILATAVQEELEKGTPEPGPLGATDERHHSVLMSLLCTHLGLSPDSIMEMELCLADTQPAVLGGAYEEFIFAPRLDNLHSCFCALQALIDSCASPASLARDPHVRMVTLYDNEEVGSESAQGAQSLLTELILRRISAS------PQRLTAFEEAIPKSFMISADMAHAVHPNYSDKHEENHRPLFHKGPVIKVNSKQRYASNAVSESMIREVAGQVGVPLQDLMVRNDSPCGTTIGPILASRLGLRVLDLGSPQLAMHSIRETACTTGVLQTLTLFKGFFELFPSVS 467          

HSP 2 Score: 168.318 bits (425), Expect = 1.681e-137
Identity = 70/126 (55.56%), Postives = 98/126 (77.78%), Query Frame = 3
Query:   54 AKNLIKFIDKSPTPFHAVATVKEMLLKSGFKEIHEQDQWTLRPNDLVFVTKNHSTIIALAIGGNYKPGNGFSMVGAHTDSPCLRLKPNSEQISSTYLKLGVETYGGGLWYTWFDRDLTVAGRCIVR 431
            A+ L+KF+++SP+PFH VA  +  LL++GF+E+ E + W + P +  F+T+N S+IIA A+GG Y PGNGFS++GAHTDSPCLR+K  S +    Y ++GVETYGGG+W TWFDRDLT+AGR I++
Sbjct:   16 ARELLKFVNRSPSPFHVVAECRSRLLQAGFRELKETEGWDIVPENKYFLTRNSSSIIAFAVGGQYVPGNGFSLIGAHTDSPCLRVKRKSRRSQVGYHQVGVETYGGGIWSTWFDRDLTLAGRVIIK 141          
BLAST of Aspartyl aminopeptidase vs. Ensembl Mouse
Match: Dnpep (aspartyl aminopeptidase [Source:MGI Symbol;Acc:MGI:1278328])

HSP 1 Score: 342.043 bits (876), Expect = 1.709e-137
Identity = 166/329 (50.46%), Postives = 232/329 (70.52%), Query Frame = 2
Query:  500 SDRYKHMLVNLRRPIARVPTLAVHLDRSVNESFAPNKESHLSPVLCTTIGEQINK-TSDQKDSPKTSLHHPIVLMEAIAEELKVKVEDIVDIELCLADSQPAAIGGIHQEFMFAPRLDNLFNCFASIQALTESLES---ISLDTNIRVVSLYDNEEIGSQSAQGAQSAFTELVLRRVVNAICEYIPTPSCSQYERAIANSLLVSADQAHAVHPNYEEKHERQHRPLPHQGIVLKVNSNQRYASNAMTTSIIREVANKSDVPLQEFVIRQDMVCGSTIGPIISANMGLATVDIGGPQLSMHSCREMADVSSVEQAVRLFKGFFDLYPDLS 1474
            S R +  LV++ RPI R+P LA+HL R++NE+F PN E HL P+L T + E++ K T +      T   H  VLM  +   L +  + I+++ELCLAD+QPA +GG ++EF+FAPRLDNL +CF ++QAL +S  S   ++ D ++R+V+LYDNEE+GS+SAQGAQS  TEL+LRR+  +          + +E AI  S ++SAD AHAVHPNY +KHE  HRPL H+G V+KVNS QRYASNA++ S+IREVA +  VPLQ+ ++R D  CG+TIGPI+++ +GL  +D+G PQL+MHS RE A  + V Q + LFKGFF+L+P +S
Sbjct:  147 SGRLEQRLVHIERPILRIPHLAIHLQRNINENFGPNTEIHLVPILATAVQEELEKGTPEPGPLGATDERHHSVLMSLLCTHLGLSPDSIMEMELCLADTQPAVLGGAYEEFIFAPRLDNLHSCFCALQALIDSCASPASLARDPHVRMVTLYDNEEVGSESAQGAQSLLTELILRRISAS------PQRLTAFEEAIPKSFMISADMAHAVHPNYSDKHEENHRPLFHKGPVIKVNSKQRYASNAVSESMIREVAGQVGVPLQDLMVRNDSPCGTTIGPILASRLGLRVLDLGSPQLAMHSIRETACTTGVLQTLTLFKGFFELFPSVS 469          

HSP 2 Score: 168.703 bits (426), Expect = 1.709e-137
Identity = 70/126 (55.56%), Postives = 98/126 (77.78%), Query Frame = 3
Query:   54 AKNLIKFIDKSPTPFHAVATVKEMLLKSGFKEIHEQDQWTLRPNDLVFVTKNHSTIIALAIGGNYKPGNGFSMVGAHTDSPCLRLKPNSEQISSTYLKLGVETYGGGLWYTWFDRDLTVAGRCIVR 431
            A+ L+KF+++SP+PFH VA  +  LL++GF+E+ E + W + P +  F+T+N S+IIA A+GG Y PGNGFS++GAHTDSPCLR+K  S +    Y ++GVETYGGG+W TWFDRDLT+AGR I++
Sbjct:   18 ARELLKFVNRSPSPFHVVAECRSRLLQAGFRELKETEGWDIVPENKYFLTRNSSSIIAFAVGGQYVPGNGFSLIGAHTDSPCLRVKRKSRRSQVGYHQVGVETYGGGIWSTWFDRDLTLAGRVIIK 143          
BLAST of Aspartyl aminopeptidase vs. Ensembl Mouse
Match: Dnpep (aspartyl aminopeptidase [Source:MGI Symbol;Acc:MGI:1278328])

HSP 1 Score: 326.25 bits (835), Expect = 9.155e-133
Identity = 160/319 (50.16%), Postives = 223/319 (69.91%), Query Frame = 2
Query:  500 SDRYKHMLVNLRRPIARVPTLAVHLDRSVNESFAPNKESHLSPVLCTTIGEQINK-TSDQKDSPKTSLHHPIVLMEAIAEELKVKVEDIVDIELCLADSQPAAIGGIHQEFMFAPRLDNLFNCFASIQALTESLES---ISLDTNIRVVSLYDNEEIGSQSAQGAQSAFTELVLRRVVNAICEYIPTPSCSQYERAIANSLLVSADQAHAVHPNYEEKHERQHRPLPHQGIVLKVNSNQRYASNAMTTSIIREVANKSDVPLQEFVIRQDMVCGSTIGPIISANMGLATVDIGGPQLSMHSCREMADVSSVEQAVRLFK 1444
            S R +  LV++ RPI R+P LA+HL R++NE+F PN E HL P+L T + E++ K T +      T   H  VLM  +   L +  + I+++ELCLAD+QPA +GG ++EF+FAPRLDNL +CF ++QAL +S  S   ++ D ++R+V+LYDNEE+GS+SAQGAQS  TEL+LRR+  +          + +E AI  S ++SAD AHAVHPNY +KHE  HRPL H+G V+KVNS QRYASNA++ S+IREVA +  VPLQ+ ++R D  CG+TIGPI+++ +GL  +D+G PQL+MHS RE A  + V Q + LFK
Sbjct:  145 SGRLEQRLVHIERPILRIPHLAIHLQRNINENFGPNTEIHLVPILATAVQEELEKGTPEPGPLGATDERHHSVLMSLLCTHLGLSPDSIMEMELCLADTQPAVLGGAYEEFIFAPRLDNLHSCFCALQALIDSCASPASLARDPHVRMVTLYDNEEVGSESAQGAQSLLTELILRRISAS------PQRLTAFEEAIPKSFMISADMAHAVHPNYSDKHEENHRPLFHKGPVIKVNSKQRYASNAVSESMIREVAGQVGVPLQDLMVRNDSPCGTTIGPILASRLGLRVLDLGSPQLAMHSIRETACTTGVLQTLTLFK 457          

HSP 2 Score: 168.318 bits (425), Expect = 9.155e-133
Identity = 70/126 (55.56%), Postives = 98/126 (77.78%), Query Frame = 3
Query:   54 AKNLIKFIDKSPTPFHAVATVKEMLLKSGFKEIHEQDQWTLRPNDLVFVTKNHSTIIALAIGGNYKPGNGFSMVGAHTDSPCLRLKPNSEQISSTYLKLGVETYGGGLWYTWFDRDLTVAGRCIVR 431
            A+ L+KF+++SP+PFH VA  +  LL++GF+E+ E + W + P +  F+T+N S+IIA A+GG Y PGNGFS++GAHTDSPCLR+K  S +    Y ++GVETYGGG+W TWFDRDLT+AGR I++
Sbjct:   16 ARELLKFVNRSPSPFHVVAECRSRLLQAGFRELKETEGWDIVPENKYFLTRNSSSIIAFAVGGQYVPGNGFSLIGAHTDSPCLRVKRKSRRSQVGYHQVGVETYGGGIWSTWFDRDLTLAGRVIIK 141          
BLAST of Aspartyl aminopeptidase vs. UniProt
Match: sp|Q9ULA0|DNPEP_HUMAN (Aspartyl aminopeptidase OS=Homo sapiens OX=9606 GN=DNPEP PE=1 SV=1)

HSP 1 Score: 355.14 bits (910), Expect = 2.645e-142
Identity = 175/333 (52.55%), Postives = 243/333 (72.97%), Query Frame = 2
Query:  500 SDRYKHMLVNLRRPIARVPTLAVHLDRSVNESFAPNKESHLSPVLCTTIGEQINKTSDQKDSPKTSL--HHPIVLMEAIAEELKVKVEDIVDIELCLADSQPAAIGGIHQEFMFAPRLDNLFNCFASIQALTESLE---SISLDTNIRVVSLYDNEEIGSQSAQGAQSAFTELVLRRVVNAICEYIPTPSCSQYERAIANSLLVSADQAHAVHPNYEEKHERQHRPLPHQGIVLKVNSNQRYASNAMTTSIIREVANKSDVPLQEFVIRQDMVCGSTIGPIISANMGLATVDIGGPQLSMHSCREMADVSSVEQAVRLFKGFFDLYPDLSYRV 1483
            S R +  LV++ RPI R+P LA+HL R++NE+F PN E HL P+L T I E++ K + +   P  ++   H  VLM  +   L +  +DIV++ELCLAD+QPA +GG + EF+FAPRLDNL +CF ++QAL +S     S++ + ++R+V+LYDNEE+GS+SAQGAQS  TELVLRR+ +A C++ PT     +E AI  S ++SAD AHAVHPNY +KHE  HRPL H+G V+KVNS QRYASNA++ ++IREVANK  VPLQ+ ++R D  CG+TIGPI+++ +GL  +D+G PQL+MHS REMA  + V Q + LFKGFF+L+P LS+ +
Sbjct:  147 SGRLEQQLVHVERPILRIPHLAIHLQRNINENFGPNTEMHLVPILATAIQEELEKGTPEP-GPLNAVDERHHSVLMSLLCAHLGLSPKDIVEMELCLADTQPAVLGGAYDEFIFAPRLDNLHSCFCALQALIDSCAGPGSLATEPHVRMVTLYDNEEVGSESAQGAQSLLTELVLRRI-SASCQH-PT----AFEEAIPKSFMISADMAHAVHPNYLDKHEENHRPLFHKGPVIKVNSKQRYASNAVSEALIREVANKVKVPLQDLMVRNDTPCGTTIGPILASRLGLRVLDLGSPQLAMHSIREMACTTGVLQTLTLFKGFFELFPSLSHNL 472          

HSP 2 Score: 173.711 bits (439), Expect = 2.645e-142
Identity = 73/126 (57.94%), Postives = 99/126 (78.57%), Query Frame = 3
Query:   54 AKNLIKFIDKSPTPFHAVATVKEMLLKSGFKEIHEQDQWTLRPNDLVFVTKNHSTIIALAIGGNYKPGNGFSMVGAHTDSPCLRLKPNSEQISSTYLKLGVETYGGGLWYTWFDRDLTVAGRCIVR 431
            AK L+KF+++SP+PFHAVA  +  LL++GF E+ E ++W ++P    F+T+N STIIA A+GG Y PGNGFS++GAHTDSPCLR+K  S +    + ++GVETYGGG+W TWFDRDLT+AGR IV+
Sbjct:   18 AKELLKFVNRSPSPFHAVAECRNRLLQAGFSELKETEKWNIKPESKYFMTRNSSTIIAFAVGGQYVPGNGFSLIGAHTDSPCLRVKRRSRRSQVGFQQVGVETYGGGIWSTWFDRDLTLAGRVIVK 143          
BLAST of Aspartyl aminopeptidase vs. UniProt
Match: sp|Q5RBT2|DNPEP_PONAB (Aspartyl aminopeptidase OS=Pongo abelii OX=9601 GN=DNPEP PE=2 SV=1)

