cAMP-dependent protein kinase type II regulatory subunit

Overview
NamecAMP-dependent protein kinase type II regulatory subunit
Smed IDSMED30008798
Length (bp)1311
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of cAMP-dependent protein kinase type II regulatory subunit (SMED30008798) t-SNE clustered cells

Violin plots show distribution of expression levels for cAMP-dependent protein kinase type II regulatory subunit (SMED30008798) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of cAMP-dependent protein kinase type II regulatory subunit (SMED30008798) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for cAMP-dependent protein kinase type II regulatory subunit (SMED30008798) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30008798

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 14

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30008798h1SMcG0009543 Contig2024GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30008798h1SMcG0009543 PL05017B2A10smed_ncbi_20240424PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30008798h1SMcG0009543 PL08003B2E09smed_ncbi_20240424PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
Smed sexual biotypeSMED30008798h1SMcG0009543 Contig17193newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30008798h1SMcG0009543 Contig17193uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30008798h1SMcG0009543 Contig27571newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30008798h1SMcG0009543 Contig49150newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30008798h1SMcG0009543 Contig49150uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
nervous systemSMED30008798h1SMcG0009543 dd_Smed_v4_1362_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30008798h1SMcG0009543 dd_Smed_v4_1362_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30008798h1SMcG0009543 dd_Smed_v4_1362_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30008798h1SMcG0009543 dd_Smed_v4_1362_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30008798h1SMcG0009543 dd_Smed_v4_1362_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
intestinal phagocyteSMED30008798h1SMcG0009543 dd_Smed_v6_1362_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of cAMP-dependent protein kinase type II regulatory subunit vs. Ensembl Human
Match: PRKAR2B (protein kinase cAMP-dependent type II regulatory subunit beta [Source:HGNC Symbol;Acc:HGNC:9392])

HSP 1 Score: 214.157 bits (544), Expect = 2.615e-64
Identity = 130/403 (32.26%), Postives = 211/403 (52.36%), Query Frame = 1
Query:   97 LTEVIEEFKKQVEIANPKDIIAYAATYFTKKVAQENESNDT-----------EFDKSLDYDSSSEDGDSLKEIMSNDKSKMKLVQTS-------NVP-------RQSITCESFDPSSIDDETFEKNRKIYPKTPKQMDKITDILETIFFFNCLDEIQFSKIIQSMFFIEVFKGDEIIKENDPGNNFYVIDYGTFTASNKSKSIYEV---YKGEGFFGELALLYNCPRSASVIADTDGGLWVIDRVTFRQLILKSAYQKRQRYLKFISSVPLLEDLTKYEQCNLADALKTKTINN-EKVISQGDAGDKMYF-------IXXXXXXXXXXXXXXXXXXSRLKAGDYFGEVALLANIPRIANVYALGYTKLAELDAKSYTRLLGPCIDNMRKNFTKYRSQLEKLLS 1197
            LTE+++ F  +V    P D++ +A  +FT+ + QENE   T           +   +    + S+  +  +E M +D    +  + +       N P       R S+  E+++P   +D+   ++R I+PKT  Q +++ +  + I  F  LD  Q S+++ +MF   V  G+ +I + D G+NFYVID GTF    K   +      Y   G FGELAL+YN PR+A++ A + G LW +DRVTFR++I+K+  +KR+ Y  FI S+P L+ L   E+  + D + TK  N+ E++I+QGD+ D  +        I       +        E +R   G YFGE+AL+ N PR A+ +A+G  K   +D +++ RLLGPC++ M++N   Y  QL  L  
Sbjct:    9 LTELLQGFTVEVLRHQPADLLEFALQHFTR-LQQENERKGTARFGHEGRTWGDLGAAAGGGTPSKGVNFAEEPMQSDSEDGEEEEAAPADAGAFNAPVINRFTRRASVCAEAYNPDEEEDDA--ESRIIHPKTDDQRNRLQEACKDILLFKNLDPEQMSQVLDAMFEKLVKDGEHVIDQGDDGDNFYVIDRGTFDIYVKCDGVGRCVGNYDNRGSFGELALMYNTPRAATITATSPGALWGLDRVTFRRIIVKNNAKKRKMYESFIESLPFLKSLEFSERLKVVDVIGTKVYNDGEQIIAQGDSADSFFIVESGEVKITMKRKGKSEVEENGAVEIARCSRGQYFGELALVTNKPRAASAHAIGTVKCLAMDVQAFERLLGPCMEIMKRNIATYEEQLVALFG 408          
BLAST of cAMP-dependent protein kinase type II regulatory subunit vs. Ensembl Human
Match: PRKAR2B (protein kinase cAMP-dependent type II regulatory subunit beta [Source:HGNC Symbol;Acc:HGNC:9392])

HSP 1 Score: 214.157 bits (544), Expect = 2.615e-64
Identity = 130/403 (32.26%), Postives = 211/403 (52.36%), Query Frame = 1
Query:   97 LTEVIEEFKKQVEIANPKDIIAYAATYFTKKVAQENESNDT-----------EFDKSLDYDSSSEDGDSLKEIMSNDKSKMKLVQTS-------NVP-------RQSITCESFDPSSIDDETFEKNRKIYPKTPKQMDKITDILETIFFFNCLDEIQFSKIIQSMFFIEVFKGDEIIKENDPGNNFYVIDYGTFTASNKSKSIYEV---YKGEGFFGELALLYNCPRSASVIADTDGGLWVIDRVTFRQLILKSAYQKRQRYLKFISSVPLLEDLTKYEQCNLADALKTKTINN-EKVISQGDAGDKMYF-------IXXXXXXXXXXXXXXXXXXSRLKAGDYFGEVALLANIPRIANVYALGYTKLAELDAKSYTRLLGPCIDNMRKNFTKYRSQLEKLLS 1197
            LTE+++ F  +V    P D++ +A  +FT+ + QENE   T           +   +    + S+  +  +E M +D    +  + +       N P       R S+  E+++P   +D+   ++R I+PKT  Q +++ +  + I  F  LD  Q S+++ +MF   V  G+ +I + D G+NFYVID GTF    K   +      Y   G FGELAL+YN PR+A++ A + G LW +DRVTFR++I+K+  +KR+ Y  FI S+P L+ L   E+  + D + TK  N+ E++I+QGD+ D  +        I       +        E +R   G YFGE+AL+ N PR A+ +A+G  K   +D +++ RLLGPC++ M++N   Y  QL  L  
Sbjct:    9 LTELLQGFTVEVLRHQPADLLEFALQHFTR-LQQENERKGTARFGHEGRTWGDLGAAAGGGTPSKGVNFAEEPMQSDSEDGEEEEAAPADAGAFNAPVINRFTRRASVCAEAYNPDEEEDDA--ESRIIHPKTDDQRNRLQEACKDILLFKNLDPEQMSQVLDAMFEKLVKDGEHVIDQGDDGDNFYVIDRGTFDIYVKCDGVGRCVGNYDNRGSFGELALMYNTPRAATITATSPGALWGLDRVTFRRIIVKNNAKKRKMYESFIESLPFLKSLEFSERLKVVDVIGTKVYNDGEQIIAQGDSADSFFIVESGEVKITMKRKGKSEVEENGAVEIARCSRGQYFGELALVTNKPRAASAHAIGTVKCLAMDVQAFERLLGPCMEIMKRNIATYEEQLVALFG 408          
BLAST of cAMP-dependent protein kinase type II regulatory subunit vs. Ensembl Human
Match: PRKAR2A (protein kinase cAMP-dependent type II regulatory subunit alpha [Source:HGNC Symbol;Acc:HGNC:9391])

HSP 1 Score: 213.386 bits (542), Expect = 3.195e-64
Identity = 134/389 (34.45%), Postives = 223/389 (57.33%), Query Frame = 1
Query:   97 LTEVIEEFKKQVEIANPKDIIAYAATYFTK-KVAQENES--NDTEFDKSLDYDSSSEDGDSLKEIMSNDKSKMKLVQTSNVP-----RQSITCESFDPSSIDDETFEKNRKIYPKTPKQMDKITDILETIFFFNCLDEIQFSKIIQSMFFIEVFKGDE-IIKENDPGNNFYVIDYGTF----TASNKSKSIYEVYKGEGFFGELALLYNCPRSASVIADTDGGLWVIDRVTFRQLILKSAYQKRQRYLKFISSVPLLEDLTKYEQCNLADALKTKTI-NNEKVISQGDAGDKMYFIXXXXXXXXXXXXXXX--------XXXSRLKAGDYFGEVALLANIPRIANVYALGYTKLAELDAKSYTRLLGPCIDNMRKNFTKYRSQLEKLLS 1197
            LTE+++ +  +V    P D++ +A  YFT+ + A+   S        +SL +       D + +   + +S+        VP     R S+  E+++P   +++T    R I+PKT +Q  ++ +  + I  F  LD+ Q S+++ +MF   + K DE +I + D G+NFYVI+ GT+    T  N+++S+ + Y   G FGELAL+YN PR+A+++A ++G LW +DRVTFR++I+K+  +KR+ +  FI SVPLL+ L   E+  + D +  K   + E++I+QG+  D  Y IE GEV + +R+  +          E +R   G YFGE+AL+ N PR A+ YA+G  K   +D +++ RLLGPC+D M++N + Y  QL K+  
Sbjct:   10 LTELLQGYTVEVLRQQPPDLVEFAVEYFTRLREARAPASVLPAATPRQSLGHPPPEPGPDRVADAKGDSESEEDEDLEVPVPSRFNRRVSVCAETYNPDEEEEDT--DPRVIHPKTDEQRCRLQEACKDILLFKNLDQEQLSQVLDAMFE-RIVKADEHVIDQGDDGDNFYVIERGTYDILVTKDNQTRSVGQ-YDNRGSFGELALMYNTPRAATIVATSEGSLWGLDRVTFRRIIVKNNAKKRKMFESFIESVPLLKSLEVSERMKIVDVIGEKIYKDGERIITQGEKADSFYIIESGEVSILIRSRTKSNKDGGNQEVEIARCHKGQYFGELALVTNKPRAASAYAVGDVKCLVMDVQAFERLLGPCMDIMKRNISHYEEQLVKMFG 394          
BLAST of cAMP-dependent protein kinase type II regulatory subunit vs. Ensembl Human
Match: PRKAR2A (protein kinase cAMP-dependent type II regulatory subunit alpha [Source:HGNC Symbol;Acc:HGNC:9391])

HSP 1 Score: 213.386 bits (542), Expect = 3.195e-64
Identity = 134/389 (34.45%), Postives = 223/389 (57.33%), Query Frame = 1
Query:   97 LTEVIEEFKKQVEIANPKDIIAYAATYFTK-KVAQENES--NDTEFDKSLDYDSSSEDGDSLKEIMSNDKSKMKLVQTSNVP-----RQSITCESFDPSSIDDETFEKNRKIYPKTPKQMDKITDILETIFFFNCLDEIQFSKIIQSMFFIEVFKGDE-IIKENDPGNNFYVIDYGTF----TASNKSKSIYEVYKGEGFFGELALLYNCPRSASVIADTDGGLWVIDRVTFRQLILKSAYQKRQRYLKFISSVPLLEDLTKYEQCNLADALKTKTI-NNEKVISQGDAGDKMYFIXXXXXXXXXXXXXXX--------XXXSRLKAGDYFGEVALLANIPRIANVYALGYTKLAELDAKSYTRLLGPCIDNMRKNFTKYRSQLEKLLS 1197
            LTE+++ +  +V    P D++ +A  YFT+ + A+   S        +SL +       D + +   + +S+        VP     R S+  E+++P   +++T    R I+PKT +Q  ++ +  + I  F  LD+ Q S+++ +MF   + K DE +I + D G+NFYVI+ GT+    T  N+++S+ + Y   G FGELAL+YN PR+A+++A ++G LW +DRVTFR++I+K+  +KR+ +  FI SVPLL+ L   E+  + D +  K   + E++I+QG+  D  Y IE GEV + +R+  +          E +R   G YFGE+AL+ N PR A+ YA+G  K   +D +++ RLLGPC+D M++N + Y  QL K+  
Sbjct:   10 LTELLQGYTVEVLRQQPPDLVEFAVEYFTRLREARAPASVLPAATPRQSLGHPPPEPGPDRVADAKGDSESEEDEDLEVPVPSRFNRRVSVCAETYNPDEEEEDT--DPRVIHPKTDEQRCRLQEACKDILLFKNLDQEQLSQVLDAMFE-RIVKADEHVIDQGDDGDNFYVIERGTYDILVTKDNQTRSVGQ-YDNRGSFGELALMYNTPRAATIVATSEGSLWGLDRVTFRRIIVKNNAKKRKMFESFIESVPLLKSLEVSERMKIVDVIGEKIYKDGERIITQGEKADSFYIIESGEVSILIRSRTKSNKDGGNQEVEIARCHKGQYFGELALVTNKPRAASAYAVGDVKCLVMDVQAFERLLGPCMDIMKRNISHYEEQLVKMFG 394          
BLAST of cAMP-dependent protein kinase type II regulatory subunit vs. Ensembl Human
Match: PRKAR2A (protein kinase cAMP-dependent type II regulatory subunit alpha [Source:HGNC Symbol;Acc:HGNC:9391])

HSP 1 Score: 206.068 bits (523), Expect = 1.281e-61
Identity = 127/385 (32.99%), Postives = 213/385 (55.32%), Query Frame = 1
Query:   97 LTEVIEEFKKQVEIANPKDIIAYAATYFTK-KVAQENES--NDTEFDKSLDYDSSSEDGDSLKEIMSNDKSKMKLVQTSNVP-----RQSITCESFDPSSIDDETFEKNRKIYPKTPKQMDKITDILETIFFFNCLDEIQFSKIIQSMFFIEVFKGDE-IIKENDPGNNFYVIDYGTF----TASNKSKSIYEVYKGEGFFGELALLYNCPRSASVIADTDGGLWVIDRVTFRQLILKSAYQKRQRYLKFISSVPLLEDLTKYEQCNLADALKTKTI-NNEKVISQG----DAGDKMYFIXXXXXXXXXXXXXXXXXXSRLKAGDYFGEVALLANIPRIANVYALGYTKLAELDAKSYTRLLGPCIDNMRKNFTKYRSQLEKLLS 1197
            LTE+++ +  +V    P D++ +A  YFT+ + A+   S        +SL +       D + +   + +S+        VP     R S+  E+++P   +++T    R I+PKT +Q  ++ +  + I  F  LD+ Q S+++ +MF   + K DE +I + D G+NFYVI+ GT+    T  N+++S+ + Y   G FGELAL+YN PR+A+++A ++G LW +DRVTFR++I+K+  +KR+ +  FI SVPLL+ L   E+  + D +  K   + E++I+Q     D G++   I                  +R   G YFGE+AL+ N PR A+ YA+G  K   +D +++ RLLGPC+D M++N + Y  QL K+  
Sbjct:   10 LTELLQGYTVEVLRQQPPDLVEFAVEYFTRLREARAPASVLPAATPRQSLGHPPPEPGPDRVADAKGDSESEEDEDLEVPVPSRFNRRVSVCAETYNPDEEEEDT--DPRVIHPKTDEQRCRLQEACKDILLFKNLDQEQLSQVLDAMFE-RIVKADEHVIDQGDDGDNFYVIERGTYDILVTKDNQTRSVGQ-YDNRGSFGELALMYNTPRAATIVATSEGSLWGLDRVTFRRIIVKNNAKKRKMFESFIESVPLLKSLEVSERMKIVDVIGEKIYKDGERIITQTKSNKDGGNQEVEI------------------ARCHKGQYFGELALVTNKPRAASAYAVGDVKCLVMDVQAFERLLGPCMDIMKRNISHYEEQLVKMFG 372          
BLAST of cAMP-dependent protein kinase type II regulatory subunit vs. Ensembl Celegans
Match: kin-2 (cAMP-dependent protein kinase regulatory subunit [Source:UniProtKB/Swiss-Prot;Acc:P30625])

HSP 1 Score: 159.458 bits (402), Expect = 6.943e-45
Identity = 98/280 (35.00%), Postives = 156/280 (55.71%), Query Frame = 1
Query:  346 TCESFDPSSIDDETFEKNRKIYPKTPKQMDKITDILETIFFFNCLDEIQFSKIIQSMFFIEVFKGDEIIKENDPGNNFYVIDYGTFTASNKSKSIYEVYKGEGFFGELALLYNCPRSASVIADTDGGLWVIDRVTFRQLILKSAYQKRQRYLKFISSVPLLEDLTKYEQCNLADALKTKTIN-NEKVISQGDAGDKMYFIXXXXXXXXXXXXXXXX--XXSRLKAGDYFGEVALLANIPRIANVYALGYTKLAELDAKSYTRLLGPCIDNMRKNFTKYRS 1176
            T  S +P   DD  ++K   + PK       +   +     F  L+E +   +  +MF +E   G+ II++ + G+NFYVID GT       + +  + +G G FGELAL+Y  PR+A+VIA TD  LW IDR+T+R++++ S  +KR+ Y +F+S V +L DL ++E+ N+ADAL+         V+ QG  GD+ + I EGE  V  +  ++        L   DYFGE+ALL + PR A V A  + K  +LD   + R++GP  + ++++ + Y S
Sbjct:   52 TGISAEPIKEDDTEYKK--VVIPKDDATRRSLESAMRKNLLFAHLEEDEQKTMYDAMFPVEKSAGETIIEQGEEGDNFYVIDKGTVDVYVNHEYVLTINEG-GSFGELALIYGTPRAATVIAKTDVKLWAIDRLTYRRILMGSVTKKRKMYDEFLSKVQILADLDQWERANVADALERCDFEPGTHVVEQGQPGDEFFIILEGEANVLQKRSDDAPFDVVGHLGMSDYFGEIALLLDRPRAATVVAKTHLKCIKLDRNRFERVMGPVREILKRDVSNYNS 328          
BLAST of cAMP-dependent protein kinase type II regulatory subunit vs. Ensembl Celegans
Match: kin-2 (cAMP-dependent protein kinase regulatory subunit [Source:UniProtKB/Swiss-Prot;Acc:P30625])

HSP 1 Score: 159.844 bits (403), Expect = 1.120e-44
Identity = 97/277 (35.02%), Postives = 155/277 (55.96%), Query Frame = 1
Query:  355 SFDPSSIDDETFEKNRKIYPKTPKQMDKITDILETIFFFNCLDEIQFSKIIQSMFFIEVFKGDEIIKENDPGNNFYVIDYGTFTASNKSKSIYEVYKGEGFFGELALLYNCPRSASVIADTDGGLWVIDRVTFRQLILKSAYQKRQRYLKFISSVPLLEDLTKYEQCNLADALKTKTIN-NEKVISQGDAGDKMYFIXXXXXXXXXXXXXXXX--XXSRLKAGDYFGEVALLANIPRIANVYALGYTKLAELDAKSYTRLLGPCIDNMRKNFTKYRS 1176
            S +P   DD  ++K   + PK       +   +     F  L+E +   +  +MF +E   G+ II++ + G+NFYVID GT       + +  + +G G FGELAL+Y  PR+A+VIA TD  LW IDR+T+R++++ S  +KR+ Y +F+S V +L DL ++E+ N+ADAL+         V+ QG  GD+ + I EGE  V  +  ++        L   DYFGE+ALL + PR A V A  + K  +LD   + R++GP  + ++++ + Y S
Sbjct:   87 SAEPIKEDDTEYKK--VVIPKDDATRRSLESAMRKNLLFAHLEEDEQKTMYDAMFPVEKSAGETIIEQGEEGDNFYVIDKGTVDVYVNHEYVLTINEG-GSFGELALIYGTPRAATVIAKTDVKLWAIDRLTYRRILMGSVTKKRKMYDEFLSKVQILADLDQWERANVADALERCDFEPGTHVVEQGQPGDEFFIILEGEANVLQKRSDDAPFDVVGHLGMSDYFGEIALLLDRPRAATVVAKTHLKCIKLDRNRFERVMGPVREILKRDVSNYNS 360          
BLAST of cAMP-dependent protein kinase type II regulatory subunit vs. Ensembl Celegans
Match: kin-2 (cAMP-dependent protein kinase regulatory subunit [Source:UniProtKB/Swiss-Prot;Acc:P30625])

HSP 1 Score: 159.458 bits (402), Expect = 1.586e-44
Identity = 97/277 (35.02%), Postives = 155/277 (55.96%), Query Frame = 1
Query:  355 SFDPSSIDDETFEKNRKIYPKTPKQMDKITDILETIFFFNCLDEIQFSKIIQSMFFIEVFKGDEIIKENDPGNNFYVIDYGTFTASNKSKSIYEVYKGEGFFGELALLYNCPRSASVIADTDGGLWVIDRVTFRQLILKSAYQKRQRYLKFISSVPLLEDLTKYEQCNLADALKTKTIN-NEKVISQGDAGDKMYFIXXXXXXXXXXXXXXXX--XXSRLKAGDYFGEVALLANIPRIANVYALGYTKLAELDAKSYTRLLGPCIDNMRKNFTKYRS 1176
            S +P   DD  ++K   + PK       +   +     F  L+E +   +  +MF +E   G+ II++ + G+NFYVID GT       + +  + +G G FGELAL+Y  PR+A+VIA TD  LW IDR+T+R++++ S  +KR+ Y +F+S V +L DL ++E+ N+ADAL+         V+ QG  GD+ + I EGE  V  +  ++        L   DYFGE+ALL + PR A V A  + K  +LD   + R++GP  + ++++ + Y S
Sbjct:   97 SAEPIKEDDTEYKK--VVIPKDDATRRSLESAMRKNLLFAHLEEDEQKTMYDAMFPVEKSAGETIIEQGEEGDNFYVIDKGTVDVYVNHEYVLTINEG-GSFGELALIYGTPRAATVIAKTDVKLWAIDRLTYRRILMGSVTKKRKMYDEFLSKVQILADLDQWERANVADALERCDFEPGTHVVEQGQPGDEFFIILEGEANVLQKRSDDAPFDVVGHLGMSDYFGEIALLLDRPRAATVVAKTHLKCIKLDRNRFERVMGPVREILKRDVSNYNS 370          
BLAST of cAMP-dependent protein kinase type II regulatory subunit vs. Ensembl Celegans
Match: egl-4 (cGMP-dependent protein kinase egl-4 [Source:UniProtKB/Swiss-Prot;Acc:O76360])

