innexin-1

Overview
Nameinnexin-1 (AFJ24866.1)
Smed IDSMED30008787
Length (bp)1879
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of innexin-1 (SMED30008787) t-SNE clustered cells

Violin plots show distribution of expression levels for innexin-1 (SMED30008787) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of innexin-1 (SMED30008787) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for innexin-1 (SMED30008787) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30008787

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 12

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30008787SMESG000043134.1 SmedASXL_015206SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30008787SMESG000043134.1 SmedASXL_015206SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X1 cellSMED30008787SMESG000043134.1 SmedASXL_015207SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30008787SMESG000043134.1 SmedASXL_015207SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
nervous systemSMED30008787SMESG000043134.1 dd_Smed_v4_11254_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30008787SMESG000043134.1 dd_Smed_v4_11254_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30008787SMESG000043134.1 dd_Smed_v4_11254_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30008787SMESG000043134.1 dd_Smed_v4_11254_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
eyeSMED30008787SMESG000043134.1 Contig38798newmark_estsPMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
eyeSMED30008787SMESG000043134.1 Contig38798uc_Smed_v2PMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
neuronSMED30008787SMESG000043134.1 Contig38798newmark_estsPMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
neuronSMED30008787SMESG000043134.1 Contig38798uc_Smed_v2PMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of innexin-1 vs. Ensembl Human
Match: PANX2 (pannexin 2 [Source:HGNC Symbol;Acc:HGNC:8600])

HSP 1 Score: 58.5362 bits (140), Expect = 2.489e-8
Identity = 45/158 (28.48%), Postives = 67/158 (42.41%), Query Frame = 2
Query:  488 FDRCVYILTFTLLLVCSATVTIKSYVLEPMTCYAPSTISGSNVLPYINNYCW--IVGTIPKAVHEHNTDDEEYWKWLESRKINYYQWVPFVLGLQAALLYIPYVFWECLIYNRLGTNLQFLIDLARKASLDFGESRQRKISQMAGSIFILLTTRKKKS 955
            FDR V I T  + ++    V  K++  EP+ CY P   +    L Y   YCW  +   +P         D   W  L   K     ++P+ L   AA++Y+P + WE L   RL + L FL+           E R  KI +   S    +T R+K+ 
Sbjct:   50 FDRVVTIGTVLVPILLVTLVFTKNFAEEPIYCYTPHNFTRDQAL-YARGYCWTELRDALPGV-------DASLWPSLFEHK-----FLPYALLAFAAIMYVPALGWEFLASTRLTSELNFLLQEIDNCYHRAAEGRAPKIEKQIQSKGPGITEREKRE 194          
BLAST of innexin-1 vs. Ensembl Human
Match: PANX2 (pannexin 2 [Source:HGNC Symbol;Acc:HGNC:8600])

HSP 1 Score: 58.5362 bits (140), Expect = 2.535e-8
Identity = 45/158 (28.48%), Postives = 67/158 (42.41%), Query Frame = 2
Query:  488 FDRCVYILTFTLLLVCSATVTIKSYVLEPMTCYAPSTISGSNVLPYINNYCW--IVGTIPKAVHEHNTDDEEYWKWLESRKINYYQWVPFVLGLQAALLYIPYVFWECLIYNRLGTNLQFLIDLARKASLDFGESRQRKISQMAGSIFILLTTRKKKS 955
            FDR V I T  + ++    V  K++  EP+ CY P   +    L Y   YCW  +   +P         D   W  L   K     ++P+ L   AA++Y+P + WE L   RL + L FL+           E R  KI +   S    +T R+K+ 
Sbjct:   50 FDRVVTIGTVLVPILLVTLVFTKNFAEEPIYCYTPHNFTRDQAL-YARGYCWTELRDALPGV-------DASLWPSLFEHK-----FLPYALLAFAAIMYVPALGWEFLASTRLTSELNFLLQEIDNCYHRAAEGRAPKIEKQIQSKGPGITEREKRE 194          
BLAST of innexin-1 vs. Ensembl Celegans
Match: unc-9 (Innexin unc-9 [Source:UniProtKB/Swiss-Prot;Acc:O01393])

HSP 1 Score: 186.037 bits (471), Expect = 1.042e-52
Identity = 116/376 (30.85%), Postives = 190/376 (50.53%), Query Frame = 2
Query:  482 DIFDRCVYILTFTLLLVCSATVTIKSYVLEPMTCYAPSTISGSNVLPYINNYCWIVGTIPKAVHE---HNTDDEEYWKWLESRKINYYQWVPFVLGLQAALLYIPYVFWECLIYNRLGTNLQFLIDLARKASLDFGESRQRKISQMAGSIFILLTTRKKKSE----KAIGLLSKFPIYKMEIVFHYLLLKVISIVMICSQFVIMEKLLNMNGKHKLFGITVLQDLLNGRYWDVTNLFPRMAFCRVPFKMQNTNVVNITTQCSLSINLINEKIFIFLWWWFSLIASLQIISLFIWIARCLSSDRRVRFINHSAQISRSFPSHNEHLIKQFERNLISIDGIFLIHMTRINCGDLICNELIHKLYEIHATSLANRGDDL 1588
            DI D+  Y  T  ++ V +  V+ K YV  P+ C+ P+T +   +  Y  NYCW+  T    +H+   HN  + E      +R+I YYQWVPFVL L+A L Y+P + W  L +   G ++Q L+ +A  + L   ESR R +  +A ++   L  + +       K + L+         + F Y+ +K++  V I  Q  ++   L    + K +G+ VL DL+NGR W+ +  FPR+  C    K+   NV   T QC L IN+ NEKIF+FLW+W+ L+A   + SLF WI   +   R++ F+         +   +   +++F  + +  DG+FL+ M   + G+L C EL   L+  +  +   +  D+
Sbjct:   22 DIIDKLNYYYTTAIITVFAILVSAKQYVGFPIQCWVPATFT-EPMEQYTENYCWVQNTYFLPLHDYIPHNYAERE------NRQIGYYQWVPFVLALEALLFYVPTIVWRLLSWQS-GIHVQSLVQMACDSRLLDLESRNRALQTIATNVEEALHVKHQVMSGNRLKLLNLIICTRSSGAAVTFLYISVKILYTVNIVGQIFLLNTFLG--NRSKWYGLQVLNDLMNGREWEESGHFPRVTLCDFEVKVLG-NVHRHTVQCVLMINMFNEKIFLFLWFWYFLLAGATLCSLFYWIYISVVPSRQLNFVGKYLTGIEGYKMVDSQSLRRFVFHFLRQDGVFLLRMVATHAGELPCYELAKTLWNNYCDNKEGKMHDV 386          
BLAST of innexin-1 vs. Ensembl Celegans
Match: inx-13 (Innexin [Source:UniProtKB/TrEMBL;Acc:O44887])

HSP 1 Score: 174.481 bits (441), Expect = 1.874e-48
Identity = 108/375 (28.80%), Postives = 187/375 (49.87%), Query Frame = 2
Query:  461 IHACGVYDIFDRCVYILTFTLLLVCSATVTIKSYVLEPMTCYAPSTISGSNVLPYINNYCWIVGTIPKAVHEHNTDDEEYWKWLESRKINYYQWVPFVLGLQAALLYIPYVFWECLIYNRLGTNLQFLIDLARKASLDFGESRQRKISQMAGSIFILLTTRKKKSEKAIGLLSKFPIYKMEIVFHYLLLKVISIVMICSQFVIMEKLLNMNGKHKLFGITVLQDLLNGRYWDVTNLFPRMAFCRVPFKMQNTNVVNITTQCSLSINLINEKIFIFLWWWFSLIASLQIISLFIWIARCLSSDRRVRFINHSAQISRSFP---SHNEHLIKQFERNLISIDGIFLIHMTRINCGDLICNELIHKLYEIHATSLANR 1576
            +H  G  D  DR  Y  T  LL++ + T++ K YV +P+ C+ P+  +G+    Y  NYC++  T   +  ++  D E      E  +I YYQWVPF+LGLQA L Y+P +FW  + +N  G  L+ ++  A+KA     ++R          ++  LT + + ++      S F      + + YL +K + +V I  QF+I+   L  +  +  +G+ +L D+LNGR W+ +  FPR+  C    ++   N    T QC L IN+ NEK+++FLW+W  ++     ++L  W  + +    R   I    QI  +F    S N  ++ +F    +  DG+F+ H+   N G +  +++I  +++       NR
Sbjct:   11 LHKQGDDDSIDRLNYYWTPMLLVIFALTLSAKQYVGQPIQCWIPAQFTGA-WEQYSENYCFVQNTYFISPDKYIPDSEID---REGAEIGYYQWVPFILGLQAILFYLPSLFWRLMNFNS-GVALKKMLFGAKKADRVDEKARNEAAKSTGAHLYESLTLQSRFAKYT----SAFTYGGSYLTYLYLFVKFLYLVQIVFQFIILNNFLGTS--YTFWGLGILSDILNGREWEESGHFPRVTMCDFEVRVLG-NKHRHTVQCVLMINMFNEKVYVFLWFWLVIVGVATFLNLVNWTRKLMFRSARKAHIKSYLQIEDNFSDDNSRNGQILDKFVDYKLKSDGVFITHLIDNNGGSVFSHDVIVDMWDRFLQDEDNR 373          
BLAST of innexin-1 vs. Ensembl Celegans
Match: inx-1 (Innexin [Source:UniProtKB/TrEMBL;Acc:Q17394])

HSP 1 Score: 167.933 bits (424), Expect = 4.080e-46
Identity = 105/361 (29.09%), Postives = 182/361 (50.42%), Query Frame = 2
Query:  482 DIFDRCVYILTFTLLLVCSATVTIKSYVLEPMTCYAPSTISGSNVLPYINNYCWIVGT----IPKAVHEHNTDDEEYWKWLESRKINYYQWVPFVLGLQAALLYIPYVFWECLIYNRLGTNLQFLIDLARKASLDFGESRQRKISQMAGSIFILLTTRKKKSEKAIGLLSKFPIYKMEIVFHYLLLKVISIVMICSQFVIMEKLLNMNGKHKLF-GITVLQDLLNGRYWDVTNLFPRMAFCRVPFKMQNTNVVNITTQCSLSINLINEKIFIFLWWWFSLIASLQIISLFIWIARCLSSDRRVRFINHSAQISRSFPSHNEHLIKQFERNLISIDGIFLIHMTRINCGDLICNELIHKLYE 1549
            D  D+  Y  T  ++   +  V+ K YV  P+ C+ P+  + +    Y  NYCW+  T    +  A      D         +R+I+YYQWVPFVL L+A   YIP + W  L++   G N+Q L  +A  A +   ++R   +  +AG +   L  +++ ++ +   + K   +   +   Y+ +K++ +  +  Q  ++   L   G   LF G  +L+DLLNGR W+V+  FPR+  C    ++   NV + T QC L IN+ NEKIF+FLW+W+ ++A +  +S+F WI       + ++FI    + +    + +   +K+F    +  DG+F + M   + GD++  ELI  L+ 
Sbjct:   20 DFVDKLNYHYTSAIIFAFAIIVSAKQYVGYPIQCWVPAQFTDA-WEQYTENYCWVENTYYLPLTSAFPLEYGDRR-------ARQISYYQWVPFVLALEALCFYIPCIMWRGLLHWHSGINVQSLTQMACDARMMDADARAATVQTIAGHMEDALEIQREVTDVSGMCVQK--RWANYVTLLYVFIKMLYLGNVVLQVFMLNSFL---GTDNLFYGFHILRDLLNGREWEVSGNFPRVTMCDFEVRVLG-NVHHHTVQCVLMINMFNEKIFLFLWFWYFMVAFVSAVSMFHWIIISFLPGQHMKFIRKYLRATDL--ATDRQSVKKFVHKFLGYDGVFCMRMISAHAGDILATELIVALWH 364          
BLAST of innexin-1 vs. Ensembl Celegans
Match: inx-1 (Innexin [Source:UniProtKB/TrEMBL;Acc:Q17394])