HSP 1 Score: 355.14 bits (910), Expect = 1.493e-141
Identity = 174/333 (52.25%), Postives = 243/333 (72.97%), Query Frame = 2
Query:  500 SDRYKHMLVNLRRPIARVPTLAVHLDRSVNESFAPNKESHLSPVLCTTIGEQINKTSDQKDSPKTSL--HHPIVLMEAIAEELKVKVEDIVDIELCLADSQPAAIGGIHQEFMFAPRLDNLFNCFASIQALTESLE---SISLDTNIRVVSLYDNEEIGSQSAQGAQSAFTELVLRRVVNAICEYIPTPSCSQYERAIANSLLVSADQAHAVHPNYEEKHERQHRPLPHQGIVLKVNSNQRYASNAMTTSIIREVANKSDVPLQEFVIRQDMVCGSTIGPIISANMGLATVDIGGPQLSMHSCREMADVSSVEQAVRLFKGFFDLYPDLSYRV 1483
            S R +  LV++ RPI R+P LA+HL R++NE+F PN E HL P+L T I E++ K + +   P  ++   H  VLM  +   L +  +DIV++ELCLAD+QPA +GG + EF+FAPRLDNL +CF ++QAL +S     S++ + ++R+++LYDNEE+GS+SAQGAQS  TELVLRR+ +A C++ PT     +E AI  S ++SAD AHAVHPNY +KHE  HRPL H+G V+KVNS QRYASNA++ ++IREVANK  VPLQ+ ++R D  CG+TIGPI+++ +GL  +D+G PQL+MHS REMA  + V Q + LFKGFF+L+P LS+ +
Sbjct:  143 SGRLEQRLVHVERPILRIPHLAIHLQRNINENFGPNTEMHLVPILATAIQEELEKGTPEP-GPLNAMDERHHSVLMSLLCAHLGLSPKDIVEMELCLADTQPAVLGGAYDEFIFAPRLDNLHSCFCALQALIDSCAGPGSLATEPHVRMITLYDNEEVGSESAQGAQSLLTELVLRRI-SASCQH-PT----AFEEAIPKSFMISADMAHAVHPNYLDKHEENHRPLFHKGPVIKVNSKQRYASNAVSEALIREVANKVKVPLQDLMVRNDTPCGTTIGPILASRLGLRVLDLGSPQLAMHSIREMACTTGVLQTLTLFKGFFELFPSLSHNL 468          

HSP 2 Score: 171.4 bits (433), Expect = 1.493e-141
Identity = 72/126 (57.14%), Postives = 98/126 (77.78%), Query Frame = 3
Query:   54 AKNLIKFIDKSPTPFHAVATVKEMLLKSGFKEIHEQDQWTLRPNDLVFVTKNHSTIIALAIGGNYKPGNGFSMVGAHTDSPCLRLKPNSEQISSTYLKLGVETYGGGLWYTWFDRDLTVAGRCIVR 431
            AK L+KF+++ P+PFHAVA  +  LL++GF E+ E ++W ++P    F+T+N STIIA A+GG Y PGNGFS++GAHTDSPCLR+K  S +    + ++GVETYGGG+W TWFDRDLT+AGR IV+
Sbjct:   14 AKELLKFVNQGPSPFHAVAECRNRLLQAGFSELKETEKWNIKPESKYFMTRNSSTIIAFAVGGQYVPGNGFSLIGAHTDSPCLRVKRRSRRSQVGFQQVGVETYGGGIWSTWFDRDLTLAGRVIVK 139          
BLAST of Aspartyl aminopeptidase vs. UniProt
Match: sp|Q2HJH1|DNPEP_BOVIN (Aspartyl aminopeptidase OS=Bos taurus OX=9913 GN=DNPEP PE=1 SV=1)

HSP 1 Score: 343.969 bits (881), Expect = 2.778e-138
Identity = 170/329 (51.67%), Postives = 237/329 (72.04%), Query Frame = 2
Query:  500 SDRYKHMLVNLRRPIARVPTLAVHLDRSVNESFAPNKESHLSPVLCTTIGEQINK-TSDQKDSPKTSLHHPIVLMEAIAEELKVKVEDIVDIELCLADSQPAAIGGIHQEFMFAPRLDNLFNCFASIQALTESLE---SISLDTNIRVVSLYDNEEIGSQSAQGAQSAFTELVLRRVVNAICEYIPTPSCSQYERAIANSLLVSADQAHAVHPNYEEKHERQHRPLPHQGIVLKVNSNQRYASNAMTTSIIREVANKSDVPLQEFVIRQDMVCGSTIGPIISANMGLATVDIGGPQLSMHSCREMADVSSVEQAVRLFKGFFDLYPDLS 1474
            S R +  LV++ RPI R+P LA+HL R+VNE+F PN E HL P+L T+I E++ K T +      T   H  VL   +   L +  EDI+++ELCLAD+QPA +GG ++EF+FAPRLDNL +CF ++QAL +S     S++ D ++R+++LYDNEE+GS+SAQGAQS  TELVLRR+ +A  +++     + +E AI  S ++SAD AHAVHPNY +KHE  HRPL H+G V+KVNS QRYASNA++ ++IREVA+   VPLQ+ ++R D  CG+TIGPI+++ +GL  +D+G PQL+MHS RE A  + V Q + LFKGFF+L+P LS
Sbjct:  143 SGRLEQRLVHVDRPILRIPHLAIHLQRNVNENFGPNMEMHLVPILATSIQEELEKGTPEPGPLNATDERHHSVLTSLLCAHLGLSPEDILEMELCLADTQPAVLGGAYEEFIFAPRLDNLHSCFCALQALIDSCSAPASLAADPHVRMIALYDNEEVGSESAQGAQSLLTELVLRRI-SASPQHL-----TAFEEAIPKSYMISADMAHAVHPNYLDKHEENHRPLFHKGPVIKVNSKQRYASNAVSEALIREVASSVGVPLQDLMVRNDSPCGTTIGPILASRLGLRVLDLGSPQLAMHSIRETACTTGVLQTITLFKGFFELFPSLS 465          

HSP 2 Score: 171.785 bits (434), Expect = 2.778e-138
Identity = 72/126 (57.14%), Postives = 98/126 (77.78%), Query Frame = 3
Query:   54 AKNLIKFIDKSPTPFHAVATVKEMLLKSGFKEIHEQDQWTLRPNDLVFVTKNHSTIIALAIGGNYKPGNGFSMVGAHTDSPCLRLKPNSEQISSTYLKLGVETYGGGLWYTWFDRDLTVAGRCIVR 431
            A+ L+KF+++SP+PFHAVA  +  LL++GF E+ E + W ++P    F+T+N STIIA A+GG Y PGNGFS++GAHTDSPCLR+K  S +    + ++GVETYGGG+W TWFDRDLT+AGR IV+
Sbjct:   14 ARELLKFVNRSPSPFHAVAECRSRLLQAGFHELKETESWDIKPESKYFLTRNSSTIIAFAVGGQYVPGNGFSLIGAHTDSPCLRVKRRSRRSQVGFQQVGVETYGGGIWSTWFDRDLTLAGRVIVK 139          
BLAST of Aspartyl aminopeptidase vs. UniProt
Match: sp|Q9Z2W0|DNPEP_MOUSE (Aspartyl aminopeptidase OS=Mus musculus OX=10090 GN=Dnpep PE=1 SV=2)

HSP 1 Score: 342.043 bits (876), Expect = 1.019e-136
Identity = 166/329 (50.46%), Postives = 232/329 (70.52%), Query Frame = 2
Query:  500 SDRYKHMLVNLRRPIARVPTLAVHLDRSVNESFAPNKESHLSPVLCTTIGEQINK-TSDQKDSPKTSLHHPIVLMEAIAEELKVKVEDIVDIELCLADSQPAAIGGIHQEFMFAPRLDNLFNCFASIQALTESLES---ISLDTNIRVVSLYDNEEIGSQSAQGAQSAFTELVLRRVVNAICEYIPTPSCSQYERAIANSLLVSADQAHAVHPNYEEKHERQHRPLPHQGIVLKVNSNQRYASNAMTTSIIREVANKSDVPLQEFVIRQDMVCGSTIGPIISANMGLATVDIGGPQLSMHSCREMADVSSVEQAVRLFKGFFDLYPDLS 1474
            S R +  LV++ RPI R+P LA+HL R++NE+F PN E HL P+L T + E++ K T +      T   H  VLM  +   L +  + I+++ELCLAD+QPA +GG ++EF+FAPRLDNL +CF ++QAL +S  S   ++ D ++R+V+LYDNEE+GS+SAQGAQS  TEL+LRR+  +          + +E AI  S ++SAD AHAVHPNY +KHE  HRPL H+G V+KVNS QRYASNA++ S+IREVA +  VPLQ+ ++R D  CG+TIGPI+++ +GL  +D+G PQL+MHS RE A  + V Q + LFKGFF+L+P +S
Sbjct:  145 SGRLEQRLVHIERPILRIPHLAIHLQRNINENFGPNTEIHLVPILATAVQEELEKGTPEPGPLGATDERHHSVLMSLLCTHLGLSPDSIMEMELCLADTQPAVLGGAYEEFIFAPRLDNLHSCFCALQALIDSCASPASLARDPHVRMVTLYDNEEVGSESAQGAQSLLTELILRRISAS------PQRLTAFEEAIPKSFMISADMAHAVHPNYSDKHEENHRPLFHKGPVIKVNSKQRYASNAVSESMIREVAGQVGVPLQDLMVRNDSPCGTTIGPILASRLGLRVLDLGSPQLAMHSIRETACTTGVLQTLTLFKGFFELFPSVS 467          

HSP 2 Score: 168.318 bits (425), Expect = 1.019e-136
Identity = 70/126 (55.56%), Postives = 98/126 (77.78%), Query Frame = 3
Query:   54 AKNLIKFIDKSPTPFHAVATVKEMLLKSGFKEIHEQDQWTLRPNDLVFVTKNHSTIIALAIGGNYKPGNGFSMVGAHTDSPCLRLKPNSEQISSTYLKLGVETYGGGLWYTWFDRDLTVAGRCIVR 431
            A+ L+KF+++SP+PFH VA  +  LL++GF+E+ E + W + P +  F+T+N S+IIA A+GG Y PGNGFS++GAHTDSPCLR+K  S +    Y ++GVETYGGG+W TWFDRDLT+AGR I++
Sbjct:   16 ARELLKFVNRSPSPFHVVAECRSRLLQAGFRELKETEGWDIVPENKYFLTRNSSSIIAFAVGGQYVPGNGFSLIGAHTDSPCLRVKRKSRRSQVGYHQVGVETYGGGIWSTWFDRDLTLAGRVIIK 141          
BLAST of Aspartyl aminopeptidase vs. UniProt
Match: sp|B9RAJ0|DNPEP_RICCO (Probable aspartyl aminopeptidase OS=Ricinus communis OX=3988 GN=RCOM_1506700 PE=2 SV=2)