HSP 1 Score: 109.768 bits (273), Expect = 1.914e-25
Identity = 80/297 (26.94%), Postives = 149/297 (50.17%), Query Frame = 1
Query:  283 MSNDKSKMKLVQTSNVPRQSITCESFDPSSIDDETFEKNRKIYPKTPKQMDKITDILETIFFFNCLDEIQFSKIIQSMFFIEVFKGDEIIKENDPGNNFYVIDYGTFTASNKSKSIYEVYKGEGFFGELALLYNCPRSASVIADTDGGLWVIDRVTFRQLILKSAYQKRQRYLKFISSVPLLEDLTKYEQCNLADALKTKTINNEK-VISQGDAGDKMYFIXXXXXXXXXXXXXXXXXXS--RLKAGDYFGEVALLANIPRIANVYALG-YTKLAELDAKSYTRLLGPCIDNMRKNF 1161
            + ND  +  ++    V R      S +P++ +++      + Y KT      I D ++   F   L + Q  +++  M+ +    G  +I+E +PG+  +V+  G    S +   + ++  G    GELA+LYNC R+ASV A TD  LWV+DR  F+ +  +   ++  + + F++ V + ++L++     +AD +     +    +I QG+ GD  + I  G+V VT +   E        L  GD+FGE ALL    R AN+ A     ++  LD +S+ +L+G  +++++K++
Sbjct:  111 LGNDLQQKAVLPADGVQRAKKIAVSAEPTNFENKP--ATLQHYNKTVGAKQMIRDAVQKNDFLKQLAKEQIIELVNCMYEMRARAGQWVIQEGEPGDRLFVVAEGELQVSREGALLGKMRAGT-VMGELAILYNCTRTASVQALTDVQLWVLDRSVFQMITQRLGMERHSQLMNFLTKVSIFQNLSEDRISKMADVMDQDYYDGGHYIIRQGEKGDAFFVINSGQVKVTQQIEGETEPREIRVLNQGDFFGERALLGEEVRTANIIAQAPGVEVLTLDRESFGKLIGD-LESLKKDY 403          
BLAST of cAMP-dependent protein kinase type II regulatory subunit vs. Ensembl Celegans
Match: egl-4 (cGMP-dependent protein kinase egl-4 [Source:UniProtKB/Swiss-Prot;Acc:O76360])

HSP 1 Score: 109.768 bits (273), Expect = 1.914e-25
Identity = 80/297 (26.94%), Postives = 149/297 (50.17%), Query Frame = 1
Query:  283 MSNDKSKMKLVQTSNVPRQSITCESFDPSSIDDETFEKNRKIYPKTPKQMDKITDILETIFFFNCLDEIQFSKIIQSMFFIEVFKGDEIIKENDPGNNFYVIDYGTFTASNKSKSIYEVYKGEGFFGELALLYNCPRSASVIADTDGGLWVIDRVTFRQLILKSAYQKRQRYLKFISSVPLLEDLTKYEQCNLADALKTKTINNEK-VISQGDAGDKMYFIXXXXXXXXXXXXXXXXXXS--RLKAGDYFGEVALLANIPRIANVYALG-YTKLAELDAKSYTRLLGPCIDNMRKNF 1161
            + ND  +  ++    V R      S +P++ +++      + Y KT      I D ++   F   L + Q  +++  M+ +    G  +I+E +PG+  +V+  G    S +   + ++  G    GELA+LYNC R+ASV A TD  LWV+DR  F+ +  +   ++  + + F++ V + ++L++     +AD +     +    +I QG+ GD  + I  G+V VT +   E        L  GD+FGE ALL    R AN+ A     ++  LD +S+ +L+G  +++++K++
Sbjct:  111 LGNDLQQKAVLPADGVQRAKKIAVSAEPTNFENKP--ATLQHYNKTVGAKQMIRDAVQKNDFLKQLAKEQIIELVNCMYEMRARAGQWVIQEGEPGDRLFVVAEGELQVSREGALLGKMRAGT-VMGELAILYNCTRTASVQALTDVQLWVLDRSVFQMITQRLGMERHSQLMNFLTKVSIFQNLSEDRISKMADVMDQDYYDGGHYIIRQGEKGDAFFVINSGQVKVTQQIEGETEPREIRVLNQGDFFGERALLGEEVRTANIIAQAPGVEVLTLDRESFGKLIGD-LESLKKDY 403          
BLAST of cAMP-dependent protein kinase type II regulatory subunit vs. Ensembl Fly
Match: Pka-R2 (gene:FBgn0022382 transcript:FBtr0088437)

HSP 1 Score: 258.07 bits (658), Expect = 3.847e-82
Identity = 148/369 (40.11%), Postives = 226/369 (61.25%), Query Frame = 1
Query:   97 LTEVIEEFKKQVEIANPKDIIAYAATYFTKKVAQENESNDTEFDKSLDYDSSSEDGDSLKEIMSNDKSKMKLVQTSNVPRQSITCESFDPSSIDDETFEKNRKIYPKTPKQMDKITDILETIFFFNCLDEIQFSKIIQSMFFIEVFKGDEIIKENDPGNNFYVIDYGTFTASNKSKSIYEVYKGEGFFGELALLYNCPRSASVIADTDGGLWVIDRVTFRQLILKSAYQKRQRYLKFISSVPLLEDLTKYEQCNLADALKTKTINN-EKVISQGDAGDKMYFIXXXXXXXXXXXXXXXXXXSRLKAGDYFGEVALLANIPRIANVYAL-GYTKLAELDAKSYTRLLGPCIDNMRKNFTKYRSQLEKLLS 1197
            L EV+ +F     +  P D+I YA  YFTK  ++    + T+         +S+D D+   +M++ +            R+S+  E++DP +   +  +    ++PKT +Q  ++ + ++ +  F  L++ Q ++++ +MF  +V  GD II++ D G+NFYVI+ G +      K I   Y   G FGELALLYN PR+A+V A+T G LW +DR TFR+++LKSA++KR+ Y + ++SVP+L+ L  YE+ NLADAL +K+ +N E++I QGDA D MYFIEEG V V +   + E E S+L  G YFGE+AL+ + PR A+VYA  G  KLA LD K++ RLLGPC+D M++N   Y SQL K+  
Sbjct:   15 LKEVLLQFSISFLVEQPPDVIDYAVEYFTKLQSERPSVSHTDQSTDDQLSVNSQDADAEPPVMASSR------------RKSVFAEAYDPEAD--DDDDGATAVFPKTDEQRARLVESVKNVLLFRSLEKEQMNQVLDAMFERKVQPGDFIIRQGDDGDNFYVIESGVYKVYINDKHI-NTYNHTGLFGELALLYNMPRAATVQAETSGLLWAMDRQTFRRILLKSAFRKRKMYEELLNSVPMLKALQNYERMNLADALVSKSYDNGERIIKQGDAADGMYFIEEGTVSVRMDQDDAEVEISQLGKGQYFGELALVTHRPRAASVYATGGVVKLAFLDVKAFERLLGPCMDIMKRNIDDYESQLVKIFG 368          
BLAST of cAMP-dependent protein kinase type II regulatory subunit vs. Ensembl Fly
Match: Pka-R2 (gene:FBgn0022382 transcript:FBtr0088438)

HSP 1 Score: 258.07 bits (658), Expect = 3.847e-82
Identity = 148/369 (40.11%), Postives = 226/369 (61.25%), Query Frame = 1
Query:   97 LTEVIEEFKKQVEIANPKDIIAYAATYFTKKVAQENESNDTEFDKSLDYDSSSEDGDSLKEIMSNDKSKMKLVQTSNVPRQSITCESFDPSSIDDETFEKNRKIYPKTPKQMDKITDILETIFFFNCLDEIQFSKIIQSMFFIEVFKGDEIIKENDPGNNFYVIDYGTFTASNKSKSIYEVYKGEGFFGELALLYNCPRSASVIADTDGGLWVIDRVTFRQLILKSAYQKRQRYLKFISSVPLLEDLTKYEQCNLADALKTKTINN-EKVISQGDAGDKMYFIXXXXXXXXXXXXXXXXXXSRLKAGDYFGEVALLANIPRIANVYAL-GYTKLAELDAKSYTRLLGPCIDNMRKNFTKYRSQLEKLLS 1197
            L EV+ +F     +  P D+I YA  YFTK  ++    + T+         +S+D D+   +M++ +            R+S+  E++DP +   +  +    ++PKT +Q  ++ + ++ +  F  L++ Q ++++ +MF  +V  GD II++ D G+NFYVI+ G +      K I   Y   G FGELALLYN PR+A+V A+T G LW +DR TFR+++LKSA++KR+ Y + ++SVP+L+ L  YE+ NLADAL +K+ +N E++I QGDA D MYFIEEG V V +   + E E S+L  G YFGE+AL+ + PR A+VYA  G  KLA LD K++ RLLGPC+D M++N   Y SQL K+  
Sbjct:   15 LKEVLLQFSISFLVEQPPDVIDYAVEYFTKLQSERPSVSHTDQSTDDQLSVNSQDADAEPPVMASSR------------RKSVFAEAYDPEAD--DDDDGATAVFPKTDEQRARLVESVKNVLLFRSLEKEQMNQVLDAMFERKVQPGDFIIRQGDDGDNFYVIESGVYKVYINDKHI-NTYNHTGLFGELALLYNMPRAATVQAETSGLLWAMDRQTFRRILLKSAFRKRKMYEELLNSVPMLKALQNYERMNLADALVSKSYDNGERIIKQGDAADGMYFIEEGTVSVRMDQDDAEVEISQLGKGQYFGELALVTHRPRAASVYATGGVVKLAFLDVKAFERLLGPCMDIMKRNIDDYESQLVKIFG 368          
BLAST of cAMP-dependent protein kinase type II regulatory subunit vs. Ensembl Fly
Match: Pka-R2 (gene:FBgn0022382 transcript:FBtr0112902)

HSP 1 Score: 239.195 bits (609), Expect = 9.363e-75
Identity = 139/361 (38.50%), Postives = 218/361 (60.39%), Query Frame = 1
Query:   97 LTEVIEEFKKQVEIANPKDIIAYAATYFTKKVAQENESNDTEFDKSLDYDSSSEDGDSLKEIMSNDKSKMKLVQTSNVPRQSITCESFDPSSIDDETFEKNRKIYPKTPKQMDKITDILETIFFFNCLDEIQFSKIIQSMFFIEVFKGDEIIKENDPGNNFYVIDYGTFTASNKSKSIYEVYKGEGFFGELALLYNCPRSASVIADTDGGLWVIDRVTFRQLILKSAYQKRQRYLKFISSVPLLEDLTKYEQCNLADALKTKTINN-EKVISQGDAGDKMYFIXXXXXXXXXXXXXXXXXXSRLKAGDYFGEVALLANIPRIANVYAL-GYTKLAELDAKSYTRLLGPCIDNMRKNFTKYR 1173
            L EV+ +F     +  P D+I YA  YFTK  ++    + T+         +S+D D+   +M++ +            R+S+  E++DP +   +  +    ++PKT +Q  ++ + ++ +  F  L++ Q ++++ +MF  +V  GD II++ D G+NFYVI+ G +      K I   Y   G FGELALLYN PR+A+V A+T G LW +DR TFR+++LKSA++KR+ Y + ++SVP+L+ L  YE+ NLADAL +K+ +N E++I QGDA D MYFIEEG V V +   + E E S+L  G YFGE+AL+ + PR A+VYA  G  KLA LD   + RL+G C   ++++ + YR
Sbjct:   15 LKEVLLQFSISFLVEQPPDVIDYAVEYFTKLQSERPSVSHTDQSTDDQLSVNSQDADAEPPVMASSR------------RKSVFAEAYDPEAD--DDDDGATAVFPKTDEQRARLVESVKNVLLFRSLEKEQMNQVLDAMFERKVQPGDFIIRQGDDGDNFYVIESGVYKVYINDKHI-NTYNHTGLFGELALLYNMPRAATVQAETSGLLWAMDRQTFRRILLKSAFRKRKMYEELLNSVPMLKALQNYERMNLADALVSKSYDNGERIIKQGDAADGMYFIEEGTVSVRMDQDDAEVEISQLGKGQYFGELALVTHRPRAASVYATGGVVKLAFLDVICFERLMGKCSGGIQRSISGYR 360          
BLAST of cAMP-dependent protein kinase type II regulatory subunit vs. Ensembl Fly
Match: Pka-R2 (gene:FBgn0022382 transcript:FBtr0112901)

HSP 1 Score: 238.424 bits (607), Expect = 1.391e-74
Identity = 143/373 (38.34%), Postives = 223/373 (59.79%), Query Frame = 1
Query:   97 LTEVIEEFKKQVEIANPKDIIAYAATYFTKKVAQENESNDTEFDKSLDYDSS--SEDGDSLKEIMSNDKSKMKLVQTSNVPRQSITCESFDPSSIDDETFEKNRKIYPKTPKQMDKITDILETIFFFNCLDEIQFSKIIQSMFFIEVFKGDEIIKENDPGNNFYVIDYGTFTASNKSKSIYEVYKGEGFFGELALLYNCPRSASVIADTDGGLWVIDRVTFRQLILKSAYQKRQRYLKFISSVPLLEDLTKYEQCNLADALKTKTINN-EKVISQGDAGDKMYFIXXXXXXXXXXXXXXXXXXSRLKAGDYFGEVALLANIPRIANVYAL-GYTKLAELDAKSYTRLLGPCIDNMRKNFTKYRSQLEKLLSRH 1203
            L EV+ +F     +  P D+I YA  YFTK   Q    + +  D+S D   S  S+D D+   +M++ +            R+S+  E++DP +   +  +    ++PKT +Q  ++ + ++ +  F  L++ Q ++++ +MF  +V  GD II++ D G+NFYVI+ G +      K I   Y   G FGELALLYN PR+A+V A+T G LW +DR TFR+++LKSA++KR+ Y + ++SVP+L+ L  YE+ NLADAL +K+ +N E++I QGDA D MYFIEEG V V +   + E E S+L  G YFGE+AL+ + PR A+VYA  G  KLA LD +++ R++G   D +++N   Y      +  R+
Sbjct:   15 LKEVLLQFSISFLVEQPPDVIDYAVEYFTK--LQSERPSVSHTDQSTDDQLSVNSQDADAEPPVMASSR------------RKSVFAEAYDPEAD--DDDDGATAVFPKTDEQRARLVESVKNVLLFRSLEKEQMNQVLDAMFERKVQPGDFIIRQGDDGDNFYVIESGVYKVYINDKHI-NTYNHTGLFGELALLYNMPRAATVQAETSGLLWAMDRQTFRRILLKSAFRKRKMYEELLNSVPMLKALQNYERMNLADALVSKSYDNGERIIKQGDAADGMYFIEEGTVSVRMDQDDAEVEISQLGKGQYFGELALVTHRPRAASVYATGGVVKLAFLDTEAFERIMGFLTDVLKRNIVIYEQMFTDMARRN 370          
BLAST of cAMP-dependent protein kinase type II regulatory subunit vs. Ensembl Fly
Match: Pka-R1 (gene:FBgn0259243 transcript:FBtr0300532)

HSP 1 Score: 188.734 bits (478), Expect = 4.094e-56
Identity = 117/309 (37.86%), Postives = 182/309 (58.90%), Query Frame = 1
Query:  265 DSLKEIMSNDKSK--MKLVQTSNVPRQSITCESFDPSSIDDETFEKNRKIYPKTPKQMDKITDILETIFFFNCLDEIQFSKIIQSMFFIEVFKGDEIIKENDPGNNFYVIDYGTFTASNKSKSIYEVYKGEGFFGELALLYNCPRSASVIADTDGGLWVIDRVTFRQLILKSAYQKRQRYLKFISSVPLLEDLTKYEQCNLADALKTKTINN-EKVISQGDAGDKMYFIXXXXXXXXXXXXXXX--XXXSRLKAGDYFGEVALLANIPRIANVYALGYTKLAELDAKSYTRLLGPCIDNMRKNFTKYRS 1176
            D+ ++++S D  +    + QT+  P +     S +P + +D T    +K+ PK  K M+ ++  +     F  LDE + S I  +MF +    G+ II++ D G+NFYVID G       S+ +  + +G G FGELAL+Y  PR+A+V A TD  LW IDR ++R++++ S  +KR+ Y +F+S V +LE L K+E+  +AD+L+T + ++ E ++ QG AGD  Y I EG  +V  +  E E   E  RL + DYFGE+ALL + PR A V A G  K  +LD   + R+LGPC D +++N T+Y S
Sbjct:    7 DASRQVISPDDCEDLSPMPQTAAPPVRRRGGISAEPVTEEDAT-NYVKKVVPKDYKTMNALSKAIAKNVLFAHLDESERSDIFDAMFPVNHIAGENIIQQGDEGDNFYVIDVGEVDVFVNSELVTTISEG-GSFGELALIYGTPRAATVRAKTDVKLWGIDRDSYRRILMGSTIRKRKMYEEFLSRVSILESLDKWERLTVADSLETCSFDDGETIVKQGAAGDDFYIILEGCAVVLQQRSEGEDPAEVGRLGSSDYFGEIALLLDRPRAATVVARGPLKCVKLDRARFERVLGPCADILKRNITQYNS 313          
BLAST of cAMP-dependent protein kinase type II regulatory subunit vs. Ensembl Zebrafish
Match: prkar2aa (protein kinase, cAMP-dependent, regulatory, type II, alpha A [Source:ZFIN;Acc:ZDB-GENE-030131-1007])

HSP 1 Score: 211.46 bits (537), Expect = 9.554e-64
Identity = 130/386 (33.68%), Postives = 201/386 (52.07%), Query Frame = 1
Query:   97 LTEVIEEFKKQVEIANPKDIIAYAATYFTKKVAQENESNDTEFDKSLDYDSSSEDGDSLKEIMSNDKSKMKLVQTSNVP--------RQSITCESFDPSSIDDETFEKNRKIYPKTPKQMDKITDILETIFFFNCLDEIQFSKIIQSMFFIEVFKGDEIIKENDPGNNFYVIDYGTF---TASNKSKSIYEVYKGEGFFGELALLYNCPRSASVIADTDGGLWVIDRVTFRQLILKSAYQKRQRYLKFISSVPLLEDLTKYEQCNLADALKTKTI-NNEKVISQGDAGDKMYF-------IXXXXXXXXXXXXXXXXXXSRLKAGDYFGEVALLANIPRIANVYALGYTKLAELDAKSYTRLLGPCIDNMRKNFTKYRSQLEKLLS 1197
            LTE+++ +  +V    P D++ +A  YFT+     ++       K+        DG+ + +  SN     +   +   P        R S+  E+F+P   DDE   + R ++PKT +Q  ++ +  + I  F  LD+ QFS+++ +MF + V   D +I + D G+NFYVI+ G +      +        Y  +G FGELAL+YN PR+A++IA  +G LW +DR TFR+LI+K+  +KR+ Y  FI S+PLL+ L   E+  + D L  KT  + E++I QGD  D  Y        I         R    E E +R   G YFGE+AL+ N PR A+ YA+G  K   +D +++ RLLGPC + M++N   Y  QL  L  
Sbjct:    9 LTELLQGYTVEVLRQRPPDLVEFAVQYFTRLRDTRSQDGSGAAAKT-GGKGVMFDGEPM-QTESNGDEDDEDDDSDFEPPPPSRFNRRVSVCAEAFNPD--DDEEDSEPRVVHPKTDEQRCRLQEACKDILLFKALDQEQFSEVLDAMFEVLVQPQDHVIDQGDDGDNFYVIERGVYDIVVQKDGVGCCVGQYNNKGSFGELALMYNTPRAATIIAKDEGALWGLDRATFRRLIVKNNAKKRRMYECFIESIPLLKSLELSERMKIVDVLGVKTFQDGERIIMQGDKADCFYIVESGEVKIMMKSKTKADRQDNAEVEIARCSRGQYFGELALVTNKPRAASAYAIGDVKCLVIDIQAFERLLGPCKEIMKRNIAHYEEQLVALFG 390          
BLAST of cAMP-dependent protein kinase type II regulatory subunit vs. Ensembl Zebrafish
Match: PRKAR2B (si:ch211-272n13.7 [Source:ZFIN;Acc:ZDB-GENE-160113-22])

HSP 1 Score: 207.223 bits (526), Expect = 3.392e-62
Identity = 129/387 (33.33%), Postives = 206/387 (53.23%), Query Frame = 1
Query:   97 LTEVIEEFKKQVEIANPKDIIAYAATYFTKKVAQENESNDTEFD----------KSLDY-----DSSSEDGDSLKEIMSNDKSKMKLVQTSNVPRQSITCESFDPSSIDDETFEKNRKIYPKTPKQMDKITDILETIFFFNCLDEIQFSKIIQSMFFIEVFKGDEIIKENDPGNNFYVIDYGTF----TASNKSKSIYEVYKGEGFFGELALLYNCPRSASVIADTDGGLWVIDRVTFRQLILKSAYQKRQRYLKFISSVPLLEDLTKYEQCNLADALKTKTIN-NEKVISQGDAGDKMYFIXXXXXXXXXXXXXXXXXXSRLKAGDYFGEVALLANIPRIANVYALGYTKLAELDAKSYTRLLGPCIDNMRKNFTKYRSQLEKLLS 1197
            LTE+++ F  +V    P D++ +A  YFT+   +ENE+    F           K++++        SE+G+   +      +    +  +  P+    C                   YPKT +Q  ++ +  + I  F  LD+ Q S+++ +MF   V  G+ II ++D G+NFYVI+ G F     A   ++++   Y   G FGELAL+YN PR+A++IA + G LW +DR+TFR++I+K+  +KR+ Y  FI ++PLL  L   E+  + D L TK  N  E++I+QGD  D  Y +E G V +T++  + E E +    G YFGE+AL+ N PR A+ YA+   K   +D +++ RLLGPC+D M++N   Y  QL  L  
Sbjct:    9 LTELLQSFTVEVLRNQPADLLEFALQYFTR--LKENETRGGAFGNERNPATRAGKAVNFIEEAMQIDSENGEEEDDDEEFVDAAFAQLLLAGFPQCFAVCAQV---------------TYPKTDEQRQRLQEACKDILLFKNLDQEQMSQVLDAMFEKVVVSGEHIIDQDDDGDNFYVIERGMFEILLKADGTTRTVGS-YDNRGSFGELALMYNTPRAATIIATSPGALWCLDRLTFRRIIVKNNAKKRKMYEAFIGTLPLLTSLEVSERMKVVDVLSTKVYNGGEQIIAQGDLADCFYIVESGHVRITMKRSKVEVEIATCSRGQYFGELALVTNKPRAASAYAMDSVKCLVMDVQAFERLLGPCMDIMKRNIANYEEQLITLFG 377          
BLAST of cAMP-dependent protein kinase type II regulatory subunit vs. Ensembl Zebrafish
Match: PRKAR2B (si:ch211-272n13.7 [Source:ZFIN;Acc:ZDB-GENE-160113-22])