HSP 1 Score: 167.933 bits (424), Expect = 4.080e-46
Identity = 105/361 (29.09%), Postives = 182/361 (50.42%), Query Frame = 2
Query:  482 DIFDRCVYILTFTLLLVCSATVTIKSYVLEPMTCYAPSTISGSNVLPYINNYCWIVGT----IPKAVHEHNTDDEEYWKWLESRKINYYQWVPFVLGLQAALLYIPYVFWECLIYNRLGTNLQFLIDLARKASLDFGESRQRKISQMAGSIFILLTTRKKKSEKAIGLLSKFPIYKMEIVFHYLLLKVISIVMICSQFVIMEKLLNMNGKHKLF-GITVLQDLLNGRYWDVTNLFPRMAFCRVPFKMQNTNVVNITTQCSLSINLINEKIFIFLWWWFSLIASLQIISLFIWIARCLSSDRRVRFINHSAQISRSFPSHNEHLIKQFERNLISIDGIFLIHMTRINCGDLICNELIHKLYE 1549
            D  D+  Y  T  ++   +  V+ K YV  P+ C+ P+  + +    Y  NYCW+  T    +  A      D         +R+I+YYQWVPFVL L+A   YIP + W  L++   G N+Q L  +A  A +   ++R   +  +AG +   L  +++ ++ +   + K   +   +   Y+ +K++ +  +  Q  ++   L   G   LF G  +L+DLLNGR W+V+  FPR+  C    ++   NV + T QC L IN+ NEKIF+FLW+W+ ++A +  +S+F WI       + ++FI    + +    + +   +K+F    +  DG+F + M   + GD++  ELI  L+ 
Sbjct:   20 DFVDKLNYHYTSAIIFAFAIIVSAKQYVGYPIQCWVPAQFTDA-WEQYTENYCWVENTYYLPLTSAFPLEYGDRR-------ARQISYYQWVPFVLALEALCFYIPCIMWRGLLHWHSGINVQSLTQMACDARMMDADARAATVQTIAGHMEDALEIQREVTDVSGMCVQK--RWANYVTLLYVFIKMLYLGNVVLQVFMLNSFL---GTDNLFYGFHILRDLLNGREWEVSGNFPRVTMCDFEVRVLG-NVHHHTVQCVLMINMFNEKIFLFLWFWYFMVAFVSAVSMFHWIIISFLPGQHMKFIRKYLRATDL--ATDRQSVKKFVHKFLGYDGVFCMRMISAHAGDILATELIVALWH 364          
BLAST of innexin-1 vs. Ensembl Celegans
Match: unc-9 (Innexin unc-9 [Source:UniProtKB/Swiss-Prot;Acc:O01393])

HSP 1 Score: 165.236 bits (417), Expect = 9.685e-46
Identity = 102/329 (31.00%), Postives = 166/329 (50.46%), Query Frame = 2
Query:  623 YINNYCWIVGTIPKAVHE---HNTDDEEYWKWLESRKINYYQWVPFVLGLQAALLYIPYVFWECLIYNRLGTNLQFLIDLARKASLDFGESRQRKISQMAGSIFILLTTRKK----KSEKAIGLLSKFPIYKMEIVFHYLLLKVISIVMICSQFVIMEKLLNMNGKHKLFGITVLQDLLNGRYWDVTNLFPRMAFCRVPFKMQNTNVVNITTQCSLSINLINEKIFIFLWWWFSLIASLQIISLFIWIARCLSSDRRVRFINHSAQISRSFPSHNEHLIKQFERNLISIDGIFLIHMTRINCGDLICNELIHKLYEIHATSLANRGDDL 1588
            Y  NYCW+  T    +H+   HN  + E      +R+I YYQWVPFVL L+A L Y+P + W  L +   G ++Q L+ +A  + L   ESR R +  +A ++   L  + +       K + L+         + F Y+ +K++  V I  Q  ++   L    + K +G+ VL DL+NGR W+ +  FPR+  C    K+   NV   T QC L IN+ NEKIF+FLW+W+ L+A   + SLF WI   +   R++ F+         +   +   +++F  + +  DG+FL+ M   + G+L C EL   L+  +  +   +  D+
Sbjct:    4 YTENYCWVQNTYFLPLHDYIPHNYAERE------NRQIGYYQWVPFVLALEALLFYVPTIVWRLLSWQS-GIHVQSLVQMACDSRLLDLESRNRALQTIATNVEEALHVKHQVMSGNRLKLLNLIICTRSSGAAVTFLYISVKILYTVNIVGQIFLLNTFLG--NRSKWYGLQVLNDLMNGREWEESGHFPRVTLCDFEVKVLG-NVHRHTVQCVLMINMFNEKIFLFLWFWYFLLAGATLCSLFYWIYISVVPSRQLNFVGKYLTGIEGYKMVDSQSLRRFVFHFLRQDGVFLLRMVATHAGELPCYELAKTLWNNYCDNKEGKMHDV 322          
BLAST of innexin-1 vs. Ensembl Fly
Match: Inx3 (gene:FBgn0265274 transcript:FBtr0085350)

HSP 1 Score: 87.4261 bits (215), Expect = 4.050e-18
Identity = 84/369 (22.76%), Postives = 148/369 (40.11%), Query Frame = 2
Query:  494 RCVYILTFTLLLVCSATVTIKSYVLEPMTCYAPSTISGSNVLPYINNYCWIVGT--IPKAVHEHNTDD-------EEYWKWLESRKINYYQWVPFVLGLQAALLYIPYVFWECLIYNRLGTNLQFLIDLARKASLDFGESRQRKISQMAGSIFILLTTRKKKSEKAIGLLSKFPIYKMEI----VFHYLLLKVISIVMICSQFVIMEKLLNMNGKHKLFGITVL------QDLLNGRYWDVTNLFPRMAFCRVPFKMQNTNVVNITTQCSLSINLINEKIFIFLWWWFSLIASLQIISLFIWIARCLSSDRRVRFINHSAQISRSFPSHNEHLIKQFERNLISIDGIFLIHMTRINCGDLICNELIHKL 1543
            RC Y +T  +L  C   VT  + + +P++C     I     +  IN +CWI  T  IP   H     D        EY +  E R  +YYQWVPFVL  Q  + Y+P+  W+ +                             KI  +   +  +++            + K+ +  +       F Y   ++++ + +     +++K L   G    +G  VL      QD    R+  +  +FPR+  C       + +V    T C L++N++NEKI+IFLW+WF ++A++  +++   +   +    R         I RS+ S     I    R L  I    ++H    N      ++++ +L
Sbjct:   31 RCHYRITTAILFTCCIIVTANNLIGDPISCINDGAIP----MHVINTFCWITYTYTIPGQQHRQIGTDVAGPGLGNEYGQ--EKRYHSYYQWVPFVLFFQGLMFYVPHWVWKNM--------------------------EDGKIRMITDGLRGMVSVPDDYRRDRQDRILKYFVNSLNTHNGYSFAYFFCELLNFINVIVNIFMVDKFL--GGAFMSYGTDVLKFSNMDQD---KRFDPMIEIFPRLTKCTFHKFGPSGSVQKHDTLCVLALNILNEKIYIFLWFWFIILATISGVAVLYSLVVIMMPTTR------ETIIKRSYRSAQRKEIAGLVRRL-EIGDFLILHFLSQNLSTRSYSDMLQQL 355          
BLAST of innexin-1 vs. Ensembl Fly
Match: Inx3 (gene:FBgn0265274 transcript:FBtr0330306)

HSP 1 Score: 87.4261 bits (215), Expect = 4.050e-18
Identity = 84/369 (22.76%), Postives = 148/369 (40.11%), Query Frame = 2
Query:  494 RCVYILTFTLLLVCSATVTIKSYVLEPMTCYAPSTISGSNVLPYINNYCWIVGT--IPKAVHEHNTDD-------EEYWKWLESRKINYYQWVPFVLGLQAALLYIPYVFWECLIYNRLGTNLQFLIDLARKASLDFGESRQRKISQMAGSIFILLTTRKKKSEKAIGLLSKFPIYKMEI----VFHYLLLKVISIVMICSQFVIMEKLLNMNGKHKLFGITVL------QDLLNGRYWDVTNLFPRMAFCRVPFKMQNTNVVNITTQCSLSINLINEKIFIFLWWWFSLIASLQIISLFIWIARCLSSDRRVRFINHSAQISRSFPSHNEHLIKQFERNLISIDGIFLIHMTRINCGDLICNELIHKL 1543
            RC Y +T  +L  C   VT  + + +P++C     I     +  IN +CWI  T  IP   H     D        EY +  E R  +YYQWVPFVL  Q  + Y+P+  W+ +                             KI  +   +  +++            + K+ +  +       F Y   ++++ + +     +++K L   G    +G  VL      QD    R+  +  +FPR+  C       + +V    T C L++N++NEKI+IFLW+WF ++A++  +++   +   +    R         I RS+ S     I    R L  I    ++H    N      ++++ +L
Sbjct:   31 RCHYRITTAILFTCCIIVTANNLIGDPISCINDGAIP----MHVINTFCWITYTYTIPGQQHRQIGTDVAGPGLGNEYGQ--EKRYHSYYQWVPFVLFFQGLMFYVPHWVWKNM--------------------------EDGKIRMITDGLRGMVSVPDDYRRDRQDRILKYFVNSLNTHNGYSFAYFFCELLNFINVIVNIFMVDKFL--GGAFMSYGTDVLKFSNMDQD---KRFDPMIEIFPRLTKCTFHKFGPSGSVQKHDTLCVLALNILNEKIYIFLWFWFIILATISGVAVLYSLVVIMMPTTR------ETIIKRSYRSAQRKEIAGLVRRL-EIGDFLILHFLSQNLSTRSYSDMLQQL 355          
BLAST of innexin-1 vs. Ensembl Fly
Match: Inx3 (gene:FBgn0265274 transcript:FBtr0345207)

HSP 1 Score: 87.4261 bits (215), Expect = 4.050e-18
Identity = 84/369 (22.76%), Postives = 148/369 (40.11%), Query Frame = 2
Query:  494 RCVYILTFTLLLVCSATVTIKSYVLEPMTCYAPSTISGSNVLPYINNYCWIVGT--IPKAVHEHNTDD-------EEYWKWLESRKINYYQWVPFVLGLQAALLYIPYVFWECLIYNRLGTNLQFLIDLARKASLDFGESRQRKISQMAGSIFILLTTRKKKSEKAIGLLSKFPIYKMEI----VFHYLLLKVISIVMICSQFVIMEKLLNMNGKHKLFGITVL------QDLLNGRYWDVTNLFPRMAFCRVPFKMQNTNVVNITTQCSLSINLINEKIFIFLWWWFSLIASLQIISLFIWIARCLSSDRRVRFINHSAQISRSFPSHNEHLIKQFERNLISIDGIFLIHMTRINCGDLICNELIHKL 1543
            RC Y +T  +L  C   VT  + + +P++C     I     +  IN +CWI  T  IP   H     D        EY +  E R  +YYQWVPFVL  Q  + Y+P+  W+ +                             KI  +   +  +++            + K+ +  +       F Y   ++++ + +     +++K L   G    +G  VL      QD    R+  +  +FPR+  C       + +V    T C L++N++NEKI+IFLW+WF ++A++  +++   +   +    R         I RS+ S     I    R L  I    ++H    N      ++++ +L
Sbjct:   31 RCHYRITTAILFTCCIIVTANNLIGDPISCINDGAIP----MHVINTFCWITYTYTIPGQQHRQIGTDVAGPGLGNEYGQ--EKRYHSYYQWVPFVLFFQGLMFYVPHWVWKNM--------------------------EDGKIRMITDGLRGMVSVPDDYRRDRQDRILKYFVNSLNTHNGYSFAYFFCELLNFINVIVNIFMVDKFL--GGAFMSYGTDVLKFSNMDQD---KRFDPMIEIFPRLTKCTFHKFGPSGSVQKHDTLCVLALNILNEKIYIFLWFWFIILATISGVAVLYSLVVIMMPTTR------ETIIKRSYRSAQRKEIAGLVRRL-EIGDFLILHFLSQNLSTRSYSDMLQQL 355          
BLAST of innexin-1 vs. Ensembl Fly
Match: Inx2 (gene:FBgn0027108 transcript:FBtr0301860)