HSP 1 Score: 283.493 bits (724), Expect = 5.410e-116
Identity = 150/350 (42.86%), Postives = 218/350 (62.29%), Query Frame = 2
Query:  509 YKHMLVNLRRPIARVPTLAVHLDRSVN-ESFAPNKESHLSPVLCTTIGEQINK-------------TSDQKDSPKT----SLHHPIVLMEAIAEELKVKVEDIVDIELCLADSQPAAIGGIHQEFMFAPRLDNLFNCFASIQALTESLESISL---DTNIRVVSLYDNEEIGSQSAQGAQSAFTELVLRRVVNAICEYIPTPSCSQYERAIANSLLVSADQAHAVHPNYEEKHERQHRPLPHQGIVLKVNSNQRYASNAMTTSIIREVANKSDVPLQEFVIRQDMVCGSTIGPIISANMGLATVDIGGPQLSMHSCREMADVSSVEQAVRLFKGFFDLYPDLSYRVRLGL 1495
            Y H LV +  PI RVPTLA+HLDR+VN + F  N +SHL PVL T++  +++K             T   K S  T    S HH + L++ IA ++     DI D EL   D+QP+ I G  +EF+F+ RLDNL   F S++AL ++  S S    ++ +R+V+L+D+EE+GS SAQGA S      L R+ +               +AI  S LVSAD AHA+HPNY +KHE  H+P  H G+V+K N+NQRYA+N++T+ + +E+A+K ++P+Q+FV+R DM CGSTIGPI+++ +G+ TVD+G PQLSMHS REM  V  V+ +   FK FF+ +  L  ++ + +
Sbjct:  148 YSHRLVRIEEPIMRVPTLAIHLDRNVNTDGFKVNTQSHLLPVLATSVKAELSKVVAENGTVGNDEETDGMKSSKGTTNANSKHHSL-LLQMIAGQIGCNGSDICDFELQACDTQPSVIAGAAKEFIFSGRLDNLCMSFCSLKALIDATASDSHLENESGVRMVALFDHEEVGSDSAQGAGSPVMFDALSRITSTF-----NSDSKLLRKAIQKSFLVSADMAHALHPNYADKHEENHQPRMHGGLVIKHNANQRYATNSVTSFLFKEIASKHNLPVQDFVVRNDMPCGSTIGPILASGVGIRTVDVGAPQLSMHSIREMCAVDDVKYSYEHFKAFFEDFSHLDSKITVDM 491          

HSP 2 Score: 157.918 bits (398), Expect = 5.410e-116
Identity = 71/124 (57.26%), Postives = 90/124 (72.58%), Query Frame = 3
Query:   60 NLIKFIDKSPTPFHAVATVKEMLLKSGFKEIHEQDQWTLRPNDLVFVTKNHSTIIALAIGGNYKPGNGFSMVGAHTDSPCLRLKPNSEQISSTYLKLGVETYGGGLWYTWFDRDLTVAGRCIVR 431
            +LI F++ SPT FHA+   K+ L  SG+ ++ E+D W L      F T+NHSTI+A AIG  Y  GNGF +VGAHTDSPC++LKP S+   S YL++GV+ YGGGLW+TWFDRDL VAGR IVR
Sbjct:   16 DLINFLNASPTAFHAIDEAKKRLKHSGYVQVSERDDWKLELGKRYFFTRNHSTIVAFAIGKKYVAGNGFYVVGAHTDSPCIKLKPVSKVTKSGYLEVGVQPYGGGLWHTWFDRDLAVAGRVIVR 139          
BLAST of Aspartyl aminopeptidase vs. TrEMBL
Match: gnl|BL_ORD_ID|20318476 (tr|A0A1S3JUA2|A0A1S3JUA2_LINUN aspartyl aminopeptidase OS=Lingula unguis OX=7574 GN=LOC106176184 PE=3 SV=1)

HSP 1 Score: 371.318 bits (952), Expect = 8.200e-147
Identity = 180/327 (55.05%), Postives = 244/327 (74.62%), Query Frame = 2
Query:  506 RYKHMLVNLRRPIARVPTLAVHLDRSVNESFAPNKESHLSPVLCTTIGEQI---NKTSDQKDSPKTSLHHPIVLMEAIAEELKVKVEDIVDIELCLADSQPAAIGGIHQEFMFAPRLDNLFNCFASIQALTESL--ESISLDTNIRVVSLYDNEEIGSQSAQGAQSAFTELVLRRVVNAICEYIPTPSCSQYERAIANSLLVSADQAHAVHPNYEEKHERQHRPLPHQGIVLKVNSNQRYASNAMTTSIIREVANKSDVPLQEFVIRQDMVCGSTIGPIISANMGLATVDIGGPQLSMHSCREMADVSSVEQAVRLFKGFFDLYPDL 1471
            +  H LV+++RPI RVP +A+HL R +NE F+PNKE+HL P+L T+I E++   +KT++  D  + +  H  VL+  ++ EL V  + I+D ELCLAD+QPA +GG   EF+FAPRLDNL N + +++ L ++   E++  D NIR++SL+DNEE+GSQSAQGA S F ELVLRR+        PTP    +E A+  SL+VSADQAHAVHPNY EKHE QHRP  H+GIV+K N+NQRYA+ A+T +I+REVA++S VPLQ+FV+R D  CGSTIGPI+SA +G+ TVDIGGPQLSMHS REM   SSV Q+++L+KGFF+ +P++
Sbjct:  138 KLGHRLVHVKRPILRVPNIAIHLMRDMNEKFSPNKETHLQPILATSIQEELEYGSKTAETSDFKQEADKHHPVLVHILSGELGVTADQIMDFELCLADTQPACLGGALNEFIFAPRLDNLLNAYTAMEGLLDACNNETLQQDPNIRMISLFDNEEVGSQSAQGAGSTFQELVLRRISG------PTPG--SFEIAMPRSLMVSADQAHAVHPNYSEKHEDQHRPGLHKGIVVKHNANQRYATTAVTAAILREVASRSQVPLQDFVVRNDSPCGSTIGPIMSAKLGMPTVDIGGPQLSMHSIREMCCTSSVLQSIKLYKGFFEFFPEI 456          

HSP 2 Score: 180.644 bits (457), Expect = 8.200e-147
Identity = 76/126 (60.32%), Postives = 103/126 (81.75%), Query Frame = 3
Query:   54 AKNLIKFIDKSPTPFHAVATVKEMLLKSGFKEIHEQDQWTLRPNDLVFVTKNHSTIIALAIGGNYKPGNGFSMVGAHTDSPCLRLKPNSEQISSTYLKLGVETYGGGLWYTWFDRDLTVAGRCIVR 431
            AK+ I +I++SP+PFHAV  +K  LL +GF E+ E ++W ++P++  FVT+NHSTIIA A+GG Y+PGNGFS+VGAHTDSPCL++KP S ++   YL++GV+ YGGG W+TWFDRDLTVAGR IV+
Sbjct:    9 AKHFINYINRSPSPFHAVEEIKIRLLSAGFLELKETEKWDIKPSNKYFVTRNHSTIIAFAVGGKYRPGNGFSIVGAHTDSPCLKIKPISRKVRQGYLQVGVQCYGGGTWHTWFDRDLTVAGRVIVK 134          
BLAST of Aspartyl aminopeptidase vs. TrEMBL
Match: gnl|BL_ORD_ID|18725980 (tr|A0A0X3PEH2|A0A0X3PEH2_SCHSO HTH psq-type domain-containing protein OS=Schistocephalus solidus OX=70667 GN=TR99382 PE=4 SV=1)

HSP 1 Score: 345.895 bits (886), Expect = 3.101e-145
Identity = 167/351 (47.58%), Postives = 237/351 (67.52%), Query Frame = 2
Query:  500 SDRYKHMLVNLRRPIARVPTLAVHLDRSVNESFAPNKESHLSPVLCTTIGEQINKTSD-----------QKDSPKTSL------------HHPIVLMEAIAEELKVKVEDIVDIELCLADSQPAAIGGIHQEFMFAPRLDNLFNCFASIQALTESLESISLDTNIRVVSLYDNEEIGSQSAQGAQSAFTELVLRRVVNAIC-EYIPTPSCSQY---ERAIANSLLVSADQAHAVHPNYEEKHERQHRPLPHQGIVLKVNSNQRYASNAMTTSIIREVANKSDVPLQEFVIRQDMVCGSTIGPIISANMGLATVDIGGPQLSMHSCREMADVSSVEQAVRLFKGFFDLYPDL 1471
            S   +  LV++ RPIA VP+LA+HL+R  N++F+PN E HL+P+LCTT+ EQ+ K ++           + + P +++             HP+ L++ IAEEL     D+V++EL  AD+QPA +GG+H EF+ APRLDN FN FA IQ L  SL S+  D+N+R+V LYD+EEIGS+SAQGA S +T  + RR+ +A+   +    S  +Y   E+ +A S L+SADQAHAVHP++ E++E  H+P  H GIVLK N +Q YA++ +T +++REVA +S VPLQEFVIRQD  CG TIGPI+S  +G+ T D+GG QL+MHSCREM   +SV  A+ LF G+F+  P++
Sbjct:  831 SGALEERLVHVNRPIACVPSLAIHLNRDANKAFSPNPEQHLAPILCTTLTEQVCKLANASELAVGVADMESEKPHSAMDAAASCPSVPSGSHPLALLKLIAEELNCAESDLVELELYFADTQPACLGGVHSEFIHAPRLDNQFNAFAGIQGLVNSLPSLKEDSNVRIVCLYDHEEIGSRSAQGANSVYTAALFRRLTSALAASFEGNESAEKYCLFEQTMAKSFLLSADQAHAVHPSWPERYEPAHKPAFHGGIVLKYNCSQNYATSGLTAAVVREVARRSAVPLQEFVIRQDQPCGGTIGPILSTQLGVPTADVGGAQLAMHSCREMTCTTSVSHAIALFTGYFEQLPNI 1181          

HSP 2 Score: 200.675 bits (509), Expect = 3.101e-145
Identity = 83/127 (65.35%), Postives = 106/127 (83.46%), Query Frame = 3
Query:   54 AKNLIKFIDKSPTPFHAVATVKEMLLKSGFKEIHEQDQWTLRPNDLVFVTKNHSTIIALAIGGNYKPGNGFSMVGAHTDSPCLRLKPNSEQISSTYLKLGVETYGGGLWYTWFDRDLTVAGRCIVRV 434
            A+ LI FI+KSP+PFH V +V+++L   GF+E+HE   W LRPND  +VTKN S+I A+A+GG YKPGNGFS++GAHTDSPCLRLKP SE++   +++L VETYGGGLWY+WFDRDLTVAGRC+VR+
Sbjct:  703 ARELISFINKSPSPFHVVRSVRDILAGHGFQELHEDQVWKLRPNDYFYVTKNRSSIFAVAVGGAYKPGNGFSIIGAHTDSPCLRLKPISERVKEGFVQLAVETYGGGLWYSWFDRDLTVAGRCLVRL 829          
BLAST of Aspartyl aminopeptidase vs. TrEMBL
Match: gnl|BL_ORD_ID|18775355 (tr|A0A0X3PTW7|A0A0X3PTW7_SCHSO HTH psq-type domain-containing protein OS=Schistocephalus solidus OX=70667 GN=TR99382 PE=4 SV=1)

HSP 1 Score: 346.28 bits (887), Expect = 4.253e-145
Identity = 167/351 (47.58%), Postives = 237/351 (67.52%), Query Frame = 2
Query:  500 SDRYKHMLVNLRRPIARVPTLAVHLDRSVNESFAPNKESHLSPVLCTTIGEQINKTSD-----------QKDSPKTSL------------HHPIVLMEAIAEELKVKVEDIVDIELCLADSQPAAIGGIHQEFMFAPRLDNLFNCFASIQALTESLESISLDTNIRVVSLYDNEEIGSQSAQGAQSAFTELVLRRVVNAIC-EYIPTPSCSQY---ERAIANSLLVSADQAHAVHPNYEEKHERQHRPLPHQGIVLKVNSNQRYASNAMTTSIIREVANKSDVPLQEFVIRQDMVCGSTIGPIISANMGLATVDIGGPQLSMHSCREMADVSSVEQAVRLFKGFFDLYPDL 1471
            S   +  LV++ RPIA VP+LA+HL+R  N++F+PN E HL+P+LCTT+ EQ+ K ++           + + P +++             HP+ L++ IAEEL     D+V++EL  AD+QPA +GG+H EF+ APRLDN FN FA IQ L  SL S+  D+N+R+V LYD+EEIGS+SAQGA S +T  + RR+ +A+   +    S  +Y   E+ +A S L+SADQAHAVHP++ E++E  H+P  H GIVLK N +Q YA++ +T +++REVA +S VPLQEFVIRQD  CG TIGPI+S  +G+ T D+GG QL+MHSCREM   +SV  A+ LF G+F+  P++
Sbjct:  941 SGALEERLVHVNRPIACVPSLAIHLNRDANKAFSPNPEQHLAPILCTTLTEQVCKLANASELAVGVADMESEKPHSAMDAAASCPSVPSGSHPLALLKLIAEELNCAESDLVELELYFADTQPACLGGVHSEFIHAPRLDNQFNAFAGIQGLVNSLPSLKEDSNVRIVCLYDHEEIGSRSAQGANSVYTAALFRRLTSALAASFEGNESAEKYCLFEQTMAKSFLLSADQAHAVHPSWPERYEPAHKPAFHGGIVLKYNCSQNYATSGLTAAVVREVARRSAVPLQEFVIRQDQPCGGTIGPILSTQLGVPTADVGGAQLAMHSCREMTCTTSVSHAIALFTGYFEQLPNI 1291          

