SMED30008821
Overview
Neoblast Clusters
Zeng et. al., 2018
Overview
Single cell RNA-seq of pluripotent neoblasts and its early progeniesWe isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)Explore this single cell expression dataset with our NB Cluster Shiny AppEmbryonic Expression
Davies et. al., 2017
Hover the mouse over a column in the graph to view average RPKM values per sample. Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult. back to top Alignments
SMED30008821 aligns in the following genomic locations:
Homology
BLAST of SMED30008821 vs. TrEMBL
Match: A0A2C9L5J0 (Uncharacterized protein OS=Biomphalaria glabrata OX=6526 GN=106061778 PE=4 SV=1) HSP 1 Score: 62.003 bits (149), Expect = 6.046e-8 Identity = 28/69 (40.58%), Postives = 39/69 (56.52%), Query Frame = -2 Query: 87 SIELPAHSHNLVLCDFFIWSYLKDIIYKEKVATIEELWEYITILCTEISTKIYDNACESVIQRIKNCRD 293 IE PA S +L DFF+W +KD++YK K+ ++ LW I +C EIS ESV+ R + C D Sbjct: 58 PIEFPARSPDLTPLDFFLWGTVKDVVYKRKLRHLDTLWNEIQAVCAEISVDTLVRCTESVLTRTQQCID 126
BLAST of SMED30008821 vs. TrEMBL
Match: A0A154PKV9 (Uncharacterized protein OS=Dufourea novaeangliae OX=178035 GN=WN55_04312 PE=4 SV=1) HSP 1 Score: 58.151 bits (139), Expect = 3.212e-6 Identity = 25/67 (37.31%), Postives = 40/67 (59.70%), Query Frame = -2 Query: 93 SIELPAHSHNLVLCDFFIWSYLKDIIYKEKVATIEELWEYITILCTEISTKIYDNACESVIQRIKNC 293 S+ PA S +L CDFF+W +LK I+++ V + L IT CTEI+ ++ N + I+R++ C Sbjct: 82 SVNWPARSPDLSSCDFFLWGHLKGIVFQTPVENLNNLRRRITNACTEITQEMLKNTEAAFIRRLEKC 148
BLAST of SMED30008821 vs. TrEMBL
Match: A0A2P8Z2Z7 (Uncharacterized protein OS=Blattella germanica OX=6973 GN=C0J52_12752 PE=4 SV=1) HSP 1 Score: 55.8398 bits (133), Expect = 3.518e-6 Identity = 27/70 (38.57%), Postives = 43/70 (61.43%), Query Frame = -2 Query: 81 IELPAHSHNLVLCDFFIWSYLKDIIYKEKVATIEELWEYITILCTEISTKIYDNACESVIQRIKNCRDES 290 +E P S +L +CD+F+W YLK +Y EK+ T+E L E IT EIS + D +++ R++ C D++ Sbjct: 9 LEWPPRSPDLSVCDYFLWGYLKSRVYIEKLRTLEVLAESITREVREISLSMLDRCMDNLSTRLQQCLDKN 78
BLAST of SMED30008821 vs. TrEMBL
Match: E2AGZ7 (Transposable element Tc3 transposase (Fragment) OS=Camponotus floridanus OX=104421 GN=EAG_00323 PE=4 SV=1) HSP 1 Score: 57.7658 bits (138), Expect = 4.321e-6 Identity = 25/67 (37.31%), Postives = 41/67 (61.19%), Query Frame = -2 Query: 81 PAHSHNLVLCDFFIWSYLKDIIYKEKVATIEELWEYITILCTEISTKIYDNACESVIQRIKNCRDES 281 PA S +L DFF+W LK+++YKE+ T + + + I CT I+ + A +S+I RI++C D + Sbjct: 92 PARSPDLTPLDFFLWGTLKNMVYKEEPTTPQAMQQQIITACTLITPNVIKRATQSLIGRIQSCIDNT 158 The following BLAST results are available for this feature:
BLAST of SMED30008821 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99) Total hits: 0
BLAST of SMED30008821 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99) Total hits: 0
BLAST of SMED30008821 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99) Total hits: 0
BLAST of SMED30008821 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99) Total hits: 0
BLAST of SMED30008821 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99) Total hits: 0
BLAST of SMED30008821 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99) Total hits: 0
BLAST of SMED30008821 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt) Total hits: 0
BLAST of SMED30008821 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL) Total hits: 4
BLAST of SMED30008821 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99) Total hits: 0
BLAST of SMED30008821 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99) Total hits: 0
BLAST of SMED30008821 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46) Total hits: 0
BLAST of SMED30008821 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46) Total hits: 0
BLAST of SMED30008821 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99) Total hits: 0
BLAST of SMED30008821 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST) Total hits: 0
Analyses
This transcript is derived from or has results from the following analyses Sequences
The following sequences are available for this feature:
transcript sequence >SMED30008821 ID=SMED30008821|Name=SMED30008821|organism=Schmidtea mediterranea sexual|type=transcript|length=1527bpback to top Annotated Terms
The following terms have been associated with this transcript:
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
|