HSP 1 Score: 80.8777 bits (198), Expect = 5.012e-16
Identity = 92/370 (24.86%), Postives = 153/370 (41.35%), Query Frame = 2
Query:  494 RCVYILTFTLLLVCSATVTIKSYVLEPMTCYAPSTISGSNVLPYINNYCWIVGT--IPK---------------AVHEHNTDDEEYWKWLESRKINYYQWVPFVLGLQAALLYIPYVFWECLIYNRLGTNLQFLIDLARKASLDFGESRQRKISQMAGSIFILLTTRKKKSEKAIGLLSKFPIYKMEIVFHYLLLKVISIVMICSQFVIMEKLLNMNGKHKLFGITVLQDL---LNGRYWDVTNLFPRMAFCRVPFKMQNTNVVNITTQCSLSINLINEKIFIFLWWWFSLIASLQIISLFIWIARCLSSDRRVRFINHSAQISRSFPSHNEHLIKQFERNLISIDGIFLIHMTRINCGDLICNELIHKL 1543
            R  Y  T  +L+  S  VT + Y+ +P+ C     I     L  ++ YCWI  T  +P+                 H    D+ +Y K        YYQWV FVL  QA L Y+P   W+     RL      ++DL      D  ++ ++KI                  +  IG L++   Y     F + + + ++ V +  Q   ++  L+  G+   +G  VL+      + R   +  +FP++  C       + +V      C L +N++NEKI++FLW+WF +++ +  ISL   IA       R     H    +RS  + +E +  +   N  +I   FL++    N   LI  E+I  L
Sbjct:   25 RMHYKATVIILIAFSLLVTSRQYIGDPIDC-----IVDEIPLGVMDTYCWIYSTFTVPERLTGITGRDVVQPGVGSHVEGEDEVKYHK--------YYQWVCFVLFFQAILFYVPRYLWKSWEGGRLK---MLVMDLNSPIVNDECKNDRKKIL----------------VDYFIGNLNRHNFY----AFRFFVCEALNFVNVIGQIYFVDFFLD--GEFSTYGSDVLKFTELEPDERIDPMARVFPKVTKCTFHKYGPSGSVQTHDGLCVLPLNIVNEKIYVFLWFWFIILSIMSGISLIYRIAVVAGPKLR-----HLLLRARSRLAESEEV--ELVANKCNIGDWFLLYQLGKNIDPLIYKEVISDL 349          
BLAST of innexin-1 vs. Ensembl Fly
Match: Inx2 (gene:FBgn0027108 transcript:FBtr0071005)

HSP 1 Score: 80.8777 bits (198), Expect = 5.012e-16
Identity = 92/370 (24.86%), Postives = 153/370 (41.35%), Query Frame = 2
Query:  494 RCVYILTFTLLLVCSATVTIKSYVLEPMTCYAPSTISGSNVLPYINNYCWIVGT--IPK---------------AVHEHNTDDEEYWKWLESRKINYYQWVPFVLGLQAALLYIPYVFWECLIYNRLGTNLQFLIDLARKASLDFGESRQRKISQMAGSIFILLTTRKKKSEKAIGLLSKFPIYKMEIVFHYLLLKVISIVMICSQFVIMEKLLNMNGKHKLFGITVLQDL---LNGRYWDVTNLFPRMAFCRVPFKMQNTNVVNITTQCSLSINLINEKIFIFLWWWFSLIASLQIISLFIWIARCLSSDRRVRFINHSAQISRSFPSHNEHLIKQFERNLISIDGIFLIHMTRINCGDLICNELIHKL 1543
            R  Y  T  +L+  S  VT + Y+ +P+ C     I     L  ++ YCWI  T  +P+                 H    D+ +Y K        YYQWV FVL  QA L Y+P   W+     RL      ++DL      D  ++ ++KI                  +  IG L++   Y     F + + + ++ V +  Q   ++  L+  G+   +G  VL+      + R   +  +FP++  C       + +V      C L +N++NEKI++FLW+WF +++ +  ISL   IA       R     H    +RS  + +E +  +   N  +I   FL++    N   LI  E+I  L
Sbjct:   25 RMHYKATVIILIAFSLLVTSRQYIGDPIDC-----IVDEIPLGVMDTYCWIYSTFTVPERLTGITGRDVVQPGVGSHVEGEDEVKYHK--------YYQWVCFVLFFQAILFYVPRYLWKSWEGGRLK---MLVMDLNSPIVNDECKNDRKKIL----------------VDYFIGNLNRHNFY----AFRFFVCEALNFVNVIGQIYFVDFFLD--GEFSTYGSDVLKFTELEPDERIDPMARVFPKVTKCTFHKYGPSGSVQTHDGLCVLPLNIVNEKIYVFLWFWFIILSIMSGISLIYRIAVVAGPKLR-----HLLLRARSRLAESEEV--ELVANKCNIGDWFLLYQLGKNIDPLIYKEVISDL 349          
BLAST of innexin-1 vs. Ensembl Zebrafish
Match: panx2 (pannexin 2 [Source:ZFIN;Acc:ZDB-GENE-050419-55])

HSP 1 Score: 51.9878 bits (123), Expect = 1.763e-6
Identity = 40/158 (25.32%), Postives = 66/158 (41.77%), Query Frame = 2
Query:  488 FDRCVYILTFTLLLVCSATVTIKSYVLEPMTCYAPSTISGSNVLPYINNYCW--IVGTIPKAVHEHNTDDEEYWKWLESRKINYYQWVPFVLGLQAALLYIPYVFWECLIYNRLGTNLQFLIDLARKASLDFGESRQRKISQMAGSIFILLTTRKKKS 955
            FDR V I T  + ++    V  +++  E + CY P   +    L Y   YCW  +   +P        D E      E      ++++P+ L   A ++YIP + WE +   RL + L FL+           E R  KI +   S    +T R+++ 
Sbjct:   41 FDRVVTIGTVIIPILLVTLVFTRNFAEESIYCYTPHNFTRDQAL-YARGYCWTELRDAVP------GVDPELRPSLFE------HKFLPYALLAFAGIMYIPALGWEFMASTRLTSELNFLLQEIDNCYHRAAEGRAPKIEKQIQSKGPGITERERRE 185          
BLAST of innexin-1 vs. Ensembl Zebrafish
Match: panx2 (pannexin 2 [Source:ZFIN;Acc:ZDB-GENE-050419-55])

HSP 1 Score: 51.6026 bits (122), Expect = 2.158e-6
Identity = 40/158 (25.32%), Postives = 66/158 (41.77%), Query Frame = 2
Query:  488 FDRCVYILTFTLLLVCSATVTIKSYVLEPMTCYAPSTISGSNVLPYINNYCW--IVGTIPKAVHEHNTDDEEYWKWLESRKINYYQWVPFVLGLQAALLYIPYVFWECLIYNRLGTNLQFLIDLARKASLDFGESRQRKISQMAGSIFILLTTRKKKS 955
            FDR V I T  + ++    V  +++  E + CY P   +    L Y   YCW  +   +P        D E      E      ++++P+ L   A ++YIP + WE +   RL + L FL+           E R  KI +   S    +T R+++ 
Sbjct:   51 FDRVVTIGTVIIPILLVTLVFTRNFAEESIYCYTPHNFTRDQAL-YARGYCWTELRDAVP------GVDPELRPSLFE------HKFLPYALLAFAGIMYIPALGWEFMASTRLTSELNFLLQEIDNCYHRAAEGRAPKIEKQIQSKGPGITERERRE 195          
BLAST of innexin-1 vs. Ensembl Zebrafish
Match: panx2 (pannexin 2 [Source:ZFIN;Acc:ZDB-GENE-050419-55])

HSP 1 Score: 50.8322 bits (120), Expect = 4.342e-6
Identity = 40/157 (25.48%), Postives = 66/157 (42.04%), Query Frame = 2
Query:  488 FDRCVYILTFTLLLVCSATVTIKSYVLEPMTCYAPSTISGSNVLPYINNYCW--IVGTIPKAVHEHNTDDEEYWKWLESRKINYYQWVPFVLGLQAALLYIPYVFWECLIYNRLGTNLQFLIDLARKASLDFGESRQRKISQMAGSIFILLTTRKKK 952
            FDR V I T  + ++    V  +++  E + CY P   +    L Y   YCW  +   +P        D E      E      ++++P+ L   A ++YIP + WE +   RL + L FL+           E R  KI +   S    +T R+++
Sbjct:   51 FDRVVTIGTVIIPILLVTLVFTRNFAEESIYCYTPHNFTRDQAL-YARGYCWTELRDAVP------GVDPELRPSLFE------HKFLPYALLAFAGIMYIPALGWEFMASTRLTSELNFLLQEIDNCYHRAAEGRAPKIEKQIQSKGPGITERERR 194          
BLAST of innexin-1 vs. Ensembl Xenopus
Match: alkbh1 (alkB homolog 1, histone H2A dioxygenase [Source:Xenbase;Acc:XB-GENE-6453434])

HSP 1 Score: 58.5362 bits (140), Expect = 2.375e-8
Identity = 45/157 (28.66%), Postives = 66/157 (42.04%), Query Frame = 2
Query:  488 FDRCVYILTFTLLLVCSATVTIKSYVLEPMTCYAPSTISGSNVLPYINNYCW--IVGTIPKAVHEHNTDDEEYWKWLESRKINYYQWVPFVLGLQAALLYIPYVFWECLIYNRLGTNLQFLIDLARKASLDFGESRQRKISQMAGSIFILLTTRKKK 952
            FDR V I T  + ++    V  K++  EP+ CY P   +    L Y   YCW  +   +P         D   W  L   K     ++P+ L   A ++YIP + WE L   RL + L FL+           E R  KI +   S    +T R+K+
Sbjct:   50 FDRVVTIGTVLIPILLVTLVFTKNFAEEPIYCYTPQNFTRDQAL-YARGYCWTELKDALPGV-------DISQWPSLFEHK-----FLPYALLAFAGIMYIPALGWEFLASTRLTSELNFLLQEIDNCYHRAAEGRAPKIEKQIQSKGPSITEREKR 193          
BLAST of innexin-1 vs. Ensembl Mouse
Match: Panx2 (pannexin 2 [Source:MGI Symbol;Acc:MGI:1890615])

HSP 1 Score: 58.5362 bits (140), Expect = 2.215e-8
Identity = 45/158 (28.48%), Postives = 67/158 (42.41%), Query Frame = 2
Query:  488 FDRCVYILTFTLLLVCSATVTIKSYVLEPMTCYAPSTISGSNVLPYINNYCW--IVGTIPKAVHEHNTDDEEYWKWLESRKINYYQWVPFVLGLQAALLYIPYVFWECLIYNRLGTNLQFLIDLARKASLDFGESRQRKISQMAGSIFILLTTRKKKS 955
            FDR V I T  + ++    V  K++  EP+ CY P   +    L Y   YCW  +   +P         D   W  L   K     ++P+ L   AA++Y+P + WE L   RL + L FL+           E R  KI +   S    +T R+K+ 
Sbjct:   50 FDRVVTIGTVLVPILLVTLVFTKNFAEEPIYCYTPHNFTRDQAL-YARGYCWTELRDALPGV-------DASLWPSLFEHK-----FLPYALLAFAAIMYVPALGWEFLASTRLTSELNFLLQEIDNCYHRAAEGRAPKIEKQIQSKGPGITEREKRE 194          
BLAST of innexin-1 vs. Ensembl Mouse
Match: Panx2 (pannexin 2 [Source:MGI Symbol;Acc:MGI:1890615])