HSP 2 Score: 199.904 bits (507), Expect = 4.253e-145
Identity = 83/127 (65.35%), Postives = 106/127 (83.46%), Query Frame = 3
Query:   54 AKNLIKFIDKSPTPFHAVATVKEMLLKSGFKEIHEQDQWTLRPNDLVFVTKNHSTIIALAIGGNYKPGNGFSMVGAHTDSPCLRLKPNSEQISSTYLKLGVETYGGGLWYTWFDRDLTVAGRCIVRV 434
            A+ LI FI+KSP+PFH V +V+++L   GF+E+HE   W LRPND  +VTKN S+I A+A+GG YKPGNGFS++GAHTDSPCLRLKP SE++   +++L VETYGGGLWY+WFDRDLTVAGRC+VR+
Sbjct:  813 ARELISFINKSPSPFHVVRSVRDILAGHGFQELHEDQVWKLRPNDYFYVTKNRSSIFAVAVGGAYKPGNGFSIIGAHTDSPCLRLKPISERVKEGFVQLAVETYGGGLWYSWFDRDLTVAGRCLVRL 939          
BLAST of Aspartyl aminopeptidase vs. TrEMBL
Match: gnl|BL_ORD_ID|24649314 (tr|A0A5K3F8B4|A0A5K3F8B4_9CEST Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 353.214 bits (905), Expect = 6.037e-145
Identity = 171/327 (52.29%), Postives = 234/327 (71.56%), Query Frame = 2
Query:  521 LVNLRRPIARVPTLAVHLDRSVNESFAPNKESHLSPVLCTTIGEQINKTSDQKDSPKTS--LHHPIVLMEAIAEELKVKVEDIVDIELCLADSQPAAIGGIHQEFMFAPRLDNLFNCFASIQALTESLESISLDTNIRVVSLYDNEEIGSQSAQGAQSAFTELVLRRVVNAIC--------EYIPTPSCSQYERAIANSLLVSADQAHAVHPNYEEKHERQHRPLPHQGIVLKVNSNQRYASNAMTTSIIREVANKSDVPLQEFVIRQDMVCGSTIGPIISANMGLATVDIGGPQLSMHSCREMADVSSVEQAVRLFKGFFDLYPDL 1471
            LV++ RP+A VP+LA+HL+R VN+SFAPN E HL+P+LCTT+ EQ++ ++   D  K S    HP  L+  IA EL+    D+V++EL LAD+QPA IGGIH+EF+ APRLDN F  + SIQAL  SL S+  D+ +RVV LYD+EEIGS+S QGA S FTE + RR+ +A+           + T +   +ER +A S ++SADQAHAVHP++ EKHE  H+P  H GIVLK + +Q YA+N +T++I++EVA +  VPLQEFVIRQD +CGSTIGPI+++++G+ T D+GG QL+MHSCREM   +SV  A+  F GFF+  P +
Sbjct:  643 LVHIARPLACVPSLAIHLNREVNKSFAPNPEVHLAPILCTTLTEQLHSSAGDIDGLKESGASRHPASLLRLIAAELQCAPSDLVELELYLADTQPARIGGIHEEFIHAPRLDNQFCSYTSIQALVNSLPSLKEDSYVRVVCLYDHEEIGSRSTQGANSLFTESLFRRITDALSVEAEGGGGGGVNTAASCLFERTMARSFILSADQAHAVHPSWPEKHEPAHKPTFHHGIVLKHHCSQNYATNGLTSAIVKEVARRCQVPLQEFVIRQDQMCGSTIGPIVASHLGVMTADVGGAQLAMHSCREMTCTTSVGHAIAFFTGFFEHLPSI 969          

HSP 2 Score: 192.2 bits (487), Expect = 6.037e-145
Identity = 81/127 (63.78%), Postives = 104/127 (81.89%), Query Frame = 3
Query:   51 YAKNLIKFIDKSPTPFHAVATVKEMLLKSGFKEIHEQDQWTLRPNDLVFVTKNHSTIIALAIGGNYKPGNGFSMVGAHTDSPCLRLKPNSEQISSTYLKLGVETYGGGLWYTWFDRDLTVAGRCIVR 431
            +AK LI FI+KSP+PFH V +  E+L  +GF+E+ E + W L PND VFVTKNHS++ A+A+GG YKPG GF ++GAHTDSPCLRLKP SE+ S  +++L V+TYGGGLWYTWFDR+LT+AGRC+VR
Sbjct:  506 HAKELINFINKSPSPFHVVRSACEILANNGFRELLEYEPWKLEPNDCVFVTKNHSSLFAVAVGGAYKPGEGFGIIGAHTDSPCLRLKPISERTSEGFVELAVQTYGGGLWYTWFDRELTLAGRCLVR 632          
BLAST of Aspartyl aminopeptidase vs. TrEMBL
Match: gnl|BL_ORD_ID|24660946 (tr|A0A5K3FA41|A0A5K3FA41_9CEST Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 353.214 bits (905), Expect = 1.699e-144
Identity = 171/327 (52.29%), Postives = 234/327 (71.56%), Query Frame = 2
Query:  521 LVNLRRPIARVPTLAVHLDRSVNESFAPNKESHLSPVLCTTIGEQINKTSDQKDSPKTS--LHHPIVLMEAIAEELKVKVEDIVDIELCLADSQPAAIGGIHQEFMFAPRLDNLFNCFASIQALTESLESISLDTNIRVVSLYDNEEIGSQSAQGAQSAFTELVLRRVVNAIC--------EYIPTPSCSQYERAIANSLLVSADQAHAVHPNYEEKHERQHRPLPHQGIVLKVNSNQRYASNAMTTSIIREVANKSDVPLQEFVIRQDMVCGSTIGPIISANMGLATVDIGGPQLSMHSCREMADVSSVEQAVRLFKGFFDLYPDL 1471
            LV++ RP+A VP+LA+HL+R VN+SFAPN E HL+P+LCTT+ EQ++ ++   D  K S    HP  L+  IA EL+    D+V++EL LAD+QPA IGGIH+EF+ APRLDN F  + SIQAL  SL S+  D+ +RVV LYD+EEIGS+S QGA S FTE + RR+ +A+           + T +   +ER +A S ++SADQAHAVHP++ EKHE  H+P  H GIVLK + +Q YA+N +T++I++EVA +  VPLQEFVIRQD +CGSTIGPI+++++G+ T D+GG QL+MHSCREM   +SV  A+  F GFF+  P +
Sbjct:  140 LVHIARPLACVPSLAIHLNREVNKSFAPNPEVHLAPILCTTLTEQLHSSAGDIDGLKESGASRHPASLLRLIAAELQCAPSDLVELELYLADTQPARIGGIHEEFIHAPRLDNQFCSYTSIQALVNSLPSLKEDSYVRVVCLYDHEEIGSRSTQGANSLFTESLFRRITDALSVEAEGGGGGGVNTAASCLFERTMARSFILSADQAHAVHPSWPEKHEPAHKPTFHHGIVLKHHCSQNYATNGLTSAIVKEVARRCQVPLQEFVIRQDQMCGSTIGPIVASHLGVMTADVGGAQLAMHSCREMTCTTSVGHAIAFFTGFFEHLPSI 466          

HSP 2 Score: 191.045 bits (484), Expect = 1.699e-144
Identity = 81/127 (63.78%), Postives = 104/127 (81.89%), Query Frame = 3
Query:   51 YAKNLIKFIDKSPTPFHAVATVKEMLLKSGFKEIHEQDQWTLRPNDLVFVTKNHSTIIALAIGGNYKPGNGFSMVGAHTDSPCLRLKPNSEQISSTYLKLGVETYGGGLWYTWFDRDLTVAGRCIVR 431
            +AK LI FI+KSP+PFH V +  E+L  +GF+E+ E + W L PND VFVTKNHS++ A+A+GG YKPG GF ++GAHTDSPCLRLKP SE+ S  +++L V+TYGGGLWYTWFDR+LT+AGRC+VR
Sbjct:    3 HAKELINFINKSPSPFHVVRSACEILANNGFRELLEYEPWKLEPNDCVFVTKNHSSLFAVAVGGAYKPGEGFGIIGAHTDSPCLRLKPISERTSEGFVELAVQTYGGGLWYTWFDRELTLAGRCLVR 129          
BLAST of Aspartyl aminopeptidase vs. Ensembl Cavefish
Match: dnpep (aspartyl aminopeptidase [Source:NCBI gene;Acc:103039951])

HSP 1 Score: 342.813 bits (878), Expect = 1.071e-137
Identity = 163/330 (49.39%), Postives = 234/330 (70.91%), Query Frame = 2
Query:  500 SDRYKHMLVNLRRPIARVPTLAVHLDRSVNESFAPNKESHLSPVLCTTIGEQINKTS----DQKDSPKTSLHHPIVLMEAIAEELKVKVEDIVDIELCLADSQPAAIGGIHQEFMFAPRLDNLFNCFASIQALTESLESISL--DTNIRVVSLYDNEEIGSQSAQGAQSAFTELVLRRVVNAICEYIPTPSCSQYERAIANSLLVSADQAHAVHPNYEEKHERQHRPLPHQGIVLKVNSNQRYASNAMTTSIIREVANKSDVPLQEFVIRQDMVCGSTIGPIISANMGLATVDIGGPQLSMHSCREMADVSSVEQAVRLFKGFFDLYPDL 1471
             D+  H LV+++RPI R+P LA+HL R +N+SF PNKE+HL P L T + E++   S    D  ++  T   H   L+  +  EL V+ + ++D ELCLAD+QP A+GG+++EF+F+PRLDNL +C+ ++ AL +S  S SL  D NIRV++LYDNEE+GS+SAQGAQS  TEL+LRR+ +      PT + + ++ ++  S ++SAD AHAVHPNY+EKHE  HRP  H+G V+K NSNQRYA+ A+T  ++RE+A +++VPLQ+ ++R D  CG+TIGPI++A +G+  +DIG PQL+MHS REM   S V Q   LFKGFF+ +P +
Sbjct:  144 GDKLLHRLVHVQRPILRIPHLAIHLQRDINDSFGPNKENHLVPFLATAVQEELETGSAASGDACNAATTPEKHHPALIRLLCGELAVEPDTLLDFELCLADTQPGALGGLYEEFIFSPRLDNLHSCYCAMTALIDSSTSTSLAADPNIRVITLYDNEEVGSESAQGAQSNLTELILRRLAST-----PT-NLTAFQESMPLSFMISADMAHAVHPNYQEKHEENHRPAFHKGPVIKFNSNQRYATTAVTACVLREIARRAEVPLQDVMVRNDSPCGTTIGPILAARLGIPVLDIGAPQLAMHSIREMCCTSGVLQTTNLFKGFFEHFPSV 467          

HSP 2 Score: 168.318 bits (425), Expect = 1.071e-137
Identity = 72/126 (57.14%), Postives = 97/126 (76.98%), Query Frame = 3
Query:   54 AKNLIKFIDKSPTPFHAVATVKEMLLKSGFKEIHEQDQWTLRPNDLVFVTKNHSTIIALAIGGNYKPGNGFSMVGAHTDSPCLRLKPNSEQISSTYLKLGVETYGGGLWYTWFDRDLTVAGRCIVR 431
            AK  + F+++  +P+H V   K  LLK+GF E+ E + W ++P++  FVT+N+STIIA A+GG YKPGNGFSM+GAHTDSPCLR+KP S++     L++GVE YGGG+W TWFDRDLTVAGR +V+
Sbjct:   17 AKEFLGFVNRGVSPYHVVEECKSRLLKAGFTELKESEHWDIKPSNKYFVTRNYSTIIAFAVGGLYKPGNGFSMIGAHTDSPCLRVKPRSKKTRLGCLQVGVECYGGGIWNTWFDRDLTVAGRVMVK 142          
BLAST of Aspartyl aminopeptidase vs. Ensembl Cavefish
Match: dnpep (aspartyl aminopeptidase [Source:NCBI gene;Acc:103039951])