HSP 1 Score: 205.682 bits (522), Expect = 9.711e-62
Identity = 132/384 (34.38%), Postives = 212/384 (55.21%), Query Frame = 1
Query:   97 LTEVIEEFKKQVEIANPKDIIAYAATYFTKKVAQENESNDTEFDKSLDYDSSSEDGDSLKEIMSNDKSKMKLVQ-----TSNVPRQSITCESFDPSSIDDETFEKNRKIYPKTPKQMDKITDILETIFFFNCLDEIQFSKIIQSMFFIEVFKGDEIIKENDPGNNFYVIDYGTF----TASNKSKSIYEVYKGEGFFGELALLYNCPRSASVIADTDGGLWVIDRVTFRQLILKSAYQKRQRYLKFISSVPLLEDLTKYEQCNLADALKTKTIN-NEKVISQGDAGDKMYFIXXXXXXXXXXXXXXXXXXSRLKAGDYFGEVALLANIPRIANVYALGYTKLAELDAKSYTRLLGPCIDNMRKNFTKYRSQLEKLL-SRHQLEE 1215
            LTE+++ F  +V    P D++ +A  YFT+   +ENE+    F         +E  + ++E M  D    +          N    ++  E+++P   ++E   + R  YPKT +Q  ++ +  + I  F  LD+ Q S+++ +MF   V  G+ II ++D G+NFYVI+ G F     A   ++++   Y   G FGELAL+YN PR+A++IA + G LW +DR+TFR++I+K+  +KR+ Y  FI ++PLL  L   E+  + D L TK  N  E++I+QGD  D  ++I E   +       +E E +    G YFGE+AL+ N PR A+ YA+   K   +D +++ RLLGPC+D M++N   Y  QL  L  S+  +EE
Sbjct:    9 LTELLQSFTVEVLRNQPADLLEFALQYFTR--LKENETRGGAF--------GNEPVNFIEEAMQIDSENGEEEDDDEEFVGNAFASALCAEAYNPDEDEEER--EPRVTYPKTDEQRQRLQEACKDILLFKNLDQEQMSQVLDAMFEKVVVSGEHIIDQDDDGDNFYVIERGMFEILLKADGTTRTVGS-YDNRGSFGELALMYNTPRAATIIATSPGALWCLDRLTFRRIIVKNNAKKRKMYEAFIGTLPLLTSLEVSERMKVVDVLSTKVYNGGEQIIAQGDLAD-CFYIVESGHVRITMKRSKEVEIATCSRGQYFGELALVTNKPRAASAYAMDSVKCLVMDVQAFERLLGPCMDIMKRNIANYEEQLITLFGSQIAIEE 378          
BLAST of cAMP-dependent protein kinase type II regulatory subunit vs. Ensembl Zebrafish
Match: PRKAR2B (si:ch211-272n13.7 [Source:ZFIN;Acc:ZDB-GENE-160113-22])

HSP 1 Score: 202.986 bits (515), Expect = 1.962e-60
Identity = 132/387 (34.11%), Postives = 214/387 (55.30%), Query Frame = 1
Query:   97 LTEVIEEFKKQVEIANPKDIIAYAATYFTKKVAQENESNDTEFDKSLDYDSSSEDGDS---LKEIMSNDKSKMKLVQ-----TSNVPRQSITCESFDPSSIDDETFEKNRKIYPKTPKQMDKITDILETIFFFNCLDEIQFSKIIQSMFFIEVFKGDEIIKENDPGNNFYVIDYGTF----TASNKSKSIYEVYKGEGFFGELALLYNCPRSASVIADTDGGLWVIDRVTFRQLILKSAYQKRQRYLKFISSVPLLEDLTKYEQCNLADALKTKTIN-NEKVISQGDAGDKMYFIXXXXXXXXXXXXXX-------XXXXSRLKAGDYFGEVALLANIPRIANVYALGYTKLAELDAKSYTRLLGPCIDNMRKNFTKYRSQLEKLLS 1197
            LTE+++ F  +V    P D++ +A  YFT+   +ENE+    F    + + ++  G +   ++E M  D    +          N    ++  E+++P   ++E   + R  YPKT +Q  ++ +  + I  F  LD+ Q S+++ +MF   V  G+ II ++D G+NFYVI+ G F     A   ++++   Y   G FGELAL+YN PR+A++IA + G LW +DR+TFR++I+K+  +KR+ Y  FI ++PLL  L   E+  + D L TK  N  E++I+QGD  D  Y +E G V +T++  +        E E +    G YFGE+AL+ N PR A+ YA+   K   +D +++ RLLGPC+D M++N   Y  QL  L  
Sbjct:    9 LTELLQSFTVEVLRNQPADLLEFALQYFTR--LKENETRGGAFGN--ERNPATRAGKAVNFIEEAMQIDSENGEEEDDDEEFVGNAFASALCAEAYNPDEDEEER--EPRVTYPKTDEQRQRLQEACKDILLFKNLDQEQMSQVLDAMFEKVVVSGEHIIDQDDDGDNFYVIERGMFEILLKADGTTRTVGS-YDNRGSFGELALMYNTPRAATIIATSPGALWCLDRLTFRRIIVKNNAKKRKMYEAFIGTLPLLTSLEVSERMKVVDVLSTKVYNGGEQIIAQGDLADCFYIVESGHVRITMKRSKSKNDTEDEEVEIATCSRGQYFGELALVTNKPRAASAYAMDSVKCLVMDVQAFERLLGPCMDIMKRNIANYEEQLITLFG 388          
BLAST of cAMP-dependent protein kinase type II regulatory subunit vs. Ensembl Zebrafish
Match: prkar2ab (protein kinase, cAMP-dependent, regulatory, type II, alpha, B [Source:ZFIN;Acc:ZDB-GENE-040426-2427])

HSP 1 Score: 181.415 bits (459), Expect = 4.288e-52
Identity = 106/296 (35.81%), Postives = 168/296 (56.76%), Query Frame = 1
Query:  334 RQSITCESFDPSSIDDETFEKNR--KIYPKTPKQMDKITDILETIFFFNCLDEIQFSKIIQSMFFIEVFKGDEIIKENDPGNNFYVIDYGTFTASNKSKSIYEV---YKGEGFFGELALLYNCPRSASVIADTDGGLWVIDRVTFRQLILKSAYQKRQRYLKFISSVPLLEDLTKYEQCNLADALKTKTINN-EKVISQGDAGDKMYF-------IXXXXXXXXXXXXXXXXXXSRLKAGDYFGEVALLANIPRIANVYALGYTKLAELDAKSYTRLLGPCIDNMRKNFTKYRSQL 1182
            R S+  E ++P   DD+  E ++   ++ KT +Q  ++ D  + I  F  L+E Q ++++ SMF + V  G+ II + D G+NFYVI+ G +    +   +      Y  +G FGELAL+YN PR+A++ A  +G LW +DR TF +LI+K+  +KR+ Y  FI  VPLL+ L   E+  + D L  ++ ++ E++I QGD+ D  Y        I         +  +EE E +R   G YFGE+AL+   PR A+VYA+G T+   +D +++ RLLG C   +++N T Y  QL
Sbjct:  115 RVSVCAEPYNPDEDDDDGDEGSQLTVLHQKTDEQRQRLQDACKHILLFKTLEEDQLAEVLDSMFEVLVKPGECIINQGDDGDNFYVIERGVYEIVIQQDGLQHSVGRYDHKGSFGELALMYNTPRAATIRALQEGALWALDRATFHRLIVKNNAKKRRMYESFIECVPLLKSLQLSERMKIVDVLGMRSFSDGERIIQQGDSADCFYIVESGEVRIMIRSKTRACQLLQEEVEVARCSRGQYFGELALVTKRPRAASVYAVGDTRCLVIDVQAFERLLGSCKQILKRNITHYEQQL 410          
BLAST of cAMP-dependent protein kinase type II regulatory subunit vs. Ensembl Xenopus
Match: ednrb2 (endothelin receptor B subtype 2 [Source:Xenbase;Acc:XB-GENE-1219159])

HSP 1 Score: 213.772 bits (543), Expect = 1.463e-64
Identity = 125/379 (32.98%), Postives = 204/379 (53.83%), Query Frame = 1
Query:   97 LTEVIEEFKKQVEIANPKDIIAYAATYFTKKVAQENESNDTEFDKSLDYDSSSEDGDSL-KEIMSNDKSKMKLVQTSNVPRQSITCESFDPSSIDDETFEKNRKIYPKTPKQMDKITDILETIFFFNCLDEIQFSKIIQSMFFIEVFKGDEIIKENDPGNNFYVIDYGTFTASNKSKSIYE---VYKGEGFFGELALLYNCPRSASVIADTDGGLWVIDRVTFRQLILKSAYQKRQRYLKFISSVPLLEDLTKYEQCNLADALKTKT-INNEKVISQGDAGDKMYF-------IXXXXXXXXXXXXXXXXXXSRLKAGDYFGEVALLANIPRIANVYALGYTKLAELDAKSYTRLLGPCIDNMRKNFTKYRSQLEKLLS 1197
            LTE+++ F  +V    P+D++ +A  YFT+   ++++S        ++       G    +E M  D    +  +  +     +  E+++P   DD+T  + + IYPKT  Q +++ +  + I  F  LD+ Q S+++ +MF   V  G+ +I + D G+NFYVID GT+    KS  +      Y   G FGELAL+YN PR+A+++A + G +W +DR TFR++I+K+  +K++ Y  FI S+P L+ L   E+  + D + TKT  + E++I+QGD  D  Y        I             E  E +R   G YFGE+AL+ N PR A+ YA+G  K   +D +++ RLLGPC++ M++N   Y  QL  L  
Sbjct:    9 LTELLQSFTVEVLRKQPEDLLEFALQYFTQ--LKQSKSQGGPLSHGMELPFRLTKGVIFAEEPMQTDSENGEEEEDDDEEDFVVCAEAYNPDEEDDDT--ETKVIYPKTDDQRNRLQEACKDILLFKSLDQEQMSQVLDAMFEKLVKCGEHVIDQGDDGDNFYVIDRGTYDIFVKSDGVVRCVGAYDNRGSFGELALMYNTPRAATIVATSVGSIWGLDRATFRRIIVKNNAKKKRMYENFIESLPFLKSLEFSERLKVVDVIGTKTYYDGEQIIAQGDGADSFYIVESGEVRINMKSKSKPDAETNEAVEIARYTRGQYFGELALVTNKPRAASAYAVGNVKCLVMDVQAFERLLGPCMEIMKRNIANYEEQLVALFG 383          
BLAST of cAMP-dependent protein kinase type II regulatory subunit vs. Ensembl Xenopus
Match: ednrb2 (endothelin receptor B subtype 2 [Source:Xenbase;Acc:XB-GENE-1219159])

HSP 1 Score: 213.001 bits (541), Expect = 4.693e-64
Identity = 128/391 (32.74%), Postives = 208/391 (53.20%), Query Frame = 1
Query:   97 LTEVIEEFKKQVEIANPKDIIAYAATYFTKKVAQENESNDTEFDKSLDY-------------DSSSEDGDSLKEIMSNDKSKMKLVQTSNVPRQSITCESFDPSSIDDETFEKNRKIYPKTPKQMDKITDILETIFFFNCLDEIQFSKIIQSMFFIEVFKGDEIIKENDPGNNFYVIDYGTFTASNKSKSIYE---VYKGEGFFGELALLYNCPRSASVIADTDGGLWVIDRVTFRQLILKSAYQKRQRYLKFISSVPLLEDLTKYEQCNLADALKTKT-INNEKVISQGDAGDKMYF-------IXXXXXXXXXXXXXXXXXXSRLKAGDYFGEVALLANIPRIANVYALGYTKLAELDAKSYTRLLGPCIDNMRKNFTKYRSQLEKLLS 1197
            LTE+++ F  +V    P+D++ +A  YFT+    +++         L +              + SE+G+  ++    D     + + S   R S+  E+++P   DD+T  + + IYPKT  Q +++ +  + I  F  LD+ Q S+++ +MF   V  G+ +I + D G+NFYVID GT+    KS  +      Y   G FGELAL+YN PR+A+++A + G +W +DR TFR++I+K+  +K++ Y  FI S+P L+ L   E+  + D + TKT  + E++I+QGD  D  Y        I             E  E +R   G YFGE+AL+ N PR A+ YA+G  K   +D +++ RLLGPC++ M++N   Y  QL  L  
Sbjct:    9 LTELLQSFTVEVLRKQPEDLLEFALQYFTQLKQSKSQGGPLSHGMELPFRLTKGVIFAEEPMQTDSENGEEEEDDDEEDFVAPVINRFSR--RASVCAEAYNPDEEDDDT--ETKVIYPKTDDQRNRLQEACKDILLFKSLDQEQMSQVLDAMFEKLVKCGEHVIDQGDDGDNFYVIDRGTYDIFVKSDGVVRCVGAYDNRGSFGELALMYNTPRAATIVATSVGSIWGLDRATFRRIIVKNNAKKKRMYENFIESLPFLKSLEFSERLKVVDVIGTKTYYDGEQIIAQGDGADSFYIVESGEVRINMKSKSKPDAETNEAVEIARYTRGQYFGELALVTNKPRAASAYAVGNVKCLVMDVQAFERLLGPCMEIMKRNIANYEEQLVALFG 395          
BLAST of cAMP-dependent protein kinase type II regulatory subunit vs. Ensembl Xenopus
Match: fgf1 (fibroblast growth factor 1 [Source:Xenbase;Acc:XB-GENE-485966])

HSP 1 Score: 203.371 bits (516), Expect = 1.781e-60
Identity = 126/390 (32.31%), Postives = 215/390 (55.13%), Query Frame = 1
Query:   97 LTEVIEEFKKQVEIANPKDIIAYAATYFTKKVAQENESNDTEFDKSL-------DYDSSSEDGDSLKEIMSNDKSKMKLVQTSNV-----PRQSITCESFDPSSIDDETFEKNRKIYPKTPKQMDKITDILETIFFFNCLDEIQFSKIIQSMFFIEVFKGDEIIKENDPGNNFYVIDYGT---FTASNKSKSIYEVYKGEGFFGELALLYNCPRSASVIADTDGGLWVIDRVTFRQLILKSAYQKRQRYLKFISSVPLLEDLTKYEQCNLADALKTKTI-NNEKVISQGDAGDKMYFIXXXXXXXXXXXXXXXXXXS-------RLKAGDYFGEVALLANIPRIANVYALGYTKLAELDAKSYTRLLGPCIDNMRKNFTKYRSQLEKLLS 1197
            LT++++ +  +V    P D++ +A  YFT+   +E +  D     SL       ++D      +S  +   +++          V      R S+  E+++P   D++T  + R + PKT +Q  ++ +  + I  F  LD+ Q S+++ +MF + V   + +I + D G+NFYV++ G    F   +        Y   G FGELAL+YN PR+A+++A ++G LW +DRVTFR++ILK+  +KR+ Y  FI SVP+L+ L   E+  + D +  +   + +++I+QGD  D  + +E GEV + +++  +  +ES       R K+G YFGE+AL+ N PR A+ YA+G  K   +D +++ RLLGPC+D M++N T Y  QL  L  
Sbjct:    9 LTDLLQGYTVEVLRQKPPDLVEFAIQYFTR--LKEKQLQDGAGAGSLRPHARVVNFDGEPMQTESNGDEEEDEEDDDDSDFEPPVINRYSRRVSVCAEAYNPDEEDEDT--EPRVVRPKTDEQRCRLQEACKDILLFKNLDQEQLSQVLDAMFEMRVKPQEHVIDQGDDGDNFYVVERGQYDIFVERDGQSRCVGRYDNHGSFGELALMYNTPRAATIVATSEGALWGLDRVTFRRIILKNNAKKRKTYEIFIESVPVLKFLELSERMKIVDVIAARVYKDGDRIIAQGDKADCFFIVESGEVKIMMKSKTKTGQESNQEVEIARCKSGQYFGELALVTNKPRAASAYAVGDVKCLIMDVQAFERLLGPCMDIMKRNITHYEEQLVALFG 394          
BLAST of cAMP-dependent protein kinase type II regulatory subunit vs. Ensembl Xenopus
Match: fgf1 (fibroblast growth factor 1 [Source:Xenbase;Acc:XB-GENE-485966])

HSP 1 Score: 201.06 bits (510), Expect = 1.674e-59
Identity = 125/395 (31.65%), Postives = 214/395 (54.18%), Query Frame = 1
Query:   97 LTEVIEEFKKQVEIANPKDIIAYAATYFTKKVAQENESNDTEFDKSLDYDSS--SEDGDSLK---------------EIMSNDKSKMKLVQTSNVPRQSITCESFDPSSIDDETFEKNRKIYPKTPKQMDKITDILETIFFFNCLDEIQFSKIIQSMFFIEVFKGDEIIKENDPGNNFYVIDYGT---FTASNKSKSIYEVYKGEGFFGELALLYNCPRSASVIADTDGGLWVIDRVTFRQLILKSAYQKRQRYLKFISSVPLLEDLTKYEQCNLADALKTKTI-NNEKVISQGDAGDKMYFIXXXXXXXXXXXXXXXXXXS-------RLKAGDYFGEVALLANIPRIANVYALGYTKLAELDAKSYTRLLGPCIDNMRKNFTKYRSQLEKLLS 1197
            LT++++ +  +V    P D++ +A  YFT+   +E +  D     SL   +   + DG+ ++               +     K    L       +  +  E+++P   D++T  + R + PKT +Q  ++ +  + I  F  LD+ Q S+++ +MF + V   + +I + D G+NFYV++ G    F   +        Y   G FGELAL+YN PR+A+++A ++G LW +DRVTFR++ILK+  +KR+ Y  FI SVP+L+ L   E+  + D +  +   + +++I+QGD  D  + +E GEV + +++  +  +ES       R K+G YFGE+AL+ N PR A+ YA+G  K   +D +++ RLLGPC+D M++N T Y  QL  L  
Sbjct:    9 LTDLLQGYTVEVLRQKPPDLVEFAIQYFTR--LKEKQLQDGAGAGSLRPHARVVNFDGEPMQTESNGDEEEDEEDDDDSDFERKRPHVLWAGLEFEKTGVCAEAYNPDEEDEDT--EPRVVRPKTDEQRCRLQEACKDILLFKNLDQEQLSQVLDAMFEMRVKPQEHVIDQGDDGDNFYVVERGQYDIFVERDGQSRCVGRYDNHGSFGELALMYNTPRAATIVATSEGALWGLDRVTFRRIILKNNAKKRKTYEIFIESVPVLKFLELSERMKIVDVIAARVYKDGDRIIAQGDKADCFFIVESGEVKIMMKSKTKTGQESNQEVEIARCKSGQYFGELALVTNKPRAASAYAVGDVKCLIMDVQAFERLLGPCMDIMKRNITHYEEQLVALFG 399          
BLAST of cAMP-dependent protein kinase type II regulatory subunit vs. Ensembl Xenopus
Match: fgf1 (fibroblast growth factor 1 [Source:Xenbase;Acc:XB-GENE-485966])

HSP 1 Score: 190.66 bits (483), Expect = 1.099e-56
Identity = 103/275 (37.45%), Postives = 166/275 (60.36%), Query Frame = 1
Query:  406 IYPKTPKQMDKITDILETIFFFNCLDEIQFSKIIQSMFFIEVFKGDEIIKENDPGNNFYVIDYG---TFTASNKSKSIYEVYKGEGFFGELALLYNCPRSASVIADTDGGLWVIDRVTFRQLILKSAYQKRQRYLKFISSVPLLEDLTKYEQCNLADALKTKTI-NNEKVISQGDAGDKMYFIXXXXXXXXXXXXXXXXXXS-------RLKAGDYFGEVALLANIPRIANVYALGYTKLAELDAKSYTRLLGPCIDNMRKNFTKYRSQLEKLLS 1197
            + PKT +Q  ++ +  + I  F  LD+ Q S+++ +MF + V   + +I + D G+NFYV++ G    F   +        Y   G FGELAL+YN PR+A+++A ++G LW +DRVTFR++ILK+  +KR+ Y  FI SVP+L+ L   E+  + D +  +   + +++I+QGD  D  + +E GEV + +++  +  +ES       R K+G YFGE+AL+ N PR A+ YA+G  K   +D +++ RLLGPC+D M++N T Y  QL  L  
Sbjct:   19 VRPKTDEQRCRLQEACKDILLFKNLDQEQLSQVLDAMFEMRVKPQEHVIDQGDDGDNFYVVERGQYDIFVERDGQSRCVGRYDNHGSFGELALMYNTPRAATIVATSEGALWGLDRVTFRRIILKNNAKKRKTYEIFIESVPVLKFLELSERMKIVDVIAARVYKDGDRIIAQGDKADCFFIVESGEVKIMMKSKTKTGQESNQEVEIARCKSGQYFGELALVTNKPRAASAYAVGDVKCLIMDVQAFERLLGPCMDIMKRNITHYEEQLVALFG 293          
BLAST of cAMP-dependent protein kinase type II regulatory subunit vs. Ensembl Mouse
Match: Prkar2a (protein kinase, cAMP dependent regulatory, type II alpha [Source:MGI Symbol;Acc:MGI:108025])

HSP 1 Score: 216.083 bits (549), Expect = 2.010e-65
Identity = 133/390 (34.10%), Postives = 214/390 (54.87%), Query Frame = 1
Query:   97 LTEVIEEFKKQVEIANPKDIIAYAATYFTKKVAQENESNDTEFDKSLDYDSSS--------EDGDSLKEIMSNDKSKMKLVQTSNVPRQSITCESFDPSSIDDETFEKN--RKIYPKTPKQMDKITDILETIFFFNCLDEIQFSKIIQSMFFIEVFKGDEIIKENDPGNNFYVIDYGTF----TASNKSKSIYEVYKGEGFFGELALLYNCPRSASVIADTDGGLWVIDRVTFRQLILKSAYQKRQRYLKFISSVPLLEDLTKYEQCNLADALKTKTI-NNEKVISQGDAGDKMYFIXX--------XXXXXXXXXXXXXXXXSRLKAGDYFGEVALLANIPRIANVYALGYTKLAELDAKSYTRLLGPCIDNMRKNFTKYRSQLEKLLS 1197
            LTE+++ +  +V    P D++ +A  YFT+      + +DT       + +          EDG+S  +  S D      V +    R S+  E+F+P    DE  E N  R ++PKT +Q  ++ +  + I  F  LD+ Q S+++ +MF   V   + +I + D G+NFYVI+ GT+    T  N+++S+ + Y   G FGELAL+YN PR+A++IA ++G LW +DRVTFR++I+K+  +KR+ +  FI SVPL + L   E+  + D +  K   + E++I+QG+  D  Y IE          +       G +E E +    G YFGE+AL+ N PR A+ YA+G  K   +D +++ RLLGPC+D M++N + Y  QL K+  
Sbjct:   10 LTELLQGYTVEVLRQQPPDLVDFAVEYFTRLREARRQESDTFIVSPTTFHTQESSAVPVIEEDGESDSD--SEDADLEVPVPSKFTRRVSVCAETFNP----DEEEEDNDPRVVHPKTDEQRCRLQEACKDILLFKNLDQEQLSQVLDAMFEKIVKTDEHVIDQGDDGDNFYVIERGTYDILVTKDNQTRSVGQ-YDNRGSFGELALMYNTPRAATIIATSEGSLWGLDRVTFRRIIVKNNAKKRKMFESFIESVPLFKSLEMSERMKIVDVIGEKIYKDGERIIAQGEKADSFYIIESGEVSILIRSKTKSNKNGGNQEVEIAHCHKGQYFGELALVTNKPRAASAYAVGDVKCLVMDVQAFERLLGPCMDIMKRNISHYEEQLVKMFG 392          
BLAST of cAMP-dependent protein kinase type II regulatory subunit vs. Ensembl Mouse
Match: Prkar2a (protein kinase, cAMP dependent regulatory, type II alpha [Source:MGI Symbol;Acc:MGI:108025])