HSP 1 Score: 51.6026 bits (122), Expect = 2.566e-6
Identity = 45/165 (27.27%), Postives = 67/165 (40.61%), Query Frame = 2
Query:  488 FDRCVYILTFTLLLVCSATVTIKSYVL--------EPMTCYAPSTISGSNVLPYINNYCW--IVGTIPKAVHEHNTDDEEYWKWLESRKINYYQWVPFVLGLQAALLYIPYVFWECLIYNRLGTNLQFLIDLARKASLDFGESRQRKISQMAGSIFILLTTRKKK 952
            FDR V I T  + ++    V  K++          EP+ CY P   +    L Y   YCW  +   +P         D   W  L   K     ++P+ L   AA++Y+P + WE L   RL + L FL+           E R  KI +   S    +T R+K+
Sbjct:   50 FDRVVTIGTVLVPILLVTLVFTKNFAARVSSLPSEEPIYCYTPHNFTRDQAL-YARGYCWTELRDALPGV-------DASLWPSLFEHK-----FLPYALLAFAAIMYVPALGWEFLASTRLTSELNFLLQEIDNCYHRAAEGRAPKIEKQIQSKGPGITEREKR 201          
BLAST of innexin-1 vs. UniProt/SwissProt
Match: sp|O01393|UNC9_CAEEL (Innexin unc-9 OS=Caenorhabditis elegans OX=6239 GN=unc-9 PE=1 SV=1)

HSP 1 Score: 186.037 bits (471), Expect = 1.326e-51
Identity = 116/376 (30.85%), Postives = 190/376 (50.53%), Query Frame = 2
Query:  482 DIFDRCVYILTFTLLLVCSATVTIKSYVLEPMTCYAPSTISGSNVLPYINNYCWIVGTIPKAVHE---HNTDDEEYWKWLESRKINYYQWVPFVLGLQAALLYIPYVFWECLIYNRLGTNLQFLIDLARKASLDFGESRQRKISQMAGSIFILLTTRKKKSE----KAIGLLSKFPIYKMEIVFHYLLLKVISIVMICSQFVIMEKLLNMNGKHKLFGITVLQDLLNGRYWDVTNLFPRMAFCRVPFKMQNTNVVNITTQCSLSINLINEKIFIFLWWWFSLIASLQIISLFIWIARCLSSDRRVRFINHSAQISRSFPSHNEHLIKQFERNLISIDGIFLIHMTRINCGDLICNELIHKLYEIHATSLANRGDDL 1588
            DI D+  Y  T  ++ V +  V+ K YV  P+ C+ P+T +   +  Y  NYCW+  T    +H+   HN  + E      +R+I YYQWVPFVL L+A L Y+P + W  L +   G ++Q L+ +A  + L   ESR R +  +A ++   L  + +       K + L+         + F Y+ +K++  V I  Q  ++   L    + K +G+ VL DL+NGR W+ +  FPR+  C    K+   NV   T QC L IN+ NEKIF+FLW+W+ L+A   + SLF WI   +   R++ F+         +   +   +++F  + +  DG+FL+ M   + G+L C EL   L+  +  +   +  D+
Sbjct:   22 DIIDKLNYYYTTAIITVFAILVSAKQYVGFPIQCWVPATFT-EPMEQYTENYCWVQNTYFLPLHDYIPHNYAERE------NRQIGYYQWVPFVLALEALLFYVPTIVWRLLSWQS-GIHVQSLVQMACDSRLLDLESRNRALQTIATNVEEALHVKHQVMSGNRLKLLNLIICTRSSGAAVTFLYISVKILYTVNIVGQIFLLNTFLG--NRSKWYGLQVLNDLMNGREWEESGHFPRVTLCDFEVKVLG-NVHRHTVQCVLMINMFNEKIFLFLWFWYFLLAGATLCSLFYWIYISVVPSRQLNFVGKYLTGIEGYKMVDSQSLRRFVFHFLRQDGVFLLRMVATHAGELPCYELAKTLWNNYCDNKEGKMHDV 386          
BLAST of innexin-1 vs. UniProt/SwissProt
Match: sp|Q03412|UNC7_CAEEL (Innexin unc-7 OS=Caenorhabditis elegans OX=6239 GN=unc-7 PE=1 SV=1)

HSP 1 Score: 161.77 bits (408), Expect = 1.063e-41
Identity = 106/367 (28.88%), Postives = 181/367 (49.32%), Query Frame = 2
Query:  482 DIFDRCVYILTFTLLLVCSATVTIKSYVLEPMTCYAPSTISGSNVLPYINNYCWIVGTIPKAVHEHNTDDEEYWKWLESRKINYYQWVPFVLGLQAALLYIPYVFWECLIYNRLGTNLQFLIDLARKASLDFGESRQRKISQMA----GSIFILLTTRKKKSEKAIGLLSKFPIYKME----IVFHYLLLKVISIVMICSQFVIMEKLLNMNGKHKLFGITVLQDLLNGRYWDVTNLFPRMAFCRVPFKMQNTNVVNITTQCSLSINLINEKIFIFLWWWFSLIASLQIISLFIWIARCLSSDRRVRFINHSAQISRSFPSH---NEHLIKQFERNLISIDGIFLIHMTRINCGDLICNELIHKLYE 1549
            D  D+  Y  T T+L   +  V+ K YV  P+ C+ P+T + + +  Y  NYCW+  T    + E +   E Y +   +R+I YYQWVPF+L ++A L Y+P + W  L+Y   G NLQ L+ +A  A L   E + R +  MA      + +    R+  S      L             +   Y+ +KV+    +  QF ++  LL  N     +G ++L+DL++   W+ T +FPR+  C    ++   N+   T QC L IN+ NEKIF+FLW+WF     + + +   WI       + + F+    ++    P+    ++  +++F  N +  DG+F++ M   + G+L+ +ELI  L++
Sbjct:  140 DFVDKLNYYYTTTILASFALLVSAKQYVGFPIQCWVPATFTDA-MEQYTENYCWVQNTYWVPMQE-DIPREIYSR--RNRQIGYYQWVPFILAIEALLFYVPCILWRGLLYWHSGINLQGLVQMACDARLMDSEIKTRTVYTMARHMQDEVQLTNIDRQGHSRSCFSNLQLGANCGRHCGCYVTMLYIGIKVLYSANVLLQFFLLNHLLGSND--LAYGFSLLKDLMHAIEWEQTGMFPRVTLCDFEVRVLG-NIHRHTVQCVLMINMFNEKIFLFLWFWFLTCGIVTVCNTMYWILIMFIPSQGMSFVRKYLRVLPDHPAKPIADDVTLRKFTNNFLRKDGVFMLRMISTHAGELMSSELILALWQ 499          
BLAST of innexin-1 vs. UniProt/SwissProt
Match: sp|O61787|INX16_CAEEL (Innexin-16 OS=Caenorhabditis elegans OX=6239 GN=inx-16 PE=3 SV=2)

HSP 1 Score: 154.836 bits (390), Expect = 1.959e-40
Identity = 106/363 (29.20%), Postives = 180/363 (49.59%), Query Frame = 2
Query:  491 DRCVYILTFTLLLVCSATVTIKSYVLEPMTCYAPSTISGSNVLPYINNYCWIVGTIPKAVHEHNTDDEEYWKWLESRKINYYQWVPFVLGLQAALLYIPYVFWECLIYNRL-GTNLQFLIDLARKASLDFGESRQRKISQMAGSIFILLTTRKKKSEKAIGLLSKFPIYKMEIVFHYLLLKVISIVMICSQFVIMEKLLNMNGKHKLFGITVLQDLLNGRYWDVTNLFPRMAFCRVPFKMQNTNVVNITTQCSLSINLINEKIFIFLWWWFSLIASLQIISLFIWIARCLSSDRRVRFINHSAQISRSFPSHNEHLIKQFERNLISIDGIFLIHMTRINCGDLICNELIHKLYEI---HATSL 1567
            DR  Y++T ++L+  S  +  K+YV EPM C+ P+  +G     +  +YC+I  T    + + N    E     E R++ YYQWVPF+L +QA    +P  FW  +IY    G  +  +I  AR+      E     + Q+A    I   T ++K   +             I   YL++K++ ++ I  QF ++   LN    +  +G  +  D++NGR+W  +  FPR++FC +  + +  N+ + + QC L +N+ NEKIFIFLW+WF+ +         IW+ R   S+ ++ FI     +++    H+     +  +N++  DG+  + +   N G L   EL+ K+Y I   HAT L
Sbjct:   26 DRLNYVVTTSILIAFSLLLFAKNYVGEPMQCWTPNQFAGG-WESFAESYCFIENTYFVPMQDSNLPAAET---REGREMIYYQWVPFLLVIQALFFCVPRAFW--IIYPSYSGLTIADMITAARQNGKQL-EGADEALEQVA---MINWRTEQQKGHGS------------RIFNCYLVMKLLILLNIVLQFFLLNSFLNT--AYTFWGWGIFWDMVNGRHWQESGHFPRVSFCDINVR-ELGNIHHWSLQCVLMVNMFNEKIFIFLWFWFAFLLVATAGDFVIWVWRRFDSNSKLGFI--LDLLNQEGIDHSPQKASELYKNVLRDDGVLFLRLLDSNSGRLNSEELMKKIYNISVGHATDL 361          
BLAST of innexin-1 vs. UniProt/SwissProt
Match: sp|A8WVX4|INX19_CAEBR (Innexin-19 OS=Caenorhabditis briggsae OX=6238 GN=inx-19 PE=3 SV=3)

HSP 1 Score: 152.525 bits (384), Expect = 5.051e-39
Identity = 110/386 (28.50%), Postives = 179/386 (46.37%), Query Frame = 2
Query:  473 GVYDIFDRCVYILTFTLLLVCSATVTIKSYVLEPMTCYAPSTISGSNVLPYINNYCWIVGTIPKAVHEHNTDDEEYWKWLESRKINYYQWVPFVLGLQAALLYIPYVFWECLIYNRLGTNLQFLIDLA--RKASLDFGESRQRKISQMAGSIFILLTTRKKKSE-KAIGLLSKFPIYKME----IVFHYLLLKVISIVMICSQFVIMEKLLNMNGKHKLFGITVLQDLLNGRYWDVTNLFPRMAFCRVPFKMQNTNVVNITTQCSLSINLINEKIFIFLWWWFSLIASLQIISLFIWIARCLSSDRRVRFINHSAQISRSFP--------------------SHNEHLIKQFERNLISIDGIFLIHMTRINCGDLICNELIHKLYE 1549
            G  D  DR  Y  T  +L VC   ++ K Y   P+ C+  +  S  ++  YI +YCWI  T    ++E+  DD       E ++I YYQWVPF+L  +A +  +P +FW    +   G N+Q LI+ A   +A LD+ + RQ+ +  +  +    L  +      +A G +++    +      I   Y   K++  V + +QF I+   L  + +   FG  VL D+  GR W  T  FPR+  C    +    N+   T QC+L IN+INEK+F FLW W+ ++A +   S   WIA       +V ++    QI+ S                      +   HL+  F  + +  DGI ++ M   + GD+I  +L+  L++
Sbjct:   19 GDDDAVDRLNYYYTPLILAVCCLVISAKQYGGTPIECWV-NPHSRESMEEYIESYCWIQNTYWIPMYENVPDDHTA---REEKQIGYYQWVPFILIAEALMFSLPCIFWRLCSFQS-GLNIQTLINAACDAQALLDYSD-RQKAVEAITCNFVDNLDLQSPNGRIRARGWIARIKFSRFLSGQCISIVYSFTKLLYSVNVVAQFFILNACLK-SSEFVFFGFQVLSDIWAGRPWTETGHFPRVTLCDFEVRYL-ANLNRYTVQCALLINIINEKVFAFLWCWYMILAIITTCSFIYWIANSFIHSEKVDYVMKFIQIAESSEYKKLQKFEKDATVERLYTVIAFAPHLLDSFVSDFLKSDGILMLRMISNHAGDMIVVQLVRNLWQ 396          
BLAST of innexin-1 vs. UniProt/SwissProt
Match: sp|O01634|INX12_CAEEL (Innexin-12 OS=Caenorhabditis elegans OX=6239 GN=inx-12 PE=1 SV=1)