HSP 1 Score: 342.428 bits (877), Expect = 1.482e-137
Identity = 163/330 (49.39%), Postives = 234/330 (70.91%), Query Frame = 2
Query:  500 SDRYKHMLVNLRRPIARVPTLAVHLDRSVNESFAPNKESHLSPVLCTTIGEQINKTS----DQKDSPKTSLHHPIVLMEAIAEELKVKVEDIVDIELCLADSQPAAIGGIHQEFMFAPRLDNLFNCFASIQALTESLESISL--DTNIRVVSLYDNEEIGSQSAQGAQSAFTELVLRRVVNAICEYIPTPSCSQYERAIANSLLVSADQAHAVHPNYEEKHERQHRPLPHQGIVLKVNSNQRYASNAMTTSIIREVANKSDVPLQEFVIRQDMVCGSTIGPIISANMGLATVDIGGPQLSMHSCREMADVSSVEQAVRLFKGFFDLYPDL 1471
             D+  H LV+++RPI R+P LA+HL R +N+SF PNKE+HL P L T + E++   S    D  ++  T   H   L+  +  EL V+ + ++D ELCLAD+QP A+GG+++EF+F+PRLDNL +C+ ++ AL +S  S SL  D NIRV++LYDNEE+GS+SAQGAQS  TEL+LRR+ +      PT + + ++ ++  S ++SAD AHAVHPNY+EKHE  HRP  H+G V+K NSNQRYA+ A+T  ++RE+A +++VPLQ+ ++R D  CG+TIGPI++A +G+  +DIG PQL+MHS REM   S V Q   LFKGFF+ +P +
Sbjct:  139 GDKLLHRLVHVQRPILRIPHLAIHLQRDINDSFGPNKENHLVPFLATAVQEELETGSAASGDACNAATTPEKHHPALIRLLCGELAVEPDTLLDFELCLADTQPGALGGLYEEFIFSPRLDNLHSCYCAMTALIDSSTSTSLAADPNIRVITLYDNEEVGSESAQGAQSNLTELILRRLAST-----PT-NLTAFQESMPLSFMISADMAHAVHPNYQEKHEENHRPAFHKGPVIKFNSNQRYATTAVTACVLREIARRAEVPLQDVMVRNDSPCGTTIGPILAARLGIPVLDIGAPQLAMHSIREMCCTSGVLQTTNLFKGFFEHFPSV 462          

HSP 2 Score: 167.933 bits (424), Expect = 1.482e-137
Identity = 72/126 (57.14%), Postives = 97/126 (76.98%), Query Frame = 3
Query:   54 AKNLIKFIDKSPTPFHAVATVKEMLLKSGFKEIHEQDQWTLRPNDLVFVTKNHSTIIALAIGGNYKPGNGFSMVGAHTDSPCLRLKPNSEQISSTYLKLGVETYGGGLWYTWFDRDLTVAGRCIVR 431
            AK  + F+++  +P+H V   K  LLK+GF E+ E + W ++P++  FVT+N+STIIA A+GG YKPGNGFSM+GAHTDSPCLR+KP S++     L++GVE YGGG+W TWFDRDLTVAGR +V+
Sbjct:   12 AKEFLGFVNRGVSPYHVVEECKSRLLKAGFTELKESEHWDIKPSNKYFVTRNYSTIIAFAVGGLYKPGNGFSMIGAHTDSPCLRVKPRSKKTRLGCLQVGVECYGGGIWNTWFDRDLTVAGRVMVK 137          
BLAST of Aspartyl aminopeptidase vs. Ensembl Cavefish
Match: dnpep (aspartyl aminopeptidase [Source:NCBI gene;Acc:103039951])

HSP 1 Score: 342.428 bits (877), Expect = 1.482e-137
Identity = 163/330 (49.39%), Postives = 234/330 (70.91%), Query Frame = 2
Query:  500 SDRYKHMLVNLRRPIARVPTLAVHLDRSVNESFAPNKESHLSPVLCTTIGEQINKTS----DQKDSPKTSLHHPIVLMEAIAEELKVKVEDIVDIELCLADSQPAAIGGIHQEFMFAPRLDNLFNCFASIQALTESLESISL--DTNIRVVSLYDNEEIGSQSAQGAQSAFTELVLRRVVNAICEYIPTPSCSQYERAIANSLLVSADQAHAVHPNYEEKHERQHRPLPHQGIVLKVNSNQRYASNAMTTSIIREVANKSDVPLQEFVIRQDMVCGSTIGPIISANMGLATVDIGGPQLSMHSCREMADVSSVEQAVRLFKGFFDLYPDL 1471
             D+  H LV+++RPI R+P LA+HL R +N+SF PNKE+HL P L T + E++   S    D  ++  T   H   L+  +  EL V+ + ++D ELCLAD+QP A+GG+++EF+F+PRLDNL +C+ ++ AL +S  S SL  D NIRV++LYDNEE+GS+SAQGAQS  TEL+LRR+ +      PT + + ++ ++  S ++SAD AHAVHPNY+EKHE  HRP  H+G V+K NSNQRYA+ A+T  ++RE+A +++VPLQ+ ++R D  CG+TIGPI++A +G+  +DIG PQL+MHS REM   S V Q   LFKGFF+ +P +
Sbjct:  139 GDKLLHRLVHVQRPILRIPHLAIHLQRDINDSFGPNKENHLVPFLATAVQEELETGSAASGDACNAATTPEKHHPALIRLLCGELAVEPDTLLDFELCLADTQPGALGGLYEEFIFSPRLDNLHSCYCAMTALIDSSTSTSLAADPNIRVITLYDNEEVGSESAQGAQSNLTELILRRLAST-----PT-NLTAFQESMPLSFMISADMAHAVHPNYQEKHEENHRPAFHKGPVIKFNSNQRYATTAVTACVLREIARRAEVPLQDVMVRNDSPCGTTIGPILAARLGIPVLDIGAPQLAMHSIREMCCTSGVLQTTNLFKGFFEHFPSV 462          

HSP 2 Score: 167.933 bits (424), Expect = 1.482e-137
Identity = 72/126 (57.14%), Postives = 97/126 (76.98%), Query Frame = 3
Query:   54 AKNLIKFIDKSPTPFHAVATVKEMLLKSGFKEIHEQDQWTLRPNDLVFVTKNHSTIIALAIGGNYKPGNGFSMVGAHTDSPCLRLKPNSEQISSTYLKLGVETYGGGLWYTWFDRDLTVAGRCIVR 431
            AK  + F+++  +P+H V   K  LLK+GF E+ E + W ++P++  FVT+N+STIIA A+GG YKPGNGFSM+GAHTDSPCLR+KP S++     L++GVE YGGG+W TWFDRDLTVAGR +V+
Sbjct:   12 AKEFLGFVNRGVSPYHVVEECKSRLLKAGFTELKESEHWDIKPSNKYFVTRNYSTIIAFAVGGLYKPGNGFSMIGAHTDSPCLRVKPRSKKTRLGCLQVGVECYGGGIWNTWFDRDLTVAGRVMVK 137          
BLAST of Aspartyl aminopeptidase vs. Ensembl Cavefish
Match: dnpep (aspartyl aminopeptidase [Source:NCBI gene;Acc:103039951])

HSP 1 Score: 293.508 bits (750), Expect = 7.094e-123
Identity = 148/328 (45.12%), Postives = 213/328 (64.94%), Query Frame = 2
Query:  500 SDRYKHMLVNLRRPIARVPTLAVHLDRSVNESFAPNKESHLSPVLCTTIGEQINKTS----DQKDSPKTSLHHPIVLMEAIAEELKVKVEDIVDIELCLADSQPAAIGGIHQEFMFAPRLDNLFNCFASIQALTESLESISLDTNIRVVSLYDNEEIGSQSAQGAQSAFTELVLRRVVNAICEYIPTPSCSQYERAIANSLLVSADQAHAVHPNYEEKHERQHRPLPHQGIVLKVNSNQRYASNAMTTSIIREVANKSDVPLQEFVIRQDMVCGSTIGPIISANMGLATVDIGGPQLSMHSCREMADVSSVEQAVRLFKGFFDLYPDL 1471
             D+  H LV+++RPI R+P LA+HL R +N+SF PNKE+HL P L T + E++   S    D  ++  T   H   L+  +  EL V+ + ++D ELCLAD+QP A+                      I + T +  S++ D NIRV++LYDNEE+GS+SAQGAQS  TEL+LRR+ +      PT + + ++ ++  S ++SAD AHAVHPNY+EKHE  HRP  H+G V+K NSNQRYA+ A+T  ++RE+A +++VPLQ+ ++R D  CG+TIGPI++A +G+  +DIG PQL+MHS REM   S V Q   LFKGFF+ +P +
Sbjct:  144 GDKLLHRLVHVQRPILRIPHLAIHLQRDINDSFGPNKENHLVPFLATAVQEELETGSAASGDACNAATTPEKHHPALIRLLCGELAVEPDTLLDFELCLADTQPGAL----------------------IDSSTST--SLAADPNIRVITLYDNEEVGSESAQGAQSNLTELILRRLAST-----PT-NLTAFQESMPLSFMISADMAHAVHPNYQEKHEENHRPAFHKGPVIKFNSNQRYATTAVTACVLREIARRAEVPLQDVMVRNDSPCGTTIGPILAARLGIPVLDIGAPQLAMHSIREMCCTSGVLQTTNLFKGFFEHFPSV 441          

HSP 2 Score: 167.933 bits (424), Expect = 7.094e-123
Identity = 72/126 (57.14%), Postives = 97/126 (76.98%), Query Frame = 3
Query:   54 AKNLIKFIDKSPTPFHAVATVKEMLLKSGFKEIHEQDQWTLRPNDLVFVTKNHSTIIALAIGGNYKPGNGFSMVGAHTDSPCLRLKPNSEQISSTYLKLGVETYGGGLWYTWFDRDLTVAGRCIVR 431
            AK  + F+++  +P+H V   K  LLK+GF E+ E + W ++P++  FVT+N+STIIA A+GG YKPGNGFSM+GAHTDSPCLR+KP S++     L++GVE YGGG+W TWFDRDLTVAGR +V+
Sbjct:   17 AKEFLGFVNRGVSPYHVVEECKSRLLKAGFTELKESEHWDIKPSNKYFVTRNYSTIIAFAVGGLYKPGNGFSMIGAHTDSPCLRVKPRSKKTRLGCLQVGVECYGGGIWNTWFDRDLTVAGRVMVK 142          
BLAST of Aspartyl aminopeptidase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001890.1 (pep scaffold:Pmarinus_7.0:GL478360:35267:48746:-1 gene:ENSPMAG00000001713.1 transcript:ENSPMAT00000001890.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 278.485 bits (711), Expect = 2.838e-91
Identity = 132/258 (51.16%), Postives = 186/258 (72.09%), Query Frame = 2
Query:  716 LMEAIAEELKVKVEDIVDIELCLADSQPA--AIGGIHQEFMFAPRLDNLFNCFASIQALTESL---ESISLDTNIRVVSLYDNEEIGSQSAQGAQSAFTELVLRRVVNAICEYIPTPSCSQYERAIANSLLVSADQAHAVHPNYEEKHERQHRPLPHQGIVLKVNSNQRYASNAMTTSIIREVANKSDVPLQEFVIRQDMVCGSTIGPIISANMGLATVDIGGPQLSMHSCREMADVSSVEQAVRLFKGFFDLYPDLS 1474
            L+  + E LKV   D++D ELCLAD+QPA  A+GG  +EF+F PRLDNL +C+ ++QAL +S     S+  D NIR+V+L+DNEE+GS+SA GA S  TE++LRR+ ++    +       +E+A+  SL++SAD AH VHPNY +KHE  HRPL H+G V+K NSNQRYA+ A+T +++REVA K+DVPLQ+ +++ D  CGSTIGPI+SA +G+  +DIG PQLSMHS REM   S V  +++LF  FF+ +P ++
Sbjct:    3 LLSILCERLKVDPGDLLDFELCLADTQPACKALGGAFEEFIFGPRLDNLHSCYCAMQALIQSSVAGASLDNDPNIRIVTLFDNEEVGSESAHGAASNLTEMILRRLASSASNPV------AFEQAVPKSLIISADMAHGVHPNYADKHEENHRPLFHKGPVIKFNSNQRYATTAITAALVREVAAKADVPLQDVMVKNDSPCGSTIGPILSARLGMRVLDIGAPQLSMHSIREMCSTSDVLLSIQLFHAFFEHFPSVN 254          
BLAST of Aspartyl aminopeptidase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003992.1 (pep scaffold:Pmarinus_7.0:GL483459:1119:7036:-1 gene:ENSPMAG00000003646.1 transcript:ENSPMAT00000003992.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 175.637 bits (444), Expect = 3.831e-53
Identity = 75/131 (57.25%), Postives = 102/131 (77.86%), Query Frame = 3
Query:   54 AKNLIKFIDKSPTPFHAVATVKEMLLKSGFKEIHEQDQWTLRPNDLVFVTKNHSTIIALAIGGNYKPGNGFSMVGAHTDSPCLRLKPNSEQISSTYLKLGVETYGGGLWYTWFDRDLTVAGRCIVRVIYLF 446
            AK+ + F++K P+P+H V   K  L  +GF+E+ E +QW + P +  FVT+N+STIIA A+GG YKPGNGFS++GAHTDSPCLR+KP S ++S+  L++ VE YGGG+W TWFDRDLTVAGR IV+V++ F
Sbjct:   17 AKDFLSFVNKGPSPYHVVEECKVQLKLAGFQELKETEQWDIAPENKYFVTRNYSTIIAFAVGGKYKPGNGFSIIGAHTDSPCLRVKPRSRKLSAGCLQVSVECYGGGIWNTWFDRDLTVAGRVIVKVVHRF 147          
BLAST of Aspartyl aminopeptidase vs. Ensembl Yeast
Match: APE4 (Cytoplasmic aspartyl aminopeptidase with possible vacuole function; Cvt pathway cargo protein; cleaves unblocked N-terminal acidic amino acids from peptide substrates; forms a 12-subunit homo-oligomer; M18 metalloprotease family [Source:SGD;Acc:S000001155])