HSP 1 Score: 206.453 bits (524), Expect = 5.285e-62
Identity = 127/386 (32.90%), Postives = 208/386 (53.89%), Query Frame = 1
Query:   97 LTEVIEEFKKQVEIANPKDIIAYAATYFTKKVAQENESNDTEFDKSLDYDSSS--------EDGDSLKEIMSNDKSKMKLVQTSNVPRQSITCESFDPSSIDDETFEKN--RKIYPKTPKQMDKITDILETIFFFNCLDEIQFSKIIQSMFFIEVFKGDEIIKENDPGNNFYVIDYGTF----TASNKSKSIYEVYKGEGFFGELALLYNCPRSASVIADTDGGLWVIDRVTFRQLILKSAYQKRQRYLKFISSVPLLEDLTKYEQCNLADALKTKTI-NNEKVISQG----DAGDKMYFIXXXXXXXXXXXXXXXXXXSRLKAGDYFGEVALLANIPRIANVYALGYTKLAELDAKSYTRLLGPCIDNMRKNFTKYRSQLEKLLS 1197
            LTE+++ +  +V    P D++ +A  YFT+      + +DT       + +          EDG+S  +  S D      V +    R S+  E+F+P    DE  E N  R ++PKT +Q  ++ +  + I  F  LD+ Q S+++ +MF   V   + +I + D G+NFYVI+ GT+    T  N+++S+ + Y   G FGELAL+YN PR+A++IA ++G LW +DRVTFR++I+K+  +KR+ +  FI SVPL + L   E+  + D +  K   + E++I+Q     + G++   I                  +    G YFGE+AL+ N PR A+ YA+G  K   +D +++ RLLGPC+D M++N + Y  QL K+  
Sbjct:   10 LTELLQGYTVEVLRQQPPDLVDFAVEYFTRLREARRQESDTFIVSPTTFHTQESSAVPVIEEDGESDSD--SEDADLEVPVPSKFTRRVSVCAETFNP----DEEEEDNDPRVVHPKTDEQRCRLQEACKDILLFKNLDQEQLSQVLDAMFEKIVKTDEHVIDQGDDGDNFYVIERGTYDILVTKDNQTRSVGQ-YDNRGSFGELALMYNTPRAATIIATSEGSLWGLDRVTFRRIIVKNNAKKRKMFESFIESVPLFKSLEMSERMKIVDVIGEKIYKDGERIIAQTKSNKNGGNQEVEI------------------AHCHKGQYFGELALVTNKPRAASAYAVGDVKCLVMDVQAFERLLGPCMDIMKRNISHYEEQLVKMFG 370          
BLAST of cAMP-dependent protein kinase type II regulatory subunit vs. Ensembl Mouse
Match: Prkar2b (protein kinase, cAMP dependent regulatory, type II beta [Source:MGI Symbol;Acc:MGI:97760])

HSP 1 Score: 206.453 bits (524), Expect = 1.396e-61
Identity = 128/401 (31.92%), Postives = 206/401 (51.37%), Query Frame = 1
Query:   97 LTEVIEEFKKQVEIANPKDIIAYAATYFTKKVAQENESNDT-----------EFDKSLDYDSSSEDGDSLKEIMSNDKSKMKL------------VQTSNVPRQSITCESFDPSSIDDETFEKNRKIYPKTPKQMDKITDILETIFFFNCLDEIQFSKIIQSMFFIEVFKGDEIIKENDPGNNFYVIDYGTFTASNKSKSIYEV---YKGEGFFGELALLYNCPRSASVIADTDGGLWVIDRVTFRQLILKSAYQKRQRYLKFISSVPLLEDLTKYEQCNLADALKTKTINN-EKVISQGDAGDKMYF-------IXXXXXXXXXXXXXXXXXXSRLKAGDYFGEVALLANIPRIANVYALGYTKLAELDAKSYTRLLGPCIDNMRKNFTKYRSQLEKLLS 1197
            LTE+++ F  +V    P D++ +A  +FT+ + QENE               +   +      S+  +  +E M +D    +             V      R S+  E+++P   +D+   ++R I+PKT  Q +++ +  + I  F  LD  Q S+++ +MF   V +G+ +I + D G+NFYVID GTF    K   +      Y   G FGELAL+YN PR+A++ A + G LW +DRVTFR++I+K+  +KR+ Y  FI S+P L+ L   E+  + D + TK  N+ E++I+QGD  D  +        I       +        E +R   G YFGE+AL+ N PR A+ +A+G  K   +D +++ RLLGPC++ M++N   Y  QL  L  
Sbjct:    9 LTELLQGFTVEVLRHQPADLLEFALQHFTR-LQQENERKGAARFGHEGRTWGDAGAAAGGGIPSKGVNFAEEPMRSDSENGEEEEAAEAGAFNAPVINRFTRRASVCAEAYNPDEEEDDA--ESRIIHPKTDDQRNRLQEACKDILLFKNLDPEQMSQVLDAMFEKLVKEGEHVIDQGDDGDNFYVIDRGTFDIYVKCDGVGRCVGNYDNRGSFGELALMYNTPRAATITATSPGALWGLDRVTFRRIIVKNNAKKRKMYESFIESLPFLKSLEVSERLKVVDVIGTKVYNDGEQIIAQGDLADSFFIVESGEVKITMKRKGKSEVEENGAVEIARCFRGQYFGELALVTNKPRAASAHAIGTVKCLAMDVQAFERLLGPCMEIMKRNIATYEEQLVALFG 406          
BLAST of cAMP-dependent protein kinase type II regulatory subunit vs. Ensembl Mouse
Match: Prkar2b (protein kinase, cAMP dependent regulatory, type II beta [Source:MGI Symbol;Acc:MGI:97760])

HSP 1 Score: 206.453 bits (524), Expect = 1.396e-61
Identity = 128/401 (31.92%), Postives = 206/401 (51.37%), Query Frame = 1
Query:   97 LTEVIEEFKKQVEIANPKDIIAYAATYFTKKVAQENESNDT-----------EFDKSLDYDSSSEDGDSLKEIMSNDKSKMKL------------VQTSNVPRQSITCESFDPSSIDDETFEKNRKIYPKTPKQMDKITDILETIFFFNCLDEIQFSKIIQSMFFIEVFKGDEIIKENDPGNNFYVIDYGTFTASNKSKSIYEV---YKGEGFFGELALLYNCPRSASVIADTDGGLWVIDRVTFRQLILKSAYQKRQRYLKFISSVPLLEDLTKYEQCNLADALKTKTINN-EKVISQGDAGDKMYF-------IXXXXXXXXXXXXXXXXXXSRLKAGDYFGEVALLANIPRIANVYALGYTKLAELDAKSYTRLLGPCIDNMRKNFTKYRSQLEKLLS 1197
            LTE+++ F  +V    P D++ +A  +FT+ + QENE               +   +      S+  +  +E M +D    +             V      R S+  E+++P   +D+   ++R I+PKT  Q +++ +  + I  F  LD  Q S+++ +MF   V +G+ +I + D G+NFYVID GTF    K   +      Y   G FGELAL+YN PR+A++ A + G LW +DRVTFR++I+K+  +KR+ Y  FI S+P L+ L   E+  + D + TK  N+ E++I+QGD  D  +        I       +        E +R   G YFGE+AL+ N PR A+ +A+G  K   +D +++ RLLGPC++ M++N   Y  QL  L  
Sbjct:    9 LTELLQGFTVEVLRHQPADLLEFALQHFTR-LQQENERKGAARFGHEGRTWGDAGAAAGGGIPSKGVNFAEEPMRSDSENGEEEEAAEAGAFNAPVINRFTRRASVCAEAYNPDEEEDDA--ESRIIHPKTDDQRNRLQEACKDILLFKNLDPEQMSQVLDAMFEKLVKEGEHVIDQGDDGDNFYVIDRGTFDIYVKCDGVGRCVGNYDNRGSFGELALMYNTPRAATITATSPGALWGLDRVTFRRIIVKNNAKKRKMYESFIESLPFLKSLEVSERLKVVDVIGTKVYNDGEQIIAQGDLADSFFIVESGEVKITMKRKGKSEVEENGAVEIARCFRGQYFGELALVTNKPRAASAHAIGTVKCLAMDVQAFERLLGPCMEIMKRNIATYEEQLVALFG 406          
BLAST of cAMP-dependent protein kinase type II regulatory subunit vs. Ensembl Mouse
Match: Prkar1b (protein kinase, cAMP dependent regulatory, type I beta [Source:MGI Symbol;Acc:MGI:97759])

HSP 1 Score: 180.259 bits (456), Expect = 4.659e-52
Identity = 123/376 (32.71%), Postives = 194/376 (51.60%), Query Frame = 1
Query:   58 NCNMNNQNYSKKILTEVIEEFKKQVEIANPKDIIAYAATYFTKKVAQENESNDTEFDKSLDYDSSSEDGDSLKEIMSNDKSKMKLVQTSNVPRQSITCESFDPSSIDDETFEKNRKIYPKTPKQMDKITDILETIFFFNCLDEIQFSKIIQSMFFIEVFKGDEIIKENDPGNNFYVIDYGTFTASNKSKSIYEVYKGEGFFGELALLYNCPRSASVIADTDGGLWVIDRVTFRQLILKSAYQKRQRYLKFISSVPLLEDLTKYEQCNLADALKTKTI-NNEKVISQGDAGDKMYFIXXXXXXXXXXXXXXX--XXXSRLKAGDYFGEVALLANIPRIANVYALGYTKLAELDAKSYTRLLGPCIDNMRKNFTKYRS 1176
             C M  Q +    + +V++E    + +A P   + +   +F K   +EN        + L    S+   DS  E +S   +    V  +   R  ++ E +     +++     RK+ PK  K M  +   +     F+ LD+ + S I  +MF +    G+ +I++ + G+NFYVID G        + +  + +G G FGELAL+Y  PR+A+V A TD  LW IDR ++R++++ S  +KR+ Y +F+S V +LE L K+E+  +ADAL+     + EK++ QG+ GD  Y I EG   V  R    E   E  RL   DYFGE+ALL N PR A V A G  K  +LD   + R+LGPC + +++N  +Y S
Sbjct:   17 GCEMYVQKHG---IQQVLKECIVHLCVAKPDRPLRFLREHFEKLEKEENR-------QILARQKSNSQCDSHDEEIS--PTPPNPVVKARRRRGGVSAEVY----TEEDAVSYVRKVIPKDYKTMTALAKAISKNVLFSHLDDNERSDIFDAMFPVTHIGGETVIQQGNEGDNFYVIDQGEVDVYVNGEWVTNISEG-GSFGELALIYGTPRAATVKAKTDLKLWGIDRDSYRRILMGSTLRKRKMYEEFLSKVSILESLEKWERLTVADALEPVQFEDGEKIVVQGEPGDDFYIITEGTASVLQRRSPNEEYVEVGRLGPSDYFGEIALLLNRPRAATVVARGPLKCVKLDRPRFERVLGPCSEILKRNIQRYNS 375          
BLAST of cAMP-dependent protein kinase type II regulatory subunit vs. UniProt/SwissProt
Match: sp|P81900|KAPR2_DROME (cAMP-dependent protein kinase type II regulatory subunit OS=Drosophila melanogaster OX=7227 GN=Pka-R2 PE=1 SV=2)

HSP 1 Score: 258.07 bits (658), Expect = 3.856e-81
Identity = 148/369 (40.11%), Postives = 226/369 (61.25%), Query Frame = 1
Query:   97 LTEVIEEFKKQVEIANPKDIIAYAATYFTKKVAQENESNDTEFDKSLDYDSSSEDGDSLKEIMSNDKSKMKLVQTSNVPRQSITCESFDPSSIDDETFEKNRKIYPKTPKQMDKITDILETIFFFNCLDEIQFSKIIQSMFFIEVFKGDEIIKENDPGNNFYVIDYGTFTASNKSKSIYEVYKGEGFFGELALLYNCPRSASVIADTDGGLWVIDRVTFRQLILKSAYQKRQRYLKFISSVPLLEDLTKYEQCNLADALKTKTINN-EKVISQGDAGDKMYFIXXXXXXXXXXXXXXXXXXSRLKAGDYFGEVALLANIPRIANVYAL-GYTKLAELDAKSYTRLLGPCIDNMRKNFTKYRSQLEKLLS 1197
            L EV+ +F     +  P D+I YA  YFTK  ++    + T+         +S+D D+   +M++ +            R+S+  E++DP +   +  +    ++PKT +Q  ++ + ++ +  F  L++ Q ++++ +MF  +V  GD II++ D G+NFYVI+ G +      K I   Y   G FGELALLYN PR+A+V A+T G LW +DR TFR+++LKSA++KR+ Y + ++SVP+L+ L  YE+ NLADAL +K+ +N E++I QGDA D MYFIEEG V V +   + E E S+L  G YFGE+AL+ + PR A+VYA  G  KLA LD K++ RLLGPC+D M++N   Y SQL K+  
Sbjct:   15 LKEVLLQFSISFLVEQPPDVIDYAVEYFTKLQSERPSVSHTDQSTDDQLSVNSQDADAEPPVMASSR------------RKSVFAEAYDPEAD--DDDDGATAVFPKTDEQRARLVESVKNVLLFRSLEKEQMNQVLDAMFERKVQPGDFIIRQGDDGDNFYVIESGVYKVYINDKHI-NTYNHTGLFGELALLYNMPRAATVQAETSGLLWAMDRQTFRRILLKSAFRKRKMYEELLNSVPMLKALQNYERMNLADALVSKSYDNGERIIKQGDAADGMYFIEEGTVSVRMDQDDAEVEISQLGKGQYFGELALVTHRPRAASVYATGGVVKLAFLDVKAFERLLGPCMDIMKRNIDDYESQLVKIFG 368          
BLAST of cAMP-dependent protein kinase type II regulatory subunit vs. UniProt/SwissProt
Match: sp|Q26619|KAPR_STRPU (cAMP-dependent protein kinase type II regulatory subunit OS=Strongylocentrotus purpuratus OX=7668 PE=2 SV=1)

HSP 1 Score: 221.09 bits (562), Expect = 6.834e-67
Identity = 137/377 (36.34%), Postives = 216/377 (57.29%), Query Frame = 1
Query:   97 LTEVIEEFKKQVEIANPKDIIAYAATYFTKKVAQENESNDTEFDKSLDYDSSSEDGDSLKEIMSNDKSKMKLVQTSNVPRQSITCESFDPSSIDDETFEKNRKIYPKTPKQMDKITDILETIFFFNCLDEIQFSKIIQSMFFIEVFKGDEIIKENDPGNNFYVID---YGTFTASNKSKSIYEVYKGEGFFGELALLYNCPRSASVIADTDGGLWVIDRVTFRQLILKSAYQKRQRYLKFISSVPLLEDLTKYEQCNLADALKTKTI-NNEKVISQGDAGDKMYFIXXXXXXXXXXXXXXXXXXSRLKA-----GDYFGEVALLANIPRIANVYALGYTKLAELDAKSYTRLLGPCIDNMRKNFTKYRSQLEKLLSR 1200
            LT+++++F   V    P D++ +A++YF K   QEN  N +   K     ++ ED +S       D    +L +     R+S+  E +DP + +D   +K   +YPK+ +Q  ++T+ ++ I  F  LDE Q  ++I +MF  +   GD +I + D G+NFYVID   Y  F   NK  +    YK  G FGELAL+YN PR+A++ A TDG LW +DRV+FR+++LK+A +KR+ Y + +  V + + L  YE+ NLADAL T+T  + + +I+QGD  D  YFIE G+  + +++   +  +   +      G YFGE+ALL N PR A+VYA+       LD  ++ RLLGPC+D M++N   Y  +  +L  +
Sbjct:    9 LTDLLQDFTVAVLREKPSDLVEFASSYFAK--LQEN--NISLGGKRGVTFTAPEDAES-----DIDDEPPELPKNRYARRKSVCAEKYDPEADNDTDTQK--LVYPKSDEQRARLTEAVKNILLFRALDEKQMQEVIDAMFEKKTTPGDHVIDQGDDGDNFYVIDRGEYDIFVNDNKVGA----YKDSGSFGELALMYNTPRAATIAATTDGILWALDRVSFRRIVLKNAAKKRRIYEELLEKVSIFKSLEPYERMNLADALVTRTYEDGDCIIAQGDGADGCYFIEAGQCRIAMKSERSDNPDEEKEVAIYNQGQYFGELALLTNKPRAASVYAVEDVDCL-LDVNAFERLLGPCMDIMKRNIEHYEQETSRLFGK 369          
BLAST of cAMP-dependent protein kinase type II regulatory subunit vs. UniProt/SwissProt
Match: sp|P00515|KAP2_BOVIN (cAMP-dependent protein kinase type II-alpha regulatory subunit OS=Bos taurus OX=9913 GN=PRKAR2A PE=1 SV=2)

HSP 1 Score: 215.698 bits (548), Expect = 1.786e-64
Identity = 132/385 (34.29%), Postives = 221/385 (57.40%), Query Frame = 1
Query:   97 LTEVIEEFKKQVEIANPKDIIAYAATYFTK-KVAQENESNDTEFDKSLDYDSSSEDG---DSLKEIMSNDKSKMKLVQTSNVPRQ-SITCESFDPSSIDDETFEKNRKIYPKTPKQMDKITDILETIFFFNCLDEIQFSKIIQSMFFIEVFKGDEIIKENDPGNNFYVIDYGTF----TASNKSKSIYEVYKGEGFFGELALLYNCPRSASVIADTDGGLWVIDRVTFRQLILKSAYQKRQRYLKFISSVPLLEDLTKYEQCNLADALKTKTI-NNEKVISQGDAGDKMYFIXXXXXXXXXXXXX--------XXXXXSRLKAGDYFGEVALLANIPRIANVYALGYTKLAELDAKSYTRLLGPCIDNMRKNFTKYRSQLEKLLS 1197
            LTE+++ +  +V    P D++ +A  YFT+ + A+   S       S   D     G   D++ +  S D+  + +       R+ S+  E+++P   +++T    R I+PKT +Q  ++ +  + I  F  LD  Q S+++ +MF   V   + +I + D G+NFYVI+ GT+    T  N+++S+ + Y   G FGELAL+YN PR+A+++A ++G LW +DRVTFR++I+K+  +KR+ +  FI SVPLL+ L   E+  + D +  K   + E++I+QG+  D  Y IE GEV + +++          +E E +R   G YFGE+AL+ N PR A+ YA+G  K   +D +++ RLLGPC+D M++N + Y  QL K+  
Sbjct:   10 LTELLQGYTVEVLRQRPPDLVDFAVDYFTRLREARSRASTPPAAPPSGSQDFDPGAGLVADAVADSESEDEEDLDVPIPGRFDRRVSVCAETYNPDEEEEDT--DPRVIHPKTDQQRCRLQEACKDILLFKNLDPEQLSQVLDAMFERTVKVDEHVIDQGDDGDNFYVIERGTYDILVTKDNQTRSVGQ-YDNHGSFGELALMYNTPRAATIVATSEGSLWGLDRVTFRRIIVKNNAKKRKMFESFIESVPLLKSLEVSERMKIVDVIGEKVYKDGERIITQGEKADSFYIIESGEVSILIKSKTKVNKDGENQEVEIARCHKGQYFGELALVTNKPRAASAYAVGDVKCLVMDVQAFERLLGPCMDIMKRNISHYEEQLVKMFG 391          
BLAST of cAMP-dependent protein kinase type II regulatory subunit vs. UniProt/SwissProt
Match: sp|P31323|KAP3_HUMAN (cAMP-dependent protein kinase type II-beta regulatory subunit OS=Homo sapiens OX=9606 GN=PRKAR2B PE=1 SV=3)

HSP 1 Score: 214.157 bits (544), Expect = 1.256e-63
Identity = 130/403 (32.26%), Postives = 211/403 (52.36%), Query Frame = 1
Query:   97 LTEVIEEFKKQVEIANPKDIIAYAATYFTKKVAQENESNDT-----------EFDKSLDYDSSSEDGDSLKEIMSNDKSKMKLVQTS-------NVP-------RQSITCESFDPSSIDDETFEKNRKIYPKTPKQMDKITDILETIFFFNCLDEIQFSKIIQSMFFIEVFKGDEIIKENDPGNNFYVIDYGTFTASNKSKSIYEV---YKGEGFFGELALLYNCPRSASVIADTDGGLWVIDRVTFRQLILKSAYQKRQRYLKFISSVPLLEDLTKYEQCNLADALKTKTINN-EKVISQGDAGDKMYF-------IXXXXXXXXXXXXXXXXXXSRLKAGDYFGEVALLANIPRIANVYALGYTKLAELDAKSYTRLLGPCIDNMRKNFTKYRSQLEKLLS 1197
            LTE+++ F  +V    P D++ +A  +FT+ + QENE   T           +   +    + S+  +  +E M +D    +  + +       N P       R S+  E+++P   +D+   ++R I+PKT  Q +++ +  + I  F  LD  Q S+++ +MF   V  G+ +I + D G+NFYVID GTF    K   +      Y   G FGELAL+YN PR+A++ A + G LW +DRVTFR++I+K+  +KR+ Y  FI S+P L+ L   E+  + D + TK  N+ E++I+QGD+ D  +        I       +        E +R   G YFGE+AL+ N PR A+ +A+G  K   +D +++ RLLGPC++ M++N   Y  QL  L  
Sbjct:    9 LTELLQGFTVEVLRHQPADLLEFALQHFTR-LQQENERKGTARFGHEGRTWGDLGAAAGGGTPSKGVNFAEEPMQSDSEDGEEEEAAPADAGAFNAPVINRFTRRASVCAEAYNPDEEEDDA--ESRIIHPKTDDQRNRLQEACKDILLFKNLDPEQMSQVLDAMFEKLVKDGEHVIDQGDDGDNFYVIDRGTFDIYVKCDGVGRCVGNYDNRGSFGELALMYNTPRAATITATSPGALWGLDRVTFRRIIVKNNAKKRKMYESFIESLPFLKSLEFSERLKVVDVIGTKVYNDGEQIIAQGDSADSFFIVESGEVKITMKRKGKSEVEENGAVEIARCSRGQYFGELALVTNKPRAASAHAIGTVKCLAMDVQAFERLLGPCMEIMKRNIATYEEQLVALFG 408          
BLAST of cAMP-dependent protein kinase type II regulatory subunit vs. UniProt/SwissProt
Match: sp|P13861|KAP2_HUMAN (cAMP-dependent protein kinase type II-alpha regulatory subunit OS=Homo sapiens OX=9606 GN=PRKAR2A PE=1 SV=2)