HSP 1 Score: 150.984 bits (380), Expect = 1.141e-38
Identity = 106/377 (28.12%), Postives = 176/377 (46.68%), Query Frame = 2
Query:  482 DIFDRCVYILTFTLLLVCSATVTIKSYVLEPMTCYAPSTISGSNVLPYINNYCWIVGTIPKAVHEHNTDDEEYWKWL-----------ESRKINYYQWVPFVLGLQAALLYIPYVFWECLIYNRLGTNLQFLIDLARKASLDFGESRQRKISQMAGSIFILLTTRKKKSEKAIGLLSKFP--IYKMEIVFHYLLLKVISIVMICSQFVIMEKLLNMNGKHKLFGITVLQDLLNGRYWDVTNLFPRMAFCRVPFKMQN-TNVVNITTQCSLSINLINEKIFIFLWWWFSLIASLQIISLFIWIARCLSSDRRVRFINHSAQISRSFPSHNEHLIKQFERNLISIDGIFLIHMTRINCGDLICNELIHKLYEIHATSLA 1570
            D  D+  Y  T   L++ SA +T  S+V  P+ C+ P+   G     Y  +YC++  T      E   +    W+ L           ++ +I YYQWVPF+L LQA L Y P V W  L Y   G N+  L +    A+    ESR+  I+ +AG I     ++K+     +  LS F        ++  YL +K + ++ +  QFV+++++L ++     +G  V  DL +G  W  T  FPR+  C   ++++N  N+   + QC L IN+ NEKIF+ LWWW   +  + I +   W  R   +     FI    +       +N   ++QF    +S D +F++ +  +N G     ELI  ++    T++ 
Sbjct:   18 DFVDKLNYCATTIGLVLASAFITGWSFVGSPIDCWFPAYYKGW-WAEYALDYCYVQNTFFVPFSEDKAERSYNWEQLVADKQNTTSLKQTNQIGYYQWVPFILALQAMLFYFPVVIWR-LFYGMAGQNVTSLCNTC-TATEGNEESRKGTITTIAGYI-----SQKRHRNLIVKQLSGFQNRANGSAVITSYLFMKALFLINVLFQFVLLKRMLGVD--SYFWGAEVTSDLWSGNEWPETGNFPRVTMCE--YEVRNLDNIHKHSVQCVLMINMFNEKIFVALWWWLCFLTVVTITNTIYWFWRASGTSVSKNFIRPYVEDIDPKVKNNRGKLQQFVSEFLSPDTVFILRLIELNNGKTPVVELIRDMWRRFNTAVP 382          
BLAST of innexin-1 vs. TrEMBL
Match: I1ZIL2 (Innexin OS=Schmidtea mediterranea OX=79327 GN=inx PE=2 SV=1)

HSP 1 Score: 843.958 bits (2179), Expect = 0.000e+0
Identity = 407/412 (98.79%), Postives = 412/412 (100.00%), Query Frame = 2
Query:  416 MVFKEFLDYLNKFNFIHACGVYDIFDRCVYILTFTLLLVCSATVTIKSYVLEPMTCYAPSTISGSNVLPYINNYCWIVGTIPKAVHEHNTDDEEYWKWLESRKINYYQWVPFVLGLQAALLYIPYVFWECLIYNRLGTNLQFLIDLARKASLDFGESRQRKISQMAGSIFILLTTRKKKSEKAIGLLSKFPIYKMEIVFHYLLLKVISIVMICSQFVIMEKLLNMNGKHKLFGITVLQDLLNGRYWDVTNLFPRMAFCRVPFKMQNTNVVNITTQCSLSINLINEKIFIFLWWWFSLIASLQIISLFIWIARCLSSDRRVRFINHSAQISRSFPSHNEHLIKQFERNLISIDGIFLIHMTRINCGDLICNELIHKLYEIHATSLANRGDDLSDSISHSSVYKAKDIETTMFI 1651
            MVFKEFLDYLNKFNFIHACGVYDIFDRCVYILTFTLLLVCSATVTIKSYVLEPMTCYAPSTISGSNVLPYINNYCWIVGTIPKAVHEHN+DDEEYWKWLESRKINYYQWVPFVLGLQAALLYIPYVFWECLIYNRLGTNLQFLIDLARKASLDFGESRQRKISQMAGSIFILLTTRKKKSEKAIGLLSKFPIYKMEIVFHYLLLKVISIVMICSQFVIMEKLLNMNGKHKLFGITVLQDLLNGRYWDVTNLFPRMAFCRVPFKMQNTNVVNITTQCSLSINLINEKIF+FLWWWFSLIASLQIISLFIW+ARCLSSDRRVRFINHSAQISRSFPSH+EHLIKQF+RNLISIDGIFLIHMTRINCGDLICNELIHKLYEIHATSLANRGDDLSDSISHSSVYKAKDIETTMFI
Sbjct:    1 MVFKEFLDYLNKFNFIHACGVYDIFDRCVYILTFTLLLVCSATVTIKSYVLEPMTCYAPSTISGSNVLPYINNYCWIVGTIPKAVHEHNSDDEEYWKWLESRKINYYQWVPFVLGLQAALLYIPYVFWECLIYNRLGTNLQFLIDLARKASLDFGESRQRKISQMAGSIFILLTTRKKKSEKAIGLLSKFPIYKMEIVFHYLLLKVISIVMICSQFVIMEKLLNMNGKHKLFGITVLQDLLNGRYWDVTNLFPRMAFCRVPFKMQNTNVVNITTQCSLSINLINEKIFLFLWWWFSLIASLQIISLFIWVARCLSSDRRVRFINHSAQISRSFPSHSEHLIKQFDRNLISIDGIFLIHMTRINCGDLICNELIHKLYEIHATSLANRGDDLSDSISHSSVYKAKDIETTMFI 412          
BLAST of innexin-1 vs. TrEMBL
Match: A0A068W6W1 (Innexin OS=Echinococcus granulosus OX=6210 GN=inx PE=3 SV=1)

HSP 1 Score: 346.665 bits (888), Expect = 8.207e-110
Identity = 168/405 (41.48%), Postives = 253/405 (62.47%), Query Frame = 2
Query:  416 MVFKEFLDYLNKFNFIHACGVYDIFDRCVYILTFTLLLVCSATVTIKSYVLEPMTCYAPSTISGSNVLPYINNYCWIVGTIPKAVHEHNTDDEEYWKWLESRKINYYQWVPFVLGLQAALLYIPYVFWECLIYNRLGTNLQFLIDLARKASLDFGESRQRKISQMAGSIFILLTTRKKKSEKA-----IGLLSKF----PIYKM--EIVFHYLLLKVISIVMICSQFVIMEKLLNMNGKHKLFGITVLQDLLNGRYWDVTNLFPRMAFCRVPFKMQNTNVVNITTQCSLSINLINEKIFIFLWWWFSLIASLQIISLFIWIARCLSSDRRVRFINHSAQISRSFPSHNEHLIKQFERNLISIDGIFLIHMTRINCGDLICNELIHKLYEIHATSLANRGDDLSDS 1597
            MV +EFL  L+K +F+ +  ++D  DRC Y+L+F +LL+C   VT+KSYV EP +CY  +T SGSN++ YIN++CW+ GT+P  V+ +  DD  YW +LES+K+NYYQWV  VL  QA L Y P + WE L +NR+GTN+ F ++ A+ A+ + G +R+ +I  +A ++  LL  R+  S +       G+   F    P  +M   I  +YL++K++       Q VIME+ L M   HKLFG+ +L DL +GRYW  T +FPR+ +CRVP K+   NV  +  QC++ +N++NEKI+IFLW+WF  +A+LQ IS+  W  R     RRV+ + H  +I+ ++       +K+FE   +  DG FL+HM R+N GD+I NELI  L+E +      R + L+D+
Sbjct:    1 MVAQEFLSQLDKLHFVDSANLHDFADRCAYLLSFIILLMCFTIVTLKSYVFEPFSCYTATTFSGSNMISYINSFCWVNGTVPADVNTNRLDDPVYWDYLESKKLNYYQWVSLVLAFQAILCYFPSLLWEGLTFNRIGTNINFYVEFAQGAAKETGINRKNRIQFLASALDTLLFARRPLSHRPHSSLCYGIAEFFGELLPRKRMGRAICAYYLVIKLLYFANAVLQLVIMERFLGMPDSHKLFGVQILLDLWHGRYWQATLIFPRVGYCRVPIKLVGRNVPTLIAQCTMPVNMLNEKIYIFLWFWFVAVATLQAISIITWTLRLSMRKRRVKALIHYLKIAEAYDQGMRETLKRFEATCLRPDGTFLLHMLRLNAGDIITNELIQALFERYI-----RHEKLADA 400          
BLAST of innexin-1 vs. TrEMBL
Match: W6UDL6 (Innexin OS=Echinococcus granulosus OX=6210 GN=inx PE=3 SV=1)

HSP 1 Score: 346.665 bits (888), Expect = 2.059e-109
Identity = 165/389 (42.42%), Postives = 246/389 (63.24%), Query Frame = 2
Query:  416 MVFKEFLDYLNKFNFIHACGVYDIFDRCVYILTFTLLLVCSATVTIKSYVLEPMTCYAPSTISGSNVLPYINNYCWIVGTIPKAVHEHNTDDEEYWKWLESRKINYYQWVPFVLGLQAALLYIPYVFWECLIYNRLGTNLQFLIDLARKASLDFGESRQRKISQMAGSIFILLTTRKKKSEKA-----IGLLSKF----PIYKM--EIVFHYLLLKVISIVMICSQFVIMEKLLNMNGKHKLFGITVLQDLLNGRYWDVTNLFPRMAFCRVPFKMQNTNVVNITTQCSLSINLINEKIFIFLWWWFSLIASLQIISLFIWIARCLSSDRRVRFINHSAQISRSFPSHNEHLIKQFERNLISIDGIFLIHMTRINCGDLICNELIHKLYE 1549
            MV +EFL  L+K +F+ +  ++D  DRC Y+L+F +LL+C   VT+KSYV EP +CY  +T SGSN++ YIN++CW+ GT+P  V+ +  DD  YW +LES+K+NYYQWV  VL  QA L Y P + WE L +NR+GTN+ F ++ A+ A+ + G +R+ +I  +A ++  LL  R+  S +       G+   F    P  +M   I  +YL++K++       Q VIME+ L M   HKLFG+ +L DL +GRYW  T +FPR+ +CRVP K+   NV  +  QC++ +N++NEKI+IFLW+WF  +A+LQ IS+  W  R     RRV+ + H  +I+ ++       +K+FE   +  DG FL+HM R+N GD+I NELI  L+E
Sbjct:    1 MVAQEFLSQLDKLHFVDSANLHDFADRCAYLLSFIILLMCFTIVTLKSYVFEPFSCYTATTFSGSNMISYINSFCWVNGTVPADVNTNRLDDPVYWDYLESKKLNYYQWVSLVLAFQAILCYFPSLLWEGLTFNRIGTNINFYVEFAQGAAKETGINRKNRIQFLASALDTLLFARRPLSHRPHSSLCYGIAEFFGELLPRKRMGRAICAYYLVIKLLYFANAVLQLVIMERFLGMPDSHKLFGVQILLDLWHGRYWQATLIFPRVGYCRVPIKLVGRNVPTLIAQCTMPVNMLNEKIYIFLWFWFVAVATLQAISIITWTLRLSMRKRRVKALIHYLKIAEAYDQGMRETLKRFEATCLRPDGTFLLHMLRLNAGDIITNELIQALFE 389          
BLAST of innexin-1 vs. TrEMBL
Match: A0A068Y5E6 (Innexin OS=Echinococcus multilocularis OX=6211 GN=inx PE=3 SV=1)