HSP 1 Score: 247.284 bits (630), Expect = 2.265e-103
Identity = 138/330 (41.82%), Postives = 204/330 (61.82%), Query Frame = 2
Query:  521 LVNLRRPIARVPTLAVHLDRSVNESFAPNKESHLSPVLCTTIGEQINKTSDQKD---------SPKTSLH-HPIVLMEAIAEELKVK-VEDIVDIELCLADSQPAAIGGIHQEFMFAPRLDNLFNCFASIQALTESLES-ISLDTNIRVVSLYDNEEIGSQSAQGAQSAFTELVLRRVV----NAICEYIPTPSCSQYERAIANSLLVSADQAHAVHPNYEEKHERQHRPLPHQGIVLKVNSNQRYASNAMTTSIIREVANKSDVPLQEFVIRQDMVCGSTIGPIISANMGLATVDIGGPQLSMHSCREMADVSSVEQAVRLFKGFFDLY 1462
            LV+L RP+ ++PTLA+HLDR VN+ F  N+E+ L P+     G Q +KT  + +         S KT +  H   L+  IA+EL +  +EDI D EL L D   + +GG + EF+F+ RLDNL +CF S+  LT + ++ I  ++ IR+++ +D+EEIGS SAQGA S F   +L R+     +   +  P    +  E + A S  +S+D AHAVHPNY  K+E QH+PL   G V+K+N+NQRY +N+    +++ +A  + VPLQ FV+  D  CGSTIGPI+++  G+ T+D+G P LSMHS RE    + +E  ++LFK FF+ Y
Sbjct:  157 LVDLNRPLLKIPTLAIHLDRDVNQKFEFNRETQLLPIG----GLQEDKTEAKTEKEINNGEFTSIKTIVQRHHAELLGLIAKELAIDTIEDIEDFELILYDHNASTLGGFNDEFVFSGRLDNLTSCFTSMHGLTLAADTEIDRESGIRLMACFDHEEIGSSSAQGADSNFLPNILERLSILKGDGSDQTKPLFHSAILETS-AKSFFLSSDVAHAVHPNYANKYESQHKPLLGGGPVIKINANQRYMTNSPGLVLVKRLAEAAKVPLQLFVVANDSPCGSTIGPILASKTGIRTLDLGNPVLSMHSIRETGGSADLEFQIKLFKEFFERY 481          

HSP 2 Score: 146.362 bits (368), Expect = 2.265e-103
Identity = 63/129 (48.84%), Postives = 93/129 (72.09%), Query Frame = 3
Query:   51 YAKNLIKFIDKSPTPFHAVATVKEMLLKSGFKEIHEQDQWT--LRPNDLVFVTKNHSTIIALAIGGNYKPGNGFSMVGAHTDSPCLRLKPNSEQISSTYLKLGVETYGGGLWYTWFDRDLTVAGRCIVR 431
            Y K  + F++ S +P+H V  +K+ L+ +GFKE+ E+D W   +      FVT+N S+IIA A+GG ++PGN  ++ GAHTDSP LR+KP S+++S  YL++GVETYGG +W++WFD+DL VAGR  V+
Sbjct:   18 YPKEFVSFLNSSHSPYHTVHNIKKHLVSNGFKELSERDSWAGHVAQKGKYFVTRNGSSIIAFAVGGKWEPGNPIAITGAHTDSPALRIKPISKRVSEKYLQVGVETYGGAIWHSWFDKDLGVAGRVFVK 146          
BLAST of Aspartyl aminopeptidase vs. Ensembl Yeast
Match: YKL103C_mRNA (Vacuolar aminopeptidase yscI; zinc metalloproteinase that belongs to the peptidase family M18; often used as a marker protein in studies of autophagy and cytosol to vacuole targeting (CVT) pathway; protein increases in abundance and relative distribution to cytoplasmic foci increases upon DNA replication stress [Source:SGD;Acc:S000001586])

HSP 1 Score: 179.489 bits (454), Expect = 1.225e-62
Identity = 108/313 (34.50%), Postives = 171/313 (54.63%), Query Frame = 2
Query:  539 PIARVPTLAVHLDRSVNESFAPNKESHLSPVLC-TTIGEQINK--TSDQKDSPKTSLHHPIVLMEAIAEELKVKVEDIVDIELCLADSQPAAIGGIHQEFMFAPRLDNLFNCFASIQALTESLESISLDTN--IRVVSLYDNEEIGSQSAQGAQSAFTELVLRRVVNAICEYIPTPSCSQYERAIANSLLVSADQAHAVHPNYEEKHERQHRPLPHQGIVLKVNSNQRYASNAMTTSIIREVANKSDVPLQEFVIRQDMVCGSTIGPIISANMGLATVDIGGPQLSMHSCREMADVSSVEQAVRLFKGFFDLY 1462
            P+ R+P+LA H  +     F  +KE    PV+   T  E+ N+  T D+K SP     H I L+  +A+   V+V +++ ++L L D Q   IGGI + F+FAPRLD+    FA++ AL    + ++ + +     V+LYDNEEIGS + QGA+    E V+ R  +A      T          ANS+++SAD  H  +PN+ E + + H P+P+ GI L ++ N   A++ + T+++ E+A ++   +Q F I+ +   G TIGP +++  G  T+D+G  QLSMHS R       V   V+ F GFF  +
Sbjct:  200 PVCRIPSLAPHFGKPAEGPF--DKEDQTIPVIGFPTPDEEGNEPPTDDEKKSPLFG-KHCIHLLRYVAKLAGVEVSELIQMDLDLFDVQKGTIGGIGKHFLFAPRLDDRLCSFAAMIALICYAKDVNTEESDLFSTVTLYDNEEIGSLTRQGAKGGLLESVVERSSSAF-----TKKPVDLHTVWANSIILSADVNHLYNPNFPEVYLKNHFPVPNVGITLSLDPNGHMATDVVGTALVEELARRNGDKVQYFQIKNNSRSGGTIGPSLASQTGARTIDLGIAQLSMHSIRAATGSKDVGLGVKFFNGFFKHW 504          

HSP 2 Score: 77.7962 bits (190), Expect = 1.225e-62
Identity = 43/130 (33.08%), Postives = 72/130 (55.38%), Query Frame = 3
Query:   54 AKNLIKFIDKSPTPFHAVATVKEMLLKSGFKEIHEQDQW--TLRPNDLVFVT-KNHSTIIALAIGGNYKPGNGFSMVGAHTDSPCLRLKPNS-EQISSTYLKLGVETYGGGLWYTWFDRDLTVAGRCIVR 431
            A+  I FI K+PT +H V+   E+L K  FK + E+  W  ++  +   F T +N + + A  +G N++   G  ++G+H D+  ++LKP S +  +  Y ++ V  YGG L   W DRDL + GR + +
Sbjct:   53 AQEFIDFIYKNPTTYHVVSFFAELLDKHNFKYLSEKSNWQDSIGEDGGKFYTIRNGTNLSAFILGKNWRAEKGVGVIGSHVDALTVKLKPVSFKDTAEGYGRIAVAPYGGTLNELWLDRDLGIGGRLLYK 182          
BLAST of Aspartyl aminopeptidase vs. Ensembl Nematostella
Match: EDO48999 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RHL4])

HSP 1 Score: 351.673 bits (901), Expect = 7.832e-143
Identity = 180/334 (53.89%), Postives = 236/334 (70.66%), Query Frame = 2
Query:  500 SDRYKHMLVNLRRPIARVPTLAVHLDRSVNESFAPNKESHLSPVLCTTIGEQINKTSDQKDSPK--TSL----HHPIVLMEAIAEELKVKV--EDIVDIELCLADSQPAAIGGIHQEFMFAPRLDNLFNCFASIQALTESLE--SISLDTNIRVVSLYDNEEIGSQSAQGAQSAFTELVLRRVVNAICEYIPTPSCSQYERAIANSLLVSADQAHAVHPNYEEKHERQHRPLPHQGIVLKVNSNQRYASNAMTTSIIREVANKSDVPLQEFVIRQDMVCGSTIGPIISANMGLATVDIGGPQLSMHSCREMADVSSVEQAVRLFKGFFDLYPDL 1471
            + + +  L+++ +PI R+P LA+HL R +N+ F PNKE+HL P+L T+I EQ+N  +  +++ K  T+L    HHP+ L++ I + L      E I+D ELCLADSQPAAIGG   EF+FAPRLDNL N + S++ L  SLE  +I+ D NIR+VSLYDNEE+GS+SAQGA S  TELVL+R+           S + +E AI  SLLVSADQAHA HPNY EKHE  HRP  H+G VLK N NQRYA+ A+T S++R +A K ++PLQE  +R D  CGSTIGPI++A +GL TVDIGGPQLSMHS RE+  +SSV Q + LFKGFF  +P++
Sbjct:  139 NGKLEQHLIHVNKPILRIPHLAIHLQRDINDKFGPNKENHLVPILATSIQEQLNMETSTEEASKNGTTLRADAHHPL-LIQLILDSLGFTCSREQIMDFELCLADSQPAAIGGALDEFIFAPRLDNLLNAYTSLEGLILSLEGPTINSDPNIRLVSLYDNEEVGSESAQGAASKLTELVLKRLATG-------GSSTAFEEAIPKSLLVSADQAHAAHPNYVEKHEENHRPGFHKGPVLKYNGNQRYATTAVTASVMRLIAEKVELPLQEVCVRNDSPCGSTIGPILAAKLGLRTVDIGGPQLSMHSIRELCCISSVYQCMHLFKGFFQHFPEV 464          