HSP 1 Score: 213.386 bits (542), Expect = 1.534e-63
Identity = 134/389 (34.45%), Postives = 223/389 (57.33%), Query Frame = 1
Query:   97 LTEVIEEFKKQVEIANPKDIIAYAATYFTK-KVAQENES--NDTEFDKSLDYDSSSEDGDSLKEIMSNDKSKMKLVQTSNVP-----RQSITCESFDPSSIDDETFEKNRKIYPKTPKQMDKITDILETIFFFNCLDEIQFSKIIQSMFFIEVFKGDE-IIKENDPGNNFYVIDYGTF----TASNKSKSIYEVYKGEGFFGELALLYNCPRSASVIADTDGGLWVIDRVTFRQLILKSAYQKRQRYLKFISSVPLLEDLTKYEQCNLADALKTKTI-NNEKVISQGDAGDKMYFIXXXXXXXXXXXXXXX--------XXXSRLKAGDYFGEVALLANIPRIANVYALGYTKLAELDAKSYTRLLGPCIDNMRKNFTKYRSQLEKLLS 1197
            LTE+++ +  +V    P D++ +A  YFT+ + A+   S        +SL +       D + +   + +S+        VP     R S+  E+++P   +++T    R I+PKT +Q  ++ +  + I  F  LD+ Q S+++ +MF   + K DE +I + D G+NFYVI+ GT+    T  N+++S+ + Y   G FGELAL+YN PR+A+++A ++G LW +DRVTFR++I+K+  +KR+ +  FI SVPLL+ L   E+  + D +  K   + E++I+QG+  D  Y IE GEV + +R+  +          E +R   G YFGE+AL+ N PR A+ YA+G  K   +D +++ RLLGPC+D M++N + Y  QL K+  
Sbjct:   10 LTELLQGYTVEVLRQQPPDLVEFAVEYFTRLREARAPASVLPAATPRQSLGHPPPEPGPDRVADAKGDSESEEDEDLEVPVPSRFNRRVSVCAETYNPDEEEEDT--DPRVIHPKTDEQRCRLQEACKDILLFKNLDQEQLSQVLDAMFE-RIVKADEHVIDQGDDGDNFYVIERGTYDILVTKDNQTRSVGQ-YDNRGSFGELALMYNTPRAATIVATSEGSLWGLDRVTFRRIIVKNNAKKRKMFESFIESVPLLKSLEVSERMKIVDVIGEKIYKDGERIITQGEKADSFYIIESGEVSILIRSRTKSNKDGGNQEVEIARCHKGQYFGELALVTNKPRAASAYAVGDVKCLVMDVQAFERLLGPCMDIMKRNISHYEEQLVKMFG 394          
BLAST of cAMP-dependent protein kinase type II regulatory subunit vs. TrEMBL
Match: A0A3Q0KLT7 (Putative camp-dependent protein kinase type II regulatory subunit OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 262.692 bits (670), Expect = 1.204e-80
Identity = 137/297 (46.13%), Postives = 201/297 (67.68%), Query Frame = 1
Query:  334 RQSITCESFDPSSIDDETFEKNRKIYPKTPKQMDKITDILETIFFFNCLDEIQFSKIIQSMFFIEVFKGDEIIKENDPGNNFYVIDYGTF------TASNKSKSIYEV--YKGEGFFGELALLYNCPRSASVIADTDGGLWVIDRVTFRQLILKSAYQKRQRYLKFISSVPLLEDLTKYEQCNLADALKTKTI-NNEKVISQGDAGDKMYFIXXXXXXXXXXXXXXXXXXSRLKAGDYFGEVALLANIPRIANVYALGYTKLAELDAKSYTRLLGPCIDNMRKNFTKYRSQLEKLLS 1197
            RQS+  ESFDP    D+  E+ R+IYPK+  Q  ++T+ ++ I  F CLDE Q SK+I +M  ++V +GD +IK+ D G+NFYVI+ GT+        SN  K   +V  Y G+G FGELAL+YN  R+AS+IA T+G LW++DR TFR+++LK+A+ KRQ Y++ +  +PLL++L+ YE+ N+ADAL+++   +   +ISQG+ G +M+ IE G V ++V+   +E E SRL  G YFGE+AL+   PR A+ YA+G TKLA LD  S+ RL+GPC+  M++N   Y  QL +LL 
Sbjct:   54 RQSVAAESFDPEKDSDDNNEEERRIYPKSDSQRSRLTNAVKEILLFRCLDEEQKSKVIDAMQEMKVKEGDVVIKQGDDGDNFYVIESGTYDIYVKQNQSNDEKLGEKVGSYNGQGSFGELALMYNTSRAASIIATTNGILWLMDRNTFRRIVLKAAFHKRQTYVELLEDIPLLKELSSYERTNVADALQSRIYQDGATIISQGETGKEMFIIESGTVRISVKENSKEVELSRLGKGAYFGELALITKRPRAASAYAVGETKLAVLDVASFERLMGPCLKVMQRNIDTYEKQLSELLG 350          
BLAST of cAMP-dependent protein kinase type II regulatory subunit vs. TrEMBL
Match: A0A095C9J6 (cAMP-dependent protein kinase type II regulatory subunit (Fragment) OS=Schistosoma haematobium OX=6185 GN=MS3_07384 PE=4 SV=1)

HSP 1 Score: 261.151 bits (666), Expect = 2.208e-80
Identity = 134/303 (44.22%), Postives = 200/303 (66.01%), Query Frame = 1
Query:  316 QTSNVPRQSITCESFDPSSIDDETFEKNRKIYPKTPKQMDKITDILETIFFFNCLDEIQFSKIIQSMFFIEVFKGDEIIKENDPGNNFYVIDYGTFTASNKSKSIYE--------VYKGEGFFGELALLYNCPRSASVIADTDGGLWVIDRVTFRQLILKSAYQKRQRYLKFISSVPLLEDLTKYEQCNLADALKTKTI-NNEKVISQGDAGDKMYFIXXXXXXXXXXXXXXXXXXSRLKAGDYFGEVALLANIPRIANVYALGYTKLAELDAKSYTRLLGPCIDNMRKNFTKYRSQLEKLLS 1197
            + S + RQS+  ESFDP    D+  E+ R+IYPK+  Q  ++T+ ++ I  F CLDE Q S++I +M  ++V +GD +IK+ D G+NFYVI+ GT+    K     E         Y G G FGELAL+YN  R+AS+IA TDG LW++DR TFR+++LK+A+ KRQ Y++ +  +PLL++L+ YE+ N+ADAL+++   +   +ISQG+ G +M+ I+ G V ++V+   +E E SR+  G YFGE+AL+   PR A+ YA+G TKLA LD  S+ RL+GPC+  M++N   Y  QL +LL 
Sbjct:   34 RNSLLRRQSVAAESFDPEKDSDDNNEEERQIYPKSDSQRARLTNAVKEILLFRCLDEEQKSRVIDAMQEMKVKEGDVVIKQGDDGDNFYVIESGTYDIYVKQNQSTEEKIGEKVGSYNGHGSFGELALMYNTSRAASIIATTDGILWLMDRNTFRRIVLKAAFHKRQTYVELLEDIPLLKELSSYERTNVADALQSRVYQDGSTIISQGETGKEMFIIQSGTVRISVKENSKEVELSRVGKGAYFGELALITKRPRAASAYAVGETKLAVLDVASFERLMGPCLKVMQRNIDTYEKQLTELLG 336          
BLAST of cAMP-dependent protein kinase type II regulatory subunit vs. TrEMBL
Match: A0A3B0IZR1 (Blast:cAMP-dependent protein kinase type II regulatory subunit OS=Drosophila guanche OX=7266 GN=DGUA_6G001143 PE=4 SV=1)

HSP 1 Score: 259.61 bits (662), Expect = 3.510e-79
Identity = 150/369 (40.65%), Postives = 226/369 (61.25%), Query Frame = 1
Query:   97 LTEVIEEFKKQVEIANPKDIIAYAATYFTKKVAQENESNDTEFDKSLDYDSSSEDGDSLKEIMSNDKSKMKLVQTSNVPRQSITCESFDPSSIDDETFEKNRKIYPKTPKQMDKITDILETIFFFNCLDEIQFSKIIQSMFFIEVFKGDEIIKENDPGNNFYVIDYGTFTASNKSKSIYEVYKGEGFFGELALLYNCPRSASVIADTDGGLWVIDRVTFRQLILKSAYQKRQRYLKFISSVPLLEDLTKYEQCNLADALKTKTI-NNEKVISQGDAGDKMYFIXXXXXXXXXXXXXXXXXXSRLKAGDYFGEVALLANIPRIANVYAL-GYTKLAELDAKSYTRLLGPCIDNMRKNFTKYRSQLEKLLS 1197
            L EV+ +F     +  P D+I YAA YF K  A      + +  +      +S+DG+    +M N +            R+S+  E++DP + DD+  E    I+PKT +Q  ++ + ++ +  F  L++ Q ++++ +MF  +V  GD II++ D G+NFYVI+ G +      K I   Y   G FGELALLYN PR+A+V A+T+G LW +DR TFR+++LKSA++KR+ Y + +++VP+L+ L  YE+ NLADAL TK+    E++I QGDA D MYFIEEG V V +   + E E S+L  G YFGE+AL+ + PR A+VYA  G+ +LA LD +++ RLLGPC+D M++N   Y SQL K+  
Sbjct:   15 LKEVLLQFSIAYLVEQPPDVIDYAADYFNKLQANRPAPANQDQSQDDQQSINSQDGEE-PPVMQNSR------------RKSVFAEAYDPEADDDD--EGATAIFPKTDEQRSRLVESVKNVLLFRSLEKEQMNQVLDAMFERKVQPGDYIIRQGDDGDNFYVIESGIYKVYINDKHI-NTYNHTGLFGELALLYNMPRAATVQAETNGLLWAMDRQTFRRILLKSAFKKRKMYEELLNNVPMLKALQNYERMNLADALITKSFEGGERIIKQGDAADGMYFIEEGTVSVRMDQDDAEVEISQLGKGQYFGELALVTHRPRAASVYATGGHVRLAFLDVRAFERLLGPCMDIMKRNIDDYESQLVKIFG 367          
BLAST of cAMP-dependent protein kinase type II regulatory subunit vs. TrEMBL
Match: T1E240 (Putative camp-dependent protein kinase r2 OS=Psorophora albipes OX=869069 PE=2 SV=1)

HSP 1 Score: 259.61 bits (662), Expect = 3.806e-79
Identity = 152/370 (41.08%), Postives = 228/370 (61.62%), Query Frame = 1
Query:   97 LTEVIEEFKKQVEIANPKDIIAYAATYFTKKVAQENESNDTEFDKSLDYDSSSEDGDSLKEIMSNDKSKMKLVQTSNVPRQSITCESFDPSSIDDETFEKNRKIYPKTPKQMDKITDILETIFFFNCLDEIQFSKIIQSMFFIEVFKGDEIIKENDPGNNFYVIDYGTFTA--SNKSKSIYEVYKGEGFFGELALLYNCPRSASVIADTDGGLWVIDRVTFRQLILKSAYQKRQRYLKFISSVPLLEDLTKYEQCNLADALKTKTIN-NEKVISQGDAGDKMYFIXXXXXXXXXXXXXXXXXXSRLKAGDYFGEVALLANIPRIANVYALGYTKLAELDAKSYTRLLGPCIDNMRKNFTKYRSQLEKLLS 1197
            L +V+ EF     +  P D+I YA  +F+K   QEN  N           +++E     + IMS+++    LV      R+S+  E++DP +   +  +  R I+PKT +Q  ++ D ++ I  F  LD+ Q ++++ +MF  +V  GD IIK+ D G+NFYVI+ G + A      K I+  Y G G FGELALLYN PR+A++ A+TDG LW +DR TFR+++LKSA++KR+ Y   + +VP+L+ L  YE+ NLADAL  KT +  +++I QGDA D MYFIE+G V + ++    E E SRL+ G YFGE+AL+ + PR A+ YA+G  K+A LD  ++ RLLGPC++ M++N   Y SQL K+  
Sbjct:   15 LRDVLLEFSIAYLLEQPGDVIDYAVEFFSK--LQENRKNTM--------ITAAEPTSPDESIMSHEEEP--LVNRYASRRKSVFAETYDPEAD--DDDDGARAIFPKTDEQRARLCDSVKNILLFRSLDKEQMNEVLDAMFEKKVKAGDYIIKQGDDGDNFYVIESGVYKAYVGEDLKHIH-TYNGSGSFGELALLYNMPRAATIQAETDGQLWAMDRQTFRRILLKSAFRKRKMYEALLDAVPMLKTLQNYERMNLADALIPKTYSVGDRIIKQGDAADGMYFIEDGTVSIRIQQDAGEVEISRLEKGQYFGELALVTHRPRAASAYAVGTVKVAFLDVDAFERLLGPCMEIMKRNIDDYESQLVKIFG 369          
BLAST of cAMP-dependent protein kinase type II regulatory subunit vs. TrEMBL
Match: A0A4Z2CNG3 (cAMP-dependent protein kinase type II regulatory subunit isoform 2 OS=Schistosoma japonicum OX=6182 GN=EWB00_008963 PE=4 SV=1)

HSP 1 Score: 258.07 bits (658), Expect = 7.360e-79
Identity = 133/301 (44.19%), Postives = 201/301 (66.78%), Query Frame = 1
Query:  334 RQSITCESFDPSSIDDETFEKNRKIYPKTPKQMDKITDILETIFFFNCLDEIQFSKIIQSMFFIEVFKGDEIIKENDPGNNFYVIDYGTF--------TASNKSKSIYEVYKGEGFFGELALLYNCPRSASVIADTDGGLWVIDRVTFRQLILKSAYQKRQRYLKFISSVPLLEDLTKYEQCNLADALKTKTI-NNEKVISQGDAGDKMYFIXXXXXXXXXXXXXXXXXXSRLKAGDYFGEVALLANIPRIANVYALGYTKLAELDAKSYTRLLGPCIDNMRKNFTKYRSQLEKLLS--RH 1203
            RQS+  ESFDP    D+  E+ R+IYPK+  Q  ++T+ ++ I  F CLDE Q SK+I +M  ++V +GD +I + D G+NFYVI+ GT+        +++ K       Y G+G FGELAL+YN  R+AS++A TDG LW++DR TFR+++LK+A+ KRQ Y++ +  +PLL++L+ YE+ N+ADAL+++   +   +I+QG+ G +M+ IE G V ++V+   EE E SR+  G YFGE+AL+   PR A+ YA+G TK+A LD  S+ RL+GPC+  M++N   Y  QL +LL   RH
Sbjct:   54 RQSVAAESFDPEKDSDDNNEEERQIYPKSDSQRARLTNAVKEILLFRCLDEEQKSKVIDAMQEMKVKQGDVVITQGDDGDNFYVIESGTYDIYVRQNQSSNEKLGEKVGSYNGQGSFGELALMYNTSRAASIVAATDGILWLMDRNTFRRIVLKAAFHKRQAYIELLEDIPLLKELSSYERTNVADALQSRVYQDGATIITQGETGKEMFIIESGTVRISVKENSEEVELSRVGKGAYFGELALITKRPRAASAYAVGQTKVAVLDVASFERLMGPCLKVMQRNIDTYEKQLNELLGTDRH 354          
BLAST of cAMP-dependent protein kinase type II regulatory subunit vs. Ensembl Cavefish
Match: si:ch211-272n13.7 (protein kinase cAMP-dependent type II regulatory subunit beta [Source:NCBI gene;Acc:103029925])

HSP 1 Score: 215.312 bits (547), Expect = 3.002e-65
Identity = 138/398 (34.67%), Postives = 218/398 (54.77%), Query Frame = 1
Query:   97 LTEVIEEFKKQVEIANPKDIIAYAATYFTKKVAQENESNDTEFDKSLDYDSSSEDGDS---LKEIMSNDKSK----------MKLVQTSNVPRQSITCESFDPSSIDDETFEKNRKIYPKTPKQMDKITDILETIFFFNCLDEIQFSKIIQSMFFIEVFKGDEIIKENDPGNNFYVIDYGTF---TASNKSKSIYEVYKGEGFFGELALLYNCPRSASVIADTDGGLWVIDRVTFRQLILKSAYQKRQRYLKFISSVPLLEDLTKYEQCNLADALKTKTIN-NEKVISQGDAGDKMYF-------IXXXXXXXXXXXXXXXXXXSRLKAGDYFGEVALLANIPRIANVYALGYTKLAELDAKSYTRLLGPCIDNMRKNFTKYRSQLEKLL-SRHQLEE 1215
            LTE+++ F  +V    P+D++ +A  YFT+   +ENES    F    + +S+   G +   ++E M  D             +  V    + R S+  E+F+P   DDE  E  R  +PKT +Q  ++ +  + I  F  LD+ Q S+++ +MF   V  G+ II ++D G+NFYVI+ GTF     S+ +      Y   G FGELAL+YN PR+A+++A + G LW +DR+TFR++I+K+  +KR+ Y  FI ++PLL  L   E+  + D L +K  +  E++I+QGD  D  Y        I      +   + EEE + +    G YFGE+AL+ N PR A+ YA+   K   +D +++ RLLGPC+D M++N   Y  QL  L  S+ ++EE
Sbjct:    9 LTELLQSFTVEVLRNQPRDLLEFALQYFTQ--LKENESRGGAFGN--EQNSAVRAGKAVNFIEEAMQIDSENEEDEDDDEEFVAPVINRFIRRASVCAEAFNPDE-DDEDKEP-RVTHPKTDEQRHRLQEACKDILLFKNLDQEQMSQVLDAMFDKAVTSGEHIIDQDDDGDNFYVIERGTFDILVKSDGTSRTVGSYDNRGSFGELALMYNTPRAATIVATSPGALWCLDRLTFRRIIVKNNAKKRKMYEAFIETLPLLTSLEVSERMKVVDVLSSKVYSKGEQIIAQGDLADSFYIVESGEVRITMKRNRLKTDSEEEEVDIATCTRGQYFGELALVTNKPRAASAYAVENVKCLVMDVQAFERLLGPCMDIMKRNIANYEEQLVTLFGSQTEIEE 400          
BLAST of cAMP-dependent protein kinase type II regulatory subunit vs. Ensembl Cavefish
Match: prkar2aa (protein kinase, cAMP-dependent, regulatory, type II, alpha A [Source:ZFIN;Acc:ZDB-GENE-030131-1007])

HSP 1 Score: 195.667 bits (496), Expect = 4.320e-58
Identity = 125/388 (32.22%), Postives = 195/388 (50.26%), Query Frame = 1
Query:   97 LTEVIEEFKKQVEIANPKDIIAYAATYFTKKVAQENESNDTEFDKSLDYDSSSEDGDSLKEIMSNDKSKMKLVQTSNVPRQS----------------ITCESFDPSSIDDETFEKNRKIYPKTPKQMDKITDILETIFFFNCLDEIQFSKIIQSMFFIEVFKGDEIIKENDPGNNFYVIDYGTF---TASNKSKSIYEVYKGEGFFGELALLYNCPRSASVIADTDGGLWVIDRVTFRQLILKSAYQKRQRYLKFISSVPLLEDLTKYEQCNLADALKTKTINN-EKVISQGDAGDKMYF-------IXXXXXXXXXXXXXXXXXXSRLKAGDYFGEVALLANIPRIANVYALGYTKLAELDAKSYTRLLGPCIDNMRKNFTKYRSQ 1179
            LTE+++ +  +V    P D++ +A  YFT+                   D+ S+DG       S   +K K V     P Q+                +  E  +P   D+++  + R ++PKT +Q  ++ +  + I  F  LD+ QFS+++ +MF + V   + +I + D G+NFYVI+ G +      +        Y  +G FGELAL+YN PR+A++IA  +G LW +DR TFR+LI+K+  +KR+ Y  FI SVPLL+ L   E+  + D L  K  ++ E++I QGD  D  Y        I         R    E E +R   G YFGE+AL+ N PR  + YA+G  K   +D +++ RLLGPC + M++N   Y  Q
Sbjct:    9 LTELLQGYTVEVLRQRPPDLVEFAVQYFTRL-----------------RDTRSQDG-------SGAAAKGKGVMFDGEPMQTESNGDEDDEDDDSDFELCAEPLNPDDDDEDS--EPRVVHPKTDEQRCRLQEACKDILLFKALDQEQFSEVLDAMFEVIVQPQEHVIDQGDDGDNFYVIERGVYDIVVQKDGVGCCVGQYDNKGSFGELALMYNTPRAATIIAKQEGALWGLDRATFRRLIVKNNAKKRRMYECFIESVPLLKSLEISERMKIVDVLGVKIFHDGERIIMQGDMADCFYIVESGEVKIMMKSKTKADRQDNAEVEITRCTRGQYFGELALVTNKPRAGSAYAVGDIKCLVIDVQAFERLLGPCKEIMKRNIAHYEEQ 370          
BLAST of cAMP-dependent protein kinase type II regulatory subunit vs. Ensembl Cavefish
Match: prkar2ab (protein kinase, cAMP-dependent, regulatory, type II, alpha, B [Source:ZFIN;Acc:ZDB-GENE-040426-2427])

HSP 1 Score: 189.119 bits (479), Expect = 1.206e-55
Identity = 124/371 (33.42%), Postives = 200/371 (53.91%), Query Frame = 1
Query:   97 LTEVIEEFKKQVEIANPKDIIAYAATYFTKKVAQENESNDTEFDKSLDYDSSSEDGDSLKEIMSNDKSKMKLVQTSNVPRQSITCESFDPSSIDDETFEKNRKIYPKTPKQMDKITDILETIFFFNCLDEIQFSKIIQSMFFIEVFKGDEIIKENDPGNNFYVIDYGTF---TASNKSKSIYEVYKGEGFFGELALLYNCPRSASVIADTDGGLWVIDRVTFRQLILKSAYQKRQRYLKFISSVPLLEDLTKYEQCNLADALKTKTI-NNEKVISQGDAGDKMYFIXXXXXXXXXXXXXXXXXXSRLKAGDYFGEVALLANIPRIANVYALGYTKLAELDAKSYTRLLGPCIDNMRKNFTKYRSQLEKLLS 1197
            LT++++ +  +V    P D++ +A  YFT+   +E  S D  FDK      SSE+ +  ++   +++ K +     +     +  E+++P   DD+  E  + I+PKT +Q  ++ +  + I  F  L+  +FS+++ +MF + V   + II + D G+NFYVI+ G +      +        Y  +G FGELAL+YN PR+A++IA   G LW +DR TF +LI+++  +KR+ Y  FI  VPLL+ L   E+  + D L  K+  N E +I Q  AG +                  E E +R   G YFGE+AL+ N PR A+VYA+G TK   +D +++ RLLGPC + M++N   Y+ QL  L  
Sbjct:    9 LTDLLKGYTVEVLKQRPSDLLDFAVQYFTR--LKEQRSADVAFDKDTTPTESSEEDEEEEKEEEDEEEKEEDDDFPDDFTFKLCAEAYNPDDDDDDDSEP-KVIHPKTDQQRSRLQEACKDILLFKTLE--KFSEVLDAMFEVLVKPQEHIIDQGDDGDNFYVIERGVYDIVVGKDGVSRCVGKYDNKGSFGELALMYNTPRAATIIATQSGALWALDRATFHRLIVRNNAKKRRMYEAFIECVPLLKSLELSERMKIVDVLGAKSFKNGELIIKQTKAGQR---------------DNAEVEVARCSRGQYFGELALVTNKPRAASVYAVGETKCLVIDVQAFERLLGPCKEIMKRNIASYKEQLVALFG 359          
BLAST of cAMP-dependent protein kinase type II regulatory subunit vs. Ensembl Cavefish
Match: prkar1ab (cAMP-dependent protein kinase type I-alpha regulatory subunit [Source:NCBI gene;Acc:103038385])