HSP 1 Score: 345.51 bits (885), Expect = 2.593e-109
Identity = 172/429 (40.09%), Postives = 258/429 (60.14%), Query Frame = 2
Query:  416 MVFKEFLDYLNKFNFIHACGVYDIFDRCVYILTFTLLLVCSATVTIKSYVLEPMTCYAPSTISGSNVLPYINNYCWIVGTIPKAVHEHNTDDEEYWKWLESRKINYYQWVPFVLGLQAALLYIPYVFWECLIYNRLGTNLQFLIDLARKASLDFGESRQRKISQMAGSIFILLTTRKKKSEKA-----------IGLLSKFPIYKMEIVFHYLLLKVISIVMICSQFVIMEKLLNMNGKHKLFGITVLQDLLNGRYWDVTNLFPRMAFCRVPFKMQNTNVVNITTQCSLSINLINEKIFIFLWWWFSLIASLQIISLFIWIARCLSSDRRVRFINHSAQISRSFPSHNEHLIKQFERNLISIDGIFLIHMTRINCGDLICNELIHKLYEIH--------ATSLANRGDDLSDSISHSSVYKAKDIETTM 1645
            MV +EFL  L+K +F+ +  ++D  DRC Y+L+F +LL+C   VT+KSYV EP +CY  +T SGSN++ YIN++CW+ GT+P  V+ +  DD  YW +LES+K+NYYQWV  VL  QA L Y P + WE L +NR+GTN+ F ++ A+ A+ + G +R+ +I  +A ++  LL  R+  S +             G L         I  +YL++K++       Q VIME+ L M   HKLFG+ +L DL +GRYW  T +FPR+ +CRVP K+   NV  +  QC++ +N++NEKI+IFLW+WF  +A+LQ IS+  W  R     RRV+ + H  +I+ ++       +K+FE   +  DG FL+HM R+N GD+I NELI  L+E +        A+S+   G     S + S+   AKD E ++
Sbjct:    1 MVAQEFLSQLDKLHFVDSANLHDFADRCAYLLSFIILLMCFTIVTLKSYVFEPFSCYTATTFSGSNMISYINSFCWVNGTVPADVNTNRLDDPVYWDYLESKKLNYYQWVSLVLAFQAILCYFPSLLWEGLTFNRIGTNINFYVEFAQGAAKETGINRKNRIQFLASALDTLLFARRPLSHRPHNSLCYGIAEFFGELLPRKRLGRAICAYYLVIKLLYFANAVLQLVIMERFLGMPDSHKLFGVQILLDLWHGRYWQSTLIFPRVGYCRVPIKLVGRNVPTLIAQCTMPVNMLNEKIYIFLWFWFVAVATLQAISIITWTLRLSMRKRRVKALIHYLKIAEAYDQGMRETLKRFEATCLRPDGTFLLHMLRLNAGDIITNELIQALFERYIRHEKLAGASSIREVGSASVSSPNPSA--DAKDDEGSV 427          
BLAST of innexin-1 vs. TrEMBL
Match: A0A4E0QYX2 (Innexin OS=Fasciola hepatica OX=6192 GN=inx PE=3 SV=1)

HSP 1 Score: 343.199 bits (879), Expect = 3.196e-108
Identity = 163/425 (38.35%), Postives = 258/425 (60.71%), Query Frame = 2
Query:  416 MVFKEFLDYLNKFNFIHACGVYDIFDRCVYILTFTLLLVCSATVTIKSYVLEPMTCYAPSTISGSNVLPYINNYCWIVGTIPKAVHEHNTDDEEYWKWLESRKINYYQWVPFVLGLQAALLYIPYVFWECLIYNRLGTNLQFLIDLARKASLDFGESRQRKISQMAGSIFILLTTR---KKKSEKAIGLLSKFPIY-------------KMEIVFHYLLLKVISIVMICSQFVIMEKLLNMNGKHKLFGITVLQDLLNGRYWDVTNLFPRMAFCRVPFKMQNTNVVNITTQCSLSINLINEKIFIFLWWWFSLIASLQIISLFIWIARCLSSDRRVRFINHSAQISRSFPSHNEHLIKQFERNLISIDGIFLIHMTRINCGDLICNELIHKLY----EIHATSLANRGDDLSDSISHSSVYKAKD 1630
            MV  EF+  L+K  F+ + G+ D  DRC Y+L+F LL++C   VT+KSYV EPM+CY P+T SGSN+ PYIN +CWI GT P +      DD+EYW  LE +KINYYQWV  VL LQA L Y+P + W+ + YNR+GTNL FLI+ A+ AS + G+ R  ++  +A  +  LL  R   +K+S     + +   IY                +V +Y+L+K + ++    Q  +M++ L + G+++LFG+++L DLL GR+W+ T++FPR+ FCRVP K+ +T +  +T QC+L +N++NEK+++FLW+WF  +ASL++ S+ +W+ R  +   R+R +    +I+ ++    + L+ +FE   + +DG F++ M R+N G L+  E++  +     E    S+A +         HS   KA D
Sbjct:    1 MVALEFISQLDKLRFVDSVGLDDFADRCSYMLSFALLVICFTIVTLKSYVFEPMSCYVPTTFSGSNLGPYINAFCWINGTTPMSADTDRLDDQEYWNSLEDKKINYYQWVSLVLALQAILCYVPRLIWDTITYNRVGTNLGFLIESAQAASKETGKERSNRVQFVASVMDTLLFARRDLRKRSTDCPEMHNPLIIYMRVVRDLFPRKRLGTALVSYYMLVKGLYLLNAVGQLFLMQRFLGVRGEYQLFGLSILNDLLMGRHWNETSVFPRIGFCRVPIKLTSTPIPMVTVQCTLPVNMLNEKVYVFLWFWFVFVASLEVASVTVWVYRLAARQSRLRTLVRYLKIADAYDEGMDPLLTRFEMTFLRLDGSFILQMMRLNAGSLVTQEILQAMLKRYTEQEEYSIAQQKRKERQQHEHSLSQKAPD 425          
BLAST of innexin-1 vs. Ensembl Cavefish
Match: panx2 (pannexin 2 [Source:NCBI gene;Acc:103040952])

HSP 1 Score: 50.0618 bits (118), Expect = 6.451e-6
Identity = 38/158 (24.05%), Postives = 67/158 (42.41%), Query Frame = 2
Query:  488 FDRCVYILTFTLLLVCSATVTIKSYVLEPMTCYAPSTISGSNVLPYINNYCW--IVGTIPKAVHEHNTDDEEYWKWLESRKINYYQWVPFVLGLQAALLYIPYVFWECLIYNRLGTNLQFLIDLARKASLDFGESRQRKISQMAGSIFILLTTRKKKS 955
            FDR V I T  + ++    V  +++  E + CY P   +    L Y   YCW  +   +P        + ++     E      ++++P+ L   A ++YIP + WE L   RL + L FL+           E R  KI +   S    ++ R+++ 
Sbjct:   51 FDRVVTIGTVIIPILLVTLVFTRNFAEESIYCYTPHNFTRDQAL-YARGYCWTELRDAVP------GVEPQQRPSLFE------HKFLPYALLAFAGIMYIPALGWEFLASTRLTSELNFLLQEIDNCYHRAAEGRAPKIEKQIQSKGPGISERERRE 195          
BLAST of innexin-1 vs. Ensembl Medaka
Match: panx2 (pannexin 2 [Source:NCBI gene;Acc:101160161])

HSP 1 Score: 52.7582 bits (125), Expect = 1.048e-6
Identity = 44/157 (28.03%), Postives = 66/157 (42.04%), Query Frame = 2
Query:  488 FDRCVYILTFTLLLVCSATVTIKSYVLEPMTCYAPSTISGSNVLPYINNYCW--IVGTIPKAVHEHNTDDEEYWKWLESRKINYYQWVPFVLGLQAALLYIPYVFWECLIYNRLGTNLQFLIDLARKASLDFGESRQRKISQMAGSIFILLTTRKKK 952
            FDR V I T  + ++    V  +++  E + CY P   +    L Y   YCW  +   IP  V  H       W  L   K     ++P+ L   A ++YIP + WE L   RL + L FL+           E R  KI +   S    +T R+++
Sbjct:   51 FDRVVTIGTVIIPILLVTLVFTRNFAEESIYCYTPHNFTRDQAL-YARGYCWTELRDAIP-GVEPH------LWPSLFEHK-----FLPYALLAFAGIMYIPALGWEFLASTRLTSELNFLLQEIDNCYHRAAEGRAPKIEKQIQSKGPGITERERR 194          
BLAST of innexin-1 vs. Ensembl Medaka
Match: panx3 (pannexin 3 [Source:NCBI gene;Acc:101163377])

HSP 1 Score: 51.6026 bits (122), Expect = 1.800e-6
Identity = 36/130 (27.69%), Postives = 64/130 (49.23%), Query Frame = 2
Query:  521 LLLVCSATVTIKSYVLEP-MTCYAPSTISGSNVLPYINNYCWIVGTIPKAVHEHNTDDEEYWKWLESRKINYYQWVPFVLGLQAALLYIPYVFWECLIYNRLGTNLQFLIDLARKASLDFGESRQRKISQ 907
            L+LVC A V  +   L P ++C+ PS  +      Y++ YCW       ++  H  D +  +   E + +  ++  P+ L   A L+Y+P + W  L+   LG++L F+ID      LD   +R  +++Q
Sbjct:   49 LMLVCMAFV--REISLGPQISCFTPSNFTAKQA-SYVDTYCW------DSLMHHEFDSDGNF---EEQSLWVHKMFPYSLMAMAILMYLPALIWRQLVMPTLGSDLLFIID-----ELDKSYNRSIRLAQ 161          
BLAST of innexin-1 vs. Planmine SMEST
Match: SMESG000043134.1 (SMESG000043134.1)

HSP 1 Score: 835.484 bits (2157), Expect = 0.000e+0
Identity = 403/412 (97.82%), Postives = 410/412 (99.51%), Query Frame = 2
Query:  416 MVFKEFLDYLNKFNFIHACGVYDIFDRCVYILTFTLLLVCSATVTIKSYVLEPMTCYAPSTISGSNVLPYINNYCWIVGTIPKAVHEHNTDDEEYWKWLESRKINYYQWVPFVLGLQAALLYIPYVFWECLIYNRLGTNLQFLIDLARKASLDFGESRQRKISQMAGSIFILLTTRKKKSEKAIGLLSKFPIYKMEIVFHYLLLKVISIVMICSQFVIMEKLLNMNGKHKLFGITVLQDLLNGRYWDVTNLFPRMAFCRVPFKMQNTNVVNITTQCSLSINLINEKIFIFLWWWFSLIASLQIISLFIWIARCLSSDRRVRFINHSAQISRSFPSHNEHLIKQFERNLISIDGIFLIHMTRINCGDLICNELIHKLYEIHATSLANRGDDLSDSISHSSVYKAKDIETTMFI 1651
            MVFKEFLDYLNKFNFIHACGVYDIFDRCVYILTFTLLLVCSATVTIKSYVL+PMTCYAPSTISGSNVL YINNYCWIVGTIPKAVHEHN+DDEEYWKWLESRKINYYQWVPFVLGLQAALLYIPYVFWECLIYNRLGTNLQFLIDLARKASLDFGESRQRKISQMAGSIFILLTTRKKKSEKAIGLLSKFPIYKMEIVFHYLLLKVIS+VMICSQFVIMEKLLNMNGKHKLFGITVLQDLLNGRYWDVTNLFPRMAFCRVPFKMQNTNVVNITTQCSLSINLINEKIFIFLWWWFSLIASLQIISLFIW+ARCLSSDRRVRFINHSAQISRSFP H+EHLIKQF+RNLISIDGIFLIH+TRINCGDLICNELIHKLYEIHATSLANRGDDLSDSISHSSVYKAKDIETTMFI
Sbjct:    1 MVFKEFLDYLNKFNFIHACGVYDIFDRCVYILTFTLLLVCSATVTIKSYVLKPMTCYAPSTISGSNVLQYINNYCWIVGTIPKAVHEHNSDDEEYWKWLESRKINYYQWVPFVLGLQAALLYIPYVFWECLIYNRLGTNLQFLIDLARKASLDFGESRQRKISQMAGSIFILLTTRKKKSEKAIGLLSKFPIYKMEIVFHYLLLKVISVVMICSQFVIMEKLLNMNGKHKLFGITVLQDLLNGRYWDVTNLFPRMAFCRVPFKMQNTNVVNITTQCSLSINLINEKIFIFLWWWFSLIASLQIISLFIWVARCLSSDRRVRFINHSAQISRSFPPHSEHLIKQFDRNLISIDGIFLIHVTRINCGDLICNELIHKLYEIHATSLANRGDDLSDSISHSSVYKAKDIETTMFI 412          
BLAST of innexin-1 vs. Planmine SMEST
Match: SMESG000065083.1 (SMESG000065083.1)