HSP 2 Score: 174.866 bits (442), Expect = 7.832e-143
Identity = 73/126 (57.94%), Postives = 100/126 (79.37%), Query Frame = 3
Query:   54 AKNLIKFIDKSPTPFHAVATVKEMLLKSGFKEIHEQDQWTLRPNDLVFVTKNHSTIIALAIGGNYKPGNGFSMVGAHTDSPCLRLKPNSEQISSTYLKLGVETYGGGLWYTWFDRDLTVAGRCIVR 431
            AK  I+F++  P+PFH V   ++ LL +GF+E+ E+D W ++P +  FVT+N STIIA A+GGNYKPGNGFS+VGAHTDSPCL++KPNS++    + ++GVE YGGG+W TWFDRDLTVAGR +++
Sbjct:   12 AKKFIEFVNNGPSPFHVVNECRKRLLTAGFQELSERDHWDVKPLNKYFVTRNQSTIIAFAVGGNYKPGNGFSIVGAHTDSPCLKVKPNSKKSKCGFHQVGVECYGGGIWSTWFDRDLTVAGRVMIK 137          
BLAST of Aspartyl aminopeptidase vs. Ensembl Medaka
Match: dnpep (aspartyl aminopeptidase [Source:NCBI gene;Acc:101170406])

HSP 1 Score: 342.428 bits (877), Expect = 7.403e-137
Identity = 164/324 (50.62%), Postives = 231/324 (71.30%), Query Frame = 2
Query:  515 HMLVNLRRPIARVPTLAVHLDRSVNESFAPNKESHLSPVLCTTIGEQINKTSDQKDSPKTSL-----HHPIVLMEAIAEELKVKVEDIVDIELCLADSQPAAIGGIHQEFMFAPRLDNLFNCFASIQALTESL--ESISLDTNIRVVSLYDNEEIGSQSAQGAQSAFTELVLRRVVNAICEYIPTPSCSQYERAIANSLLVSADQAHAVHPNYEEKHERQHRPLPHQGIVLKVNSNQRYASNAMTTSIIREVANKSDVPLQEFVIRQDMVCGSTIGPIISANMGLATVDIGGPQLSMHSCREMADVSSVEQAVRLFKGFFDLYP 1465
            H LV++ RP+ R+P LA+HL R +N+SF PNKE+HL P+L T + E++   S       +       HHP  L++ +  EL V  E ++D ELCL D+ PA +GG+++EF+F+PRLDNL +C+ ++Q L ES   +S++ D NIR+++LYDNEE+GS+SAQGA S  TEL+L R+  +      + + + +++A   S ++SAD AHAVHPNY+EKHE  HRP  H+G V+K NSNQRYA+ A+T +IIREVA++ DVPLQ+ ++R D  CG+TIGPI++A +G+  VDIGGPQLSMHS REM   SSV Q+  LFKGFF+L+P
Sbjct:  144 HHLVHVSRPLLRIPHLAIHLQRDINDSFGPNKENHLVPILATAVQEELETGSSSSADISSPSSTAEKHHP-ALVKVLCSELGVDAEALMDFELCLTDTHPAVLGGVYEEFIFSPRLDNLHSCYCALQGLVESCSGDSLNKDPNIRMIALYDNEEVGSESAQGAHSHLTELILSRLAAS------SSNLTSFQQAAPLSFMISADMAHAVHPNYQEKHEENHRPSFHKGPVIKFNSNQRYATTAVTAAIIREVASQVDVPLQDVMVRNDSPCGTTIGPILAARLGIPVVDIGGPQLSMHSIREMCCTSSVLQSTTLFKGFFELFP 460          

HSP 2 Score: 166.007 bits (419), Expect = 7.403e-137
Identity = 69/126 (54.76%), Postives = 96/126 (76.19%), Query Frame = 3
Query:   54 AKNLIKFIDKSPTPFHAVATVKEMLLKSGFKEIHEQDQWTLRPNDLVFVTKNHSTIIALAIGGNYKPGNGFSMVGAHTDSPCLRLKPNSEQISSTYLKLGVETYGGGLWYTWFDRDLTVAGRCIVR 431
            AK  ++F+++  +P+H V   K  L ++GF E+ E +QW ++P    FVT+N+S++IA A+GG YKPGNGFSM+GAHTDSPCLR+KP S++     L++GVE YGGG+W TWFDRDLTVAGR +V+
Sbjct:   12 AKEFLQFVNRGVSPYHVVEECKRRLREAGFIELKETEQWHIKPASKYFVTRNYSSLIAFAVGGQYKPGNGFSMIGAHTDSPCLRVKPRSKRTKQGCLQVGVECYGGGIWNTWFDRDLTVAGRVMVK 137          
BLAST of Aspartyl aminopeptidase vs. Planmine SMEST
Match: SMESG000011865.1 (SMESG000011865.1)

HSP 1 Score: 687.567 bits (1773), Expect = 0.000e+0
Identity = 333/334 (99.70%), Postives = 333/334 (99.70%), Query Frame = 2
Query:  497 ESDRYKHMLVNLRRPIARVPTLAVHLDRSVNESFAPNKESHLSPVLCTTIGEQINKTSDQKDSPKTSLHHPIVLMEAIAEELKVKVEDIVDIELCLADSQPAAIGGIHQEFMFAPRLDNLFNCFASIQALTESLESISLDTNIRVVSLYDNEEIGSQSAQGAQSAFTELVLRRVVNAICEYIPTPSCSQYERAIANSLLVSADQAHAVHPNYEEKHERQHRPLPHQGIVLKVNSNQRYASNAMTTSIIREVANKSDVPLQEFVIRQDMVCGSTIGPIISANMGLATVDIGGPQLSMHSCREMADVSSVEQAVRLFKGFFDLYPDLSYRVRLGLS 1498
            ESDRYKHMLVNLRRPIARVPTLAVHLDRSVNESFAPNKESHLSPVLCTTIGEQINKTSDQKDSPKTSLHHPIVLMEAIAEELKVKVEDIVDIELCLADSQPAAIGGIHQEFMFAPRLDNLFNCFASIQALTESLESISLDTNIRVVSLYDNEEIGSQSAQGAQSAFTELVLRRVVNAICE IPTPSCSQYERAIANSLLVSADQAHAVHPNYEEKHERQHRPLPHQGIVLKVNSNQRYASNAMTTSIIREVANKSDVPLQEFVIRQDMVCGSTIGPIISANMGLATVDIGGPQLSMHSCREMADVSSVEQAVRLFKGFFDLYPDLSYRVRLGLS
Sbjct:  138 ESDRYKHMLVNLRRPIARVPTLAVHLDRSVNESFAPNKESHLSPVLCTTIGEQINKTSDQKDSPKTSLHHPIVLMEAIAEELKVKVEDIVDIELCLADSQPAAIGGIHQEFMFAPRLDNLFNCFASIQALTESLESISLDTNIRVVSLYDNEEIGSQSAQGAQSAFTELVLRRVVNAICECIPTPSCSQYERAIANSLLVSADQAHAVHPNYEEKHERQHRPLPHQGIVLKVNSNQRYASNAMTTSIIREVANKSDVPLQEFVIRQDMVCGSTIGPIISANMGLATVDIGGPQLSMHSCREMADVSSVEQAVRLFKGFFDLYPDLSYRVRLGLS 471          

HSP 2 Score: 275.789 bits (704), Expect = 0.000e+0
Identity = 127/127 (100.00%), Postives = 127/127 (100.00%), Query Frame = 3
Query:   51 YAKNLIKFIDKSPTPFHAVATVKEMLLKSGFKEIHEQDQWTLRPNDLVFVTKNHSTIIALAIGGNYKPGNGFSMVGAHTDSPCLRLKPNSEQISSTYLKLGVETYGGGLWYTWFDRDLTVAGRCIVR 431
            YAKNLIKFIDKSPTPFHAVATVKEMLLKSGFKEIHEQDQWTLRPNDLVFVTKNHSTIIALAIGGNYKPGNGFSMVGAHTDSPCLRLKPNSEQISSTYLKLGVETYGGGLWYTWFDRDLTVAGRCIVR
Sbjct:   11 YAKNLIKFIDKSPTPFHAVATVKEMLLKSGFKEIHEQDQWTLRPNDLVFVTKNHSTIIALAIGGNYKPGNGFSMVGAHTDSPCLRLKPNSEQISSTYLKLGVETYGGGLWYTWFDRDLTVAGRCIVR 137          
BLAST of Aspartyl aminopeptidase vs. Planmine SMEST
Match: SMESG000011865.1 (SMESG000011865.1)

HSP 1 Score: 686.026 bits (1769), Expect = 0.000e+0
Identity = 333/334 (99.70%), Postives = 333/334 (99.70%), Query Frame = 2
Query:  497 ESDRYKHMLVNLRRPIARVPTLAVHLDRSVNESFAPNKESHLSPVLCTTIGEQINKTSDQKDSPKTSLHHPIVLMEAIAEELKVKVEDIVDIELCLADSQPAAIGGIHQEFMFAPRLDNLFNCFASIQALTESLESISLDTNIRVVSLYDNEEIGSQSAQGAQSAFTELVLRRVVNAICEYIPTPSCSQYERAIANSLLVSADQAHAVHPNYEEKHERQHRPLPHQGIVLKVNSNQRYASNAMTTSIIREVANKSDVPLQEFVIRQDMVCGSTIGPIISANMGLATVDIGGPQLSMHSCREMADVSSVEQAVRLFKGFFDLYPDLSYRVRLGLS 1498
            ESDRYKHMLVNLRRPIARVPTLAVHLDRSVNESFAPNKESHLSPVLCTTIGEQINKTSDQKDSPKTSLHHPIVLMEAIAEELKVKVEDIVDIELCLADSQPAAIGGIHQEFMFAPRLDNLFNCFASIQALTESLESISLDTNIRVVSLYDNEEIGSQSAQGAQSAFTELVLRRVVNAICE IPTPSCSQYERAIANSLLVSADQAHAVHPNYEEKHERQHRPLPHQGIVLKVNSNQRYASNAMTTSIIREVANKSDVPLQEFVIRQDMVCGSTIGPIISANMGLATVDIGGPQLSMHSCREMADVSSVEQAVRLFKGFFDLYPDLSYRVRLGLS
Sbjct:  130 ESDRYKHMLVNLRRPIARVPTLAVHLDRSVNESFAPNKESHLSPVLCTTIGEQINKTSDQKDSPKTSLHHPIVLMEAIAEELKVKVEDIVDIELCLADSQPAAIGGIHQEFMFAPRLDNLFNCFASIQALTESLESISLDTNIRVVSLYDNEEIGSQSAQGAQSAFTELVLRRVVNAICECIPTPSCSQYERAIANSLLVSADQAHAVHPNYEEKHERQHRPLPHQGIVLKVNSNQRYASNAMTTSIIREVANKSDVPLQEFVIRQDMVCGSTIGPIISANMGLATVDIGGPQLSMHSCREMADVSSVEQAVRLFKGFFDLYPDLSYRVRLGLS 463          