HSP 1 Score: 178.718 bits (452), Expect = 1.564e-51
Identity = 104/262 (39.69%), Postives = 156/262 (59.54%), Query Frame = 1
Query:  400 RKIYPKTPKQMDKITDILETIFFFNCLDEIQFSKIIQSMFFIEVFKGDEIIKENDPGNNFYVIDYGTFTASNKSKSIYEVYKGEGFFGELALLYNCPRSASVIADTDGGLWVIDRVTFRQLILKSAYQKRQRYLKFISSVPLLEDLTKYEQCNLADALKTKTI-NNEKVISQGDAGDKMYFIXXXXXXXXXXXXXXX--XXXSRLKAGDYFGEVALLANIPRIANVYALGYTKLAELDAKSYTRLLGPCIDNMRKNFTKYRS 1176
            RK+ PK  K M  +   +E    F+ LD+ + S I  +MF +    G+ +I++ D G+NFYVID G       ++    + +G G FGELAL+Y  PR+A+V A T+  LW IDR ++R++++ S  +KR+ Y +F+S V +LE L K+E+  +ADAL+     +++K++ QG+ GD+ + I EG   V  R  E E   E  RL   DYFGE+ALL N PR A V A G  K  +LD   + R+LGPC D +++N  +Y S
Sbjct:  113 RKVIPKDYKTMAALAKAIEKNVLFSHLDDNERSDIFDAMFPVTYIAGEIVIQQGDEGDNFYVIDQGEMDVYVNNEWATSIGEG-GSFGELALIYGTPRAATVRAKTNAKLWGIDRDSYRRILMGSTLRKRKMYEEFLSKVSILESLDKWERLTVADALEPVQFEDSQKIVVQGEPGDEFFIILEGCAAVLQRRSENEEFVEVGRLGPSDYFGEIALLMNRPRAATVVARGPLKCVKLDRPRFERVLGPCSDILKRNIQQYNS 373          
BLAST of cAMP-dependent protein kinase type II regulatory subunit vs. Ensembl Cavefish
Match: prkar1b (protein kinase cAMP-dependent type I regulatory subunit beta [Source:NCBI gene;Acc:111191378])

HSP 1 Score: 176.792 bits (447), Expect = 1.052e-50
Identity = 104/262 (39.69%), Postives = 152/262 (58.02%), Query Frame = 1
Query:  400 RKIYPKTPKQMDKITDILETIFFFNCLDEIQFSKIIQSMFFIEVFKGDEIIKENDPGNNFYVIDYGTFTASNKSKSIYEVYKGEGFFGELALLYNCPRSASVIADTDGGLWVIDRVTFRQLILKSAYQKRQRYLKFISSVPLLEDLTKYEQCNLADALKTKTI-NNEKVISQGDAGDKMYFIXXXXXXXXXXXX--XXXXXXSRLKAGDYFGEVALLANIPRIANVYALGYTKLAELDAKSYTRLLGPCIDNMRKNFTKYRS 1176
            RK+ PK  K M  +   +     F  LD+ + S I  +MF +    G+ +I++ D G+NFYVID G        + +  + +G G FGELAL+Y  PR+A+V A TD  LW IDR ++R++++ S  +KR+ Y +F+S V +LE L K+E+  +ADAL+     + EK++ QG+ GD  + I EG   V  R    EE  E  RL   DYFGE+ALL N PR A V A G  K  +LD   + R+LGPC + +++N  +Y S
Sbjct:  116 RKVIPKDYKTMTALAKAISKNVLFAHLDDNERSDIFDAMFPVTHIAGETVIQQGDEGDNFYVIDQGEVDVYVNGEWVTGIGEG-GSFGELALIYGTPRAATVKAKTDLKLWGIDRDSYRRILMGSTLRKRKMYEEFLSKVSILESLEKWERLTVADALEPVQFEDGEKIVVQGEPGDDFFIITEGTASVLQRRSDNEEYVEVGRLGPSDYFGEIALLLNRPRAATVVARGPLKCVKLDRPRFERVLGPCSEILKRNIQRYNS 376          
BLAST of cAMP-dependent protein kinase type II regulatory subunit vs. Ensembl Sea Lamprey
Match: prkar2aa (protein kinase, cAMP-dependent, regulatory, type II, alpha A [Source:ZFIN;Acc:ZDB-GENE-030131-1007])

HSP 1 Score: 158.688 bits (400), Expect = 2.350e-46
Identity = 83/196 (42.35%), Postives = 119/196 (60.71%), Query Frame = 1
Query:  640 YKGEGFFGELALLYNCPRSASVIADTDGGLWVIDRVTFRQLILKSAYQKRQRYLKFISSVPLLEDLTKYEQCNLADALKTKTI-NNEKVISQG---------DAGDKMYFIXXXXXXXXXXXXXXXXXXSRLKAGDYFGEVALLANIPRIANVYALGYTKLAELDAKSYTRLLGPCIDNMRKNFTKYRSQLEKLLS 1197
            Y   G FGELAL+YN PR+A+++A T+G LW +DR TFR++ILK+A QKR+ Y  FI SVPLL+ L   E+  + D + TK+  + E++I+QG         +AG+    ++         T E E E +R   G YFGE++L+ N PR A+ YA+G  K A +  + + RLLGPC+D M++N T Y  QL  L  
Sbjct:   20 YDNRGSFGELALMYNTPRAATIVATTEGSLWAMDRATFRRIILKNAAQKRKMYEAFIESVPLLKSLDASERMKVVDTITTKSYEDGEQIIAQGAKADCFFIVEAGEVRIMMKSKTQPPAETTKEGEVEIARCTRGQYFGELSLVTNKPRAASAYAVGNVKCAVMGVQPFERLLGPCMDIMKRNITHYEEQLVALFG 215          
BLAST of cAMP-dependent protein kinase type II regulatory subunit vs. Ensembl Sea Lamprey
Match: si:ch211-272n13.7 (protein kinase cAMP-dependent type II regulatory subunit beta [Source:HGNC Symbol;Acc:HGNC:9392])

HSP 1 Score: 149.443 bits (376), Expect = 8.188e-42
Identity = 91/307 (29.64%), Postives = 164/307 (53.42%), Query Frame = 1
Query:   97 LTEVIEEFKKQVEIANPKDIIAYAATYFTKKVAQENESNDTEFDKSLD-YDSSSEDGDSLKE--IMSNDKSKMKL------------------VQTSNVPRQSITCESFDPSSIDDETFEKNRKIYPKTPKQMDKITDILETIFFFNCLDEIQFSKIIQSMFFIEVFKGDEIIKENDPGNNFYVIDYGTF---TASNKSKSIYEVYKGEGFFGELALLYNCPRSASVIADTDGGLWVIDRVTFRQLILKSAYQKRQRYLKFISSVPLLEDLTKYEQCNLADALKTKTI-NNEKVISQGDAGDKMYFI 942
            LTE+++ F  +V  + P D++ +AA YF +   +  E       +  D +D +   G +  E  +  +  +                      V +    R S+  E+++P   +++T  + R I+PKT +Q +++ +  + I  F  LD+ Q S+++ +MF   V  G+ +I +   G+NFYVI+ G +     +N        Y   G FGELAL+YN  R+A++IA ++G LW +DR+TFR++I+K+A +KR+ Y  FI +VPLL+ L   E+  + D + +K+  ++E++I+QG+  D  Y +
Sbjct:    9 LTELLQAFTVEVLRSRPADLLDFAAAYFAEMRQRARERCGAPAQQLADGFDDAHGRGVNFSEENVAGHSSNSDNNGDDDRDDDDDDESDFEAPVISRFTRRASVCAEAYNPDEEEEDT--ETRVIHPKTDEQRNRLQEACKHILIFKNLDQEQMSQVLDAMFEKTVETGEHVIDQGADGDNFYVIERGMYDIYVTTNDVSRCVGAYNNRGSFGELALMYNTSRAATIIATSEGALWGLDRLTFRRIIVKNAAKKRKMYECFIETVPLLKSLDFSERLKVVDVIASKSFQDSERIIAQGEKADCFYLV 313          
BLAST of cAMP-dependent protein kinase type II regulatory subunit vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001198.1 (pep scaffold:Pmarinus_7.0:GL480445:10050:25657:1 gene:ENSPMAG00000001068.1 transcript:ENSPMAT00000001198.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 91.2781 bits (225), Expect = 1.365e-20
Identity = 61/221 (27.60%), Postives = 108/221 (48.87%), Query Frame = 1
Query:  454 ETIFFFNCLDEIQFSKIIQSMFFIEVFKGDEIIKENDPGNNFYVIDYGTFTASNKSKSIYEVYKGEGFFGELALLYNCPRSASVIADTDGGLWVIDRVTFRQLILKSAYQKRQRYLKFISSVPLLEDLTKYEQCNLADALKTKTI-NNEKVISQGDAGDKMYFIXXXXXXXXXXXXXXXXXXSRLKAGDYFGEVALLANIPRIANVYALGYTKLAELDAKS 1113
            +T+   +C+ E   ++            G+ II E D      V   G    S + +S+  +  G   FGELA+LY+C R+A+V A TD  L  + R  FR ++++ +  +R+  +KF+ +   L++L   +   + D ++     + E ++++G+ G   Y I  G+V V+       R    L+ GD+FGE+AL+ N+ R A   A+G      L  +S
Sbjct:   20 QTVLLGDCMSETTRAR------------GETIIAEGDSSRRLKVDVEGLLDVSKQGESLCTLQPG-ALFGELAILYDCTRTATVKALTDVRLLYLSRHAFRSVLMRESQLRRKLIIKFLKTAKTLKNLPDEQLSKMFDCMEESAFADGEAIVNEGEVGHIFYVILRGQVRVSQEVEGSPRLIRVLEPGDHFGELALIRNMRRTATCTAVGAVTCLTLHTRS 227          
BLAST of cAMP-dependent protein kinase type II regulatory subunit vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001825.1 (pep scaffold:Pmarinus_7.0:GL485714:520:7294:-1 gene:ENSPMAG00000001656.1 transcript:ENSPMAT00000001825.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 79.337 bits (194), Expect = 7.693e-17
Identity = 36/132 (27.27%), Postives = 71/132 (53.79%), Query Frame = 1
Query:  415 KTPKQMDKITDILETIFFFNCLDEIQFSKIIQSMFFIEVFKGDEIIKENDPGNNFYVIDYGTFTASNKSKSIYEVYKGEGFFGELALLYNCPRSASVIADTDGGLWVIDRVTFRQLILKSAYQKRQRYLKFI 810
            K P     I   L    F   L++ + +++++ M+         +I+E + GN+ YV+   +     +   +  ++ G   FGELA+LYNC R+A+V A T   +WV+DR+TF+ ++++    + Q +++F+
Sbjct:  163 KNPCSQRLIKAALAKNEFLRRLEDGRVARMVECMYERAYSPEQAVIREGEAGNHLYVLAAASLDCQQRGTCLGHMHPGT-VFGELAILYNCKRTATVKAVTAVRVWVLDRLTFQAIVIREEQARHQEHVRFL 293          
BLAST of cAMP-dependent protein kinase type II regulatory subunit vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005026.1 (pep scaffold:Pmarinus_7.0:GL484567:1893:8879:-1 gene:ENSPMAG00000004571.1 transcript:ENSPMAT00000005026.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 63.929 bits (154), Expect = 3.765e-13
Identity = 29/59 (49.15%), Postives = 43/59 (72.88%), Query Frame = 1
Query:  652 GFFGELALLYNCPRSASVIADTDGGLWVIDRVTFRQLILKSAYQKRQRYLKFISSVPLL 828
            G FGELAL+Y  PR+A+V A TD  LW IDR ++R++++ S  +KR+ Y +F+S V +L
Sbjct:   37 GSFGELALIYGTPRAATVKAKTDLKLWGIDRDSYRRILMGSTLRKRKMYEEFLSKVSIL 95          
BLAST of cAMP-dependent protein kinase type II regulatory subunit vs. Ensembl Yeast
Match: BCY1 (Regulatory subunit of the cyclic AMP-dependent protein kinase (PKA); PKA is a component of a signaling pathway that controls a variety of cellular processes, including metabolism, cell cycle, stress response, stationary phase, and sporulation [Source:SGD;Acc:S000001295])

HSP 1 Score: 175.252 bits (443), Expect = 1.074e-50
Identity = 107/280 (38.21%), Postives = 162/280 (57.86%), Query Frame = 1
Query:  334 RQSITCESFDPSSIDDETFEKNRKIYPKTPKQMDKITDILETIFFFNCLDEIQFSKIIQSMFFIEVFKGDEIIKENDPGNNFYVIDYGT---FTASNKSKSIYEVYKGEGF-FGELALLYNCPRSASVIADTDGGLWVIDRVTFRQLILKSAYQKRQRYLKFISSVPLLEDLTKYEQCNLADALKTKTIN-NEKVISQGDAGDKMYFIXXXXXXXXXXXXXXXXXXSRLKAGDYFGEVALLANIPRIANVYALGYTKLAELDAKSYTRLLGPCIDNMRKN 1158
            R S++ E+  P++ DD T +  ++   K+ +Q+ ++   +   F FN LD      +I  +    V KG  IIK+ D G+ FYV++ GT   +   NK  S      G G  FGELAL+YN PR+A+V+A +D  LW +DR+TFR+++L S+++KR  Y   + S+P+L+ LT Y++  LADAL TK     E +I +GD G+  Y I   E      + + +   ++LK  DYFGEVALL ++PR A V A   TK+A L    + RLLGP +D ++ N
Sbjct:  143 RTSVSGETLQPNNFDDWTPDHYKE---KSEQQLQRLEKSIRNNFLFNKLDSDSKRLVINCLEEKSVPKGATIIKQGDQGDYFYVVEKGTVDFYVNDNKVNS-----SGPGSSFGELALMYNSPRAATVVATSDCLLWALDRLTFRKILLGSSFKKRLMYDDLLKSMPVLKSLTTYDRAKLADALDTKIYQPGETIIREGDQGENFYLI---EYGAVDVSKKGQGVINKLKDHDYFGEVALLNDLPRQATVTATKRTKVATLGKSGFQRLLGPAVDVLKLN 411          
BLAST of cAMP-dependent protein kinase type II regulatory subunit vs. Ensembl Nematostella
Match: EDO38262 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SDH8])

HSP 1 Score: 226.868 bits (577), Expect = 3.247e-70
Identity = 131/378 (34.66%), Postives = 217/378 (57.41%), Query Frame = 1
Query:   97 LTEVIEEFKKQVEIANPKDIIAYAATYFTKKVAQENESNDTEFDKSLDYDSSSEDGDSLKEIMSNDKSKMKLVQTSN--VPRQSITCESFDPSSIDDETFEKNRKIYPKTPKQMDKITDILETIFFFNCLDEIQFSKIIQSMFFIEVFKGDEIIKENDPGNNFYVIDYGTF---TASNKSKSIYEVYKGEGFFGELALLYNCPRSASVIADTDGGLWVIDRVTFRQLILKSAYQKRQRYLKFISSVPLLEDLTKYEQCNLADALKTKTI-NNEKVISQGDAGDKMYFIXXXXXXXXXXXXXXXXXX---SRLKAGDYFGEVALLANIPRIANVYALGYTKLAELDAKSYTRLLGPCIDNMRKNFTKYRSQLEKLLSRH 1203
            L++++++F   V    P+DI+ +AA YF K   +E  S   +        S    G+   +  + D+         N    RQS+  E F P S D+   ++   +YPKT +Q  ++ D ++ I  F  L + Q ++++ +MF  +   GD II + D G+NFYVID G +      +  + +   Y  +G FGELAL+YN PR+A++++ ++G +W +DR+TFR+++LK+A +KR+ +   + +VPLL+++T+YE+ NLADAL ++   + E +I QGD  D MYF+E G V + +    +   E   ++   G YFGE+AL+ +  R A+VY++G    A LD  ++ RLLGPC+D M++N   Y  QL+KL   H
Sbjct:    9 LSDLLQDFTVHVLREKPEDIVDFAANYFMKLKLKEKRSQKGKKKNKEKGVSFGPPGNDEDDTYNEDEDDEMPEPPKNRYARRQSVCAEPFHPDSEDE--GDEQPIVYPKTDEQRQRLNDAIKNILLFKNLAKEQLNEVLDAMFERKTQAGDHIIDQGDDGDNFYVIDRGQYDIYVRIDGQEKMVGSYDNKGSFGELALMYNTPRAATIVSTSEGVIWGLDRMTFRRILLKAAAKKRKVHEALLETVPLLQEITEYERMNLADALVSRQFKDGECIIKQGDEADFMYFVESGTVSIRMHNKSDPTTEVEIAQCTKGGYFGELALITHNTRAASVYSVGDCVCASLDVHAFERLLGPCMDIMKRNIDGYEEQLQKLGVEH 384          
BLAST of cAMP-dependent protein kinase type II regulatory subunit vs. Ensembl Nematostella
Match: EDO48439 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RJW7])

HSP 1 Score: 182.956 bits (463), Expect = 1.381e-53
Identity = 105/270 (38.89%), Postives = 159/270 (58.89%), Query Frame = 1
Query:  376 DDETFEKNRKIYPKTPKQMDKITDILETIFFFNCLDEIQFSKIIQSMFFIEVFKGDEIIKENDPGNNFYVIDYGTFTASNKSKSIYEVYKGEGFFGELALLYNCPRSASVIADTDGGLWVIDRVTFRQLILKSAYQKRQRYLKFISSVPLLEDLTKYEQCNLADALK-TKTINNEKVISQGDAGDKMYFIXXXXXXXXXXXXXXX--XXXSRLKAGDYFGEVALLANIPRIANVYALGYTKLAELDAKSYTRLLGPCIDNMRKNFTKYRS 1176
            +DE     +K+ PK  K M  ++  +     F+ LDE + S I  +M  ++   G+ IIK+ D G+NFY++D G       +  +       G FGELAL+Y  PR+A++ A TD  LW IDRVT+R++++ S  +KR+ Y +F+  V +LE L K+E+  +ADAL+ T+  + + V+ QG+ GD+ + I EG  +V  R    E   E SRL   DYFGE+AL+ N PR A V A G  K  +LD + + R+LGPCID +++N  +Y S
Sbjct:  100 EDEATSYVKKVVPKDYKTMAALSKAITKNILFSHLDENERSDIFDAMSLVKHGAGEIIIKQGDEGDNFYIVDSGEVDVFVNNVGLVSTIGEGGSFGELALIYGTPRAATIKAKTDVKLWAIDRVTYRRILMGSQIRKRRMYEQFLEKVSILESLDKWERLTVADALEPTQFQDGDDVVVQGEHGDEFFIIVEGTAVVLQRRSANEDFIEVSRLGPSDYFGEIALVLNRPRAATVQARGTLKCVKLDRQRFERVLGPCIDILKRNIQQYNS 369          
BLAST of cAMP-dependent protein kinase type II regulatory subunit vs. Ensembl Nematostella
Match: EDO49534 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGJ3])

HSP 1 Score: 182.57 bits (462), Expect = 2.258e-53
Identity = 120/379 (31.66%), Postives = 200/379 (52.77%), Query Frame = 1
Query:   97 LTEVIEEFKKQVEIANPKDIIAYAATYFTK------KVAQENESNDTEFDKSLDYDSSSEDGDSLKEIMSNDKSKMKLVQTSNVPRQSITCESFDPSSIDDETFEKNRKIYPKTPKQMDKITDILETIFFFNCLDEIQFSKIIQSMFFIEVFKGDEIIKENDPGNNFYVIDYGTFTA---SNKSKSIYEVYKGEGFFGELALLYNCPRSASVIADTDGGLWVIDRVTFRQLILKSAYQKRQRYLKFISSVPLLEDLTKYEQCNLADALKTKTINNEK-VISQGDAGDKMYFIXXXXXXXX---XXXXXXXXXXSRLKAGDYFGEVALLANIPRIANVYAL-GYTKLAELDAKSYTRLLGPCIDNMRKNFTKYRSQLEKL 1191
            L ++++ F   V    P D++ +AA+YF+K       +   +  +  E D     +S S   D  K        ++ L       R S+  E ++P  ++       R  YPK+     ++ +++  IF F    + Q + ++ +M+   V++ + II++ D G+NFY+ID G F     +N ++      KG G FGELAL+YNCPRSA++ A T G LWV+DR +FR++++ +  +KR+ Y   +  +P+L  LT YE+ +LADAL T    +E+ +I Q D  D +YFIE G V ++    +   + +  S    G+YFGE+AL+    R A+V+A  G    A L+  ++ RLLGPC   M++N   Y  + + L
Sbjct:   10 LHKLLQSFILDVFTEQPDDLVDFAASYFSKLNTSRKPIHSSSTPSTQEEDDFYCSESLSLPSDRFKRPSYQQNHRLYLR------RDSVAGEVYEP--VNSNCVSAQR-FYPKSEDARKRLENVIGNIFIFKSCGKDQINMMLDAMYERVVYQEETIIRQGDAGDNFYIIDEGEFEVLFETNGAQEKLGRLKGPGSFGELALMYNCPRSATIRACTPGVLWVLDRKSFRRILVDTTERKRRHYETLLERIPVLSQLTAYERTSLADALTTSVYRDEECIIRQDDPADCLYFIESGIVEISIRDSKDRSKVKVISTAGPGEYFGELALVNKTKRGASVHAKGGQVTCAVLEVNAFERLLGPCKGLMQRNMKTYEEERKCL 379          
BLAST of cAMP-dependent protein kinase type II regulatory subunit vs. Ensembl Nematostella
Match: EDO41163 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S513])

HSP 1 Score: 166.007 bits (419), Expect = 2.732e-47
Identity = 128/373 (34.32%), Postives = 210/373 (56.30%), Query Frame = 1
Query:   97 LTEVIEEFKKQVEIANPKDIIAYAATYFTK-KVAQENESNDTEFDKSLDYDSSSEDGDSLKEIMSNDKSKMKLVQTSNVPRQSITCESFDPSSIDDETFEKNRKIYPKTPKQMDKITDILETIFFFNCLDEIQFSKIIQSMFFIEVFKGDEIIKENDPGNNFYVIDYGTFTA----SNKSKSI-YEVYKGEGFFGELALLYNCPRSASVIADTDGGLWVIDRVTFRQLILKSAYQKRQRYLKFISSVPLLEDLTKYEQCNLADALKTKTI-NNEKVISQG-DAGDKMYFIXXXXXXXXXXXXXXXXXXSRLKAGDYFGEVALLANIPRIANVYALGYTKLAELDAKSYTRLLGPCIDNMRKNFTKYRSQLEKL 1191
            L+ ++EEF  +    NP+DI+ +AA YF   K  +E ++   +  +S      SED D L        ++  +++  +  R +++ E ++P    +E  +   K +PK+ +Q + +   L  ++ F          I+ SMF  +V   + IIK  D G+NFYVI+ G +      +N   SI    + G G FGELAL++N  R+A+++A T+G LW +DR TF Q+++  A ++R+R ++ + SV +L++L   E   ++DAL  K   + E VI +G ++   MYFIE+G+V VTV+ GE E+     K  +YFGE+AL+ N PR A+VYA+G  K A L    + RL+GPC + M++N  +Y  Q +KL
Sbjct:   13 LSSLLEEFVVKCIQENPEDIVEFAADYFNMLKRFKEKKAASKQAAQS---KKESEDKDDLA------PAEQPIIKGRSR-RAAVSAEPYNP----NENADFKAKFHPKSEEQRNHLKKKLLELWLFEKFHREDLDVILDSMFEKKVSPEEIIIKVGDEGDNFYVINTGEYDVFALDTNTGASIKVHTFNGTGMFGELALMHNSLRNATIVAKTEGTLWALDRSTFVQVVVGGAQRRRERNIELLKSVSILKELKPDELDKVSDALYPKEFKDGEAVIREGNESAYCMYFIEKGKVRVTVKDGEVEKTVEFDK--NYFGELALVMNQPRSASVYAVGECKFASLKKDDFERLMGPCKEIMKRNAKEYEEQKKKL 369          
BLAST of cAMP-dependent protein kinase type II regulatory subunit vs. Ensembl Nematostella
Match: EDO38399 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SCY8])