HSP 1 Score: 256.144 bits (653), Expect = 1.826e-78
Identity = 149/420 (35.48%), Postives = 232/420 (55.24%), Query Frame = 2
Query:  416 MVFKEFLDYLNKFNFIHACGVYDIFDRCVYILTFTLLLVCSATVTIKSYVLEPMTCYAPSTISGSNVLPYINNYCWIVGTIPKAVHEHNTDDEEYWKWLESRKINYYQWVPFVLGLQAALLYIPYVFWECLIYNRLGTNLQFLIDLARKASLDFGESRQRKISQMAGSIFILLTTR-----------KKKSEKAIGLLSKFPIYKMEIVFHYLLLKVISIVMICSQFVIMEKLLNMNGKHKL-FGITVLQDLLNGRYWDVTNLFPRMAFCRVPFKMQNTNVVN-ITTQCSLSINLINEKIFIFLWWWFSLIASLQIISLFIWIARCLSSDRRVRFINHSAQISRSFPSHNE--HLIKQFERNLISIDGIFLIHMTRINCGDLICNELIHKLYEIHATSLANR-----GDDLSDSISHSSV 1615
            MV  EFLDYL+K       G+ D+ DR  +  +  +L+VC   VT+K YV +P++CY P+ I GSN+L Y+ N CW+ GTI  +        +E WK LE  K+ YYQWVPF+LGLQ  + Y+P + W+ + YNR GT++Q L+  A +A     E+R + +S ++ ++  LL              ++K   ++G L         +V  YLLLK+  +     Q +IM+K L  +  + L FGI V  ++ +G  W  T +FPR+++C V  K+ +  V+N +  QC L +N++NE+I+ FLW W  ++ SL I+S+ IWI R L    R  FI     IS       +  +L+ +FE   +  DGIFL+ M  +N GD+I +E++ +L+ I+ T+  NR     G D  D  S + +
Sbjct:    1 MVASEFLDYLSKLQVSTNVGLEDLPDRLNFTFSVIVLMVCILIVTVKQYVFKPISCYLPNNIGGSNLLSYVENLCWVQGTIALSNQAKFPSTDEEWKNLEKHKMLYYQWVPFMLGLQCIMFYVPKLVWQIICYNRTGTDIQHLVVSANQAVHSSDEARSKMVSYLSKTLEQLLYQHRDHRSGKLAKFRRKIHNSVGFLMCSKRIGTWLVSSYLLLKLSYVANGFIQLIIMQKFLGFSDFNLLTFGIEVGNNIWSGTDWKTTLIFPRVSYCFV--KVTHLGVINSMVAQCVLPVNMLNERIYFFLWCWILIVLSLTILSIPIWILRILCIKYRRHFIRQFLIISEEITKDQKENYLLAKFESQFLRHDGIFLLKMISLNAGDIITSEIVCQLWNIYKTNYVNRNFLNDGSDEDDDKSRTMI 418          
BLAST of innexin-1 vs. Planmine SMEST
Match: SMESG000081749.1 (SMESG000081749.1)

HSP 1 Score: 242.662 bits (618), Expect = 1.173e-73
Identity = 137/394 (34.77%), Postives = 221/394 (56.09%), Query Frame = 2
Query:  425 KEFLDYLNKFNFIHACGVYDIFDRCVYILTFTLLLVCSATVTIKSYVLEPMTCYAPSTISGSNVLPYINNYCWIVGTIPKAVHEHNTDDEEYWKWLE-SRKINYYQWVPFVLGLQAALLYIPYVFWECLIYNRLGTNLQFLIDLARKASLDFGESRQRKISQMAGSIFILLTTRKKKSEKAIGLLSKFPIYKMEI----------VFH---YLLLKVISIVMICSQFVIMEKLLNMNGKHKL---FGITVLQDLLNGRYWDVTNLFPRMAFCRVPFKMQNTNVVNITTQCSLSINLINEKIFIFLWWWFSLIASLQIISLFIWIARCLSSDRRVRFINHSAQISRSFPSHNEHLIKQFERNLISIDGIFLIHMTRINCGDLICNELIHKLYEIH 1555
            + FL     F      G+ D  D+  ++ +  +L+VCS  V+ K Y+   ++CY P  +SG ++  Y+ NYCW+ GTIP   +E     ++ W   + SRKINYYQWVPFVLGLQ  L Y+P + W+ +IYN  G +L+ L+  A+KAS   GE R+  I Q+A  +  L   R+          +KFP+ + ++          VF    Y+++K++ +     Q ++M+  L   G  KL   FG T+L+D+L+G+ W+   LFPR++FC +      T+  +   QC+L IN++NEKI+IFLW+W   +  L IIS+ +W+ R     +R  FI    +I  ++    ++LI QF    +  DGIF++H+  +N GDLI  +++ +L+EI+
Sbjct:    2 ETFLSQFTAFQAGKYVGIEDAADKASFLFSVIILVVCSVIVSTKQYITADISCYIPVVLSGVDLDKYVKNYCWVHGTIPFYANETLPQTKDEWIIADASRKINYYQWVPFVLGLQGVLFYLPRLIWKTIIYNLSGNDLEGLVVSAKKASNQVGEIRKETILQVAKCLEDLFLQRRVLGH------TKFPVLRQKMSLICCGRRTGVFFISLYIVIKLLYLTNAICQIILMQNFLKY-GVSKLNAAFGWTILKDILSGKQWNDNLLFPRVSFCFISDISTVTHKNHHIAQCALPINMLNEKIYIFLWFWTVGVLFLTIISIPLWLYRMTFFRKRKDFIKRFLKIKSAYTKDKKNLISQFVEQFLRHDGIFILHIISLNAGDLIATDIVSELWEIY 388          
BLAST of innexin-1 vs. Planmine SMEST
Match: SMESG000080788.1 (SMESG000080788.1)

HSP 1 Score: 242.662 bits (618), Expect = 2.160e-73
Identity = 128/393 (32.57%), Postives = 221/393 (56.23%), Query Frame = 2
Query:  416 MVFKEFLDYLNKFNFIHACGVYDIFDRCVYILTFTLLLVCSATVTIKSYVLEPMTCYAPSTISGSNVLPYINNYCWIVGTIPKAVHEH-NTDDEEYWKWLESRKINYYQWVPFVLGLQAALLYIPYVFWECLIYNRLGTNLQFLIDLARKASLDFGESRQRKISQMAGSIFILLTTRKKKSEKAIGLLSK-------FPIYKME----IVFHYLLLKVISIVMICSQFVIMEKLLNMNGKHKLFGITVLQDLLNGRYWDVTNLFPRMAFCRVPFKMQNTNVVN-ITTQCSLSINLINEKIFIFLWWWFSLIASLQIISLFIWIARCLSSDRRVRFINHSAQISRSFPSHNEHLIKQFERNLISIDGIFLIHMTRINCGDLICNELIHKLYEIH 1555
            MV +EFL+ + +F      G+ D  D+  ++ + TLL++    VTIKSY+ +P+ CY  +   GSN   Y+ NYCW+ GTI     E    +D ++ +  ++R+INYYQWVPF+LGLQ  + YIP + W+ + YN+ GTNL+ +++ A  A+      R+ KI ++A +I  +L   +   +     L +       F ++       ++  Y+L+K +  + +  Q  IM+K L  N     FG TVL ++++G+ W  T +FPR+ +C V   +++  V N    QC+L +N++NEKI++FLW+W  L+  +  IS+ +W  R     RR +FI     + +++   ++ +I  F    +  DG+FL+ M  IN GD+I  +++++L EI+
Sbjct:    1 MVAEEFLNLIGQFKISTYVGIEDFADKLSFLFSVTLLILSMMVVTIKSYLFKPLACYTATAPGGSNFENYLENYCWVHGTITFLPGEDIPQNDVDWARADDTRRINYYQWVPFILGLQCFMFYIPKIIWQIICYNKSGTNLESIVNDANAANNTPPVERKDKIERIARTIEDMLFQHRDYRQGNFAKLRRKIYNTCNFCVFSKHMGTWLILSYILIKFLYGLNVIGQLFIMKKFLGFNNSTSSFGYTVLSNMISGKEWHQTGIFPRVTYCYVR-NIKHVGVANKYVAQCALPVNMLNEKIYVFLWFWMVLVGIVTAISIPLWFYRMAFLSRRSKFIKRFLMMHQNYERSDKPMINNFIEEFLRHDGVFLVRMLFINAGDIITADIVNRLLEIY 392          
BLAST of innexin-1 vs. Planmine SMEST
Match: SMESG000081749.1 (SMESG000081749.1)