HSP 2 Score: 275.018 bits (702), Expect = 0.000e+0
Identity = 127/127 (100.00%), Postives = 127/127 (100.00%), Query Frame = 3
Query:   51 YAKNLIKFIDKSPTPFHAVATVKEMLLKSGFKEIHEQDQWTLRPNDLVFVTKNHSTIIALAIGGNYKPGNGFSMVGAHTDSPCLRLKPNSEQISSTYLKLGVETYGGGLWYTWFDRDLTVAGRCIVR 431
            YAKNLIKFIDKSPTPFHAVATVKEMLLKSGFKEIHEQDQWTLRPNDLVFVTKNHSTIIALAIGGNYKPGNGFSMVGAHTDSPCLRLKPNSEQISSTYLKLGVETYGGGLWYTWFDRDLTVAGRCIVR
Sbjct:    3 YAKNLIKFIDKSPTPFHAVATVKEMLLKSGFKEIHEQDQWTLRPNDLVFVTKNHSTIIALAIGGNYKPGNGFSMVGAHTDSPCLRLKPNSEQISSTYLKLGVETYGGGLWYTWFDRDLTVAGRCIVR 129          
The following BLAST results are available for this feature:
BLAST of Aspartyl aminopeptidase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DNPEP4.771e-14352.55aspartyl aminopeptidase [Source:HGNC Symbol;Acc:HG... [more]
DNPEP6.174e-14352.55aspartyl aminopeptidase [Source:HGNC Symbol;Acc:HG... [more]
DNPEP6.438e-14352.55aspartyl aminopeptidase [Source:HGNC Symbol;Acc:HG... [more]
DNPEP2.879e-12652.55aspartyl aminopeptidase [Source:HGNC Symbol;Acc:HG... [more]
DNPEP5.815e-8257.94aspartyl aminopeptidase [Source:HGNC Symbol;Acc:HG... [more]
back to top
BLAST of Aspartyl aminopeptidase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
dnpp-14.060e-11244.98Aspartyl aminopeptidase [Source:UniProtKB/Swiss-P... [more]
dnpp-15.038e-11244.98Aspartyl aminopeptidase [Source:UniProtKB/Swiss-P... [more]
back to top
BLAST of Aspartyl aminopeptidase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Aspartyl aminopeptidase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dnpep3.197e-13447.98aspartyl aminopeptidase [Source:ZFIN;Acc:ZDB-GENE-... [more]
dnpep3.592e-13447.98aspartyl aminopeptidase [Source:ZFIN;Acc:ZDB-GENE-... [more]
dnpep3.792e-13146.46aspartyl aminopeptidase [Source:ZFIN;Acc:ZDB-GENE-... [more]
dnpep3.843e-12744.92aspartyl aminopeptidase [Source:ZFIN;Acc:ZDB-GENE-... [more]
dnpep5.395e-7957.14aspartyl aminopeptidase [Source:ZFIN;Acc:ZDB-GENE-... [more]
back to top
BLAST of Aspartyl aminopeptidase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 3
Match NameE-valueIdentityDescription
dnpep4.122e-13248.96aspartyl aminopeptidase [Source:NCBI gene;Acc:5487... [more]
dnpep5.920e-12948.78aspartyl aminopeptidase [Source:NCBI gene;Acc:5487... [more]
dnpep1.465e-12147.37aspartyl aminopeptidase [Source:NCBI gene;Acc:5487... [more]
back to top
BLAST of Aspartyl aminopeptidase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Dnpep1.681e-13750.46aspartyl aminopeptidase [Source:MGI Symbol;Acc:MGI... [more]
Dnpep1.681e-13750.46aspartyl aminopeptidase [Source:MGI Symbol;Acc:MGI... [more]
Dnpep1.681e-13750.46aspartyl aminopeptidase [Source:MGI Symbol;Acc:MGI... [more]
Dnpep1.709e-13750.46aspartyl aminopeptidase [Source:MGI Symbol;Acc:MGI... [more]
Dnpep9.155e-13350.16aspartyl aminopeptidase [Source:MGI Symbol;Acc:MGI... [more]
back to top
BLAST of Aspartyl aminopeptidase vs. UniProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9ULA0|DNPEP_HUMAN2.645e-14252.55Aspartyl aminopeptidase OS=Homo sapiens OX=9606 GN... [more]
sp|Q5RBT2|DNPEP_PONAB1.493e-14152.25Aspartyl aminopeptidase OS=Pongo abelii OX=9601 GN... [more]
sp|Q2HJH1|DNPEP_BOVIN2.778e-13851.67Aspartyl aminopeptidase OS=Bos taurus OX=9913 GN=D... [more]
sp|Q9Z2W0|DNPEP_MOUSE1.019e-13650.46Aspartyl aminopeptidase OS=Mus musculus OX=10090 G... [more]
sp|B9RAJ0|DNPEP_RICCO5.410e-11642.86Probable aspartyl aminopeptidase OS=Ricinus commun... [more]
back to top
BLAST of Aspartyl aminopeptidase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
gnl|BL_ORD_ID|203184768.200e-14755.05tr|A0A1S3JUA2|A0A1S3JUA2_LINUN aspartyl aminopepti... [more]
gnl|BL_ORD_ID|187259803.101e-14547.58tr|A0A0X3PEH2|A0A0X3PEH2_SCHSO HTH psq-type domain... [more]
gnl|BL_ORD_ID|187753554.253e-14547.58tr|A0A0X3PTW7|A0A0X3PTW7_SCHSO HTH psq-type domain... [more]
gnl|BL_ORD_ID|246493146.037e-14552.29tr|A0A5K3F8B4|A0A5K3F8B4_9CEST Uncharacterized pro... [more]
gnl|BL_ORD_ID|246609461.699e-14452.29tr|A0A5K3FA41|A0A5K3FA41_9CEST Uncharacterized pro... [more]
back to top
BLAST of Aspartyl aminopeptidase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
dnpep1.071e-13749.39aspartyl aminopeptidase [Source:NCBI gene;Acc:1030... [more]
dnpep1.482e-13749.39aspartyl aminopeptidase [Source:NCBI gene;Acc:1030... [more]
dnpep1.482e-13749.39aspartyl aminopeptidase [Source:NCBI gene;Acc:1030... [more]
dnpep7.094e-12345.12aspartyl aminopeptidase [Source:NCBI gene;Acc:1030... [more]
back to top
BLAST of Aspartyl aminopeptidase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSPMAT00000001890.12.838e-9151.16pep scaffold:Pmarinus_7.0:GL478360:35267:48746:-1 ... [more]
ENSPMAT00000003992.13.831e-5357.25pep scaffold:Pmarinus_7.0:GL483459:1119:7036:-1 ge... [more]
back to top
BLAST of Aspartyl aminopeptidase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
APE42.265e-10341.82Cytoplasmic aspartyl aminopeptidase with possible ... [more]
YKL103C_mRNA1.225e-6234.50Vacuolar aminopeptidase yscI; zinc metalloproteina... [more]
back to top
BLAST of Aspartyl aminopeptidase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO489997.832e-14353.89Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Aspartyl aminopeptidase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
dnpep7.403e-13750.62aspartyl aminopeptidase [Source:NCBI gene;Acc:1011... [more]
back to top
BLAST of Aspartyl aminopeptidase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000011865.10.000e+099.70SMESG000011865.1[more]
SMESG000011865.10.000e+099.70SMESG000011865.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30008823 ID=SMED30008823|Name=Aspartyl aminopeptidase|organism=Schmidtea mediterranea sexual|type=transcript|length=1533bp
GCGATACTATAAAAAATAACATGTCCACATTAACAAGTTCAAGCATGAAT
TATGCAAAGAATTTAATAAAATTCATTGATAAATCTCCTACTCCATTTCA
TGCCGTTGCTACCGTGAAGGAAATGCTGCTTAAAAGTGGATTCAAAGAAA
TACATGAGCAAGACCAGTGGACATTAAGGCCTAACGATTTGGTATTCGTT
ACGAAGAACCACTCAACGATAATTGCCTTGGCAATCGGCGGTAATTATAA
ACCAGGCAACGGGTTCAGCATGGTCGGCGCTCACACCGACAGTCCCTGTT
TACGACTGAAACCCAATTCTGAACAGATCTCAAGCACGTATTTGAAACTT
GGAGTTGAAACATATGGCGGTGGATTGTGGTACACTTGGTTTGATAGGGA
CTTGACCGTTGCTGGGCGCTGTATTGTTAGGGTAATTTATTTGTTTCCCT
CTCCCTTCGAATTCGAGCTTTAATTGCCGAATAATAATCGATTTAGGAAT
CTGATAGATACAAGCACATGCTTGTCAATTTACGGCGACCAATTGCTCGA
GTTCCTACTCTTGCTGTTCACTTGGATCGGTCCGTTAATGAATCATTTGC
ACCGAATAAAGAATCGCATTTGAGTCCAGTTTTATGCACGACGATTGGCG
AGCAAATAAACAAAACTTCTGATCAGAAGGATTCACCGAAAACCTCCCTT
CACCATCCGATTGTATTAATGGAGGCAATCGCCGAAGAGTTGAAGGTTAA
AGTTGAAGATATTGTTGACATTGAGCTTTGTCTGGCAGATAGTCAACCGG
CAGCTATCGGTGGTATTCACCAGGAATTCATGTTCGCTCCCCGCCTGGAT
AACTTATTCAATTGTTTCGCGTCCATTCAAGCGCTAACCGAAAGTCTCGA
ATCAATTTCTCTTGACACAAACATCCGAGTGGTTTCTCTTTATGATAACG
AAGAGATCGGTTCCCAATCAGCACAAGGGGCCCAATCGGCTTTCACTGAG
TTAGTTCTCAGGCGGGTAGTTAATGCGATTTGTGAATATATTCCAACGCC
TTCATGCTCACAGTATGAACGGGCAATTGCGAACTCATTATTGGTATCCG
CTGATCAGGCTCATGCAGTCCATCCTAATTATGAGGAAAAACACGAACGC
CAACATAGACCTTTGCCACATCAAGGAATCGTGTTGAAGGTGAATTCAAA
TCAACGATACGCATCGAATGCTATGACTACTTCCATTATACGGGAAGTAG
CAAATAAATCTGACGTTCCACTGCAAGAATTTGTCATCCGGCAAGATATG
GTGTGTGGCAGCACTATAGGGCCGATAATATCGGCAAATATGGGCCTGGC
AACTGTTGATATCGGTGGCCCTCAGTTGAGTATGCATTCGTGTCGTGAAA
TGGCTGACGTTTCCAGTGTTGAGCAAGCCGTCCGTTTGTTCAAGGGATTT
TTCGATCTTTATCCTGATTTGTCATATCGAGTGAGATTGGGACTTAGTTG
ATTTTCCCCCACAAAATTTGGTTATCGAAATGC
back to top

protein sequence of SMED30008823-orf-1

>SMED30008823-orf-1 ID=SMED30008823-orf-1|Name=SMED30008823-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=157bp
DTIKNNMSTLTSSSMNYAKNLIKFIDKSPTPFHAVATVKEMLLKSGFKEI
HEQDQWTLRPNDLVFVTKNHSTIIALAIGGNYKPGNGFSMVGAHTDSPCL
RLKPNSEQISSTYLKLGVETYGGGLWYTWFDRDLTVAGRCIVRVIYLFPS
PFEFEL*
back to top

protein sequence of SMED30008823-orf-2

>SMED30008823-orf-2 ID=SMED30008823-orf-2|Name=SMED30008823-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=328bp
MLVNLRRPIARVPTLAVHLDRSVNESFAPNKESHLSPVLCTTIGEQINKT
SDQKDSPKTSLHHPIVLMEAIAEELKVKVEDIVDIELCLADSQPAAIGGI
HQEFMFAPRLDNLFNCFASIQALTESLESISLDTNIRVVSLYDNEEIGSQ
SAQGAQSAFTELVLRRVVNAICEYIPTPSCSQYERAIANSLLVSADQAHA
VHPNYEEKHERQHRPLPHQGIVLKVNSNQRYASNAMTTSIIREVANKSDV
PLQEFVIRQDMVCGSTIGPIISANMGLATVDIGGPQLSMHSCREMADVSS
VEQAVRLFKGFFDLYPDLSYRVRLGLS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000096ventral epidermis
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR001948Peptidase_M18
Vocabulary: biological process
TermDefinition
GO:0006508proteolysis
GO:0006518peptide metabolic process
Vocabulary: molecular function
TermDefinition
GO:0008270zinc ion binding
GO:0004177aminopeptidase activity
GO:0005515protein binding
GO:0008233peptidase activity
GO:0008237metallopeptidase activity
GO:0016787hydrolase activity
GO:0042802identical protein binding
GO:0046872metal ion binding
GO:0070006metalloaminopeptidase activity
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005737cytoplasm
GO:0005829cytosol
GO:0072562blood microparticle
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001948Peptidase M18PRINTSPR00932AMINO1PTASEcoord: 142..160
score: 56.14
coord: 6..23
score: 43.83
coord: 190..206
score: 58.82
coord: 279..294
score: 63.89
IPR001948Peptidase M18PFAMPF02127Peptidase_M18coord: 2..312
e-value: 6.8E-112
score: 374.4
IPR001948Peptidase M18PANTHERPTHR28570FAMILY NOT NAMEDcoord: 2..321
NoneNo IPR availableGENE3DG3DSA:3.40.630.10coord: 33..323
e-value: 1.1E-104
score: 352.2
NoneNo IPR availablePANTHERPTHR28570:SF3ASPARTYL AMINOPEPTIDASEcoord: 2..321
NoneNo IPR availableCDDcd05658M18_DAPcoord: 2..312
e-value: 1.72795E-171
score: 481.269
NoneNo IPR availableSUPERFAMILYSSF53187Zn-dependent exopeptidasescoord: 87..312
NoneNo IPR availableSUPERFAMILYSSF101821Aminopeptidase/glucanase lid domaincoord: 2..89