HSP 1 Score: 118.242 bits (295), Expect = 1.264e-28
Identity = 87/261 (33.33%), Postives = 136/261 (52.11%), Query Frame = 1
Query:  301 KMKLVQTSNVPRQSITCESFDPSSIDDETFEKNRKIYPKTPKQMDKITDILETIFFFNCLDEIQFSKIIQSMFFIEVFKGDEIIKENDPGNNFYVIDYGTFTASNKSKSIYEVYKGEGFFGELALLYNCPRSASVIADTDGGLWVIDRVTFRQLILKSAYQKRQRYLKFISSVPLLEDLTKYEQCNLADALKTKTIN-NEKVISQGDAGDKMYFIXXXXXXXXXXXXXXX--XXXSRLKAGDYFGEVALLANIPRIANVYA 1074
            K KL  +    RQ+++ ES   +  +  T  K  + +PK  +    I D +    F   L+  Q  +I+  M+     + D II+E D GN  Y I  G    + ++K + E+  G   FGELA+LYNC R+A+V A     LW IDR  F+ +++++   ++  ++ F+ SVPLL++L   E   LAD L+    +  + +I + + GD  Y I +G   VT R   +   +E  +L+ GDYFGE ALL+   R ANV A
Sbjct:   11 KKKLRPSKKEKRQAVSGESSTKAQEESRT-GKELERFPKDFRSKQLIKDAIFENDFLKNLEAAQVREIVDCMYSNTFQRNDVIIQEGDAGNALYAIADGRLQVTRENKVLGEMVAGM-VFGELAILYNCRRTATVTAMEPTKLWKIDRRVFQIIMMRTGMIRQAEHMAFLKSVPLLKELPNAELSKLADVLEVDFYHAGDYIIRENERGDTFYIITKGSARVTQRIEGQTGPKEIRKLQKGDYFGEKALLSEDRRTANVIA 269          

HSP 2 Score: 50.8322 bits (120), Expect = 6.905e-7
Identity = 36/112 (32.14%), Postives = 59/112 (52.68%), Query Frame = 1
Query:  451 LETIFFFNCLDEIQFSKIIQSMFFIEVFKGDEIIKENDPGNNFYVIDYGTFTASNK------SKSIYEVYKGEGFFGELALLYNCPRSASVIADTDG-GLWVIDRVTFRQLI 765
            L+++     L   + SK+   +       GD II+EN+ G+ FY+I  G+   + +       K I ++ KG+ +FGE ALL    R+A+VIA+ +G    V+DR  F  +I
Sbjct:  178 LKSVPLLKELPNAELSKLADVLEVDFYHAGDYIIRENERGDTFYIITKGSARVTQRIEGQTGPKEIRKLQKGD-YFGEKALLSEDRRTANVIAEENGVECLVVDRTVFMTVI 288          
BLAST of cAMP-dependent protein kinase type II regulatory subunit vs. Ensembl Medaka
Match: si:ch211-272n13.7 (protein kinase cAMP-dependent type II regulatory subunit beta [Source:NCBI gene;Acc:101166375])

HSP 1 Score: 218.779 bits (556), Expect = 1.585e-66
Identity = 135/397 (34.01%), Postives = 218/397 (54.91%), Query Frame = 1
Query:   97 LTEVIEEFKKQVEIANPKDIIAYAATYFTKKVAQENESNDTEFDKSLDYDSSSEDGDSLK---EIMSNDKSK---------------MKLVQTSNVPRQSITCESFDPSSIDDETFEKNRKIYPKTPKQMDKITDILETIFFFNCLDEIQFSKIIQSMFFIEVFKGDEIIKENDPGNNFYVIDYGTFTASNKSKSIYEV---YKGEGFFGELALLYNCPRSASVIADTDGGLWVIDRVTFRQLILKSAYQKRQRYLKFISSVPLLEDLTKYEQCNLADALKTKTINN-EKVISQGDAGDKMYFIXXXXXXXXXXXXXXX--------XXXSRLKAGDYFGEVALLANIPRIANVYALGYTKLAELDAKSYTRLLGPCIDNMRKNFTKYRSQLEKLLS 1197
            LTE+++ F  +V    P+D++ +A  YFT+   ++NE+ +  F    D +S+   G ++    E M  D                  +  V    + R S+  E+F+P   +DE  ++ R  YPKT +Q  ++ +    I  F  LD  + S+++ +MF     +G+ II ++D G+NFYVI+ GTF    K   I ++   Y   G FGELAL+YN PR+A++IA + G LW +DR+TFR++I+K+  +KR+ Y  FI ++PLL  L   E+  + D L T+  N+ +++I+QGD  D  Y +E G+V +T++              E +    G YFGE+AL+ N PR A+ YA+G  K   +D +++ RLLGPC+D M++N   Y  QL+ L  
Sbjct:    9 LTELLQSFTVEVLRNQPRDLLEFALQYFTQ--LKDNETKEAAFGN--DQNSAPRSGKAVNFIDEAMQIDSENGEEEEDDDDDDDEEFIAPVINRFIRRASVCAEAFNPD--EDEEDKEPRVTYPKTDEQRQRLQEACRDILLFKNLDPEEISQVLDAMFEKFCTEGEHIIDQDDDGDNFYVIESGTFNIFVKVDGIEKLVGCYDNRGSFGELALMYNTPRAATIIATSPGALWCLDRLTFRRIIVKNNAKKRRLYEAFIETLPLLTSLETSERMKVVDVLSTRVYNDSQQIIAQGDLADCFYIVESGQVRITMKRSRMTKKDQEEEEVEIATCTRGQYFGELALVTNKPRAASAYAVGSVKCLVMDVQAFERLLGPCMDIMKRNIANYEEQLQSLFG 399          
BLAST of cAMP-dependent protein kinase type II regulatory subunit vs. Ensembl Medaka
Match: prkar2aa (cAMP-dependent protein kinase type II-alpha regulatory subunit [Source:NCBI gene;Acc:101159349])

HSP 1 Score: 206.453 bits (524), Expect = 5.278e-62
Identity = 125/379 (32.98%), Postives = 205/379 (54.09%), Query Frame = 1
Query:   97 LTEVIEEFKKQVEIANPKDIIAYAATYFTK---KVAQENESNDTEFDKSLDYDSSSEDGDSLKEIMSNDKSKMKLVQTSNVPRQ-SITCESFDPSSIDDETFEKNRKIYPKTPKQMDKITDILETIFFFNCLDEIQFSKIIQSMFFIEVFKGDEIIKENDPGNNFYVIDYGTFTASNKSKSIYEVYKGEGFFGELALLYNCPRSASVIADTDGGLWVIDRVTFRQLILKSAYQKRQRYLKFISSVPLLEDLTKYEQCNLADALKTKT-INNEKVISQGDAGDKMYF-------IXXXXXXXXXXXXXXXXXXSRLKAGDYFGEVALLANIPRIANVYALGYTKLAELDAKSYTRLLGPCIDNMRKNFTKYRSQLEKLLS 1197
            LTE+++ +  +V    P D++ +A  YFT+      Q+      +  K + +D      +S  +   +D S  +    S   R+ S+  E+F+P   D++T  + R ++PKT +Q  ++ +    I  F  LD+ QFS+++ +MF ++V   + +I +   G+NFYVI+ G +      K + + Y  +G FGELAL+YN PR+A++IA  +G LW +DR TFR+LI+K+  +KR+ Y  FI SVPLL+ L   E+  + D L  K  ++ E++I+QG+  +  Y        I              E E +R   G YFGE+AL+ N PR A+ YA+G  K   +D +++ RLLG C + M++N + Y  QL  L  
Sbjct:    9 LTELLQGYTVEVLRQRPSDLVEFAVQYFTRLRDSRGQDGAGTGAKQGKGVMFDGEPMQTESNGDDEEDDDSDFEPPPPSRFNRRVSVCAEAFNPDDDDEDT--EPRVVHPKTDEQRCRLQEACRDILLFKTLDQEQFSQVLDAMFELKVQPQEHVIDQGHDGDNFYVIERGIYDIVVSGKCVGQ-YNNKGSFGELALMYNTPRAATIIATQEGALWGLDRATFRRLIVKNNAKKRRMYETFIESVPLLKTLEPNERMKIVDVLGMKQFLDGERIIAQGEKAECFYIVESGEVKIMMKSKTKADHADNAEVEITRCSRGQYFGELALVTNKPRAASAYAVGDVKCLVIDVQAFERLLGSCKEIMKRNISHYEEQLVALFG 384          
BLAST of cAMP-dependent protein kinase type II regulatory subunit vs. Ensembl Medaka
Match: prkar2aa (cAMP-dependent protein kinase type II-alpha regulatory subunit [Source:NCBI gene;Acc:101159349])

HSP 1 Score: 199.904 bits (507), Expect = 1.032e-59
Identity = 123/372 (33.06%), Postives = 201/372 (54.03%), Query Frame = 1
Query:   97 LTEVIEEFKKQVEIANPKDIIAYAATYFTK---KVAQENESNDTEFDKSLDYDSSSEDGDSLKEIMSNDKSKMKLVQTSNVPRQ-SITCESFDPSSIDDETFEKNRKIYPKTPKQMDKITDILETIFFFNCLDEIQFSKIIQSMFFIEVFKGDEIIKENDPGNNFYVIDYGTFTASNKSKSIYEVYKGEGFFGELALLYNCPRSASVIADTDGGLWVIDRVTFRQLILKSAYQKRQRYLKFISSVPLLEDLTKYEQCNLADALKTKT-INNEKVISQGDAGDKMYFIXXXXXXXXXXXXXXXXXXSRLKAGDYFGEVALLANIPRIANVYALGYTKLAELDAKSYTRLLGPCIDNMRKNFTKYRSQLEKLLS 1197
            LTE+++ +  +V    P D++ +A  YFT+      Q+      +  K + +D      +S  +   +D S  +    S   R+ S+  E+F+P   D++T  + R ++PKT +Q  ++ +    I  F  LD+ QFS+++ +MF ++V   + +I +   G+NFYVI+ G +      K + + Y  +G FGELAL+YN PR+A++IA  +G LW +DR TFR+LI+K+  +KR+ Y  FI SVPLL+ L   E+  + D L  K  ++ E++I+Q  A                     E E +R   G YFGE+AL+ N PR A+ YA+G  K   +D +++ RLLG C + M++N + Y  QL  L  
Sbjct:    9 LTELLQGYTVEVLRQRPSDLVEFAVQYFTRLRDSRGQDGAGTGAKQGKGVMFDGEPMQTESNGDDEEDDDSDFEPPPPSRFNRRVSVCAEAFNPDDDDEDT--EPRVVHPKTDEQRCRLQEACRDILLFKTLDQEQFSQVLDAMFELKVQPQEHVIDQGHDGDNFYVIERGIYDIVVSGKCVGQ-YNNKGSFGELALMYNTPRAATIIATQEGALWGLDRATFRRLIVKNNAKKRRMYETFIESVPLLKTLEPNERMKIVDVLGMKQFLDGERIIAQTKA---------------DHADNAEVEITRCSRGQYFGELALVTNKPRAASAYAVGDVKCLVIDVQAFERLLGSCKEIMKRNISHYEEQLVALFG 362          
BLAST of cAMP-dependent protein kinase type II regulatory subunit vs. Ensembl Medaka
Match: si:ch211-272n13.7 (protein kinase cAMP-dependent type II regulatory subunit beta [Source:NCBI gene;Acc:101166375])

HSP 1 Score: 200.675 bits (509), Expect = 1.364e-59
Identity = 134/397 (33.75%), Postives = 216/397 (54.41%), Query Frame = 1
Query:   97 LTEVIEEFKKQVEIANPKDIIAYAATYFTKKVAQENESNDTEFDKSLDYDSSSEDGDSLK---EIMSNDKSK---------------MKLVQTSNVPRQSITCESFDPSSIDDETFEKNRKIYPKTPKQMDKITDILETIFFFNCLDEIQFSKIIQSMFFIEVFKGDEIIKENDPGNNFYVIDYGTFTASNKSKSIYEV---YKGEGFFGELALLYNCPRSASVIADTDGGLWVIDRVTFRQLILKSAYQKRQRYLKFISSVPLLEDLTKYEQCNLADALKTKTINN-EKVISQGDAGDKMYFIXXXXXXXXXXXXXXX--------XXXSRLKAGDYFGEVALLANIPRIANVYALGYTKLAELDAKSYTRLLGPCIDNMRKNFTKYRSQLEKLLS 1197
            LTE+++ F  +V    P+D++ +A  YFT+   ++NE+ +  F    D +S+   G ++    E M  D                  +  V    + R S+  E+F+P   +DE  ++ R+ +        K+ DIL   F F   +EI  S+++ +MF     +G+ II ++D G+NFYVI+ GTF    K   I ++   Y   G FGELAL+YN PR+A++IA + G LW +DR+TFR++I+K+  +KR+ Y  FI ++PLL  L   E+  + D L T+  N+ +++I+QGD  D  Y +E G+V +T++              E +    G YFGE+AL+ N PR A+ YA+G  K   +D +++ RLLGPC+D M++N   Y  QL+ L  
Sbjct:    9 LTELLQSFTVEVLRNQPRDLLEFALQYFTQ--LKDNETKEAAFGN--DQNSAPRSGKAVNFIDEAMQIDSENGEEEEDDDDDDDEEFIAPVINRFIRRASVCAEAFNPD--EDEEDKEPRRGFKFVSSPQPKMFDIL---FIFQ--EEI--SQVLDAMFEKFCTEGEHIIDQDDDGDNFYVIESGTFNIFVKVDGIEKLVGCYDNRGSFGELALMYNTPRAATIIATSPGALWCLDRLTFRRIIVKNNAKKRRLYEAFIETLPLLTSLETSERMKVVDVLSTRVYNDSQQIIAQGDLADCFYIVESGQVRITMKRSRMTKKDQEEEEVEIATCTRGQYFGELALVTNKPRAASAYAVGSVKCLVMDVQAFERLLGPCMDIMKRNIANYEEQLQSLFG 392          
BLAST of cAMP-dependent protein kinase type II regulatory subunit vs. Ensembl Medaka
Match: prkar1b (protein kinase cAMP-dependent type I regulatory subunit beta [Source:NCBI gene;Acc:101155602])

HSP 1 Score: 176.792 bits (447), Expect = 8.519e-51
Identity = 103/262 (39.31%), Postives = 152/262 (58.02%), Query Frame = 1
Query:  400 RKIYPKTPKQMDKITDILETIFFFNCLDEIQFSKIIQSMFFIEVFKGDEIIKENDPGNNFYVIDYGTFTASNKSKSIYEVYKGEGFFGELALLYNCPRSASVIADTDGGLWVIDRVTFRQLILKSAYQKRQRYLKFISSVPLLEDLTKYEQCNLADALKTKTI-NNEKVISQGDAGDKMYFIXXXXXXXXXXXXXXX--XXXSRLKAGDYFGEVALLANIPRIANVYALGYTKLAELDAKSYTRLLGPCIDNMRKNFTKYRS 1176
            RK+ PK  K M  +   +     F  LD+ + S I  +MF +    G+ +I++ D G+NFYVID G        + +  + +G G FGELAL+Y  PR+A+V A TD  LW IDR ++R++++ S  +KR+ Y +F+S V +LE L K+E+  +ADAL+     + EK++ QG+ GD  + I EG   V  R  + E   E  RL   DYFGE+ALL N PR A V A G  K  +LD   + R+LGPC + +++N  +Y S
Sbjct:  114 RKVIPKDYKTMTALAKAISKNVLFAHLDDNERSDIFDAMFPVTHIAGETVIQQGDEGDNFYVIDQGEVDVYVNGELVTNIGEG-GSFGELALIYGTPRAATVKAKTDLKLWGIDRDSYRRILMGSTLRKRKMYEEFLSKVSILESLDKWERLTVADALEPVQFEDGEKIVVQGEPGDDFFIITEGIASVLQRRSDNEEYVEVGRLGPSDYFGEIALLLNRPRAATVVARGPLKCVKLDRPRFERVLGPCSEILKRNIQRYNS 374          
BLAST of cAMP-dependent protein kinase type II regulatory subunit vs. Planmine SMEST
Match: SMESG000051354.1 (SMESG000051354.1)

HSP 1 Score: 753.051 bits (1943), Expect = 0.000e+0
Identity = 389/390 (99.74%), Postives = 389/390 (99.74%), Query Frame = 1
Query:   67 MNNQNYSKKILTEVIEEFKKQVEIANPKDIIAYAATYFTKKVAQENESNDTEFDKSLDYDSSSEDGDSLKEIMSNDKSKMKLVQTSNVPRQSITCESFDPSSIDDETFEKNRKIYPKTPKQMDKITDILETIFFFNCLDEIQFSKIIQSMFFIEVFKGDEIIKENDPGNNFYVIDYGTFTASNKSKSIYEVYKGEGFFGELALLYNCPRSASVIADTDGGLWVIDRVTFRQLILKSAYQKRQRYLKFISSVPLLEDLTKYEQCNLADALKTKTINNEKVISQGDAGDKMYFIXXXXXXXXXXXXXXXXXXSRLKAGDYFGEVALLANIPRIANVYALGYTKLAELDAKSYTRLLGPCIDNMRKNFTKYRSQLEKLLSRHQLEELFPELIN 1236
            MNNQNYS KILTEVIEEFKKQVEIANPKDIIAYAATYFTKKVAQENESNDTEFDKSLDYDSSSEDGDSLKEIMSNDKSKMKLVQTSNVPRQSITCESFDPSSIDDETFEKNRKIYPKTPKQMDKITDILETIFFFNCLDEIQFSKIIQSMFFIEVFKGDEIIKENDPGNNFYVIDYGTFTASNKSKSIYEVYKGEGFFGELALLYNCPRSASVIADTDGGLWVIDRVTFRQLILKSAYQKRQRYLKFISSVPLLEDLTKYEQCNLADALKTKTINNEKVISQGDAGDKMYFIEEGEVLVTVRTGEEEREESRLKAGDYFGEVALLANIPRIANVYALGYTKLAELDAKSYTRLLGPCIDNMRKNFTKYRSQLEKLLSRHQLEELFPELIN
Sbjct:    1 MNNQNYSNKILTEVIEEFKKQVEIANPKDIIAYAATYFTKKVAQENESNDTEFDKSLDYDSSSEDGDSLKEIMSNDKSKMKLVQTSNVPRQSITCESFDPSSIDDETFEKNRKIYPKTPKQMDKITDILETIFFFNCLDEIQFSKIIQSMFFIEVFKGDEIIKENDPGNNFYVIDYGTFTASNKSKSIYEVYKGEGFFGELALLYNCPRSASVIADTDGGLWVIDRVTFRQLILKSAYQKRQRYLKFISSVPLLEDLTKYEQCNLADALKTKTINNEKVISQGDAGDKMYFIEEGEVLVTVRTGEEEREESRLKAGDYFGEVALLANIPRIANVYALGYTKLAELDAKSYTRLLGPCIDNMRKNFTKYRSQLEKLLSRHQLEELFPELIN 390          
BLAST of cAMP-dependent protein kinase type II regulatory subunit vs. Planmine SMEST
Match: SMESG000017499.1 (SMESG000017499.1)

HSP 1 Score: 256.914 bits (655), Expect = 7.819e-82
Identity = 159/383 (41.51%), Postives = 231/383 (60.31%), Query Frame = 1
Query:   97 LTEVIEEFKKQVEIANPKDIIAYAATYFTKKVAQENESNDTEFDKSLDYDSSSEDGDSLKEIMSNDKSKMKLVQTSNVPRQSITCESFDPSSIDDETFEKNRKIYPKTPKQMDKITDILETIFFFNCLDEIQFSKIIQSMFFIEVFKGDEIIKENDPGNNFYVIDYGTFTASNKSKSIYEVYKGEGFFGELALLYNCPRSASVIADTDGGLWVIDRVTFRQLILKSAYQKRQRYLKFISSVPLLEDLTKYEQCNLADALKTKTI-NNEKVISQGDAGDKMYFIXXXXXXXXXXXXXXX--XXXSRLKAGDYFGEVALLANIPRIANVYALGYTKLAELDAKSYTRLLGPCIDNMRKNFTKYRSQLEKLLSRHQLEELFPELIN 1236
            LTE+++ F   V    P +++ YA  YF    ++  E N++         + SED D       ND +  K VQ     RQS+  ESFDP   DDE       IY KT  Q  ++ + ++ IF F  LD+ Q  K+I SM  + V    ++I + D G++FYVI+ G F        I   Y   G FGELAL+YN PR+A++I+ T+G LW +DR TFR ++LK+A++KRQ Y   + SV LL++L+ Y++ N+ADAL ++T  ++E ++ QG  G +M+FIE GEV V   T +    +E +RL  GDYFGEVALL   PR+A+VYA+G T +A LD KS+ RLLGPCI+ M+KN  KYR+QL ++L   +++E+ PEL +
Sbjct:   12 LTELLQNFAISVLRHKPHNLVHYAFEYFKDLSSKHEEINNS------GNHTHSEDSD-------NDDNIKKQVQRGR--RQSVAAESFDPEKEDDEDLPV---IYSKTDAQRSRLVEAIKPIFLFRSLDDEQRGKVIDSMREVVVESDQKVIVQGDGGDDFYVIEKGMFDIFVNGSKIGN-YSDTGSFGELALMYNTPRAATIISVTNGILWAMDRKTFRHIVLKNAFKKRQMYEGLLQSVDLLDELSSYDRTNVADALVSRTYEDSEMILEQGKPGMEMFFIENGEVRVIRDTNDGSPPKEVNRLHKGDYFGEVALLIKEPRLASVYAVGKTTVAVLDIKSFERLLGPCINLMKKNLPKYRNQLREILGS-KVDEMVPELAH 374          
BLAST of cAMP-dependent protein kinase type II regulatory subunit vs. Planmine SMEST
Match: SMESG000019065.1 (SMESG000019065.1)