HSP 1 Score: 234.187 bits (596), Expect = 2.098e-70
Identity = 134/390 (34.36%), Postives = 217/390 (55.64%), Query Frame = 2
Query:  443 LNKFNFIHACGVYDIFDRCVYILTFTLLLVCSATVTIKSYVLEPMTCYAPSTISGSNVLPYINNYCWIVGTIPKAVHEHNTDDEEYWKWLES---RKINYYQWVPFVLGLQAALLYIPYVFWECLIYNRLGTNLQFLIDLARKASLDFGESRQRKISQMAGSIFILLTTRKKKSEKAIGLLSKFPIYKMEI----------VFH---YLLLKVISIVMICSQFVIMEKLLNMNGKHKL---FGITVLQDLLNGRYWDVTNLFPRMAFCRVPFKMQNTNVVNITTQCSLSINLINEKIFIFLWWWFSLIASLQIISLFIWIARCLSSDRRVRFINHSAQISRSFPSHNEHLIKQFERNLISIDGIFLIHMTRINCGDLICNELIHKLYEIH 1555
             + FN     GV D  D+  ++ +  +L+VC+  V+ K Y+   + CY P   +G  +  YI NYCW  GTIP    E+ T  +    W+++   R++NYYQWVPFVLGLQ  L Y+P + W+ +IYN  G +L+ L+  A+KAS   GE R+  I Q+A  +  L   R+          +KFP+ + ++          VF    Y+++K++ +     Q ++M+  L   G  KL   FG T+L+D+L+G+ W+   LFPR++FC +      T+  +   QC+L IN++NEKI+IFLW+W   +  L IIS+ +W+ R     +R  FI    +I  ++    ++LI QF    +  DGIF++H+  +N GDLI  +++ +L+EI+
Sbjct:    8 FSNFNVEKYVGVEDGADKASFLFSVVILVVCTVIVSTKQYIFGEIACYIPILNTGEKLEDYIQNYCWAHGTIP--FRENETLPQNRKDWMQADFDRRLNYYQWVPFVLGLQGVLFYLPRLIWKTIIYNLSGNDLEGLVVSAKKASNQVGEIRKETILQVAKCLEDLFLQRRVLGH------TKFPVLRQKMSLICCGRRTGVFFISLYIVIKLLYLTNAICQIILMQNFLKY-GVSKLNAAFGWTILKDILSGKQWNDNLLFPRVSFCFISDISTVTHKNHHIAQCALPINMLNEKIYIFLWFWTVGVLFLTIISIPLWLYRMTFFRKRKDFIKRFLKIKSAYTKDKKNLISQFVEQFLRHDGIFILHIISLNAGDLIATDIVSELWEIY 388          
The following BLAST results are available for this feature:
BLAST of innexin-1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 2
Match NameE-valueIdentityDescription
PANX22.489e-828.48pannexin 2 [Source:HGNC Symbol;Acc:HGNC:8600][more]
PANX22.535e-828.48pannexin 2 [Source:HGNC Symbol;Acc:HGNC:8600][more]
back to top
BLAST of innexin-1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
unc-91.042e-5230.85Innexin unc-9 [Source:UniProtKB/Swiss-Prot;Acc:O0... [more]
inx-131.874e-4828.80Innexin [Source:UniProtKB/TrEMBL;Acc:O44887][more]
inx-14.080e-4629.09Innexin [Source:UniProtKB/TrEMBL;Acc:Q17394][more]
inx-14.080e-4629.09Innexin [Source:UniProtKB/TrEMBL;Acc:Q17394][more]
unc-99.685e-4631.00Innexin unc-9 [Source:UniProtKB/Swiss-Prot;Acc:O0... [more]
back to top
BLAST of innexin-1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Inx34.050e-1822.76gene:FBgn0265274 transcript:FBtr0085350[more]
Inx34.050e-1822.76gene:FBgn0265274 transcript:FBtr0330306[more]
Inx34.050e-1822.76gene:FBgn0265274 transcript:FBtr0345207[more]
Inx25.012e-1624.86gene:FBgn0027108 transcript:FBtr0301860[more]
Inx25.012e-1624.86gene:FBgn0027108 transcript:FBtr0071005[more]
back to top
BLAST of innexin-1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
panx21.763e-625.32pannexin 2 [Source:ZFIN;Acc:ZDB-GENE-050419-55][more]
panx22.158e-625.32pannexin 2 [Source:ZFIN;Acc:ZDB-GENE-050419-55][more]
panx24.342e-625.48pannexin 2 [Source:ZFIN;Acc:ZDB-GENE-050419-55][more]
back to top
BLAST of innexin-1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
alkbh12.375e-828.66alkB homolog 1, histone H2A dioxygenase [Source:Xe... [more]
back to top
BLAST of innexin-1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Panx22.215e-828.48pannexin 2 [Source:MGI Symbol;Acc:MGI:1890615][more]
Panx22.566e-627.27pannexin 2 [Source:MGI Symbol;Acc:MGI:1890615][more]
back to top
BLAST of innexin-1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O01393|UNC9_CAEEL1.326e-5130.85Innexin unc-9 OS=Caenorhabditis elegans OX=6239 GN... [more]
sp|Q03412|UNC7_CAEEL1.063e-4128.88Innexin unc-7 OS=Caenorhabditis elegans OX=6239 GN... [more]
sp|O61787|INX16_CAEEL1.959e-4029.20Innexin-16 OS=Caenorhabditis elegans OX=6239 GN=in... [more]
sp|A8WVX4|INX19_CAEBR5.051e-3928.50Innexin-19 OS=Caenorhabditis briggsae OX=6238 GN=i... [more]
sp|O01634|INX12_CAEEL1.141e-3828.12Innexin-12 OS=Caenorhabditis elegans OX=6239 GN=in... [more]
back to top
BLAST of innexin-1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
I1ZIL20.000e+098.79Innexin OS=Schmidtea mediterranea OX=79327 GN=inx ... [more]
A0A068W6W18.207e-11041.48Innexin OS=Echinococcus granulosus OX=6210 GN=inx ... [more]
W6UDL62.059e-10942.42Innexin OS=Echinococcus granulosus OX=6210 GN=inx ... [more]
A0A068Y5E62.593e-10940.09Innexin OS=Echinococcus multilocularis OX=6211 GN=... [more]
A0A4E0QYX23.196e-10838.35Innexin OS=Fasciola hepatica OX=6192 GN=inx PE=3 S... [more]
back to top
BLAST of innexin-1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
panx26.451e-624.05pannexin 2 [Source:NCBI gene;Acc:103040952][more]
back to top
BLAST of innexin-1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of innexin-1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of innexin-1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of innexin-1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
panx21.048e-628.03pannexin 2 [Source:NCBI gene;Acc:101160161][more]
panx31.800e-627.69pannexin 3 [Source:NCBI gene;Acc:101163377][more]
back to top
BLAST of innexin-1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000043134.10.000e+097.82SMESG000043134.1[more]
SMESG000065083.11.826e-7835.48SMESG000065083.1[more]
SMESG000081749.11.173e-7334.77SMESG000081749.1[more]
SMESG000080788.12.160e-7332.57SMESG000080788.1[more]
SMESG000081749.12.098e-7034.36SMESG000081749.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30008787
GenBankAFJ24866.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30008787 ID=SMED30008787|Name=innexin-1|organism=Schmidtea mediterranea sexual|type=transcript|length=1879bp
TCTATTACCTTTAGTAGGTTTTCTGTTACCTGCAACATTGTTACACTTTT
GGCAAAGTAAGAATAAGTTAATTATAAACATAAATAGTCAAATCAAAACA
TTACTATCACTATCCAGAATTTATATGACAAATCAAATGACTCATTACTG
CAATATTGCGAAAGCAAGAGAATTCTGCTTAAATAAGCCAAATGAAATGA
TTCAAATGATTCATACGAGTGCGACATTGATTCATATTCTAAAATATGTT
ACGTAACTGTCATTGTGATTGTGGCGTCTGCATGCTGCCCTCATTTGCTT
CCACTAATCACGTAATGACTAACGCTAAATTCTGATTGGTTGATTTTCCC
ACAATTGATTTTCATTAATTTTCATCGATTTAATTGAGTTTTGTTTTTTC
TGTTTATACATTTTCATGGTTTTCAAAGAGTTTCTCGATTATTTGAATAA
ATTCAATTTCATTCACGCATGTGGAGTTTATGACATTTTCGATCGTTGCG
TCTACATACTGACATTCACTTTGCTTCTTGTTTGTTCGGCAACAGTAACT
ATCAAATCGTATGTGTTGGAACCGATGACTTGTTATGCTCCCTCGACAAT
TAGTGGATCAAATGTCTTGCCGTATATCAACAATTACTGCTGGATTGTTG
GAACCATTCCGAAAGCTGTCCATGAACATAATACCGACGATGAAGAGTAT
TGGAAGTGGCTGGAGTCCAGGAAAATAAATTATTATCAATGGGTTCCATT
TGTGTTGGGATTACAAGCGGCTCTCCTATACATTCCTTATGTGTTCTGGG
AGTGCCTCATATACAATCGACTTGGTACGAATTTACAATTTTTAATTGAC
CTCGCTCGAAAAGCATCTTTGGATTTCGGAGAAAGTCGCCAGCGGAAAAT
CTCCCAAATGGCCGGAAGTATATTTATTCTATTGACAACGCGCAAAAAAA
AGTCTGAAAAAGCAATCGGACTTCTGTCTAAGTTTCCAATTTATAAAATG
GAAATTGTTTTCCATTATTTATTGTTGAAAGTGATCAGCATTGTCATGAT
TTGTTCACAGTTTGTCATCATGGAGAAACTGCTTAACATGAATGGAAAGC
ACAAATTGTTTGGGATAACTGTATTGCAGGATCTGCTCAACGGTCGTTAT
TGGGATGTTACGAATTTGTTTCCCAGAATGGCATTTTGTAGGGTTCCTTT
CAAAATGCAGAATACAAATGTTGTTAACATCACGACTCAATGCTCTTTGT
CAATTAATCTCATTAATGAGAAAATTTTCATTTTTCTTTGGTGGTGGTTT
AGTTTGATTGCAAGTTTACAAATAATCTCTTTATTTATCTGGATAGCTCG
ATGTTTATCGTCAGATCGGAGAGTTCGGTTCATTAACCACAGTGCACAAA
TAAGTAGATCTTTTCCTTCACACAACGAACACCTCATCAAGCAATTTGAA
AGGAATCTCATCTCAATCGATGGGATATTTCTCATTCACATGACCAGAAT
TAACTGTGGTGATCTTATCTGTAACGAGCTCATTCACAAGCTTTATGAAA
TCCACGCAACAAGCCTGGCAAACCGAGGAGATGATCTCAGTGACTCGATT
TCTCACAGTTCAGTGTACAAAGCCAAGGATATTGAAACAACTATGTTTAT
CTAAAGACGGAATCAAATTTTTTAAACTTGTTTATTTTATACTCCATATC
TTTACACTATTCCTTCATTCTGACAGGAAATAAAAATTAAAGTTTTTGTT
AAGGAATATTTTGATAAAATTTTTTGGCTTTTAACATCTTGTCATCTATT
TCTGTCCTCAATATAGAGGGCATAGTTGCATTTCGAAACTATAAAAAATT
ATTATACTGTTTTAGCATGTGAATATATG
back to top

protein sequence of SMED30008787-orf-1

>SMED30008787-orf-1 ID=SMED30008787-orf-1|Name=SMED30008787-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=413bp
MVFKEFLDYLNKFNFIHACGVYDIFDRCVYILTFTLLLVCSATVTIKSYV
LEPMTCYAPSTISGSNVLPYINNYCWIVGTIPKAVHEHNTDDEEYWKWLE
SRKINYYQWVPFVLGLQAALLYIPYVFWECLIYNRLGTNLQFLIDLARKA
SLDFGESRQRKISQMAGSIFILLTTRKKKSEKAIGLLSKFPIYKMEIVFH
YLLLKVISIVMICSQFVIMEKLLNMNGKHKLFGITVLQDLLNGRYWDVTN
LFPRMAFCRVPFKMQNTNVVNITTQCSLSINLINEKIFIFLWWWFSLIAS
LQIISLFIWIARCLSSDRRVRFINHSAQISRSFPSHNEHLIKQFERNLIS
IDGIFLIHMTRINCGDLICNELIHKLYEIHATSLANRGDDLSDSISHSSV
YKAKDIETTMFI*
back to top
Aliases
The feature 'innexin-1' has the following synonyms
Synonym
inx1
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000036eye
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR000990Innexin
Vocabulary: cellular component
TermDefinition
GO:0005921gap junction
GO:0005886plasma membrane
GO:0016020membrane
GO:0016021integral component of membrane
GO:0030054cell junction
Vocabulary: biological process
TermDefinition
GO:0006810transport
GO:0006811ion transport
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000990InnexinPRINTSPR01262INNEXINcoord: 201..215
score: 27.47
coord: 251..260
score: 42.4
coord: 106..128
score: 56.7
coord: 74..83
score: 38.4
coord: 276..292
score: 63.06
coord: 45..56
score: 35.67
IPR000990InnexinPFAMPF00876Innexincoord: 23..378
e-value: 4.1E-82
score: 276.3
IPR000990InnexinPANTHERPTHR11893INNEXINcoord: 10..384
IPR000990InnexinPROSITEPS51013PANNEXINcoord: 17..386
score: 28.042
NoneNo IPR availableTMHMMTMhelixcoord: 29..51
NoneNo IPR availableTMHMMTMhelixcoord: 106..128
NoneNo IPR availableTMHMMTMhelixcoord: 289..311
NoneNo IPR availableTMHMMTMhelixcoord: 197..219