HSP 1 Score: 249.595 bits (636), Expect = 5.830e-79
Identity = 147/379 (38.79%), Postives = 222/379 (58.58%), Query Frame = 1
Query:  103 EVIEEFKKQVEIANPKDIIAYAATYFTKKVAQENESNDTEFDKSLDYDSSSEDGDSLKEIMSNDKSKMKLVQTSNVPRQSITCESFDPSSIDDETFEKNRKIYPKTPKQMDKITDILETIFFFNCLDEIQFSKIIQSMFFIEVFKGDEIIKENDPGNNFYVIDYGTF---TASNKSKSIYEVYKGEGFFGELALLYNCPRSASVIADTDGGLWVIDRVTFRQLILKSAYQKRQRYLKFISSVPLLEDLTKYEQCNLADALKTKTIN-NEKVISQGDAGDKMYFIXX--XXXXXXXXXXXXXXXXSRLKAGDYFGEVALLANIPRIANVYALGYTKLAELDAKSYTRLLGPCIDNMRKNFTKYRSQLEKLL-SRHQLEEL 1218
            E++++F   V   NP+DII +   YF  K +++ +S           DS SE+ D ++E+    + + +        R+ +  ESFDP   DD   E  R +YPKTP+Q  ++   ++ I  F CLDE Q   +I +MF   V +G+++I + + G+NFYVI+ GT+      N   +    Y G G FGELAL+YN PR+A++    DG +W + R TFR ++LK A+QKR +Y   + +VPLL++L+ YE+ N+ADAL T+    N  +I QG+ G +MYF+EE    V V     + E E +R+  G YFGE+ALL   PR A+VY +  TKLA LD  S+ RLLGPC+D M+++ + Y  QL+ +  S H++ EL
Sbjct:   14 ELLQDFTVCVLRDNPEDIIQFGIDYFKTKKSEQLQSAH--------LDSESENDDQMEELPPMPRPQGR--------RRGVAAESFDPEKEDDPNQE--RIVYPKTPEQRARLNMAVQNILLFRCLDEEQMVDVIDAMFERRVVQGEKVIIQGEDGDNFYVIESGTYDIIVKINGVDTKVGKYDGSGSFGELALMYNTPRAATIQTVNDGVVWAMTRETFRSIVLKKAFQKRLKYEALLENVPLLKELSPYERMNIADALLTRIYEPNTTIIKQGEPGLEMYFLEEGCVRVTVREAGSDTEAEVTRIGPGGYFGELALLTKHPRAASVYCVEKTKLAILDVGSFERLLGPCLDIMQRSISNYEEQLKGIFGSLHKMPEL 374          
BLAST of cAMP-dependent protein kinase type II regulatory subunit vs. Planmine SMEST
Match: SMESG000023850.1 (SMESG000023850.1)

HSP 1 Score: 223.016 bits (567), Expect = 1.595e-68
Identity = 137/358 (38.27%), Postives = 208/358 (58.10%), Query Frame = 1
Query:  145 PKDIIAYAATYFTKKVAQENESNDTEFDKSLDYDSSSEDGDSLKEIM-SNDKSKMKLVQTSNVPRQSITCESFDPSSIDDETFEKNRKIYPKTPKQMDKITDILETIFFFNCLDEIQFSKIIQSMFFIEVFKGDEIIKENDPGNNFYVIDYGTFTA----SNKSKSIYEVYKGEGFFGELALLYNCPRSASVIADTDGGLWVIDRVTFRQLILKSAYQKRQRYLKFISSVPLLEDLTKYEQCNLADALKTKTINN-EKVISQGDAGDKMYFIXXXXXXXXXXXXXXXXXXSRLKAGDYFGEVALLANIPRIANVYALGYTKLAELDAKSYTRLLGPCIDNMRKNFTKYRSQLEKLLSR 1200
            P D + Y + YF K     +E    +  KS   D S    +SL + + S D   +++   +N  R+S+  E       D +  +    + PKT +Q  ++ ++ + I  F  LD+ Q + +I +MF +E   G+ II + D G+NFYVID G F       +K K I+ VY+ EGFFGELAL+YN  RSA+V A+T G LW +DR TFR L++   + ++Q Y  F+   P+ +++T  E+ N+ADAL  K  ++ E +I QG  G +M+FIE GEVL+T     +E E +RL  G YFGE+ALL+N  R A+  A+G T+ A LD K++ RL+GPC++ M++N   Y +QLE L  +
Sbjct:   28 PDDFVEYVSNYFLKIY---DEQGHNKVYKSPHNDQSDSFVNSLLDSLDSIDSEDIEVKPKANYRRKSVAAER--IDMDDIDDDDDIYAVIPKTDEQRQRLKEVCKQILLFQALDDDQLNHVINAMFLVEPKPGENIIVQGDDGDNFYVIDSGIFNCYIKDGDKDKLIH-VYENEGFFGELALMYNAVRSATVTAETAGTLWAMDRKTFRSLVVVQTHNRKQIYDTFLKQFPIFQEMTASERMNIADALVPKKYDDKEVIIKQGRPGQEMFFIENGEVLITKVHQGKEIEITRLHVGQYFGELALLSNQARQASAQAVGETRCAMLDVKTFERLMGPCLEIMKRNIEDYNTQLENLFGK 379          
BLAST of cAMP-dependent protein kinase type II regulatory subunit vs. Planmine SMEST
Match: SMESG000057377.1 (SMESG000057377.1)

HSP 1 Score: 222.246 bits (565), Expect = 2.216e-68
Identity = 139/369 (37.67%), Postives = 208/369 (56.37%), Query Frame = 1
Query:  106 VIEEFKKQVEIANPKDIIAYAATYFTKKVAQENESNDTEFDKSLDYDSSSEDGDSLKEIMSNDK-SKMKLVQTSNVPRQSITCESFDPSSIDDETFEKNRKIYPKTPKQMDKITDILETIFFFNCLDEIQFSKIIQSMFFIEVFKGDEIIKENDPGNNFYVID---YGTFTASNKSKSIYEVYKGEGFFGELALLYNCPRSASVIADTDGGLWVIDRVTFRQLILKSAYQKRQRYLKFISSVPLLEDLTKYEQCNLADALKTK-TINNEKVISQGDAGDKMYFIXXXXXXXXXXXXXXXXXXSRLKAGDYFGEVALLANIPRIANVYALGYTKLAELDAKSYTRLLGPCIDNMRKNFTKYRSQLEKLLS 1197
            ++ +F   V    P + I +A+ YFT+   Q N+S        LD  +SS    SL E   ND    +   Q +N  R+S+  E F+P  ++  + +   +++ K+ +Q  ++  + E +  F  L     + II +M+ I+V  G EII E D G+NFY+I+   Y  F   N  K   + Y  EG FGELAL+YN  R+AS+IA T G +W + R  FR ++L  A+++R+ Y K +  VP+L  L+ +E+ N+ADAL  K  I+ E +I +GD G  MYFI  G+V +   T EE+   + L  G YFGE+ALL+N PR ANV AL  T LA LD KS+ RL+GPCI+ M++N   Y+  +  L +
Sbjct:   14 ILHQFTYAVMERKPTNYIHFASKYFTR--LQNNQS--------LDRITSSFGSVSLSEASDNDSVDTLDSKQYAN-RRKSVAAERFNPEDLN--SLDIQMEVHEKSEEQRSRLRKVCEKVSIFKSLSNADVTSIIDAMYEIKVKPGQEIIVEGDSGDNFYIIESGIYDAFITVNGEKKKIKTYDNEGNFGELALMYNALRAASIIASTSGIIWAVTRQVFRSVVLVKAHRQREMYNKLLEQVPMLAPLSDFERANIADALTPKECISKELIIVEGDPGYHMYFIISGKVEIYRTTVEEKVVINELGPGKYFGELALLSNQPRAANVKALEDTVLAVLDVKSFERLMGPCIEVMKRNMDDYKKNVVDLFN 369          
The following BLAST results are available for this feature:
BLAST of cAMP-dependent protein kinase type II regulatory subunit vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PRKAR2B2.615e-6432.26protein kinase cAMP-dependent type II regulatory s... [more]
PRKAR2B2.615e-6432.26protein kinase cAMP-dependent type II regulatory s... [more]
PRKAR2A3.195e-6434.45protein kinase cAMP-dependent type II regulatory s... [more]
PRKAR2A3.195e-6434.45protein kinase cAMP-dependent type II regulatory s... [more]
PRKAR2A1.281e-6132.99protein kinase cAMP-dependent type II regulatory s... [more]
back to top
BLAST of cAMP-dependent protein kinase type II regulatory subunit vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kin-26.943e-4535.00cAMP-dependent protein kinase regulatory subunit ... [more]
kin-21.120e-4435.02cAMP-dependent protein kinase regulatory subunit ... [more]
kin-21.586e-4435.02cAMP-dependent protein kinase regulatory subunit ... [more]
egl-41.914e-2526.94cGMP-dependent protein kinase egl-4 [Source:UniPr... [more]
egl-41.914e-2526.94cGMP-dependent protein kinase egl-4 [Source:UniPr... [more]
back to top
BLAST of cAMP-dependent protein kinase type II regulatory subunit vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pka-R23.847e-8240.11gene:FBgn0022382 transcript:FBtr0088437[more]
Pka-R23.847e-8240.11gene:FBgn0022382 transcript:FBtr0088438[more]
Pka-R29.363e-7538.50gene:FBgn0022382 transcript:FBtr0112902[more]
Pka-R21.391e-7438.34gene:FBgn0022382 transcript:FBtr0112901[more]
Pka-R14.094e-5637.86gene:FBgn0259243 transcript:FBtr0300532[more]
back to top
BLAST of cAMP-dependent protein kinase type II regulatory subunit vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
prkar2aa9.554e-6433.68protein kinase, cAMP-dependent, regulatory, type I... [more]
PRKAR2B3.392e-6233.33si:ch211-272n13.7 [Source:ZFIN;Acc:ZDB-GENE-160113... [more]
PRKAR2B9.711e-6234.38si:ch211-272n13.7 [Source:ZFIN;Acc:ZDB-GENE-160113... [more]
PRKAR2B1.962e-6034.11si:ch211-272n13.7 [Source:ZFIN;Acc:ZDB-GENE-160113... [more]
prkar2ab4.288e-5235.81protein kinase, cAMP-dependent, regulatory, type I... [more]
back to top
BLAST of cAMP-dependent protein kinase type II regulatory subunit vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ednrb21.463e-6432.98endothelin receptor B subtype 2 [Source:Xenbase;Ac... [more]
ednrb24.693e-6432.74endothelin receptor B subtype 2 [Source:Xenbase;Ac... [more]
fgf11.781e-6032.31fibroblast growth factor 1 [Source:Xenbase;Acc:XB-... [more]
fgf11.674e-5931.65fibroblast growth factor 1 [Source:Xenbase;Acc:XB-... [more]
fgf11.099e-5637.45fibroblast growth factor 1 [Source:Xenbase;Acc:XB-... [more]
back to top
BLAST of cAMP-dependent protein kinase type II regulatory subunit vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Prkar2a2.010e-6534.10protein kinase, cAMP dependent regulatory, type II... [more]
Prkar2a5.285e-6232.90protein kinase, cAMP dependent regulatory, type II... [more]
Prkar2b1.396e-6131.92protein kinase, cAMP dependent regulatory, type II... [more]
Prkar2b1.396e-6131.92protein kinase, cAMP dependent regulatory, type II... [more]
Prkar1b4.659e-5232.71protein kinase, cAMP dependent regulatory, type I ... [more]
back to top
BLAST of cAMP-dependent protein kinase type II regulatory subunit vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P81900|KAPR2_DROME3.856e-8140.11cAMP-dependent protein kinase type II regulatory s... [more]
sp|Q26619|KAPR_STRPU6.834e-6736.34cAMP-dependent protein kinase type II regulatory s... [more]
sp|P00515|KAP2_BOVIN1.786e-6434.29cAMP-dependent protein kinase type II-alpha regula... [more]
sp|P31323|KAP3_HUMAN1.256e-6332.26cAMP-dependent protein kinase type II-beta regulat... [more]
sp|P13861|KAP2_HUMAN1.534e-6334.45cAMP-dependent protein kinase type II-alpha regula... [more]
back to top
BLAST of cAMP-dependent protein kinase type II regulatory subunit vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3Q0KLT71.204e-8046.13Putative camp-dependent protein kinase type II reg... [more]
A0A095C9J62.208e-8044.22cAMP-dependent protein kinase type II regulatory s... [more]
A0A3B0IZR13.510e-7940.65Blast:cAMP-dependent protein kinase type II regula... [more]
T1E2403.806e-7941.08Putative camp-dependent protein kinase r2 OS=Psoro... [more]
A0A4Z2CNG37.360e-7944.19cAMP-dependent protein kinase type II regulatory s... [more]
back to top
BLAST of cAMP-dependent protein kinase type II regulatory subunit vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:ch211-272n13.73.002e-6534.67protein kinase cAMP-dependent type II regulatory s... [more]
prkar2aa4.320e-5832.22protein kinase, cAMP-dependent, regulatory, type I... [more]
prkar2ab1.206e-5533.42protein kinase, cAMP-dependent, regulatory, type I... [more]
prkar1ab1.564e-5139.69cAMP-dependent protein kinase type I-alpha regulat... [more]
prkar1b1.052e-5039.69protein kinase cAMP-dependent type I regulatory su... [more]
back to top
BLAST of cAMP-dependent protein kinase type II regulatory subunit vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
prkar2aa2.350e-4642.35protein kinase, cAMP-dependent, regulatory, type I... [more]
si:ch211-272n13.78.188e-4229.64protein kinase cAMP-dependent type II regulatory s... [more]
ENSPMAT00000001198.11.365e-2027.60pep scaffold:Pmarinus_7.0:GL480445:10050:25657:1 g... [more]
ENSPMAT00000001825.17.693e-1727.27pep scaffold:Pmarinus_7.0:GL485714:520:7294:-1 gen... [more]
ENSPMAT00000005026.13.765e-1349.15pep scaffold:Pmarinus_7.0:GL484567:1893:8879:-1 ge... [more]
back to top
BLAST of cAMP-dependent protein kinase type II regulatory subunit vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
BCY11.074e-5038.21Regulatory subunit of the cyclic AMP-dependent pro... [more]
back to top
BLAST of cAMP-dependent protein kinase type II regulatory subunit vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO382623.247e-7034.66Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO484391.381e-5338.89Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO495342.258e-5331.66Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO411632.732e-4734.32Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO383991.264e-2833.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of cAMP-dependent protein kinase type II regulatory subunit vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:ch211-272n13.71.585e-6634.01protein kinase cAMP-dependent type II regulatory s... [more]
prkar2aa5.278e-6232.98cAMP-dependent protein kinase type II-alpha regula... [more]
prkar2aa1.032e-5933.06cAMP-dependent protein kinase type II-alpha regula... [more]
si:ch211-272n13.71.364e-5933.75protein kinase cAMP-dependent type II regulatory s... [more]
prkar1b8.519e-5139.31protein kinase cAMP-dependent type I regulatory su... [more]
back to top
BLAST of cAMP-dependent protein kinase type II regulatory subunit vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000051354.10.000e+099.74SMESG000051354.1[more]
SMESG000017499.17.819e-8241.51SMESG000017499.1[more]
SMESG000019065.15.830e-7938.79SMESG000019065.1[more]
SMESG000023850.11.595e-6838.27SMESG000023850.1[more]
SMESG000057377.12.216e-6837.67SMESG000057377.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30008798 ID=SMED30008798|Name=cAMP-dependent protein kinase type II regulatory subunit|organism=Schmidtea mediterranea sexual|type=transcript|length=1311bp
ACCGAACTGAATTATGAATTGTTTTACTGAATTATCAAGGTTAATTATTA
TCAGTTGAATTGTAACATGAATAATCAAAATTATTCCAAAAAAATATTAA
CAGAAGTTATAGAAGAATTCAAGAAACAAGTTGAAATTGCAAATCCAAAA
GATATCATTGCATATGCAGCGACATACTTTACAAAAAAAGTAGCACAAGA
AAATGAATCAAACGACACCGAATTTGACAAAAGTCTAGATTATGATTCCT
CTTCAGAAGATGGAGACTCACTAAAAGAAATTATGTCAAACGACAAATCA
AAAATGAAATTGGTTCAAACCTCAAATGTTCCAAGACAAAGCATAACGTG
TGAATCATTTGATCCGTCTTCAATTGATGATGAAACGTTTGAAAAAAATC
GAAAAATCTACCCCAAGACTCCAAAACAAATGGATAAGATCACCGATATA
CTTGAAACTATCTTTTTTTTCAATTGTTTGGATGAGATACAATTTTCTAA
AATTATTCAGTCAATGTTTTTCATTGAAGTGTTCAAAGGGGACGAGATCA
TCAAAGAAAACGATCCGGGAAACAATTTCTATGTCATTGACTACGGCACA
TTCACTGCGTCTAATAAAAGTAAGTCAATTTATGAAGTGTACAAAGGAGA
AGGATTTTTTGGAGAATTGGCTTTGCTTTATAACTGTCCGAGATCAGCAT
CCGTTATCGCTGATACAGACGGTGGGCTGTGGGTGATTGACCGAGTTACC
TTTCGTCAACTGATACTTAAGAGTGCTTACCAAAAAAGACAAAGATATTT
GAAATTCATAAGTTCAGTGCCATTATTGGAAGATTTGACAAAATATGAGC
AATGCAATCTAGCAGATGCTCTGAAAACAAAAACTATAAACAATGAAAAA
GTCATATCACAAGGAGATGCTGGAGACAAAATGTATTTTATTGAAGAAGG
AGAAGTTCTTGTCACAGTTCGAACTGGGGAAGAAGAACGAGAAGAAAGCC
GTTTAAAAGCCGGAGATTATTTTGGAGAAGTCGCTCTTTTGGCAAATATC
CCGCGTATAGCTAATGTATACGCCCTTGGATATACAAAACTAGCTGAGCT
TGATGCTAAAAGTTATACGAGGTTACTCGGTCCATGCATTGACAATATGA
GAAAGAACTTCACGAAGTACCGGAGCCAGTTGGAAAAGCTGCTCTCAAGA
CACCAATTGGAAGAATTATTTCCAGAGTTAATTAATTAATTTGTAATGAA
ATAATTATTTGGATTAAACAATAAAACATTGAAAATAAATTGTTTCTCTA
TTTCAAATACC
back to top

protein sequence of SMED30008798-orf-1

>SMED30008798-orf-1 ID=SMED30008798-orf-1|Name=SMED30008798-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=391bp
MNNQNYSKKILTEVIEEFKKQVEIANPKDIIAYAATYFTKKVAQENESND
TEFDKSLDYDSSSEDGDSLKEIMSNDKSKMKLVQTSNVPRQSITCESFDP
SSIDDETFEKNRKIYPKTPKQMDKITDILETIFFFNCLDEIQFSKIIQSM
FFIEVFKGDEIIKENDPGNNFYVIDYGTFTASNKSKSIYEVYKGEGFFGE
LALLYNCPRSASVIADTDGGLWVIDRVTFRQLILKSAYQKRQRYLKFISS
VPLLEDLTKYEQCNLADALKTKTINNEKVISQGDAGDKMYFIEEGEVLVT
VRTGEEEREESRLKAGDYFGEVALLANIPRIANVYALGYTKLAELDAKSY
TRLLGPCIDNMRKNFTKYRSQLEKLLSRHQLEELFPELIN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0016301kinase activity
GO:0008603cAMP-dependent protein kinase regulator activity
GO:0000166nucleotide binding
GO:0005515protein binding
GO:0030552cAMP binding
Vocabulary: biological process
TermDefinition
GO:0016310phosphorylation
GO:2000479regulation of cAMP-dependent protein kinase activity
GO:0001932regulation of protein phosphorylation
GO:0007411axon guidance
GO:0007622rhythmic behavior
GO:0007623circadian rhythm
GO:0045475locomotor rhythm
GO:0045859regulation of protein kinase activity
GO:0048148behavioral response to cocaine
GO:0048149behavioral response to ethanol
GO:0048511rhythmic process
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000070intestinal phagocyte
Vocabulary: INTERPRO
TermDefinition
IPR000595cNMP-bd_dom
IPR012198cAMP_dep_PK_reg_su
IPR014710RmlC-like_jellyroll
IPR003117cAMP_dep_PK_reg_su_I/II_a/b
IPR018488cNMP-bd_CS
IPR018490cNMP-bd-like
Vocabulary: cellular component
TermDefinition
GO:0005952cAMP-dependent protein kinase complex
GO:0005737cytoplasm
GO:0005886plasma membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 358..378
NoneNo IPR availablePRINTSPR00103CAMPKINASEcoord: 329..340
score: 44.17
coord: 317..326
score: 70.33
coord: 288..302
score: 35.78
coord: 350..362
score: 48.97
coord: 273..287
score: 51.78
NoneNo IPR availablePANTHERPTHR11635:SF162CAMP-DEPENDENT PROTEIN KINASE TYPE II REGULATORY SUBUNITcoord: 8..378
NoneNo IPR availablePANTHERPTHR11635CAMP-DEPENDENT PROTEIN KINASE REGULATORY CHAINcoord: 8..378
NoneNo IPR availableSUPERFAMILYSSF47391Dimerization-anchoring domain of cAMP-dependent PK regulatory subunitcoord: 9..44
IPR000595Cyclic nucleotide-binding domainSMARTSM00100cnmp_10coord: 253..372
e-value: 1.3E-16
score: 71.2
coord: 134..248
e-value: 2.1E-13
score: 60.5
IPR000595Cyclic nucleotide-binding domainPFAMPF00027cNMP_bindingcoord: 157..234
e-value: 5.4E-16
score: 58.4
coord: 276..354
e-value: 8.4E-15
score: 54.6
IPR000595Cyclic nucleotide-binding domainPROSITEPS50042CNMP_BINDING_3coord: 253..371
score: 30.856
IPR000595Cyclic nucleotide-binding domainPROSITEPS50042CNMP_BINDING_3coord: 134..250
score: 30.817
IPR000595Cyclic nucleotide-binding domainCDDcd00038CAP_EDcoord: 134..233
e-value: 1.25818E-22
score: 89.6925
IPR000595Cyclic nucleotide-binding domainCDDcd00038CAP_EDcoord: 253..363
e-value: 1.00874E-25
score: 98.1669
IPR012198cAMP-dependent protein kinase regulatory subunitPIRSFPIRSF000548PK_regulatorycoord: 1..382
e-value: 8.6E-93
score: 309.4
IPR014710RmlC-like jelly roll foldGENE3DG3DSA:2.60.120.10coord: 92..234
e-value: 6.7E-38
score: 131.5
IPR014710RmlC-like jelly roll foldGENE3DG3DSA:2.60.120.10coord: 235..378
e-value: 7.0E-41
score: 141.1
IPR018488Cyclic nucleotide-binding, conserved sitePROSITEPS00889CNMP_BINDING_2coord: 198..215
IPR018488Cyclic nucleotide-binding, conserved sitePROSITEPS00888CNMP_BINDING_1coord: 279..295
IPR018490Cyclic nucleotide-binding-likeSUPERFAMILYSSF51206cAMP-binding domain-likecoord: 115..235
IPR018490Cyclic nucleotide-binding-likeSUPERFAMILYSSF51206cAMP-binding domain-likecoord: 239..359